1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@article{veldhuizen1984d, 20 title = {{D}-stability and {K}aps-{R}entrop-methods}, 21 author = {Veldhuizen, M van}, 22 journal = {Computing}, 23 volume = {32}, 24 number = {3}, 25 pages = {229--237}, 26 year = {1984}, 27 publisher = {Springer} 28} 29 30@article{shampine1982implementation, 31 title = {Implementation of {R}osenbrock methods}, 32 author = {Shampine, Lawrence F}, 33 journal = {ACM Transactions on Mathematical Software (TOMS)}, 34 volume = {8}, 35 number = {2}, 36 pages = {93--113}, 37 year = {1982}, 38 publisher = {ACM New York, NY, USA} 39} 40 41@book{wanner1996solving, 42 title = {Solving ordinary differential equations {II}}, 43 author = {Wanner, Gerhard and Hairer, Ernst}, 44 volume = {375}, 45 year = {1996}, 46 publisher = {Springer Berlin Heidelberg New York} 47} 48 49@article{kaps1979generalized, 50 title = {Generalized {R}unge--{K}utta methods of order four with stepsize control for stiff ordinary differential equations}, 51 author = {Kaps, Peter and Rentrop, Peter}, 52 journal = {Numerische Mathematik}, 53 volume = {33}, 54 pages = {55--68}, 55 year = {1979}, 56 publisher = {Springer} 57} 58 59@book{butcher2016numerical, 60 title = {Numerical methods for ordinary differential equations}, 61 author = {Butcher, John Charles}, 62 year = {2016}, 63 publisher = {John Wiley \& Sons} 64} 65 66@article{chung1993, 67 author = {Chung, J. and Hulbert, G. M.}, 68 title = {A Time Integration Algorithm for Structural Dynamics With Improved Numerical Dissipation: The Generalized-alpha Method}, 69 journal = {Journal of Applied Mechanics}, 70 volume = {60}, 71 number = {2}, 72 pages = {371-375}, 73 year = {1993}, 74 month = {06}, 75 issn = {0021-8936}, 76 doi = {10.1115/1.2900803}, 77 url = {https://doi.org/10.1115/1.2900803}, 78 eprint = {https://asmedigitalcollection.asme.org/appliedmechanics/article-pdf/60/2/371/5463014/371\_1.pdf}, 79} 80 81@article{hosea1996analysis, 82 title = {Analysis and implementation of {TR-BDF2}}, 83 author = {Hosea, ME and Shampine, LF}, 84 journal = {Applied Numerical Mathematics}, 85 volume = {20}, 86 number = {1-2}, 87 pages = {21--37}, 88 year = {1996}, 89 publisher = {Elsevier} 90} 91 92@article{kennedy2019diagonally, 93 title = {Diagonally implicit {R}unge--{K}utta methods for stiff {ODE}s}, 94 author = {Kennedy, Christopher A and Carpenter, Mark H}, 95 journal = {Applied Numerical Mathematics}, 96 volume = {146}, 97 pages = {221--244}, 98 year = {2019}, 99 publisher = {Elsevier} 100} 101 102@inproceedings{xu2017adaptive, 103 title = {Adaptive relaxed {ADMM}: Convergence theory and practical implementation}, 104 author = {Xu, Zheng and Figueiredo, Mario AT and Yuan, Xiaoming and Studer, Christoph and Goldstein, Tom}, 105 booktitle = {Proceedings of the IEEE conference on computer vision and pattern recognition}, 106 pages = {7389--7398}, 107 year = {2017} 108} 109 110@article{hindmarsh1996time, 111 title = {Time-step limits for stable solutions of the ice-sheet equation}, 112 author = {Hindmarsh, Richard CA and Payne, Antony J}, 113 journal = {Annals of Glaciology}, 114 volume = {23}, 115 pages = {74--85}, 116 year = {1996}, 117 publisher = {Cambridge University Press} 118} 119 120@article{benson2006flexible, 121 title = {Flexible complementarity solvers for large-scale applications}, 122 author = {Benson, Steven J and Munson, Todd S}, 123 journal = {Optimization Methods and Software}, 124 volume = {21}, 125 number = {1}, 126 pages = {155--168}, 127 year = {2006}, 128 publisher ={Taylor \& Francis} 129} 130 131@article{byrd1994representations, 132 title = {Representations of quasi-{N}ewton matrices and their use in limited memory methods}, 133 author = {Byrd, Richard H and Nocedal, Jorge and Schnabel, Robert B}, 134 journal = {Mathematical Programming}, 135 volume = {63}, 136 number = {1-3}, 137 pages = {129--156}, 138 year = {1994}, 139 publisher = {Springer} 140} 141 142@article{gilbert1989some, 143 title = {Some numerical experiments with variable-storage quasi-{N}ewton algorithms}, 144 author = {Gilbert, Jean Charles and Lemar{\'e}chal, Claude}, 145 journal = {Mathematical programming}, 146 volume = {45}, 147 number = {1-3}, 148 pages = {407--435}, 149 year = {1989}, 150 publisher = {Springer} 151} 152 153@inproceedings{dener2019accelerating, 154 title = {Accelerating limited-memory quasi-{N}ewton convergence for large-scale optimization}, 155 author = {Dener, Alp and Munson, Todd}, 156 booktitle = {Computational Science--ICCS 2019: 19th International Conference, Faro, Portugal, June 12--14, 2019, Proceedings, Part III 19}, 157 pages = {495--507}, 158 year = {2019}, 159 organization = {Springer} 160} 161 162@article{park2021linear, 163 title = {Linear and nonlinear solvers for simulating multiphase flow within large-scale engineered subsurface systems}, 164 author = {Park, Heeho D and Hammond, Glenn E and Valocchi, Albert J and LaForce, Tara}, 165 journal = {Advances in Water Resources}, 166 volume = {156}, 167 pages = {104029}, 168 year = {2021}, 169 publisher = {Elsevier} 170} 171 172@inproceedings{va1981design, 173 title = {Design of optimally smoothing multi-stage schemes for the {E}uler equations}, 174 author = {Van Leer, Bram and Tai, Chang-Hsien and Powell, Kenneth}, 175 booktitle = {9th Computational Fluid Dynamics Conference}, 176 pages = {1933}, 177 year = {1981} 178} 179 180@article{pierce1997preconditioned, 181 title = {Preconditioned multigrid methods for compressible flow calculations on stretched meshes}, 182 author = {Pierce, Niles A and Giles, Michael B}, 183 journal = {Journal of Computational Physics}, 184 volume = {136}, 185 number = {2}, 186 pages = {425--445}, 187 year = {1997}, 188 publisher = {Elsevier} 189} 190 191@article{kong2016highly, 192 title = {A highly scalable multilevel {S}chwarz method with boundary geometry preserving coarse spaces for {3D} elasticity problems on domains with complex geometry}, 193 author = {Kong, Fande and Cai, Xiao-Chuan}, 194 journal = {SIAM Journal on Scientific Computing}, 195 volume = {38}, 196 number = {2}, 197 pages = {C73--C95}, 198 year = {2016}, 199 publisher = {SIAM} 200} 201 202@inproceedings{gutierrez2017accommodating, 203 title = {Accommodating thread-level heterogeneity in coupled parallel applications}, 204 author = {Guti{\'e}rrez, Samuel K and Davis, Kei and Arnold, Dorian C and Baker, Randal S and Robey, Robert W and McCormick, Patrick and 205 Holladay, Daniel and Dahl, Jon A and Zerr, R Joe and Weik, Florian and others}, 206 booktitle = {2017 {IEEE} International Parallel and Distributed Processing Symposium ({IPDPS})}, 207 pages = {469--478}, 208 year = {2017}, 209 organization = {IEEE} 210} 211 212@article{heroux2011bi, 213 title = {Bi-modal MPI and MPI+ threads computing on scalable multicore systems}, 214 author = {Heroux, Michael A and Brightwell, R and Wolf, Michael M}, 215 journal = {IJHPCA (Submitted)}, 216 year = {2011} 217} 218 219@inproceedings{bozdaug2005parallel, 220 title = {A parallel distance-2 graph coloring algorithm for distributed memory computers}, 221 author = {Bozda{\u{g}}, Doruk and Catalyurek, Umit and Gebremedhin, Assefaw H and Manne, Fredrik and Boman, Erik G and {\"O}zg{\"u}ner, F{\"u}sun}, 222 booktitle = {International conference on high performance computing and communications}, 223 pages = {796--806}, 224 year = {2005}, 225 organization = {Springer} 226} 227 228@article{dohrmann2009overlapping, 229 title = {An overlapping {S}chwarz algorithm for almost incompressible elasticity}, 230 author = {Dohrmann, Clark R and Widlund, Olof B}, 231 journal = {SIAM journal on numerical analysis}, 232 volume = {47}, 233 number = {4}, 234 pages = {2897--2923}, 235 year = {2009}, 236 publisher = {SIAM} 237} 238 239@article{dohrmann2008domain, 240 title = {Domain decomposition for less regular subdomains: Overlapping {S}chwarz in two dimensions}, 241 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 242 journal = {SIAM journal on numerical analysis}, 243 volume = {46}, 244 number = {4}, 245 pages = {2153--2168}, 246 year = {2008}, 247 publisher = {SIAM} 248} 249 250@incollection{dohrmann2008family, 251 title = {A family of energy minimizing coarse spaces for overlapping {S}chwarz preconditioners}, 252 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 253 booktitle = {Domain decomposition methods in science and engineering XVII}, 254 pages = {247--254}, 255 year = {2008}, 256 publisher = {Springer} 257} 258 259@book{dohrmann2008extending, 260 title = {Extending theory for domain decomposition algorithms to irregular subdomains}, 261 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 262 year = {2008}, 263 publisher = {Springer} 264} 265 266@article{dryja1994schwarz, 267 title = {{S}chwarz analysis of iterative substructuring algorithms for elliptic problems in three dimensions}, 268 author = {Dryja, Maksymilian and Smith, Barry F and Widlund, Olof B}, 269 journal = {SIAM journal on numerical analysis}, 270 volume = {31}, 271 number = {6}, 272 pages = {1662--1694}, 273 year = {1994}, 274 publisher = {SIAM} 275} 276 277@book{smith1990domain, 278 title = {Domain decomposition algorithms for the partial differential equations of linear elasticity}, 279 author = {Smith, Barry F}, 280 year = {1990}, 281 publisher = {New York University} 282} 283 284@article{bramble1989construction, 285 title = {The construction of preconditioners for elliptic problems by substructuring. {IV}}, 286 author = {Bramble, James H and Pasciak, Joseph E and Schatz, Alfred H}, 287 journal = {Mathematics of Computation}, 288 volume = {53}, 289 number = {187}, 290 pages = {1--24}, 291 year = {1989} 292} 293 294@article{kaczmarz1937angenaherte, 295 title = {Angenaherte auflosung von systemen linearer gleichungen}, 296 author = {Kaczmarz, Stefan}, 297 journal = {Bull. Int. Acad. Pol. Sic. Let., Cl. Sci. Math. Nat.}, 298 pages = {355--357}, 299 year = {1937} 300} 301 302@article{nataf2022recent, 303 title = {Recent advances in domain decomposition methods for large-scale saddle point problems}, 304 author = {Nataf, Fr{\'e}d{\'e}ric and Tournier, Pierre-Henri}, 305 journal = {Comptes Rendus. M{\'e}canique}, 306 volume = {350}, 307 number = {S1}, 308 pages = {1--15}, 309 year = {2022} 310} 311 312@article{al2022robustpd, 313 title = {A robust algebraic multilevel domain decomposition preconditioner for sparse symmetric positive definite matrices}, 314 author = {Al Daas, Hussam and Jolivet, Pierre}, 315 journal = {SIAM Journal on Scientific Computing}, 316 volume = {44}, 317 number = {4}, 318 pages = {A2582--A2598}, 319 year = {2022}, 320 publisher = {SIAM} 321} 322 323@article{al2022robust, 324 title = {A robust algebraic domain decomposition preconditioner for sparse normal equations}, 325 author = {Al Daas, Hussam and Jolivet, Pierre and Scott, Jennifer A}, 326 journal = {SIAM Journal on Scientific Computing}, 327 volume = {44}, 328 number = {3}, 329 pages = {A1047--A1068}, 330 year = {2022}, 331 publisher = {SIAM} 332} 333 334@article{al2021multilevel, 335 title = {A multilevel {S}chwarz preconditioner based on a hierarchy of robust coarse spaces}, 336 author = {Al Daas, Hussam and Grigori, Laura and Jolivet, Pierre and Tournier, Pierre-Henri}, 337 journal = {SIAM Journal on Scientific Computing}, 338 volume = {43}, 339 number = {3}, 340 pages = {A1907--A1928}, 341 year = {2021}, 342 publisher = {SIAM} 343} 344 345@book{dolean2015introduction, 346 title = {An introduction to domain decomposition methods: algorithms, theory, and parallel implementation}, 347 author = {Dolean, Victorita and Jolivet, Pierre and Nataf, Fr{\'e}d{\'e}ric}, 348 year = {2015}, 349 publisher = {SIAM} 350} 351 352@article{spillane2011robust, 353 title = {A robust two-level domain decomposition preconditioner for systems of {PDE}s}, 354 author = {Spillane, Nicole and Dolean, Victorita and Hauret, Patrice and Nataf, Fr{\'e}d{\'e}ric and Pechstein, Clemens and Scheichl, Robert}, 355 journal = {Comptes Rendus Mathematique}, 356 volume = {349}, 357 number = {23-24}, 358 pages = {1255--1259}, 359 year = {2011}, 360 publisher = {Elsevier} 361} 362 363@article{kong2020highly, 364 title = {A Highly Parallel Multilevel {N}ewton--{K}rylov--{S}chwarz Method with Subspace-Based Coarsening and 365 Partition-Based Balancing for the Multigroup Neutron Transport Equation on Three-Dimensional Unstructured Meshes}, 366 author = {Kong, Fande and Wang, Yaqi and Gaston, Derek R and Permann, Cody J and Slaughter, Andrew E and Lindsay, 367 Alexander D and DeHart, Mark D and Martineau, Richard C}, 368 journal = {SIAM Journal on Scientific Computing}, 369 volume = {42}, 370 number = {5}, 371 pages = {C193--C220}, 372 year = {2020}, 373 publisher = {SIAM} 374} 375 376@article{ipsen2001note, 377 title = {A note on preconditioning nonsymmetric matrices}, 378 author = {Ipsen, Ilse CF}, 379 journal = {SIAM Journal on Scientific Computing}, 380 volume = {23}, 381 number = {3}, 382 pages = {1050--1051}, 383 year = {2001}, 384 publisher = {SIAM} 385} 386 387@article{murphy2000note, 388 title = {A note on preconditioning for indefinite linear systems}, 389 author = {Murphy, Malcolm F and Golub, Gene H and Wathen, Andrew J}, 390 journal = {SIAM Journal on Scientific Computing}, 391 volume = {21}, 392 number = {6}, 393 pages = {1969--1972}, 394 year = {2000}, 395 publisher = {SIAM} 396} 397 398@article{oliphant1961implicit, 399 title = {An implicit, numerical method for solving two-dimensional time-dependent diffusion problems}, 400 author = {Oliphant, Thomas A}, 401 journal = {Quarterly of Applied mathematics}, 402 volume = {19}, 403 number = {3}, 404 pages = {221--229}, 405 year = {1961} 406} 407 408@article{dupont1968approximate, 409 title = {An approximate factorization procedure for solving self-adjoint elliptic difference equations}, 410 author = {Dupont, Todd and Kendall, Richard P and Rachford, Jr, HH}, 411 journal = {SIAM Journal on Numerical Analysis}, 412 volume = {5}, 413 number = {3}, 414 pages = {559--573}, 415 year = {1968}, 416 publisher = {SIAM} 417} 418 419@inproceedings{manteuffel1979shifted, 420 title = {Shifted incomplete {C}holesky factorization}, 421 author = {Manteuffel, Thomas A}, 422 booktitle = {Sparse Matrix Proceedings 1978}, 423 pages = {41--61}, 424 year = {1979}, 425 organization = {SIAM, Philadelphia, PA} 426} 427 428@incollection{chan1997approximate, 429 title = {Approximate and incomplete factorizations}, 430 author = {Chan, Tony F and Van Der Vorst, Henk A}, 431 booktitle = {Parallel numerical algorithms}, 432 pages = {167--202}, 433 year = {1997}, 434 publisher = {Springer} 435} 436 437@article{mandel2008multispace, 438 title = {Multispace and multilevel {BDDC}}, 439 author = {Mandel, Jan and Soused{\'\i}k, Bed{\v{r}}ich and Dohrmann, Clark R}, 440 journal = {Computing}, 441 volume = {83}, 442 number = {2-3}, 443 pages = {55--85}, 444 year = {2008}, 445 publisher = {Springer} 446} 447 448@article{klawonn2006dual, 449 title = {Dual-primal {FETI} methods for linear elasticity}, 450 author = {Klawonn, Axel and Widlund, Olof B}, 451 journal = {Communications on Pure and Applied Mathematics: A Journal Issued by the Courant Institute of Mathematical Sciences}, 452 volume = {59}, 453 number = {11}, 454 pages = {1523--1572}, 455 year = {2006}, 456 publisher = {Wiley Online Library} 457} 458 459@article{dohrmann2007approximate, 460 title = {An approximate {BDDC} preconditioner}, 461 author = {Dohrmann, Clark R}, 462 journal = {Numerical Linear Algebra with Applications}, 463 volume = {14}, 464 number = {2}, 465 pages = {149--168}, 466 year = {2007}, 467 publisher = {Wiley Online Library} 468} 469 470@book{dryja1987additive, 471 title = {An additive variant of the {S}chwarz alternating method for the case of many subregions}, 472 author = {Dryja, Maksymilian and Widlund, Olof}, 473 year = {1987}, 474 publisher = {Ultracomputer Research Laboratory, Univ., Courant Inst. of Mathematical~…} 475} 476 477@article{couturier2016tsirm, 478 title = {{TSIRM}: A two-stage iteration with least-squares residual minimization algorithm to solve large sparse linear and nonlinear systems}, 479 author = {Couturier, Rapha{\"e}l and Khodja, Lilia Ziane and Guyeux, Christophe}, 480 journal = {Journal of Computational Science}, 481 volume = {17}, 482 pages = {535--546}, 483 year = {2016}, 484 publisher = {Elsevier} 485} 486 487@article{chan1998transpose, 488 title = {Transpose-free formulations of Lanczos-type methods for nonsymmetric linear systems}, 489 author = {Chan, Tony F and De Pillis, Lisette and Van Der Vorst, Henk}, 490 journal = {Numerical Algorithms}, 491 volume = {17}, 492 pages = {51--66}, 493 year = {1998}, 494 publisher = {Springer} 495} 496 497@article{catabriga2006performance, 498 title = {Performance of {LCD} iterative method in the finite element and finite difference solution of convection--diffusion equations}, 499 author = {Catabriga, L and Valli, AMP and Melotti, BZ and Pessoa, LM and Coutinho, ALGA}, 500 journal = {Communications in numerical methods in engineering}, 501 volume = {22}, 502 number = {6}, 503 pages = {643--656}, 504 year = {2006}, 505 publisher = {Wiley Online Library} 506} 507 508@article{catabriga2004evaluating, 509 title = {Evaluating the {LCD} algorithm for solving linear systems of equations arising from implicit {SUPG} formulation of compressible flows}, 510 author = {Catabriga, Lucia and Coutinho, Alvaro LGA and Franca, Leopoldo P}, 511 journal = {International Journal for Numerical Methods in Engineering}, 512 volume = {60}, 513 number = {9}, 514 pages = {1513--1534}, 515 year = {2004}, 516 publisher = {Wiley Online Library} 517} 518 519@article{dai2004study, 520 title = {Study on semi-conjugate direction methods for non-symmetric systems}, 521 author = {Dai, Yu-Hong and Yuan, Jinyun}, 522 journal = {International journal for numerical methods in engineering}, 523 volume = {60}, 524 number = {8}, 525 pages = {1383--1399}, 526 year = {2004}, 527 publisher = {Wiley Online Library} 528} 529 530@article{yuan2004semi, 531 title = {Semi-conjugate direction methods for real positive definite systems}, 532 author = {Yuan, JY and Golub, Gene H and Plemmons, Robert J and Cecilio, WAG}, 533 journal = {BIT Numerical Mathematics}, 534 volume = {44}, 535 pages = {189--207}, 536 year = {2004}, 537 publisher = {Springer} 538} 539 540@article{ji2017breakdown, 541 title = {A breakdown-free block conjugate gradient method}, 542 author = {Ji, Hao and Li, Yaohang}, 543 journal = {BIT Numerical Mathematics}, 544 volume = {57}, 545 pages = {379--403}, 546 year = {2017}, 547 publisher = {Springer} 548} 549 550@inproceedings{jolivet2016block, 551 title = {Block iterative methods and recycling for improved scalability of linear solvers}, 552 author = {Jolivet, Pierre and Tournier, Pierre-Henri}, 553 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 554 pages = {190--203}, 555 year = {2016}, 556 organization = {IEEE} 557} 558 559@article{calandra2013modified, 560 title = {A modified block flexible {GMRES} method with deflation at each iteration for the solution of non-{H}ermitian linear systems with multiple right-hand sides}, 561 author = {Calandra, Henri and Gratton, Serge and Lago, Rafael and Vasseur, Xavier and Carvalho, Luiz Mariano}, 562 journal = {SIAM Journal on Scientific Computing}, 563 volume = {35}, 564 number = {5}, 565 pages = {S345--S367}, 566 year = {2013}, 567 publisher = {SIAM} 568} 569 570@article{o1980block, 571 title = {The block conjugate gradient algorithm and related methods}, 572 author = {O'Leary, Dianne P}, 573 journal = {Linear algebra and its applications}, 574 volume = {29}, 575 pages = {293--322}, 576 year = {1980}, 577 publisher = {Elsevier} 578} 579 580@article{erhel1996restarted, 581 title = {Restarted {GMRES} preconditioned by deflation}, 582 author = {Erhel, Jocelyne and Burrage, Kevin and Pohl, Bert}, 583 journal = {Journal of computational and applied mathematics}, 584 volume = {69}, 585 number = {2}, 586 pages = {303--318}, 587 year = {1996}, 588 publisher = {Elsevier} 589} 590 591@article{bai1994newton, 592 title = {A {N}ewton basis {GMRES} implementation}, 593 author = {Bai, Zhaojun and Hu, Dan and Reichel, Lothar}, 594 journal = {IMA Journal of Numerical Analysis}, 595 volume = {14}, 596 number = {4}, 597 pages = {563--581}, 598 year = {1994}, 599 publisher = {Oxford University Press} 600} 601 602@article{sidje1997alternatives, 603 title = {Alternatives for parallel Krylov subspace basis computation}, 604 author = {Sidje, Roger B}, 605 journal = {Numerical linear algebra with applications}, 606 volume = {4}, 607 number = {4}, 608 pages = {305--331}, 609 year = {1997}, 610 publisher = {Wiley Online Library} 611} 612 613@inproceedings{mohiyuddin2009minimizing, 614 title = {Minimizing communication in sparse matrix solvers}, 615 author = {Mohiyuddin, Marghoob and Hoemmen, Mark and Demmel, James and Yelick, Katherine}, 616 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage and Analysis}, 617 pages = {1--12}, 618 year = {2009} 619} 620 621@article{demmel2012communication, 622 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 623 author = {Demmel, James and Grigori, Laura and Hoemmen, Mark and Langou, Julien}, 624 journal = {SIAM Journal on Scientific Computing}, 625 volume = {34}, 626 number = {1}, 627 pages = {A206--A239}, 628 year = {2012}, 629 publisher = {SIAM} 630} 631 632@article{philippe2012generation, 633 title = {On the generation of {K}rylov subspace bases}, 634 author = {Philippe, Bernard and Reichel, Lothar}, 635 journal = {Applied Numerical Mathematics}, 636 volume = {62}, 637 number = {9}, 638 pages = {1171--1186}, 639 year = {2012}, 640 publisher = {Elsevier} 641} 642 643@article{wakam2013memory, 644 title = {Memory efficient hybrid algebraic solvers for linear systems arising from compressible flows}, 645 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Pacull, Fran{\c{c}}ois}, 646 journal = {Computers \& Fluids}, 647 volume = {80}, 648 pages = {158--167}, 649 year = {2013}, 650 publisher = {Elsevier} 651} 652 653@misc{wakam2011parallelism, 654 title = {Parallelism and robustness in {GMRES} with the {N}ewton basis and the deflated restarting}, 655 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Erhel, Jocelyne}, 656 year = {2011}, 657 url = {https://hal.inria.fr/inria-00638247/en} 658} 659 660@article{tu2015feti, 661 title = {A {FETI-DP} type domain decomposition algorithm for three-dimensional incompressible {S}tokes equations}, 662 author = {Tu, Xuemin and Li, Jing}, 663 journal = {SIAM Journal on Numerical Analysis}, 664 volume = {53}, 665 number = {2}, 666 pages = {720--742}, 667 year = {2015}, 668 publisher = {SIAM} 669} 670 671@article{farhat2001feti, 672 title = {{FETI-DP}: a dual--primal unified {FETI} method—part {I}: A faster alternative to the two-level {FETI} method}, 673 author = {Farhat, Charbel and Lesoinne, Michel and LeTallec, Patrick and Pierson, Kendall and Rixen, Daniel}, 674 journal = {International journal for numerical methods in engineering}, 675 volume = {50}, 676 number = {7}, 677 pages = {1523--1544}, 678 year = {2001}, 679 publisher = {Wiley Online Library} 680} 681 682@article{lottes2023optimal, 683 title = {Optimal polynomial smoothers for multigrid {V}-cycles}, 684 author = {Lottes, James}, 685 journal = {Numerical Linear Algebra with Applications}, 686 volume = {30}, 687 number = {6}, 688 pages = {e2518}, 689 year = {2023}, 690 publisher = {Wiley Online Library} 691} 692 693@article{phillips2022optimal, 694 title = {Optimal {C}hebyshev Smoothers and One-sided {V}-cycles}, 695 author = {Phillips, Malachi and Fischer, Paul}, 696 journal = {arXiv preprint arXiv:2210.03179}, 697 year = {2022} 698} 699 700@incollection{toint1981towards, 701 title = {Towards an efficient sparsity exploiting {N}ewton method for minimization}, 702 author = {Toint, Philippe}, 703 booktitle = {Sparse matrices and their uses}, 704 pages = {57--88}, 705 year = {1981}, 706 publisher = {Academic press} 707} 708 709@article{cools2019numerically, 710 title = {Numerically stable recurrence relations for the communication hiding pipelined conjugate gradient method}, 711 author = {Cools, Siegfried and Cornelis, Jeffrey and Vanroose, Wim}, 712 journal = {IEEE Transactions on Parallel and Distributed Systems}, 713 volume = {30}, 714 number = {11}, 715 pages = {2507--2522}, 716 year = {2019}, 717 publisher = {IEEE} 718} 719 720@article{cornelis2018communication, 721 title = {The communication-hiding conjugate gradient method with deep pipelines}, 722 author = {Cornelis, Jeffrey and Cools, Siegfried and Vanroose, Wim}, 723 journal = {arXiv preprint arXiv:1801.04728}, 724 year = {2018} 725} 726 727@article{d1993conjugate, 728 title = {Conjugate gradient algorithms with reduced synchronization overhead on distributed memory multiprocessors}, 729 author = {D’Azevedo, EF and Eijkhout, VL and Romine, CH}, 730 journal = {Computer Science Technical Report CS-93-185, University of Tennessee, Knoxville}, 731 year = {1993} 732} 733 734@book{malek2014preconditioning, 735 title = {Preconditioning and the conjugate gradient method in the context of solving {PDEs}}, 736 author = {M{\'a}lek, Josef and Strako{\v{s}}, Zden{\v{e}}k}, 737 year = {2014}, 738 publisher = {SIAM} 739} 740 741@book{fokkema1996enhanced, 742 title = {Enhanced implementation of {BiCGstab}(l) for solving linear systems of equations}, 743 author = {Fokkema, Diederik R}, 744 year = {1996}, 745 publisher = {Citeseer} 746} 747 748@article{sleijpen1994bicgstab, 749 title = {{BiCGstab}(l) and other hybrid {Bi-CG} methods}, 750 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A and Fokkema, Diederik R}, 751 journal = {Numerical Algorithms}, 752 volume = {7}, 753 pages = {75--109}, 754 year = {1994}, 755 publisher = {Springer} 756} 757 758@article{sleijpen1995overview, 759 title = {An overview of approaches for the stable computation of hybrid {BiCG} methods}, 760 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A}, 761 journal = {Applied numerical mathematics}, 762 volume = {19}, 763 number = {3}, 764 pages = {235--254}, 765 year = {1995}, 766 publisher = {Elsevier} 767} 768 769@article{fischer1998projection, 770 title = {Projection techniques for iterative solution of Ax= b with successive right-hand sides}, 771 author = {Fischer, Paul F}, 772 journal = {Computer methods in applied mechanics and engineering}, 773 volume = {163}, 774 number = {1-4}, 775 pages = {193--204}, 776 year = {1998}, 777 publisher = {Elsevier} 778} 779 780@article{maskery2018insights, 781 title = {Insights into the mechanical properties of several triply periodic minimal surface lattice structures 782 made by polymer additive manufacturing}, 783 author = {Maskery, Ian and Sturm, Logan and Aremu, Adedeji O and Panesar, Ajit and Williams, 784 Christopher B and Tuck, Christopher J and Wildman, Ricky D and Ashcroft, Ian A and Hague, Richard JM}, 785 journal = {Polymer}, 786 volume = {152}, 787 pages = {62--71}, 788 year = {2018}, 789 publisher = {Elsevier} 790} 791 792@book{karniadakis2005spectral, 793 title = {Spectral/hp element methods for computational fluid dynamics}, 794 author = {Karniadakis, George and Sherwin, Spencer J}, 795 year = {2005}, 796 publisher = {Oxford University Press, USA} 797} 798 799@article{golub1969calculation, 800 title = {Calculation of {G}auss quadrature rules}, 801 author = {Golub, Gene H and Welsch, John H}, 802 journal = {Mathematics of computation}, 803 volume = {23}, 804 number = {106}, 805 pages = {221--230}, 806 year = {1969} 807} 808 809@article{soderlind2006adaptive, 810 title = {Adaptive time-stepping and computational stability}, 811 author = {S{\"o}derlind, Gustaf and Wang, Lina}, 812 journal = {Journal of Computational and Applied Mathematics}, 813 volume = {185}, 814 number = {2}, 815 pages = {225--243}, 816 year = {2006}, 817 publisher = {Elsevier} 818} 819 820@article{soderlind2003digital, 821 title = {Digital filters in adaptive time-stepping}, 822 author = {S{\"o}derlind, Gustaf}, 823 journal = {{ACM} Transactions on Mathematical Software ({TOMS})}, 824 volume = {29}, 825 number = {1}, 826 pages = {1--26}, 827 year = {2003}, 828 publisher = {ACM New York, NY, USA} 829} 830 831@article{volkwein2013proper, 832 title = {Proper orthogonal decomposition: Theory and reduced-order modelling}, 833 author = {Volkwein, Stefan}, 834 journal = {Lecture Notes, University of Konstanz}, 835 volume = {4}, 836 number = {4}, 837 pages = {1--29}, 838 year = {2013}, 839 url = {http://www.math.uni-konstanz.de/numerik/personen/volkwein/teaching/POD-Book.pdf} 840} 841 842@article{frisvad2012building, 843 title = {Building an orthonormal basis from a {3D} unit vector without normalization}, 844 author = {Frisvad, Jeppe Revall}, 845 journal = {Journal of Graphics Tools}, 846 volume = {16}, 847 number = {3}, 848 pages = {151--159}, 849 year = {2012}, 850 publisher = {Taylor \& Francis} 851} 852 853@article{constantinescu2007multirate, 854 title = {Multirate timestepping methods for hyperbolic conservation laws}, 855 author = {Constantinescu, Emil M and Sandu, Adrian}, 856 journal = {Journal of Scientific Computing}, 857 volume = {33}, 858 number = {3}, 859 pages = {239--278}, 860 year = {2007}, 861 publisher = {Springer} 862} 863 864@article{liu2022newton, 865 title = {A {N}ewton-{MR} algorithm with complexity guarantees for nonconvex smooth unconstrained optimization}, 866 author = {Liu, Yang and Roosta, Fred}, 867 journal = {arXiv preprint arXiv:2208.07095}, 868 year = {2022} 869} 870 871@article{choi2011minres, 872 title = {{MINRES-QLP}: A {K}rylov subspace method for indefinite or singular symmetric systems}, 873 author = {Choi, Sou-Cheng T and Paige, Christopher C and Saunders, Michael A}, 874 journal = {SIAM Journal on Scientific Computing}, 875 volume = {33}, 876 number = {4}, 877 pages = {1810--1836}, 878 year = {2011}, 879 publisher = {SIAM} 880} 881 882@article{chen2020predict, 883 title = {Predict-and-recompute conjugate gradient variants}, 884 author = {Chen, Tyler and Carson, Erin}, 885 journal = {SIAM Journal on Scientific Computing}, 886 volume = {42}, 887 number = {5}, 888 pages = {A3084--A3108}, 889 year = {2020}, 890 publisher = {SIAM} 891} 892 893@article{cools2018analyzing, 894 title = {Analyzing the effect of local rounding error propagation on the maximal attainable accuracy of the pipelined conjugate gradient method}, 895 author = {Cools, Siegfried and Yetkin, Emrullah Fatih and Agullo, Emmanuel and Giraud, Luc and Vanroose, Wim}, 896 journal = {SIAM Journal on Matrix Analysis and Applications}, 897 volume = {39}, 898 number = {1}, 899 pages = {426--450}, 900 year = {2018}, 901 publisher = {SIAM} 902} 903 904@inproceedings{tiwari2020pipelined, 905 title = {Pipelined preconditioned conjugate gradient methods for distributed memory systems}, 906 author = {Tiwari, Manasi and Vadhiyar, Sathish}, 907 booktitle = {2020 IEEE 27th International Conference on High Performance Computing, Data, and Analytics (HiPC)}, 908 pages = {151--160}, 909 year = {2020}, 910 organization = {IEEE} 911} 912 913@article{nash1984newton, 914 title = {Newton-type minimization via the {L}anczos method}, 915 author = {Nash, Stephen G}, 916 journal = {SIAM Journal on Numerical Analysis}, 917 volume = {21}, 918 number = {4}, 919 pages = {770--788}, 920 year = {1984}, 921 publisher = {SIAM} 922} 923 924@inproceedings{eller2016scalable, 925 title = {Scalable non-blocking preconditioned conjugate gradient methods}, 926 author = {Eller, Paul R and Gropp, William}, 927 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 928 pages = {204--215}, 929 year = {2016}, 930 organization = {IEEE} 931} 932 933@article{gould1999solving, 934 title = {Solving the trust-region subproblem using the Lanczos method}, 935 author = {Gould, Nicholas IM and Lucidi, Stefano and Roma, Massimo and Toint, Philippe L}, 936 journal = {SIAM Journal on Optimization}, 937 volume = {9}, 938 number = {2}, 939 pages = {504--525}, 940 year = {1999}, 941 publisher = {SIAM} 942} 943 944@article{cools2017communication, 945 title = {The communication-hiding pipelined {BiCGstab} method for the parallel solution of large unsymmetric linear systems}, 946 author = {Cools, Siegfried and Vanroose, Wim}, 947 journal = {Parallel Computing}, 948 volume = {65}, 949 pages = {1--20}, 950 year = {2017}, 951 publisher = {Elsevier} 952} 953 954@Misc{moabwebsite, 955 key = {MOAB}, 956 title = {{MOAB} Website}, 957 howpublished = {\url{https://www.mcs.anl.gov/~fathom/moab-docs/html/contents.html}}, 958 year = {2023} 959} 960 961@book{deuflhard2011, 962 title = {{N}ewton Methods for Nonlinear Problems}, 963 author = {Peter Deuflhard}, 964 volume = {35}, 965 year = {2011}, 966 isbn = {978-3-642-23898-7}, 967 doi = {10.1007/978-3-642-23899-4}, 968 publisher = {Springer-Verlag}, 969 address = {Berlin, Heidelberg} 970} 971 972@article{ketcheson2010runge, 973 title = {{R}unge--{K}utta methods with minimum storage implementations}, 974 author = {Ketcheson, David I}, 975 journal = {Journal of Computational Physics}, 976 volume = {229}, 977 number = {5}, 978 pages = {1763--1773}, 979 year = {2010}, 980 publisher = {Elsevier} 981} 982 983@article{WalkerNi2011, 984 title = {{A}nderson acceleration for fixed-point iterations}, 985 author = {Homer F Walker and Peng Ni}, 986 journal = {SIAM Journal on Numerical Analysis}, 987 volume = {49}, 988 number = {4}, 989 pages = {1715--1735}, 990 year = {2011}, 991 publisher = {SIAM} 992} 993 994@article{Hua2007, 995 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 996 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 997 journal = {AIChE Journal}, 998 volume = {53}, 999 number = {10}, 1000 pages = {2534--2548}, 1001 year = {2007}, 1002 publisher = {Wiley Online Library} 1003} 1004 1005@Article{ openblas, 1006 title = {{OpenBLAS}: A High Performance {BLAS} Library on {L}oongson {3A} {CPU}}, 1007 journal = {Journal of Software}, 1008 volume = {22}, 1009 pages = {208--216}, 1010 year = {2011}, 1011 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 1012 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 1013} 1014 1015@Misc{ openblas-website, 1016 title = {{OpenBLAS}}, 1017 key = {OpenBLAS}, 1018 howpublished = {\url{https://www.openblas.net}} 1019} 1020 1021@Misc{ openacc-website, 1022 title = {{OpenACC}}, 1023 key = {OpenACC}, 1024 howpublished = {\url{https://www.openacc.org}} 1025} 1026 1027@Misc{ bueler2020petsc, 1028 title = {{PETSc} for Partial Differential Equations: Numerical Solutions in {C} and {P}ython}, 1029 author = {Bueler, Ed}, 1030 year = {2020}, 1031 publisher = {SIAM}, 1032 petsc_uses = {KSP} 1033} 1034 1035@TechReport{ petscforgpuexascale, 1036 title = {Toward Performance-Portable {PETSc} for {GPU}-based Exascale Systems}, 1037 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1038 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 1039 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1040 institution = {Argonne National Laboratory}, 1041 number = {ANL/MCS-P9401-1020}, 1042 note = {\url{https://arxiv.org/abs/2011.00715}}, 1043 year = {2020}, 1044 petsc_uses = {KSP} 1045} 1046 1047@Article{ mills2021, 1048 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 1049 journal = {Parallel Computing}, 1050 volume = {108}, 1051 pages = {102831}, 1052 year = {2021}, 1053 issn = {0167-8191}, 1054 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 1055 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 1056 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1057 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 1058 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 1059} 1060 1061@Article{ rupp:2016:pis:2988256.2907944, 1062 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 1063 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 1064 journal = {ACM Trans. Math. Softw.}, 1065 issue_date = {September 2016}, 1066 volume = {43}, 1067 number = {2}, 1068 month = aug, 1069 year = {2016}, 1070 issn = {0098-3500}, 1071 pages = {11:1--11:27}, 1072 articleno = {11}, 1073 numpages = {27}, 1074 doi = {10.1145/2907944}, 1075 acmid = {2907944}, 1076 publisher = {ACM}, 1077 address = {New York, NY, USA}, 1078 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 1079 gradient method}, 1080 petsc_uses = {KSP} 1081} 1082 1083@Article{ dalcin2011parallel, 1084 title = {Parallel distributed computing using python}, 1085 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 1086 journal = {Advances in Water Resources}, 1087 volume = {34}, 1088 number = {9}, 1089 pages = {1124--1139}, 1090 year = {2011}, 1091 publisher = {Elsevier}, 1092 petsc_uses = {KSP} 1093} 1094 1095@Article{ mendezpongaortiz2018, 1096 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 1097 author = {JP Mendez and M Ponga and M Ortiz}, 1098 journal = {Journal of the Mechanics and Physics of Solids}, 1099 year = {2018}, 1100 petsc_uses = {KSP} 1101} 1102 1103@TechReport{ morgan2020evaluation, 1104 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 1105 System: Part 1: Vector Node Performance}, 1106 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 1107 year = {2020}, 1108 institution = {Argonne National Laboratory}, 1109 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 1110 petsc_uses = {KSP} 1111} 1112 1113@TechReport{ pdeconstrainedspectraladjoints, 1114 title = {PDE constrained optimization, error estimation and control with spectral elements 1115 using PETSc and TAO}, 1116 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 1117 type = {Preprint}, 1118 number = {ANL/MCS-P9031-1117}, 1119 institution = {ANL}, 1120 month = nov, 1121 year = {2017}, 1122 petsc_uses = {KSP} 1123} 1124 1125@InProceedings{ asc2013, 1126 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 1127 title = {Evaluation of overlapping restricted additive {S}chwarz preconditioning for 1128 parallel solution of very large power flow problems}, 1129 booktitle = {HiPCNA-PG’13}, 1130 year = {2013}, 1131 petsc_uses = {KSP} 1132} 1133 1134@InProceedings{ as2013, 1135 author = {S. Abhyankar and B. F. Smith}, 1136 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 1137 Smart Grid Applications}, 1138 booktitle = {Proceedings of the IEEE PES General Meeting}, 1139 year = {2013}, 1140 petsc_uses = {KSP} 1141} 1142 1143@TechReport{ tspaper, 1144 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 1145 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 1146 Barry F. Smith}, 1147 type = {Preprint}, 1148 number = {ANL/MCS-P5061-0114}, 1149 institution = {ANL}, 1150 month = jan, 1151 year = {2014}, 1152 petsc_uses = {KSP} 1153} 1154 1155@TechReport{ abhyankaretal2018, 1156 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 1157 and Barry F. Smith and Hong Zhang}, 1158 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 1159 journal = {arXiv e-preprints}, 1160 eprint = {1806.01437}, 1161 archiveprefix = {arXiv}, 1162 year = {2018}, 1163 petsc_uses = {KSP} 1164} 1165 1166@Article{ zhang2021cams, 1167 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 1168 author = {Hong Zhang and Emil M. Constantinescu}, 1169 journal = {arXiv e-preprints}, 1170 eprint = {2202.11890}, 1171 archiveprefix = {arXiv}, 1172 year = {2022}, 1173 petsc_uses = {KSP} 1174} 1175 1176@InProceedings{ zhangconstantinescu2021b, 1177 title = {Revolve-based adjoint checkpointing for multistage time integration}, 1178 author = {Hong Zhang and Emil M. Constantinescu}, 1179 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 1180 month = jun, 1181 year = {2021}, 1182 petsc_uses = {KSP} 1183} 1184 1185@Article{ zhang2022tsadjoint, 1186 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 1187 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 1188 Sensitivity Analysis}}, 1189 journal = {SIAM Journal on Scientific Computing}, 1190 volume = {44}, 1191 number = {1}, 1192 pages = {C1-C24}, 1193 year = {2022}, 1194 doi = {10.1137/21M140078X}, 1195 petsc_uses = {KSP} 1196} 1197 1198@TechReport{ bb2008, 1199 author = {Tomasz Blachowicz and Bartlomiej Baron}, 1200 title = {A graphical extension for the Windows version of the Parallel Finite Element 1201 Micromagnetics Package (MagParExt)}, 1202 url = {http://arxiv.org/abs/0807.2655}, 1203 year = {2008}, 1204 petsc_uses = {KSP} 1205} 1206 1207@Article{ jacvgv2008, 1208 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 1209 and J L Vicent}, 1210 title = {Field induced vortex dynamics in magnetic {Ni} nanotriangles}, 1211 journal = {Nanotechnology}, 1212 volume = {19}, 1213 year = {2008}, 1214 doi = {10.1088/0957-4484/19/28/285717}, 1215 petsc_uses = {KSP} 1216} 1217 1218@Article{ yjdwh2008, 1219 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1220 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1221 journal = {Journal of the Magnetics Society of Japan}, 1222 volume = {32}, 1223 year = {2008}, 1224 pages = {50-53}, 1225 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 1226 petsc_uses = {KSP} 1227} 1228 1229@Article{ mtrtrsa2008, 1230 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 1231 Schrefl and M. Albrecht}, 1232 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 1233 journal = {J. Appl. Phys.}, 1234 volume = {103}, 1235 year = {2008}, 1236 doi = {10.1063/1.2894587}, 1237 petsc_uses = {KSP} 1238} 1239 1240@InProceedings{ tmrttsa2008, 1241 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 1242 Schrefl and M. Albrecht}, 1243 title = {Patterning of magnetic films by focused ion beam irradiation}, 1244 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 1245 year = {2008}, 1246 petsc_uses = {KSP} 1247} 1248 1249@Article{ yjdbh2007, 1250 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 1251 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 1252 factor for the single-phase soft magnetic films}, 1253 journal = {J. Magn. Magn. Mater.}, 1254 volume = {320}, 1255 number = {7}, 1256 pages = {1393-1397}, 1257 doi = {10.1016/j.jmmm.2007.11.025}, 1258 petsc_uses = {KSP} 1259} 1260 1261@Article{ lxky2007, 1262 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 1263 title = {Micromagnetic simulation and experimental study on microwave permeability of 1264 nano-magnetic films}, 1265 journal = {Transactions of Nonferrous Metals Society of China}, 1266 year = {2007}, 1267 pages = {756-759}, 1268 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 1269 petsc_uses = {KSP} 1270} 1271 1272@Article{ yjdwh2008a, 1273 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1274 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1275 journal = {Journal of the Magnetics Society of Japan}, 1276 volume = {32}, 1277 year = {2008}, 1278 pages = {50-53}, 1279 doi = {10.3379/msjmag.32.50}, 1280 petsc_uses = {KSP} 1281} 1282 1283@Article{ lylw2007, 1284 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 1285 title = {Micromagnetic study of magnetization reversal in patterned {DyFeCo} thin films}, 1286 journal = {Phys. Stat. Sol.}, 1287 volume = {204}, 1288 number = {12}, 1289 pages = {4049-4052}, 1290 year = {2007}, 1291 doi = {10.1002/pssa.200777359}, 1292 petsc_uses = {KSP} 1293} 1294 1295@InProceedings{ sg2007, 1296 author = {Simon Greaves}, 1297 title = {Micromagnetic Simulations of Magnetic Recording Media}, 1298 booktitle = {High Performance Computing on Vector Systems 2007}, 1299 doi = {10.1007/978-3-540-74384-2_17}, 1300 petsc_uses = {KSP} 1301} 1302 1303@Article{ bsc2007, 1304 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 1305 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm {NiFe} Nanorings}, 1306 journal = {IEEE Trans. Magn.}, 1307 volume = {43}, 1308 year = {2007}, 1309 pages = {2884-2886}, 1310 doi = {10.1109/TMAG.2007.892867}, 1311 petsc_uses = {KSP} 1312} 1313 1314@Article{ ffbf, 1315 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 1316 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 1317 Micromagnetic Simulations: Nmag.}, 1318 journal = {IEEE Trans. Magn. Volume}, 1319 volume = {43}, 1320 pages = {2896-2898}, 1321 doi = {10.1109/TMAG.2007.893843}, 1322 petsc_uses = {KSP} 1323} 1324 1325@InBook{ dfssfs2006, 1326 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 1327 chapter = {Computational Aspects of Micromagnetics}, 1328 title = {The Science of Hysteresis}, 1329 editor = { G. Bertotti and I. Mayergoyz}, 1330 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 1331 petsc_uses = {KSP} 1332} 1333 1334@InBook{ fss, 1335 author = {J. Fidler and T. Schrefl and W. Scholz}, 1336 chapter = {Computational Micromagnetics}, 1337 title = {Handbook of Theoretical and Computational Nanotechnology}, 1338 editor = {M. Rieth and W. Schommers}, 1339 url = {http://www.amazon.com/gp/product/158883042X}, 1340 petsc_uses = {KSP} 1341} 1342 1343@InBook{ shbsef, 1344 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 1345 Josef Fidler}, 1346 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 1347 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 1348 editor = {Helmut Kronmueller and Stuart Parkin}, 1349 doi = {10.1002/9780470022184.hmm203}, 1350 petsc_uses = {KSP} 1351} 1352 1353@InBook{ sfs, 1354 author = {D. Suess and J. Fidler and T. Schrefl}, 1355 chapter = {Micromagnetic Simulation of magnetic materials}, 1356 title = {Handbook of Magnetic Materials}, 1357 editor = {K. H. J. Buschow}, 1358 url = {http://www.amazon.com/gp/product/0444518509}, 1359 petsc_uses = {KSP} 1360} 1361 1362@Article{ fsxzs, 1363 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 1364 Sharma}, 1365 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 1366 Recording.}, 1367 journal = {IEEE Trans. Magn. Volume}, 1368 volume = {43}, 1369 pages = {2175-2177}, 1370 doi = {10.1109/TMAG.2007.893122}, 1371 petsc_uses = {KSP} 1372} 1373 1374@Article{ sb2006, 1375 author = {W. Scholz and S. Batra}, 1376 title = {Effect of write current waveform on magnetization and head field dynamics of 1377 perpendicular recording heads}, 1378 journal = {IEEE Trans. Magn.}, 1379 volume = {42}, 1380 year = {2006}, 1381 pages = {2264--2266}, 1382 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 1383 petsc_uses = {KSP} 1384} 1385 1386@Article{ bsr2006, 1387 author = {S. Batra and W. Scholz and T. Roscamp}, 1388 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 1389 recording system}, 1390 journal = {J. Appl. Phys.}, 1391 volume = {99}, 1392 year = {2006}, 1393 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 1394 petsc_uses = {KSP} 1395} 1396 1397@InProceedings{ japios2006, 1398 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 1399 Subramanian}, 1400 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 1401 in systems with cubic and uniaxial anisotropy.}, 1402 booktitle = {Intermag 2006 Conference}, 1403 petsc_uses = {KSP} 1404} 1405 1406@Article{ kbmb2006, 1407 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 1408 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 1409 Perpendicular Recording Heads}, 1410 journal = {IEEE Trans. Magn.}, 1411 volume = {42}, 1412 year = {2006}, 1413 pages = {2428--2430}, 1414 doi = {10.1109/TMAG.2006.879430}, 1415 petsc_uses = {KSP} 1416} 1417 1418@Article{ cclcw2006, 1419 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 1420 title = {Control of Domain Wall Motion in Permalloy Ring}, 1421 journal = {IEEE Trans. Magn.}, 1422 volume = {42}, 1423 year = {2006}, 1424 pages = {2960--2962}, 1425 doi = {10.1109/TMAG.2006.878414}, 1426 petsc_uses = {KSP} 1427} 1428 1429@Article{ bfmfzczg2007, 1430 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 1431 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 1432 title = {Micromagnetic modelling of ferromagnetic cones}, 1433 journal = {J. Magn. Magn. Mater.}, 1434 volume = {312}, 1435 year = {2007}, 1436 pages = {234-238}, 1437 url = {http://eprints.soton.ac.uk/45900/}, 1438 petsc_uses = {KSP} 1439} 1440 1441@PhDThesis{ rb2005, 1442 author = {Richard Boardman}, 1443 title = {Computer simulation studies of magnetic nanostructures}, 1444 school = {Computational Engineering and Design Group, School of Engineering Sciences, 1445 University of Southampton, United Kingdom}, 1446 year = {2005}, 1447 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 1448 petsc_uses = {KSP} 1449} 1450 1451@InProceedings{ cwwy2006, 1452 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 1453 title = {MPI Performance Analysis Tools on Blue Gene/L}, 1454 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 1455 year = {2006}, 1456 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 1457 petsc_uses = {KSP} 1458} 1459 1460@InProceedings{ ch2006, 1461 author = {I.-H. Chung and J.K. Hollingsworth}, 1462 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 1463 Programs}, 1464 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 1465 pages = {45--56}, 1466 doi = {10.1109/HPDC.2006.1652135}, 1467 petsc_uses = {KSP} 1468} 1469 1470@Article{ lkpl2005, 1471 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1472 title = {Multibit {MRAM} using a pair of memory cells}, 1473 journal = {IEEE Trans. Magn.}, 1474 volume = {41}, 1475 year = {2005}, 1476 pages = {2670-2672}, 1477 doi = {10.1109/TMAG.2005.855288}, 1478 petsc_uses = {KSP} 1479} 1480 1481@Article{ gscn2005, 1482 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 1483 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 1484 journal = {Phys. Rev. B}, 1485 volume = {71}, 1486 year = {2005}, 1487 doi = {10.1103/PhysRevB.71.144407}, 1488 petsc_uses = {KSP} 1489} 1490 1491@PhDThesis{ mda, 1492 author = {Massimiliano d'Aquino}, 1493 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 1494 school = { Universita di Napoli Federico II.}, 1495 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 1496 petsc_uses = {KSP} 1497} 1498 1499@TechReport{ ssdfssf2003, 1500 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 1501 Stehno and J. Fidler}, 1502 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 1503 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 1504 petsc_uses = {KSP} 1505} 1506 1507@InProceedings{ sb2006a, 1508 author = {W. Scholz and S. Batra}, 1509 title = {Effect of write current waveform on magnetization and head field dynamics of 1510 perpendicular recording heads}, 1511 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 1512 petsc_uses = {KSP} 1513} 1514 1515@Article{ scholz-batra1, 1516 author = {W. Scholz and S. Batra}, 1517 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 1518 Recording}, 1519 journal = {IEEE Trans. Magn.}, 1520 note = {submitted}, 1521 year = {2005}, 1522 petsc_uses = {KSP} 1523} 1524 1525@Article{ scholz-batra2, 1526 author = {W. Scholz and S. Batra}, 1527 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 1528 journal = {IEEE Trans. Magn.}, 1529 volume = {41}, 1530 year = {2005}, 1531 pages = {702-706}, 1532 petsc_uses = {KSP} 1533} 1534 1535@Article{ daquino-scholz1, 1536 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1537 title = {Micromagnetic Analysis of Fast Precessional Switching}, 1538 journal = {J. Magn. Magn. Mater.}, 1539 volume = {290-291}, 1540 year = {2005}, 1541 pages = {510-513}, 1542 petsc_uses = {KSP} 1543} 1544 1545@Article{ aq-scholz-fid, 1546 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1547 title = {Numerical and analytical study of fast precessional switching}, 1548 journal = {J. Appl. Phys.}, 1549 volume = {95}, 1550 year = {2004}, 1551 pages = {7055-7057}, 1552 petsc_uses = {KSP} 1553} 1554 1555@InProceedings{ gar-tabik-gar, 1556 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 1557 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 1558 Scatterers}, 1559 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 1560 (PDP'04)}, 1561 year = {2004}, 1562 pages = {80--}, 1563 petsc_uses = {KSP} 1564} 1565 1566@InProceedings{ aq-scholz-mia, 1567 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 1568 title = {Analysis of fast precessional switching in magnetic thin films}, 1569 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 1570 year = {2004}, 1571 pages = {257-260}, 1572 petsc_uses = {KSP} 1573} 1574 1575@Article{ scholz-fid-seus, 1576 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 1577 Dittrich and V. Tsiantos}, 1578 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 1579 Axes}, 1580 journal = {J. Magn. Magn. Mater.}, 1581 year = {2004}, 1582 pages = {1524-1525}, 1583 petsc_uses = {KSP} 1584} 1585 1586@Article{ boardman-zimmerman, 1587 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 1588 Peter de Groot}, 1589 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 1590 journal = {Journal of Applied Physics}, 1591 year = {2005}, 1592 petsc_uses = {KSP} 1593} 1594 1595@Article{ lim-kim-park, 1596 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1597 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 1598 journal = {IEEE Trans. Magn.}, 1599 note = {submitted}, 1600 petsc_uses = {KSP} 1601} 1602 1603@Article{ scholz-suess2, 1604 author = {W. Scholz and D. Suess and T. Schrefl and and J. Fidler}, 1605 title = {Micromagnetic simulation of magnetization reversal in small particles with 1606 surface anisotropy}, 1607 journal = {J. Appl. Phys.}, 1608 volume = {95}, 1609 year = {2004}, 1610 pages = {6807-6809}, 1611 petsc_uses = {KSP} 1612} 1613 1614@Article{ scholz-schrefl1, 1615 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 1616 Tsiantos}, 1617 title = {Micromagnetic simulation of the pinning and depinning process in permanent 1618 magnets}, 1619 journal = {IEEE Trans. Magn.}, 1620 volume = {39}, 1621 year = {2003}, 1622 pages = {2920-2922}, 1623 petsc_uses = {KSP} 1624} 1625 1626@Article{ scholz-guslienko, 1627 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 1628 W. Chantrell and J. Fidler}, 1629 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 1630 nanodots}, 1631 journal = {J. Magn. Magn. Mater.}, 1632 volume = {266}, 1633 year = {2003}, 1634 pages = {155-163}, 1635 petsc_uses = {KSP} 1636} 1637 1638@Article{ scholz1, 1639 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 1640 Forster and V. Tsiantos}, 1641 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1642 journal = {Comp. Mat. Sci}, 1643 year = {2003}, 1644 pages = {366--383}, 1645 volume = {28}, 1646 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 1647 petsc_uses = {KSP} 1648} 1649 1650@PhDThesis{ scholz2, 1651 author = {W. Scholz}, 1652 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1653 school = {Vienna University of Technology, Vienna, Austria}, 1654 year = {2003}, 1655 petsc_uses = {KSP} 1656} 1657 1658@Article{ scholz3, 1659 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 1660 Forster and J. Fidler}, 1661 title = {Implementation of a high performance parallel finite element micromagnetics 1662 package}, 1663 journal = {J. Magn. Magn. Mater.}, 1664 year = {2004}, 1665 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 1666 petsc_uses = {KSP} 1667} 1668 1669% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1670@InBook{ zhanggladwell1, 1671 author = {W. Zhang and I. Gladwell}, 1672 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 1673 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 1674 year = {2000}, 1675 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 1676 Physics, vol. 552}, 1677 publisher = {Springer}, 1678 pages = {4190-}, 1679 petsc_uses = {KSP} 1680} 1681 1682@Article{ wolf1, 1683 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 1684 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 1685 thin films}, 1686 journal = {Phil. Mag. A}, 1687 year = {2003}, 1688 lab = {ANL}, 1689 petsc_uses = {KSP} 1690} 1691 1692@Article{ wolf2, 1693 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 1694 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 1695 grain-boundary properties}, 1696 journal = {Computational Materials Science}, 1697 year = {2001}, 1698 volume = {23}, 1699 pages = {15--32}, 1700 lab = {ANL}, 1701 petsc_uses = {KSP} 1702} 1703 1704@Article{ wolf3, 1705 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 1706 title = {Role of grain rotation in grain growth by mesoscale simulation}, 1707 journal = {Phil. Mag. A}, 1708 year = {2002}, 1709 volume = {82}, 1710 pages = {1271--1297}, 1711 lab = {ANL}, 1712 petsc_uses = {KSP} 1713} 1714 1715% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1716@Article{ saut, 1717 author = { Olivier Saut}, 1718 title = {Bidimensional Study of the {M}axwell-{B}loch Model in a Nonlinear Crystal}, 1719 journal = {SIAM Journal on Scientific Computing}, 1720 year = {2004}, 1721 note = {submitted}, 1722 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 1723 petsc_uses = {KSP} 1724} 1725 1726% LiteralHTML: 1727% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 1728% LiteralHTML: 1729@InBook{ khanallorenziayachepennec2016, 1730 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 1731 of Brain Deformation in {Alzheimer's} Disease}, 1732 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 1733 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 1734 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 1735 Miller}, 1736 pages = {167--176}, 1737 isbn = {978-3-319-28329-6}, 1738 doi = {10.1007/978-3-319-28329-6_15}, 1739 publisher = {Springer International Publishing}, 1740 year = {2016}, 1741 petsc_uses = {KSP} 1742} 1743 1744@Article{ ataseven, 1745 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 1746 title = {Parallel implementation of the accelerated {BEM} approach for {EMSI} of the human 1747 brain}, 1748 journal = {Medical and Biological Engineering and Computing}, 1749 month = feb, 1750 year = {2008}, 1751 doi = {10.1007/s11517-008-0316-0}, 1752 petsc_uses = {KSP} 1753} 1754 1755@Article{ dennis-eberhart-03, 1756 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 1757 pages = {832-840}, 1758 volume = {125}, 1759 number = {6}, 1760 title = {Finite-element simulation of cooling of realistic {3-D} human head and neck}, 1761 journal = {J Biomech Eng}, 1762 year = {2003}, 1763 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 1764 petsc_uses = {KSP} 1765} 1766 1767@Conference{ gu7174parallel, 1768 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 1769 frequency-domain small animal optical tomography}}, 1770 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 1771 booktitle = {Proc. of SPIE Vol}, 1772 volume = {7174}, 1773 number = {717406}, 1774 pages = {1}, 1775 petsc_uses = {KSP} 1776} 1777 1778@Article{ barchanski2005using, 1779 title = {{Using domain decomposition techniques for the calculation of low-frequency 1780 electric current densities in high-resolution 3D human anatomy models}}, 1781 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 1782 T.}, 1783 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 1784 and Electronic Engineering}, 1785 volume = {24}, 1786 number = {2}, 1787 pages = {458--467}, 1788 issn = {0332-1649}, 1789 year = {2005}, 1790 publisher = {Emerald Group Publishing Limited}, 1791 petsc_uses = {KSP} 1792} 1793 1794@Article{ motrescurienen05, 1795 author = {V. C. Motrescu and U. van Rienen}, 1796 pages = {227--231}, 1797 volume = {3}, 1798 title = {Computation of currents induced by {ELF} electric fields in anisotropic human 1799 tissues using the Finite Integration Technique}, 1800 journal = {Advances in Radio Science}, 1801 year = {2005}, 1802 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 1803 petsc_uses = {KSP} 1804} 1805 1806@Article{ motrescurienen04, 1807 author = {V. C. Motrescu and U. van Rienen}, 1808 pages = {309--313}, 1809 volume = {2}, 1810 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 1811 Integration Technique (FIT)}, 1812 journal = {Advances in Radio Science}, 1813 year = {2004}, 1814 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 1815 petsc_uses = {KSP} 1816} 1817 1818@InProceedings{ dbl2, 1819 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 1820 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 1821 booktitle = {ECCOMAS2000}, 1822 year = {2000}, 1823 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 1824 petsc_uses = {KSP} 1825} 1826 1827@Unpublished{ cell, 1828 title = {Parallel Simulation Engines for Whole-Cell Models}, 1829 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 1830 Weber}, 1831 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 1832 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 1833 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 1834 year = {2001}, 1835 petsc_uses = {KSP} 1836} 1837 1838@Article{ barker2010two, 1839 title = {Two-level {N}ewton and hybrid {S}chwarz preconditioners for fluid-structure 1840 interaction}, 1841 author = {Barker, A.T. and Cai, X.C.}, 1842 journal = {SIAM Journal on Scientific Computing}, 1843 volume = {32}, 1844 number = {4}, 1845 pages = {2395--2417}, 1846 year = {2010}, 1847 publisher = {Society for Industrial and Applied Mathematics}, 1848 petsc_uses = {KSP} 1849} 1850 1851@Article{ barker2010scalable, 1852 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 1853 with application to blood flow modeling}, 1854 author = {Barker, A.T. and Cai, X.C.}, 1855 journal = {Journal of Computational Physics}, 1856 volume = {229}, 1857 number = {3}, 1858 pages = {642--659}, 1859 year = {2010}, 1860 publisher = {Elsevier}, 1861 petsc_uses = {KSP} 1862} 1863 1864@Article{ barker2009nks, 1865 title = {{NKS} for fully coupled fluid-structure interaction with application}, 1866 author = {Barker, A.T. and Cai, X.C.}, 1867 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 1868 pages = {275--282}, 1869 year = {2009}, 1870 publisher = {Springer}, 1871 petsc_uses = {KSP} 1872} 1873 1874@Article{ mirams2013, 1875 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 1876 and Yi Cui and Gary R Mirams}, 1877 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 1878 to predict {QT} interval changes in the rabbit ventricular wedge}, 1879 journal = {Journal of pharmacological and toxicological methods}, 1880 volume = {68}, 1881 number = {1}, 1882 pages = {88--96}, 1883 year = {2013}, 1884 doi = {10.1016/j.vascn.2013.04.004}, 1885 petsc_uses = {KSP} 1886} 1887 1888% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1889% LiteralHTML: <center><img alt="" 1890% LiteralHTML: src="images/spine0l.jpg"></center></p> 1891% LiteralHTML: <center><img alt="" 1892% LiteralHTML: src="images/vertebra.jpg"></center></p> 1893% LiteralHTML:<font color="#FF0000"> 1894% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 1895% LiteralHTML:Understanding bone mechanical properties and how they may lead to 1896% LiteralHTML:fractures is thus an important medical research activity. PETSc and 1897% LiteralHTML:Prometheus have been used for extremely large scale finite element 1898% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 1899% LiteralHTML:team of doctors and computational scientists. This computation was 1900% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 1901% LiteralHTML:with over 4000 processors.</p> 1902% LiteralHTML: </font> 1903@Article{ arbenz2008scalable, 1904 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 1905 analysis of human bone structures}, 1906 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 1907 journal = {International Journal for Numerical Methods in Engineering}, 1908 volume = {73}, 1909 number = {7}, 1910 pages = {927--947}, 1911 year = {2008}, 1912 publisher = {Wiley Online Library}, 1913 petsc_uses = {KSP} 1914} 1915 1916@InProceedings{ adams-04, 1917 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1918 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 1919 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 1920 half a billion degrees of freedom}, 1921 note = {Gordon Bell Award}, 1922 year = {2004}, 1923 petsc_uses = {KSP} 1924} 1925 1926@InProceedings{ adams-03b, 1927 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1928 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 1929 Whole Bone Micro-Mechanics on the {IBM SP}}, 1930 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 1931 year = {2003}, 1932 petsc_uses = {KSP} 1933} 1934 1935@InProceedings{ oghattas2002, 1936 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 1937 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 1938 booktitle = {Procceedings of SC2002}, 1939 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 1940 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 1941 by time-dependent PDEs, and scalability results for an inverse wave propagation 1942 problem of determining the material field of an acoustic medium. Using the 1943 algorithm, they solved a synthetic inverse wave propagation problem though a 1944 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 1945 processors.}, 1946 year = {2002}, 1947 petsc_uses = {KSP} 1948} 1949 1950% LiteralHTML: <a name="biology:cardiology"> 1951% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1952% LiteralHTML: <center><img alt="" 1953% LiteralHTML: src="images/heart.jpg"> 1954% LiteralHTML: <img alt="" 1955% LiteralHTML: src="images/pump.jpg"></center></p> 1956% LiteralHTML: 1957% LiteralHTML:<font color="#FF0000"> 1958% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 1959% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 1960% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 1961% LiteralHTML: through the heart. PETSc has been used by several research groups to 1962% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 1963% LiteralHTML: fully understand the developments of arrhthmias.</p> 1964% LiteralHTML:</font> 1965@InProceedings{ oghattas2000, 1966 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1967 Walkington}, 1968 title = {A Parallel Dynamic-Mesh {L}agrangian Method for Simulation of Flows with Dynamic 1969 Interfaces}, 1970 booktitle = {Procceedings of SC2000}, 1971 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1972 note = {Blood flow modeling at the microscale including effects on individual blood 1973 cells, for designing heart assist pumps, etc.}, 1974 year = {2000}, 1975 petsc_uses = {KSP} 1976} 1977 1978@InBook{ cfps2006, 1979 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1980 editor = {A. Quarteroni et al.}, 1981 title = {Complex Systems in Biomedicine}, 1982 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1983 publisher = {Springer-Verlag}, 1984 pages = {187--241}, 1985 year = {2006}, 1986 petsc_uses = {KSP} 1987} 1988 1989@InProceedings{ cfpst2007, 1990 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 1991 title = {Determining recovery times from transmembrane action potentials and unipolar 1992 electrograms in normal heart tissue}, 1993 booktitle = {FIMH07}, 1994 publisher = {Springer-Verlag}, 1995 volume = {4466}, 1996 pages = {139--149}, 1997 year = {2007}, 1998 petsc_uses = {KSP} 1999} 2000 2001@Article{ seemann2010framework, 2002 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 2003 Equations Using PETSc}}, 2004 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 2005 D{\\"o}ssel, O.}, 2006 journal = {Progress in Industrial Mathematics at ECMI 2008}, 2007 pages = {363--369}, 2008 year = {2010}, 2009 publisher = {Springer}, 2010 petsc_uses = {KSP} 2011} 2012 2013@InProceedings{ pft2005, 2014 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 2015 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 2016 Intramural Heterogeneity}, 2017 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 2018 pages = {267--277}, 2019 editors = {A. Frangi et al.}, 2020 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 2021 year = {2005}, 2022 petsc_uses = {KSP} 2023} 2024 2025@Article{ bgcp2005, 2026 author = {Boyce E. Griffith and Charles S. Peskin}, 2027 title = {On the order of accuracy of the immersed boundary method: Higher order 2028 convergence rates for sufficiently smooth problems}, 2029 journal = {Journal of Computational Physics}, 2030 year = {2005}, 2031 volume = {208}, 2032 pages = {75--105}, 2033 petsc_uses = {KSP} 2034} 2035 2036@Article{ griffith2007adaptive, 2037 title = {An adaptive, formally second order accurate version of the immersed boundary 2038 method}, 2039 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 2040 journal = {Journal of Computational Physics}, 2041 volume = {223}, 2042 number = {1}, 2043 pages = {10--49}, 2044 year = {2007}, 2045 publisher = {Elsevier}, 2046 petsc_uses = {KSP} 2047} 2048 2049@PhDThesis{ griffith05, 2050 author = {Boyce Griffith}, 2051 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 2052 parallel version of the immersed boundary method}, 2053 school = {New York University}, 2054 year = {2005}, 2055 petsc_uses = {KSP} 2056} 2057 2058@PhDThesis{ murillo, 2059 author = {Maria S. Murillo}, 2060 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 2061 Differential Equations with an Application in Computational Biology}, 2062 school = {University of Colorado at Boulder}, 2063 year = {2002}, 2064 petsc_uses = {KSP} 2065} 2066 2067@Article{ spv2004, 2068 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 2069 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 2070 journal = {IEEE Trans. Biomed. Eng}, 2071 year = {2004}, 2072 volume = {51}, 2073 pages = {1960--1968}, 2074 petsc_uses = {KSP} 2075} 2076 2077@Article{ vphl2003, 2078 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 2079 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 2080 journal = {J. Electrocardiol.}, 2081 year = {2003}, 2082 volume = {36}, 2083 pages = {69--74}, 2084 petsc_uses = {KSP} 2085} 2086 2087@InProceedings{ spbv2003, 2088 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and and E.J. Vigmond}, 2089 title = {Preconditioning Techniques for the Bidomain Equations}, 2090 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2091 Methods}, 2092 pages = {571--580}, 2093 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2094 note = {}, 2095 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2096 year = {2003}, 2097 petsc_uses = {KSP} 2098} 2099 2100@Article{ franz-pavir-04, 2101 author = {P. Colli Franzone and L.~F. Pavarino}, 2102 title = {A parallel solver for reaction-diffusion systems in computational 2103 electrocardiology}, 2104 journal = {Mathematical Models and Methods in Applied Sciences}, 2105 year = {2004}, 2106 volume = {14}, 2107 number = {6}, 2108 pages = {883--912}, 2109 petsc_uses = {KSP} 2110} 2111 2112@Article{ franz-pavir-05, 2113 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2114 title = {Simulating patterns of excitation, repolarization and action potential 2115 durationwith cardiac Bidomain and Monodomain models}, 2116 journal = {Mathematical Biosciences}, 2117 year = {2005}, 2118 volume = {197}, 2119 number = {1}, 2120 pages = {35--66}, 2121 petsc_uses = {KSP} 2122} 2123 2124@Article{ franz-pavir-06, 2125 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2126 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 2127 the dispersion of cardiac repolarization and action potential duration: a 2128 simulation study}, 2129 journal = {Mathematical Biosciences}, 2130 year = {2006}, 2131 volume = {204}, 2132 number = {1}, 2133 pages = {132--165}, 2134 petsc_uses = {KSP} 2135} 2136 2137@InProceedings{ colli-franz-sim, 2138 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 2139 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 2140 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 2141 Mediterranean Conference on Medical and Biological Engineering}, 2142 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 2143 year = {2004}, 2144 petsc_uses = {KSP} 2145} 2146 2147@InProceedings{ pf2003, 2148 author = {Luca F. Pavarino and Piero Colli Franzone}, 2149 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 2150 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2151 Methods}, 2152 pages = {669--776}, 2153 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2154 note = {}, 2155 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2156 year = {2003}, 2157 petsc_uses = {KSP} 2158} 2159 2160@Article{ maria-is04, 2161 author = {Maria Murillo and Xiao-Chuan Cai}, 2162 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 2163 activity of the heart}, 2164 journal = {Numerical Linear Algebra with Applications}, 2165 year = {2004}, 2166 volume = {11}, 2167 pages = {261 - 277}, 2168 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 2169 petsc_uses = {KSP} 2170} 2171 2172@Article{ murli2007monitoring, 2173 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 2174 Imaging in a Grid computing PSE}}, 2175 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 2176 and Lapegna, M.}, 2177 journal = {Grid-Based Problem Solving Environments}, 2178 pages = {421--432}, 2179 year = {2007}, 2180 publisher = {Springer}, 2181 petsc_uses = {KSP} 2182} 2183 2184@Article{ carracciuolo:2006:tpc, 2185 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 2186 title = {Towards a parallel component for imaging in {PETSc} programming environment: a case 2187 study in {3-D} echocardiography}, 2188 journal = {Parallel Comput.}, 2189 volume = {32}, 2190 issue = {1}, 2191 month = jan, 2192 year = {2006}, 2193 issn = {0167-8191}, 2194 pages = {67--83}, 2195 numpages = {17}, 2196 doi = {10.1016/j.parco.2005.09.001}, 2197 acmid = {1141218}, 2198 publisher = {Elsevier Science Publishers B. V.}, 2199 address = {Amsterdam, The Netherlands, The Netherlands}, 2200 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 2201 component}, 2202 petsc_uses = {KSP} 2203} 2204 2205@Article{ damore2011integration, 2206 title = {Integration of emerging computer technologies for an efficient image sequences 2207 analysis}, 2208 journal = {Integrated Computer-Aided Engineering }, 2209 volume = {18}, 2210 number = {4}, 2211 pages = {365 - 378}, 2212 year = {2011}, 2213 note = {}, 2214 issn = {1875-8835}, 2215 doi = {10.3233/ICA-2011-0382}, 2216 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 2217 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 2218 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 2219 petsc_uses = {KSP} 2220} 2221 2222@InProceedings{ eth_biwi_00721, 2223 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and and G. 2224 Székely}, 2225 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 2226 a {S}chur Complement Preconditioner}, 2227 booktitle = {Euro-Par 2009 Parallel Processing}, 2228 year = {2009}, 2229 month = aug, 2230 pages = {747-759}, 2231 volume = {5704}, 2232 editor = {H. Sips and D. Epema and and H.-X. Lin}, 2233 series = {Lecture Notes in Computer Science}, 2234 publisher = {Springer}, 2235 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 2236 parallel Krylov solver}, 2237 petsc_uses = {KSP} 2238} 2239 2240% LiteralHTML: <a name="biology:imagingandsurgery"> 2241% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 2242% LiteralHTML: <center><img alt="" 2243% LiteralHTML: src="images/brain.jpg"></center> 2244@Article{ ganser2004deformable, 2245 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 2246 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 2247 journal = {Medical Image Analysis}, 2248 volume = {8}, 2249 number = {1}, 2250 pages = {3--22}, 2251 year = {2004}, 2252 publisher = {Elsevier}, 2253 petsc_uses = {KSP} 2254} 2255 2256@Unpublished{ taccsurgery, 2257 title = {{TACC} supercomputer performs laser cancer surgery on canine}, 2258 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 2259 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 2260 Austin performed laser surgery on a dog in Houston without the intervention of a 2261 surgeon. The treatment was developed collaboratively by computational experts from 2262 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 2263 leading technologists from the M.D. Anderson Cancer Center in Houston, and 2264 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 2265 state-of-the-art thermal imaging technology, and advanced computational methods, 2266 dynamic, data-driven treatments are being pursued as a minimally invasive 2267 alternative to the standard treatment of cancer.}, 2268 petsc_uses = {KSP} 2269} 2270 2271@Article{ ffhbresso2008, 2272 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 2273 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 2274 Tinsley Oden}, 2275 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 2276 journal = {Engineering with Computers}, 2277 note = {Special issue on Computational Bioengineering}, 2278 year = {2008}, 2279 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 2280 petsc_uses = {KSP} 2281} 2282 2283@TechReport{ dobbhbbbdeffghkkps2008, 2284 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 2285 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 2286 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 2287 and S. Prudhomme and R. J. Stafford}, 2288 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 2289 Cancer}, 2290 year = {2008}, 2291 institution = {University of Texas at Austin}, 2292 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 2293 petsc_uses = {KSP} 2294} 2295 2296@Article{ ogdb2004, 2297 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 2298 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 2299 journal = {Physics in Medicine and Biology}, 2300 year = {2004}, 2301 volume = {49}, 2302 pages = {2955--2947}, 2303 petsc_uses = {KSP} 2304} 2305 2306@InProceedings{ majumdar11, 2307 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 2308 Baldridge and P. Krysl}, 2309 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 2310 booktitle = {ICCS 2005}, 2311 pages = {672--679}, 2312 editor = {V.S. Sunderam et al.}, 2313 year = {2005}, 2314 petsc_uses = {KSP} 2315} 2316 2317@Conference{ sermesant-etal:03, 2318 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 2319 Ayache, H.}, 2320 title = {A parallel implementation of non-rigid registration using a volumetric 2321 biomechanical model}, 2322 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 2323 address = {Philadelphia, PA, USA}, 2324 publisher = {Springer-Verlag}, 2325 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2326 series = {Lecture Notes in Computer Science}, 2327 volume = {2717}, 2328 pages = {398-407}, 2329 date = {june 23-24}, 2330 year = {2003}, 2331 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 2332 petsc_uses = {KSP} 2333} 2334 2335@Conference{ sermesant-etal:04, 2336 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 2337 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 2338 title = {A Novel Nonrigid Registration Algorithm And Applications}, 2339 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 2340 address = {Philadelphia, PA, USA}, 2341 publisher = {Springer-Verlag}, 2342 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2343 series = {Lecture Notes in Computer Science}, 2344 volume = {2208}, 2345 pages = {923}, 2346 year = {2003}, 2347 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 2348 petsc_uses = {KSP} 2349} 2350 2351@Article{ warfield-haker-talos-05, 2352 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 2353 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 2354 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 2355 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 2356 title = {Capturing intraoperative deformations: research experience at {B}righam and {W}omen's 2357 hospital}, 2358 journal = {Medical Image Analysis}, 2359 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 2360 year = {2005}, 2361 petsc_uses = {KSP} 2362} 2363 2364@Article{ brain3, 2365 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 2366 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 2367 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 2368 Deformation during Image Guided Neurosurgery}, 2369 journal = {Computing and Visualization in Science}, 2370 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 2371 year = {2002}, 2372 petsc_uses = {KSP} 2373} 2374 2375@Article{ brain2, 2376 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 2377 Kikinis and Simon K. Warfield}, 2378 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 2379 Element Biomechanical Model}, 2380 journal = {IEEE Transactions on Medical Imaging}, 2381 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 2382 year = {2001}, 2383 petsc_uses = {KSP} 2384} 2385 2386@InProceedings{ brain1, 2387 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 2388 Ferenc A. Jolesz and Ron Kikinis}, 2389 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 2390 Guided Neurosurgery}, 2391 booktitle = {Proceedings of SC2000}, 2392 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 2393 year = {2000}, 2394 petsc_uses = {KSP} 2395} 2396 2397@Article{ vanne06, 2398 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 2399 M. Lassas and M. Kalke}, 2400 title = {Parallelized {B}ayesian inversion for three-dimensional dental {X}-ray imaging}, 2401 journal = {IEEE Transactions on Medical Imaging}, 2402 volume = {25}, 2403 number = {2}, 2404 month = feb, 2405 year = {2006}, 2406 pages = {218--228}, 2407 petsc_uses = {KSP} 2408} 2409 2410@InProceedings{ knepleybardhan2015, 2411 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 2412 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 2413 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 2414 Exposition}, 2415 volume = {9}, 2416 pages = {V009T12A04}, 2417 doi = {10.1115/IMECE2015-53579}, 2418 year = {2015}, 2419 petsc_uses = {KSP} 2420} 2421 2422@InProceedings{ bardhanknepley2015, 2423 title = {Multiscale models and approximation algorithms for protein electrostatics}, 2424 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 2425 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 2426 volume = {61}, 2427 pages = {163--174}, 2428 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 2429 doi = {10.2495/BEM380131}, 2430 publisher = {WIT Press}, 2431 year = {2015}, 2432 petsc_uses = {KSP} 2433} 2434 2435% LiteralHTML: 2436% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 2437% LiteralHTML: 2438@InProceedings{ adamsbrennanknepleywang2022, 2439 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 2440 quench plasmas}, 2441 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 2442 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 2443 (IPDPS '22)}, 2444 doi = {10.1109/IPDPS53621.2022.00020}, 2445 year = {2022}, 2446 petsc_uses = {DMPlex} 2447} 2448 2449@Misc{ adamsknepleybrennan2021, 2450 title = {Runaway Electron Generation with High-Performance, Structure Preserving 2451 Discretization of {F}okker--{P}lank--{L}andau}, 2452 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 2453 year = {2021}, 2454 petsc_uses = {KSP} 2455} 2456 2457@Article{ adamshirvijokiknepleybrownisaacmills2017, 2458 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 2459 Architectures}, 2460 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 2461 Isaac and Richard Mills}, 2462 journal = {SIAM Journal on Scientific Computing}, 2463 volume = {39}, 2464 number = {6}, 2465 pages = {C452--C465}, 2466 doi = {10.1137/17M1118828}, 2467 eprint = {1702.08880}, 2468 year = {2017}, 2469 petsc_uses = {KSP} 2470} 2471 2472@Article{ pusztayknepleyadams2022, 2473 title = {Conservative Projection Between {FEM} and Particle Bases}, 2474 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 2475 journal = {SIAM Journal on Scientific Computing}, 2476 volume = {44}, 2477 number = {4}, 2478 pages = {C310--C319}, 2479 doi = {10.1137/21M145407}, 2480 year = {2022} 2481} 2482 2483@Article{ hirvijoki2017, 2484 author = {Eero Hirvijoki and Mark F. Adams}, 2485 title = {Conservative discretization of the {Landau} collision integral}, 2486 journal = {Physics of Plasmas}, 2487 volume = {24}, 2488 number = {3}, 2489 pages = {032121}, 2490 doi = {10.1063/1.4979122}, 2491 year = {2017}, 2492 petsc_uses = {KSP} 2493} 2494 2495@Article{ mollenadamsknepleyhagerchang2021, 2496 title = {Implementation of higher-order velocity mapping between marker particles and grid 2497 in the particle-in-cell code {XGC}}, 2498 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 2499 S. Chang}, 2500 journal = {Journal of Plasma Physics}, 2501 volume = {87}, 2502 number = {2}, 2503 pages = {905870229}, 2504 eprint = {2012.11764}, 2505 doi = {10.1017/S0022377821000441}, 2506 year = {2021}, 2507 petsc_uses = {KSP} 2508} 2509 2510@Article{ lsmh2014, 2511 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 2512 title = {Comparison of particle trajectories and collision operators for collisional 2513 transport in nonaxisymmetric plasmas}, 2514 journal = { Physics of Plasmas}, 2515 volume = {21}, 2516 year = {2014}, 2517 petsc_uses = {KSP} 2518} 2519 2520@Article{ lpcep2014, 2521 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 2522 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 2523 pedestal}, 2524 journal = {Plasma Physics and Controlled Fusion}, 2525 volume = {56}, 2526 year = {2014}, 2527 petsc_uses = {KSP} 2528} 2529 2530@Article{ facets-scidac08, 2531 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 2532 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 2533 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 2534 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 2535 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 2536 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 2537 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 2538 Stotler and A. Pigarov}, 2539 journal = {J. Phys.: Conf. Ser.}, 2540 volume = {125}, 2541 year = {2008}, 2542 pages = {012040}, 2543 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 2544 petsc_uses = {KSP} 2545} 2546 2547@Article{ facets-scidac09, 2548 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 2549 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 2550 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 2551 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 2552 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 2553 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 2554 and A. Pigarov and H. Zhang}, 2555 journal = {J. Phys.: Conf. Ser.}, 2556 volume = {180}, 2557 year = {2009}, 2558 pages = {012056}, 2559 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 2560 petsc_uses = {KSP} 2561} 2562 2563@InProceedings{ facets-scidac10, 2564 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 2565 {FACETS} Code}, 2566 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 2567 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 2568 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 2569 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 2570 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 2571 Pigarov and H. Zhang}, 2572 booktitle = {Proceedings of SciDAC 2010 Conference}, 2573 year = {2010}, 2574 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 2575 petsc_uses = {KSP} 2576} 2577 2578@InProceedings{ facets-fec2010, 2579 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 2580 the {FACETS} Framework}, 2581 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 2582 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 2583 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 2584 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 2585 Republic of Korea}, 2586 year = {2010}, 2587 petsc_uses = {KSP} 2588} 2589 2590@InProceedings{ facets-epdp2010, 2591 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 2592 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 2593 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 2594 Groebner and S. Balay and L. McInnes and H. Zhang}, 2595 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 2596 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 2597 year = {2010}, 2598 petsc_uses = {KSP} 2599} 2600 2601@Article{ carlssoncary09, 2602 author = {Johan Carlsson, John R. Cary}, 2603 title = {The hypersecant {J}acobian approximation for quasi-{N}ewton solves of sparse 2604 nonlinear systems}, 2605 journal = {arXiv}, 2606 year = {2009}, 2607 note = {http://arxiv.org/abs/0905.1054}, 2608 url = {http://arxiv.org/pdf/0905.1054v1}, 2609 petsc_uses = {KSP} 2610} 2611 2612@InProceedings{ oshahjs2006, 2613 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 2614 S.J. Janhunen and T.P. Kiviniemi}, 2615 title = {Performance enhancements to {ELMFIRE} gyrokinetic code leading to new ranges of 2616 application}, 2617 booktitle = {33rd EPS Conference on Plasma Phys.}, 2618 year = {2006}, 2619 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 2620 note = {European fusion code}, 2621 petsc_uses = {KSP} 2622} 2623 2624@Article{ zhu2006, 2625 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 2626 title = {Intermediate nonlinear evolution of the {P}arker instability: Formation of 2627 convection-induced discontinuities and absence of finite-time singularities}, 2628 journal = {Phys. Rev. Lett.}, 2629 volume = {96}, 2630 number = {065001}, 2631 year = {2006}, 2632 doi = {10.1103/PhysRevLett.96.065001}, 2633 petsc_uses = {KSP} 2634} 2635 2636@InProceedings{ ppc2005, 2637 author = {B. Philip and M. Pernice and L.Chacon}, 2638 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 2639 Refinement}, 2640 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 2641 methods}, 2642 year = {2005}, 2643 lab = {LANL}, 2644 petsc_uses = {KSP} 2645} 2646 2647@Article{ pp2005, 2648 author = {M. Pernice and B. Philip}, 2649 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 2650 Refinement}, 2651 year = {2005}, 2652 journal = {SIAM J. of Sci. Comput.}, 2653 lab = {LANL}, 2654 petsc_uses = {KSP} 2655} 2656 2657@Article{ gt2004, 2658 author = {A. H. Glasser and X. Z. Tang}, 2659 title = {The {SEL} macroscopic modeling code}, 2660 year = {2004}, 2661 journal = {Computer Physics Communications}, 2662 pages = {237--243}, 2663 volume = {164}, 2664 lab = {LANL}, 2665 petsc_uses = {KSP} 2666} 2667 2668@Article{ nl2006, 2669 author = {Y. Nishimura and Z.Lin}, 2670 title = {A finite element mesh in a tokamak edge geometry}, 2671 year = {2006}, 2672 journal = {Contributions to Plasma Physics}, 2673 volume = {22}, 2674 lab = {PPPL}, 2675 petsc_uses = {KSP} 2676} 2677 2678@Article{ nlle2004, 2679 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 2680 title = {A finite element {P}oisson solver for gyrokinetic particle simulations in a global 2681 field aligned mesh}, 2682 year = {2006}, 2683 journal = {J. Comput. Phys.}, 2684 volume = {214}, 2685 pages = {657}, 2686 lab = {PPPL}, 2687 petsc_uses = {KSP} 2688} 2689 2690@InProceedings{ lnlle2004, 2691 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 2692 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 2693 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2694 year = {2004}, 2695 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 2696 lab = {PPPL}, 2697 petsc_uses = {KSP} 2698} 2699 2700@InProceedings{ nlclew2004, 2701 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 2702 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 2703 model}, 2704 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2705 year = {2004}, 2706 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 2707 lab = {PPPL}, 2708 petsc_uses = {KSP} 2709} 2710 2711@Article{ tb1, 2712 author = {X.~Z.~Tang and A.~H.~Boozer}, 2713 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 2714 plasma}, 2715 journal = {Physics of Plasmas}, 2716 year = {2004}, 2717 pages = {171--185}, 2718 volume = {11}, 2719 lab = {LANL}, 2720 petsc_uses = {KSP} 2721} 2722 2723@Unpublished{ nlcw, 2724 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 2725 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 2726 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 2727 Albuquerque, New Mexico, October 2003}, 2728 year = {2003}, 2729 petsc_uses = {KSP} 2730} 2731 2732@TechReport{ tang2001, 2733 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 2734 Strauss}, 2735 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 2736 year = {2001}, 2737 institution = {Princeton Plasma Physics Laboratory}, 2738 number = {PPPL-3532}, 2739 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 2740 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 2741 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 2742 March 12-14, 2001.}, 2743 lab = {PPPL}, 2744 petsc_uses = {KSP} 2745} 2746 2747% LiteralHTML: 2748% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 2749% LiteralHTML: 2750@Article{ valerathomasgarciacastillo2019, 2751 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 2752 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 2753 Coastal Ocean Model}, 2754 journal = {Journal of Marine Science and Engineering}, 2755 volume = {7}, 2756 number = {6}, 2757 article-number= {185}, 2758 url = {https://www.mdpi.com/2077-1312/7/6/185}, 2759 issn = {2077-1312}, 2760 doi = {10.3390/jmse7060185}, 2761 year = {2019}, 2762 petsc_uses = {KSP} 2763} 2764 2765@Article{ furuichimat2015, 2766 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 2767 thermal convection simulation surrounded by free surface}, 2768 author = {Mikito Furuichi and Dave A May}, 2769 journal = {Computer Physics Communications}, 2770 volume = {192}, 2771 pages = {1--11}, 2772 year = {2015}, 2773 petsc_uses = {KSP} 2774} 2775 2776@Article{ sharplesmoresivelicjadamecmay2016, 2777 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 2778 model}, 2779 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 2780 Dave A May}, 2781 journal = {Physics of the Earth and Planetary Interiors}, 2782 volume = {252}, 2783 pages = {77--90}, 2784 year = {2016}, 2785 petsc_uses = {KSP} 2786} 2787 2788@Article{ spiegelmanmaywilson2016, 2789 title = {On the solvability of incompressible {S}tokes with viscoplastic rheologies in 2790 geodynamics}, 2791 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 2792 journal = {Geochemistry, Geophysics, Geosystems}, 2793 volume = {17}, 2794 number = {6}, 2795 pages = {2213--2238}, 2796 year = {2016}, 2797 petsc_uses = {KSP} 2798} 2799 2800@Article{ buiteretal2016, 2801 title = {Benchmarking numerical models of brittle thrust wedges}, 2802 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 2803 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 2804 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 2805 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 2806 journal = {Journal of structural geology}, 2807 volume = {92}, 2808 pages = {140--177}, 2809 year = {2016}, 2810 petsc_uses = {KSP} 2811} 2812 2813@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 2814 title = {Modular and flexible spectral-element waveform modelling in two and three 2815 dimensions}, 2816 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 2817 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 2818 journal = {Geophysical Journal International}, 2819 volume = {216}, 2820 number = {3}, 2821 pages = {1675--1692}, 2822 doi = {10.1093/gji/ggy469}, 2823 year = {2019}, 2824 petsc_uses = {KSP} 2825} 2826 2827@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 2828 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 2829 Modeling}, 2830 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 2831 Martin van Driel and Lion Krischer and Andreas Fichtner}, 2832 journal = {SIAM Journal on Scientific Computing}, 2833 volume = {43}, 2834 number = {2}, 2835 pages = {C127--C153}, 2836 eprint = {http://arxiv.org/abs/2004.08729}, 2837 doi = {10.1137/20M1332748}, 2838 year = {2021}, 2839 petsc_uses = {KSP} 2840} 2841 2842@Article{ parsani2021, 2843 title = {High-order accurate entropy-stable discontinuous collocated {G}alerkin methods with 2844 the summation-by-parts property for compressible {CFD} frameworks: Scalable {SSDC} 2845 algorithms and flow solver}, 2846 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 2847 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 2848 journal = {Journal of Computational Physics}, 2849 volume = {424}, 2850 pages = {109844}, 2851 issn = {0021-9991}, 2852 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 2853 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 2854 year = {2021}, 2855 petsc_uses = {KSP} 2856} 2857 2858@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 2859 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 2860 governed by {PDEs}}, 2861 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 2862 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 2863 journal = {SIAM Journal of Scientific Computing}, 2864 volume = {42}, 2865 number = {5}, 2866 pages = {A3397--A3426}, 2867 year = {2020} 2868} 2869 2870@Article{ zampinibouakaramturkiyyahkniokeyes2022, 2871 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 2872 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 2873 Keyes}, 2874 journal = {Advances on Computational Mathematics}, 2875 note = {In press}, 2876 year = {2022} 2877} 2878 2879@Article{ dassizampiniscacchi2022, 2880 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 2881 discretizations of elliptic equations in mixed form}, 2882 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 2883 journal = {Computer Methods in Applied Mechanics and Engineering}, 2884 volume = {391}, 2885 pages = {114620}, 2886 year = {2022} 2887} 2888 2889@Article{ youngoppenheimdimant2017, 2890 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 2891 title = {Hybrid simulations of coupled {F}arley-{B}uneman/gradient drift instabilities in the 2892 equatorial E region ionosphere}, 2893 journal = {Journal of Geophysical Research: Space Physics}, 2894 volume = {122}, 2895 number = {5}, 2896 issn = {2169-9402}, 2897 doi = {10.1002/2017JA024161}, 2898 pages = {5768--5781}, 2899 year = {2017}, 2900 petsc_uses = {KSP} 2901} 2902 2903@Article{ rioussetpatylillisfillingimenglandwithershale2013, 2904 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in {M}ars' 2905 dynamo region}, 2906 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 2907 and Scott L England and Paul G Withers and John P M Hale}, 2908 journal = {Journal of Geophysical Research: Space Physics}, 2909 volume = {118}, 2910 number = {6}, 2911 pages = {3647--3659}, 2912 year = {2013}, 2913 publisher = {Wiley Online Library}, 2914 petsc_uses = {KSP} 2915} 2916 2917@Article{ chien2016representation, 2918 title = {Representation of topography by partial steps using the immersed boundary method 2919 in a vector vorticity equation model (VVM)}, 2920 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 2921 journal = {Journal of Advances in Modeling Earth Systems}, 2922 year = {2016}, 2923 publisher = {Wiley Online Library}, 2924 petsc_uses = {KSP} 2925} 2926 2927@Article{ berger2015parallel, 2928 title = {Parallel preconditioners for monolithic solution of shear bands}, 2929 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 2930 journal = {Journal of Computational Physics}, 2931 year = {2015}, 2932 publisher = {Elsevier}, 2933 petsc_uses = {KSP} 2934} 2935 2936@Article{ may2015496, 2937 title = {A scalable, matrix-free multigrid preconditioner for finite element 2938 discretizations of heterogeneous {S}tokes flow }, 2939 journal = {Computer Methods in Applied Mechanics and Engineering }, 2940 volume = {290}, 2941 number = {0}, 2942 pages = {496--523}, 2943 year = {2015}, 2944 issn = {0045-7825}, 2945 doi = {10.1016/j.cma.2015.03.014}, 2946 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 2947 petsc_uses = {KSP} 2948} 2949 2950@Article{ isaacknepley2017, 2951 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 2952 author = {Tobin Isaac and Matthew G. Knepley}, 2953 journal = {ArXiv e-prints}, 2954 eprint = {1508.02470}, 2955 year = {2017}, 2956 note = {\url{http://arxiv.org/abs/1508.02470}}, 2957 petsc_uses = {DMPlex} 2958}} 2959 2960@Article{ knepleylangegorman2017, 2961 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 2962 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 2963 journal = {ArXiv e-prints}, 2964 eprint = {1506.06194}, 2965 year = {2017}, 2966 note = {\url{http://arxiv.org/abs/1506.06194}}, 2967 petsc_uses = {DMPlex} 2968} 2969 2970@Article{ langemitchellknepleygorman2015, 2971 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2972 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2973 journal = {SIAM Journal on Scientific Computing}, 2974 volume = {38}, 2975 number = {5}, 2976 pages = {S143--S155}, 2977 eprint = {http://arxiv.org/abs/1506.07749}, 2978 doi = {10.1137/15M1026092}, 2979 year = {2016}, 2980 petsc_uses = {DMPlex} 2981} 2982 2983@InProceedings{ langeknepleygorman2015, 2984 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 2985 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 2986 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 2987 month = apr, 2988 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 2989 year = {2015}, 2990 petsc_uses = {DMPlex} 2991} 2992 2993@InProceedings{ wallworkknepleybarralpiggott2022, 2994 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 2995 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 2996 Piggott}, 2997 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 2998 editor = {Trevor Robinson}, 2999 month = jan, 3000 address = {Seattle, WA}, 3001 pages = {1--5}, 3002 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 3003 year = {2022}, 3004 petsc_uses = {DMPlex} 3005} 3006 3007@InProceedings{ timalsinaknepley2023, 3008 title = {Tetrahedralization of a Hexahedral Mesh}, 3009 author = {Aman Timalsina and Matthew G. Knepley}, 3010 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 3011 year = {2023}, 3012 petsc_uses = {DMPlex} 3013} 3014 3015@Article{ farrellknepleywechsungmitchell2020, 3016 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 3017 methods}, 3018 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 3019 Wechsung}, 3020 journal = {ACM Transaction on Mathematical Software}, 3021 eprint = {http://arxiv.org/abs/1912.08516}, 3022 volume = {47}, 3023 number = {3}, 3024 pages = {1--22}, 3025 year = {2021}, 3026 petsc_uses = {KSP,DMPlex} 3027} 3028 3029@Article{ farrellmitchellscottwechsung2022, 3030 title = {Robust multigrid methods for nearly incompressible elasticity using macro 3031 elements}, 3032 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 3033 Wechsung}, 3034 journal = {IMA Journal of Numerical Analysis}, 3035 issn = {0272-4979}, 3036 doi = {10.1093/imanum/drab083}, 3037 url = {https://doi.org/10.1093/imanum/drab083}, 3038 year = {2022}, 3039 petsc_uses = {KSP,DMPlex} 3040} 3041 3042@Misc{ firedrakeproject, 3043 title = {{The {F}iredrake project}}, 3044 author = {David A Ham and Firedrake Team}, 3045 url = {http://firedrakeproject.org}, 3046 year = {2022}, 3047 petsc_uses = {KSP} 3048} 3049 3050@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 3051 title = {Firedrake: automating the finite element method by composing abstractions}, 3052 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 3053 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 3054 and Paul HJ Kelly}, 3055 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3056 volume = {43}, 3057 number = {3}, 3058 pages = {24}, 3059 year = {2016}, 3060 petsc_uses = {KSP} 3061} 3062 3063@Article{ mitchellmuller2016, 3064 title = {High level implementation of geometric multigrid solvers for finite element 3065 problems: Applications in atmospheric modelling}, 3066 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 3067 journal = {Journal of Computational Physics}, 3068 volume = {327}, 3069 pages = {1--18}, 3070 year = {2016}, 3071 petsc_uses = {KSP} 3072} 3073 3074@Article{ mcraeberceamitchellhamcotter2016, 3075 title = {Automated generation and symbolic manipulation of tensor product finite 3076 elements}, 3077 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 3078 and Colin J Cotter}, 3079 journal = {SIAM Journal on Scientific Computing}, 3080 volume = {38}, 3081 number = {5}, 3082 pages = {S25--S47}, 3083 year = {2016}, 3084 petsc_uses = {KSP} 3085} 3086 3087@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 3088 title = {A structure-exploiting numbering algorithm for finite elements on extruded 3089 meshes, and its performance evaluation in {Firedrake}}, 3090 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 3091 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 3092 journal = {Geoscientific Model Development}, 3093 volume = {9}, 3094 number = {10}, 3095 pages = {3803--3815}, 3096 doi = {10.5194/gmd-9-3803-2016}, 3097 year = {2016}, 3098 petsc_uses = {KSP} 3099} 3100 3101@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 3102 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 3103 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 3104 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 3105 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 3106 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 3107 publisher = {Springer Berlin Heidelberg}, 3108 pages = {279--289}, 3109 isbn = {978-3-642-38750-0}, 3110 doi = {10.1007/978-3-642-38750-0_21}, 3111 year = {2013}, 3112 petsc_uses = {KSP} 3113} 3114 3115@Article{ kirbymitchell2017, 3116 title = {Solver composition across the {PDE}/linear algebra barrier}, 3117 author = {Robert C Kirby and Lawrence Mitchell}, 3118 journal = {arXiv preprint arXiv:1706.01346}, 3119 year = {2017}, 3120 petsc_uses = {KSP} 3121} 3122 3123@Article{ saibaba2012application, 3124 title = {Application of hierarchical matrices to linear inverse problems in 3125 geostatistics}, 3126 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 3127 Peter K and Darve, Eric F}, 3128 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 3129 volume = {67}, 3130 number = {5}, 3131 pages = {857}, 3132 year = {2012}, 3133 petsc_uses = {KSP} 3134} 3135 3136@Article{ collignonkausmayfernandez14, 3137 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 3138 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 3139 journal = {Geochem Geophy Geosy}, 3140 year = {2014}, 3141 petsc_uses = {KSP} 3142} 3143 3144@Article{ fernandezkaus14, 3145 author = {Fern\'andez, N. and Kaus, B.}, 3146 title = {Fold interaction and wavelength selection in {3D} models of multilayer detachment 3147 folding}, 3148 journal = {Tectonophysics}, 3149 year = {2014}, 3150 petsc_uses = {KSP} 3151} 3152 3153@Article{ baumannkauspopov14, 3154 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 3155 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 3156 journal = {Tectonophysics}, 3157 year = {2014}, 3158 petsc_uses = {KSP} 3159} 3160 3161@Article{ lechmannschmalholzhetenyimaykaus14, 3162 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 3163 J. P.}, 3164 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 3165 of the modern {India-Asia} collisional system with {3-D} numerical models}, 3166 journal = { Journal of Geophysical Research - Solid Earth}, 3167 year = {2014}, 3168 petsc_uses = {KSP} 3169} 3170 3171@InBook{ fernandezkaus14b, 3172 author = {Fern\'andez N. and Kaus B.J.P.}, 3173 title = {Analytical and numerical investigation of {3D} multilayer detachment}, 3174 booktitle = {Mathematics of Planet Earth}, 3175 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 3176 and Dur\'an J.J. and Vargas-Guzman J.A.}, 3177 publisher = {Springer}, 3178 year = {2014}, 3179 petsc_uses = {KSP} 3180} 3181 3182@Article{ hossein-hsueh-etal-2014a, 3183 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 3184 journal = {J. Mech. Phys. Solids}, 3185 pages = {320--348}, 3186 title = {Effective toughness of heterogeneous media}, 3187 volume = {71}, 3188 year = {2014}, 3189 petsc_uses = {KSP} 3190} 3191 3192@Unpublished{ leon-baldelli-bourdin-2014a, 3193 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 3194 month = aug, 3195 note = {Submitted.}, 3196 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 3197 year = {2014}, 3198 petsc_uses = {KSP} 3199} 3200 3201@Article{ leon-baldelli-babadjian-etal-2013a, 3202 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 3203 Maurini, C.}, 3204 journal = {J. Mech. Phys. Solids}, 3205 pages = {15-32}, 3206 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 3207 volume = {70}, 3208 year = {2014}, 3209 petsc_uses = {KSP} 3210} 3211 3212@Article{ mesgarnejad-bourdin-etal-2014a, 3213 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 3214 journal = {Comp. Methods Appl. Mech. Engng.}, 3215 title = {Validation simulations for the variational approach to fracture}, 3216 volume = {Submitted}, 3217 year = {2014}, 3218 petsc_uses = {KSP} 3219} 3220 3221@InProceedings{ bourdin-chukwudozie-etal-2013a, 3222 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3223 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 3224 University, Stanford, CA}, 3225 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 3226 Fracturing Under In-Situ Stresses}, 3227 year = {2013}, 3228 petsc_uses = {KSP} 3229} 3230 3231@Article{ maurini-bourdin-etal-2012a, 3232 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 3233 journal = {Int. J. Fracture}, 3234 number = {1-2}, 3235 pages = {75-91}, 3236 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 3237 capillary tube: experiments and numerical simulations using a two-dimensional 3238 variational approach}, 3239 volume = {184}, 3240 year = {2013}, 3241 petsc_uses = {KSP} 3242} 3243 3244@Article{ mesgarnejad-bourdin-etal-2013a, 3245 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 3246 journal = {J. Mech. Phys Solids}, 3247 number = {11}, 3248 pages = {2360--2379}, 3249 title = {A variational approach to the fracture of brittle thin films under out of plane 3250 loading}, 3251 volume = {61}, 3252 year = {2013}, 3253 petsc_uses = {KSP} 3254} 3255 3256@InProceedings{ bourdin-chukwudozie-etal-2012a, 3257 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3258 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 3259 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 3260 volume = {SPE 159154}, 3261 year = {2012}, 3262 petsc_uses = {KSP} 3263} 3264 3265@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 3266 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 3267 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 3268 Langtangen}, 3269 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 3270 journal = {Advances in Water Resources}, 3271 volume = {51}, 3272 number = {0}, 3273 pages = {405--437}, 3274 year = {2013}, 3275 note = {35th Year Anniversary Issue}, 3276 issn = {0309-1708}, 3277 doi = {10.1016/j.advwatres.2012.05.008}, 3278 petsc_uses = {KSP} 3279} 3280 3281@Article{ scheltingamyerspietrzak10, 3282 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 3283 title = {A finite element sea ice model of the {C}anadian Arctic Archipelago}, 3284 journal = {Ocean Dynamics}, 3285 volume = {60}, 3286 number = {6}, 3287 pages = {1539-1558}, 3288 year = {2010}, 3289 issn = {1616-7341}, 3290 doi = {10.1007/s10236-010-0356-5}, 3291 publisher = {Springer-Verlag}, 3292 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 3293 Archipelago; Freshwater flux}, 3294 language = {English}, 3295 petsc_uses = {KSP} 3296} 3297 3298@InBook{ destefanoandreasisecchi13, 3299 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 3300 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 3301 inversions}, 3302 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 3303 chapter = {626}, 3304 pages = {3226--3230}, 3305 doi = {10.1190/segam2013-0244.1}, 3306 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 3307 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 3308 petsc_uses = {KSP} 3309} 3310 3311@Article{ pourhiethuetmaylabroussejolivet12, 3312 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 3313 title = {Kinematic interpretation of the {3D} shapes of metamorphic core complexes}, 3314 journal = {Geochem. Geophys. Geosyst.}, 3315 volume = {13}, 3316 pages = {Q09002}, 3317 year = {2012}, 3318 doi = {10.1029/2012GC004271}, 3319 petsc_uses = {KSP} 3320} 3321 3322@Article{ lechmannmaykausschmalholz11, 3323 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 3324 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 3325 collision}, 3326 journal = {Geophysical Journal International}, 3327 volume = {187}, 3328 pages = {10--33}, 3329 year = {2011}, 3330 doi = {10.1111/j.1365-246X.2011.05164.x}, 3331 petsc_uses = {KSP} 3332} 3333 3334@Article{ stefano:r69, 3335 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 3336 Virgilio and Fred F. Snyder}, 3337 collaboration = {}, 3338 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 3339 application to subsalt imaging}, 3340 publisher = {SEG}, 3341 year = {2011}, 3342 journal = {Geophysics}, 3343 volume = {76}, 3344 number = {3}, 3345 pages = {R69-R80}, 3346 keywords = {geophysical image processing; inverse problems; seismology}, 3347 doi = {10.1190/1.3554652}, 3348 petsc_uses = {KSP} 3349} 3350 3351@Article{ stefano:806, 3352 author = {Michele De Stefano}, 3353 collaboration = {}, 3354 title = {Simultaneous joint inversion for susceptibility and velocity}, 3355 publisher = {SEG}, 3356 year = {2011}, 3357 journal = {SEG Technical Program Expanded Abstracts}, 3358 volume = {30}, 3359 number = {1}, 3360 pages = {806-810}, 3361 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 3362 doi = {10.1190/1.3628198}, 3363 petsc_uses = {KSP} 3364} 3365 3366@Article{ mayknepley2011, 3367 author = {Dave A. May and Matthew G. Knepley}, 3368 title = {Optimal, scalable forward models for computing gravity anomalies}, 3369 journal = {Geophysical Journal International}, 3370 volume = {187}, 3371 number = {1}, 3372 pages = {161--177}, 3373 url = {http://arxiv.org/abs/1107.5951}, 3374 note = {\url{http://arxiv.org/abs/1107.5951}}, 3375 year = {2011}, 3376 petsc_uses = {KSP} 3377} 3378 3379@InProceedings{ bourdinknepleymaurini2010, 3380 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3381 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 3382 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 3383 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 3384 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 3385 address = {Stanford, CA}, 3386 year = {2010}, 3387 petsc_uses = {KSP} 3388} 3389 3390@InProceedings{ bourdinknepleymaurini2010b, 3391 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3392 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 3393 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 3394 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 3395 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 3396 address = {Sacramento, CA}, 3397 year = {2010}, 3398 petsc_uses = {KSP} 3399} 3400 3401@Article{ chen2007full, 3402 title = {Full {3D} tomography for the crustal structure of the {Los Angeles} region}, 3403 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 3404 journal = {Bulletin of the Seismological Society of America}, 3405 volume = {97}, 3406 number = {4}, 3407 pages = {1094}, 3408 year = {2007}, 3409 publisher = {Seismol Soc America}, 3410 petsc_uses = {KSP} 3411} 3412 3413@Article{ brown2010ens, 3414 author = {Brown, Jed}, 3415 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 3416 Zürich, Switzerland}, 3417 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 3418 journal = {Journal of Scientific Computing}, 3419 publisher = {Springer Netherlands}, 3420 issn = {0885-7474}, 3421 keyword = {Mathematics and Statistics}, 3422 pages = {48-63}, 3423 volume = {45}, 3424 issue = {1}, 3425 doi = {10.1007/s10915-010-9396-8}, 3426 year = {2010}, 3427 petsc_uses = {KSP} 3428} 3429 3430@PhDThesis{ brown2011, 3431 title = {Computational methods for ice flow simulation}, 3432 author = {Jed Brown}, 3433 school = {ETH Z{\"u}rich}, 3434 year = {2011}, 3435 petsc_uses = {KSP} 3436} 3437 3438@Article{ brown2013tmeice, 3439 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 3440 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 3441 journal = {SIAM Journal on Scientific Computing}, 3442 volume = {35}, 3443 number = {2}, 3444 year = {2013}, 3445 pages = {359--375}, 3446 doi = {10.1137/110834512}, 3447 note = {Also preprint ANL/MCS-P743-1298}, 3448 petsc_uses = {KSP} 3449} 3450 3451@InProceedings{ brown2013quasinewton, 3452 author = {Jed Brown and Peter Brune}, 3453 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 3454 methods}, 3455 year = {2013}, 3456 booktitle = {International Conference on Mathematics and Computational Methods Applied to 3457 Nuclear Science and Engineering}, 3458 pages = {2554--2565}, 3459 petsc_uses = {KSP} 3460} 3461 3462@Misc{ spiegelman-siampp10, 3463 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 3464 Earth Geodynamics}, 3465 author = {Marc Spiegelman}, 3466 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 3467 Computing}, 3468 year = {2010}, 3469 petsc_uses = {KSP} 3470} 3471 3472@Article{ schauer2011a, 3473 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 3474 Quintana-Ort\'{\i}}, 3475 title = {Large scale simulation of wave propagation in soils interacting with structures 3476 using {FEM} and {SBFEM}}, 3477 journal = {Journal of Computational Acoustics}, 3478 volume = {19}, 3479 number = {1}, 3480 pages = {75--93}, 3481 year = {2011}, 3482 doi = {10.1142/S0218396X11004316}, 3483 petsc_uses = {KSP} 3484} 3485 3486@Misc{ bsa2010, 3487 author = {J. Brown and B. Smith and A. Ahmadia}, 3488 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 3489 note = {submitted to SIAM Journal on Scientific Computing}, 3490 year = {2012}, 3491 petsc_uses = {KSP} 3492} 3493 3494@Article{ kellerkatz2016, 3495 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 3496 author = {Tobias Keller and Richard F. Katz}, 3497 journal = {Journal of Petrology}, 3498 doi = {10.1093/petrology/egw030}, 3499 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 3500 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 3501 year = {2016}, 3502 petsc_uses = {KSP} 3503} 3504 3505@Article{ weatherley12, 3506 author = {S. Weatherley and R.F. Katz}, 3507 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 3508 mantle}, 3509 journal = {Geochem.\ Geophys.\ Geosys.}, 3510 year = {2012}, 3511 volume = {13}, 3512 number = {1}, 3513 pages = {Q0AC18}, 3514 doi = {10.1029/2011GC003989}, 3515 petsc_uses = {KSP} 3516} 3517 3518@Article{ katz12, 3519 author = {R.F. Katz and S. Weatherley}, 3520 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 3521 journal = {Earth\ Planet.\ Sci.\ Lett.}, 3522 year = {2012}, 3523 doi = {10.1016/j.epsl.2012.04.042}, 3524 volume = {335-336}, 3525 pages = {226-237}, 3526 petsc_uses = {KSP} 3527} 3528 3529@Article{ katz10b, 3530 author = {R.F. Katz}, 3531 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 3532 journal = {Geochem.\ Geophys.\ Geosys.}, 3533 volume = {10}, 3534 number = {Q0AC07}, 3535 year = {2010}, 3536 doi = {10.1029/2010GC003282}, 3537 petsc_uses = {KSP} 3538} 3539 3540@Article{ england10, 3541 author = {P.C. England and R.F. Katz}, 3542 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 3543 journal = {Nature}, 3544 year = {2010}, 3545 volume = {467}, 3546 pages = {700--703}, 3547 doi = {10.1038/nature09417}, 3548 petsc_uses = {KSP} 3549} 3550 3551@Article{ weatherley10, 3552 author = {S. Weatherley and R.F. Katz}, 3553 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 3554 journal = {Geochem.\ Geophys.\ Geosys.}, 3555 year = {2010}, 3556 volume = {11}, 3557 number = {10}, 3558 doi = {10.1029/2010GC003192}, 3559 petsc_uses = {KSP} 3560} 3561 3562@Article{ katz10, 3563 author = {R.F. Katz and M.G. Worster}, 3564 title = {The stability of ice-sheet grounding lines}, 3565 journal = {Proc.~Roy.~Soc.~A}, 3566 year = {2010}, 3567 volume = {466}, 3568 pages = {1597--1620}, 3569 doi = {10.1098/rspa.2009.0434}, 3570 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 3571 petsc_uses = {KSP} 3572} 3573 3574@Article{ kyrkesmith2013stress, 3575 title = {Stress balances of ice streams in a vertically integrated, higher-order 3576 formulation}, 3577 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 3578 journal = {Journal of Glaciology}, 3579 volume = {59}, 3580 number = {215}, 3581 pages = {449--466}, 3582 year = {2013}, 3583 doi = {10.3189/2013JoG12J140}, 3584 petsc_uses = {KSP} 3585} 3586 3587@Article{ takei2013anisotropy1, 3588 author = {Takei Y. and R.F. Katz}, 3589 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 3590 Governing equations and linearised analysis}}, 3591 journal = {J.\ Fluid\ Mech.}, 3592 year = {2013}, 3593 volume = {734}, 3594 pages = {424-455}, 3595 doi = {10.1017/jfm.2013.482}, 3596 petsc_uses = {KSP} 3597} 3598 3599@Article{ katz2013anisotropy2, 3600 author = {Katz R.F. and Y. Takei}, 3601 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 3602 Numerical solutions of the full equations}}, 3603 journal = {J.\ Fluid\ Mech.}, 3604 year = {2013}, 3605 volume = {734}, 3606 pages = {456-485}, 3607 doi = {10.1017/jfm.2013.483}, 3608 petsc_uses = {KSP} 3609} 3610 3611@Article{ kyrke-smith2014subglacial, 3612 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 3613 title = {Subglacial hydrology and the formation of ice streams}, 3614 journal = {Proc.\ Roy.\ Soc.\ A}, 3615 year = {2014}, 3616 volume = {470}, 3617 number = {2161}, 3618 doi = {10.1098/rspa.2013.0494}, 3619 petsc_uses = {KSP} 3620} 3621 3622@Article{ spiegelmanwilsonvankeken2013, 3623 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 3624 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 3625 multi-physics problems in the solid Earth sciences}}, 3626 journal = {AGU Fall Meeting Abstracts}, 3627 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 3628 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 3629 year = {2013}, 3630 month = dec, 3631 pages = {A2208}, 3632 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 3633 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 3634 petsc_uses = {KSP} 3635} 3636 3637@Article{ bueler2009shallow, 3638 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 3639 ice sheet model}}, 3640 author = {Ed Bueler and Jed Brown}, 3641 journal = {Journal of Geophysical Research-Earth Surface}, 3642 volume = {114}, 3643 number = {F3}, 3644 pages = {F03008}, 3645 year = {2009}, 3646 publisher = {American Geophysical Union}, 3647 petsc_uses = {KSP} 3648} 3649 3650@Article{ bueler2007est, 3651 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 3652 effective tools for verification}}, 3653 author = {Ed Bueler and Jed Brown and Craig Lingle}, 3654 journal = {J. Glaciol}, 3655 volume = {53}, 3656 pages = {499--516}, 3657 year = {2007}, 3658 petsc_uses = {KSP} 3659} 3660 3661@Article{ bueler2007fcv, 3662 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 3663 simulations}}, 3664 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 3665 journal = {Ann. Glaciol}, 3666 volume = {46}, 3667 pages = {97--105}, 3668 year = {2007}, 3669 petsc_uses = {KSP} 3670} 3671 3672@Article{ bueler2005iso, 3673 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 3674 Latrice N. Bowman}, 3675 title = {Exact solutions and numerical verification for isothermal ice sheets}, 3676 journal = {J. Glaciol.}, 3677 volume = {51}, 3678 number = {173}, 3679 pages = {291--306}, 3680 year = {2005}, 3681 petsc_uses = {KSP} 3682} 3683 3684@Article{ chao2008programming, 3685 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 3686 author = {Chao-fan, Z. and Yao-lin, S.}, 3687 journal = {Earthquake}, 3688 year = {2008}, 3689 petsc_uses = {KSP} 3690} 3691 3692@Article{ marti2014, 3693 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 3694 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 3695 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 3696 title = {Full sphere hydrodynamic and dynamo benchmarks}, 3697 journal = {Geophysical Journal International}, 3698 year = {2014}, 3699 doi = {10.1093/gji/ggt518}, 3700 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 3701 petsc_uses = {KSP} 3702} 3703 3704@InProceedings{ ganfulukyangxueyang2013, 3705 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 3706 Guangwen}, 3707 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 3708 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 3709 Field-Programmable Custom Computing Machines}, 3710 series = {FCCM '13}, 3711 pages = {230--}, 3712 year = {2013}, 3713 isbn = {978-0-7695-4969-9}, 3714 doi = {10.1109/FCCM.2013.26}, 3715 acmid = {2495688}, 3716 publisher = {IEEE Computer Society}, 3717 petsc_uses = {KSP} 3718} 3719 3720@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 3721 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 3722 Xiaomeng Huang and Guangwen Yang}, 3723 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 3724 Conference on}, 3725 title = {A highly-efficient and green data flow engine for solving {E}uler atmospheric 3726 equations}, 3727 year = {2014}, 3728 month = sep, 3729 pages = {1-6}, 3730 doi = {10.1109/FPL.2014.6927462}, 3731 petsc_uses = {KSP} 3732} 3733 3734%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 3735%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 3736%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 3737@Article{ aagaardknepleywilliams13, 3738 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 3739 Models of Quasi-static and Dynamic Crustal Deformation}, 3740 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 3741 journal = {Journal of Geophysical Research: Solid Earth}, 3742 volume = {118}, 3743 number = {6}, 3744 pages = {3059--3079}, 3745 issn = {2169-9356}, 3746 doi = {10.1002/jgrb.50217}, 3747 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 3748 year = {2013}, 3749 petsc_uses = {KSP} 3750} 3751 3752@InProceedings{ aagaardknepleywilliams11, 3753 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3754 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3755 Deformation}, 3756 booktitle = {Eos Transactions of the AGU}, 3757 organization = {American Geophysical Union}, 3758 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 3759 year = {2011}, 3760 petsc_uses = {KSP} 3761} 3762 3763@InProceedings{ knepley10b, 3764 author = {Matthew G. {Knepley}}, 3765 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 3766 booktitle = {Eos Transactions of the AGU}, 3767 organization = {American Geophysical Union}, 3768 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 3769 year = {2010}, 3770 petsc_uses = {KSP} 3771} 3772 3773@InProceedings{ mayknepleygurnis09, 3774 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 3775 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 3776 booktitle = {Eos Transactions of the AGU}, 3777 organization = {American Geophysical Union}, 3778 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 3779 year = {2009}, 3780 petsc_uses = {KSP} 3781} 3782 3783@InProceedings{ yuenknepleyerlebacherwright09, 3784 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 3785 title = {The Coming Role of {GPU} in Computational Geodynamics}, 3786 booktitle = {Eos Transactions of the AGU}, 3787 organization = {American Geophysical Union}, 3788 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 3789 year = {2009}, 3790 petsc_uses = {KSP} 3791} 3792 3793@InProceedings{ aagaardknepleywilliams08, 3794 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 3795 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3796 Deformation}, 3797 booktitle = {Eos Transactions of the AGU}, 3798 organization = {American Geophysical Union}, 3799 volume = {89}, 3800 number = {53}, 3801 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 3802 year = {2007}, 3803 petsc_uses = {KSP} 3804} 3805 3806@InProceedings{ aagaardknepleywilliams07, 3807 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3808 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3809 Deformation}, 3810 booktitle = {Eos Transactions of the AGU}, 3811 organization = {American Geophysical Union}, 3812 volume = {88}, 3813 number = {52}, 3814 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 3815 year = {2007}, 3816 petsc_uses = {KSP} 3817} 3818 3819@InProceedings{ aagaardknepleywilliams05, 3820 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3821 title = {Development of software for studying earthquakes across multiple spatial and 3822 temporal scales by coupling quasi-static and dynamic simulations}, 3823 booktitle = {Eos Transactions of the AGU}, 3824 organization = {American Geophysical Union}, 3825 volume = {86}, 3826 number = {52}, 3827 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 3828 year = {2005}, 3829 petsc_uses = {KSP} 3830} 3831 3832@InProceedings{ williamsgablehagermeadeaagaardknepley08, 3833 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 3834 Brad Aagaard and Matthew G. Knepley}, 3835 title = {Modeling of Multiple Earthquake Cycles in {S}outhern {C}alifornia Using the {SCEC} 3836 Community Fault Model}, 3837 booktitle = {Proceedings of Geosciences '08}, 3838 address = {Wellington, NZ}, 3839 month = nov, 3840 year = {2008}, 3841 petsc_uses = {KSP} 3842} 3843 3844@TechReport{ zhang07, 3845 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 3846 Tsunamis}, 3847 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 3848 type = {Preprint}, 3849 number = {ANL/MCS-P1459-0907}, 3850 institution = {ANL}, 3851 month = sep, 3852 year = {2007}, 3853 petsc_uses = {KSP} 3854} 3855 3856@Article{ katz08b, 3857 author = {Richard F. Katz}, 3858 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 3859 focusing at mid-ocean ridges}, 3860 journal = {J. Petrology}, 3861 year = {2008}, 3862 volume = {49}, 3863 pages = {2099--2121}, 3864 doi = {10.1093/petrology/egn058}, 3865 petsc_uses = {KSP} 3866} 3867 3868@Article{ hgrhkjvv2008, 3869 title = {On preconditioning for a parallel solution of the {R}ichards equation}, 3870 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 3871 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 3872 journal = {Computers and Geosciences}, 3873 volume = {34}, 3874 pages = {1958--1963}, 3875 year = {2008}, 3876 petsc_uses = {KSP} 3877} 3878 3879@Article{ maymoresi2008, 3880 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 3881 computational geodynamics}, 3882 journal = {Physics of the Earth and Planetary Interiors}, 3883 volume = {171}, 3884 number = {1-4}, 3885 pages = {33--47}, 3886 year = {2008}, 3887 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 3888 Applications}, 3889 issn = {0031-9201}, 3890 doi = {10.1016/j.pepi.2008.07.036}, 3891 author = {Dave A. May and Louis Moresi}, 3892 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 3893 petsc_uses = {KSP} 3894} 3895 3896@Article{ kausmuhlhausmay2010, 3897 title = {A stabilization algorithm for geodynamic numerical simulations with a free 3898 surface}, 3899 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 3900 journal = {Physics of the Earth and Planetary Interiors}, 3901 volume = {181}, 3902 number = {1}, 3903 pages = {12--20}, 3904 year = {2010}, 3905 petsc_uses = {KSP} 3906} 3907 3908@Article{ duretzmaygeryatackley2011, 3909 title = {Discretization errors and free surface stabilization in the finite difference and 3910 marker-in-cell method for applied geodynamics: A numerical study}, 3911 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 3912 journal = {Geochemistry, Geophysics, Geosystems}, 3913 volume = {12}, 3914 number = {7}, 3915 year = {2011}, 3916 petsc_uses = {KSP} 3917} 3918 3919@Article{ furuichimaytackley2011, 3920 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 3921 {Schur} complement approach with mixed precision arithmetic}, 3922 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 3923 journal = {Journal of Computational Physics}, 3924 volume = {230}, 3925 number = {24}, 3926 pages = {8835--8851}, 3927 year = {2011}, 3928 petsc_uses = {KSP} 3929} 3930 3931@Article{ kellermaykaus2013, 3932 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 3933 lithosphere and crust}, 3934 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 3935 journal = {Geophysical Journal International}, 3936 volume = {195}, 3937 number = {3}, 3938 pages = {1406--1442}, 3939 year = {2013}, 3940 petsc_uses = {KSP} 3941} 3942 3943@Article{ schellartfreemanstegmanmoresimay2007, 3944 title = {Evolution and diversity of subduction zones controlled by slab width}, 3945 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 3946 May}, 3947 journal = {Nature}, 3948 volume = {446}, 3949 number = {7133}, 3950 pages = {308--311}, 3951 year = {2007}, 3952 petsc_uses = {KSP} 3953} 3954 3955@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 3956 title = {A comparison of numerical surface topography calculations in geodynamic 3957 modelling: an evaluation of the sticky air method}, 3958 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 3959 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 3960 journal = {Geophysical Journal International}, 3961 volume = {189}, 3962 number = {1}, 3963 pages = {38--54}, 3964 year = {2012}, 3965 petsc_uses = {KSP} 3966} 3967 3968@Article{ stegmanfreemanschellartmoresimay2006, 3969 title = {Influence of trench width on subduction hinge retreat rates in {3-D} models of slab 3970 rollback}, 3971 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 3972 May}, 3973 journal = {Geochemistry, Geophysics, Geosystems}, 3974 volume = {7}, 3975 number = {3}, 3976 year = {2006}, 3977 petsc_uses = {KSP} 3978} 3979 3980@InProceedings{ may2014ptatin, 3981 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 3982 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 3983 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 3984 Computing, Networking, Storage and Analysis}}, 3985 organization = {ACM}, 3986 pages = {274--284}, 3987 year = {2014}, 3988 doi = {10.1109/SC.2014.28}, 3989 petsc_uses = {KSP} 3990} 3991 3992@Article{ maybrownpourhiet2015, 3993 title = {A scalable, matrix-free multigrid preconditioner for finite element 3994 discretizations of heterogeneous {Stokes} flow}, 3995 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 3996 journal = {Computer Methods in Applied Mechanics and Engineering}, 3997 volume = {290}, 3998 pages = {496--523}, 3999 year = {2015}, 4000 doi = {10.1016/j.cma.2015.03.014}, 4001 petsc_uses = {KSP} 4002} 4003 4004@Article{ duretzmayyamato2016, 4005 title = {A free surface capturing discretization for the staggered grid finite difference 4006 scheme}, 4007 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 4008 journal = {Geophysical Journal International}, 4009 volume = {204}, 4010 number = {3}, 4011 pages = {1518--1530}, 4012 year = {2016}, 4013 petsc_uses = {KSP} 4014} 4015 4016@Article{ rhebergenwellskatzwathen2014, 4017 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 4018 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 4019 journal = {SIAM J. Sci. Comput.}, 4020 volume = {36}, 4021 pages = {A1960--A1977}, 4022 year = {2014}, 4023 petsc_uses = {KSP} 4024} 4025 4026@Article{ katz08a, 4027 author = {R.F. Katz and M.G. Worster}, 4028 title = {Simulation of directional solidification, thermochemical convection, and chimney 4029 formation in a {H}ele-{S}haw cell}, 4030 journal = {J. Comp. Phys.}, 4031 volume = {227}, 4032 pages = {9823-9840}, 4033 year = {2008}, 4034 doi = {10.1016/j.jcp.2008.06.039}, 4035 petsc_uses = {KSP} 4036} 4037 4038@Article{ aabg2007, 4039 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 4040 title = {Full waveform inversion for seismic velocity and anelastic losses in 4041 heterogeneous structures}, 4042 journal = {Bulletin of Seismological Society of America}, 4043 year = {2007}, 4044 volume = {97}, 4045 pages = {1990--2008}, 4046 petsc_uses = {KSP} 4047} 4048 4049@Article{ katz2006, 4050 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 4051 title = {The dynamics of melt and shear localization in partially molten aggregates}, 4052 journal = {Nature}, 4053 year = {2006}, 4054 volume = {442}, 4055 pages = {676--679}, 4056 month = aug, 4057 day = {10}, 4058 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 4059 petsc_uses = {KSP} 4060} 4061 4062@InProceedings{ mqrs2003, 4063 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 4064 year = {2003}, 4065 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 4066 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 4067 Sozopol, Bulgaria, June 4-8, 2003}, 4068 petsc_uses = {KSP} 4069} 4070 4071@InProceedings{ lichtner1, 4072 author = {Chuan Lu and Peter C. Lichtner}, 4073 year = {2005}, 4074 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 4075 Geologic Media}, 4076 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 4077 lab = {LANL}, 4078 petsc_uses = {KSP} 4079} 4080 4081@Article{ hammondlichtnermills2014, 4082 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 4083 Example with {PFLOTRAN}}, 4084 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 4085 journal = {Water Resources Research}, 4086 volume = {50}, 4087 number = {1}, 4088 pages = {208--228}, 4089 doi = {10.1002/2012WR013483}, 4090 year = {2014}, 4091 petsc_uses = {KSP} 4092} 4093 4094@Article{ smw2003, 4095 author = {R. Scheichl and R. Masson and J. Wendebourg}, 4096 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 4097 journal = {Computational Geosciences}, 4098 year = {2003}, 4099 volume = {7}, 4100 pages = {295--318}, 4101 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 4102 petsc_uses = {KSP} 4103} 4104 4105@Article{ kees-miller-03, 4106 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 4107 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 4108 journal = {Computational Geosciences}, 4109 year = {2003}, 4110 volume = {7}, 4111 pages = {91--114}, 4112 petsc_uses = {KSP} 4113} 4114 4115@Article{ bk2003, 4116 author = {JN Buur and T Kuehnel}, 4117 title = {Improving depth imaging by automated model updating}, 4118 journal = {The Leading Edge}, 4119 year = {2003}, 4120 volume = {22}, 4121 pages = {310-318}, 4122 petsc_uses = {KSP} 4123} 4124 4125@Article{ frederickbuffett2016, 4126 title = {Submarine groundwater discharge as a possible formation mechanism for 4127 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 4128 author = {Jennifer M. Frederick and Bruce A. Buffett}, 4129 journal = {Journal of Geophysical Research: Solid Earth}, 4130 volume = {121}, 4131 number = {3}, 4132 pages = {1383--1404}, 4133 issn = {2169-9356}, 4134 doi = {10.1002/2015JB012627}, 4135 year = {2016}, 4136 petsc_uses = {KSP} 4137} 4138 4139% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4140% LiteralHTML:<font color="#FF0000"> 4141% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 4142% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 4143% LiteralHTML:variety of these simulations.</p> 4144% LiteralHTML:</font> 4145% LiteralHTML: 4146@InProceedings{ appelbe1, 4147 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4148 year = {2003}, 4149 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 4150 computational methodology}, 4151 page = {781}, 4152 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 4153 Proceedings}, 4154 publisher = {Springer-Verlag}, 4155 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 4156 petsc_uses = {KSP} 4157} 4158 4159% LiteralHTML:<a name="katz"> 4160@InProceedings{ gd1, 4161 author = {Guillaume Dumont and Michel Kern}, 4162 title = {Parallelization of a {3D} Seismic Migration Code with {PETSc}}, 4163 year = {1999}, 4164 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 4165 Computing}, 4166 petsc_uses = {KSP} 4167} 4168 4169% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 4170% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 4171% LiteralHTML:<font color="#FF0000"> 4172% LiteralHTML: Figures from the work of Richard Katz 4173@PhDThesis{ katzthesis, 4174 author = {R.F. Katz}, 4175 title = {The deep roots of volcanoes: models of magma dynamics with applications to 4176 subduction zones}, 4177 school = {Columbia University}, 4178 year = {2005}, 4179 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 4180 petsc_uses = {KSP} 4181} 4182 4183@InCollection{ knepleykatzsmith06, 4184 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 4185 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 4186 USA}, 4187 title = {Developing a Geodynamics Simulator with {PETSc}}, 4188 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 4189 series = {Lecture Notes in Computational Science and Engineering}, 4190 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 4191 publisher = {Springer Berlin Heidelberg}, 4192 isbn = {978-3-540-31619-0}, 4193 keyword = {Mathematics and Statistics}, 4194 pages = {413-438}, 4195 volume = {51}, 4196 doi = {10.1007/3-540-31619-1_12}, 4197 year = {2006}, 4198 petsc_uses = {KSP} 4199} 4200 4201@Article{ katz04, 4202 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 4203 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 4204 the global mid-ocean ridge system}, 4205 journal = {Geophys.\ Res.\ Letts.}, 4206 year = {2004}, 4207 volume = {31}, 4208 pages = {L15605}, 4209 petsc_uses = {KSP} 4210} 4211 4212@Article{ katz07, 4213 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 4214 Ethan Coon}, 4215 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 4216 Toolkit for Scientific Computation}}, 4217 journal = {Phys. Earth Planet. In.}, 4218 volume = {163}, 4219 pages = {52--68}, 4220 year = {2007}, 4221 petsc_uses = {KSP} 4222} 4223 4224@Article{ williams2006development, 4225 title = {{Development of a package for modeling stress in the lithosphere}}, 4226 author = {Williams, CA}, 4227 journal = {Eos Trans. AGU}, 4228 volume = {87}, 4229 pages = {36}, 4230 year = {2006}, 4231 petsc_uses = {KSP} 4232} 4233 4234@Article{ goverswortel05, 4235 author = {R. Govers and M.J.R. Wortel}, 4236 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 4237 journal = {Earth and Planetary Science Letters}, 4238 volume = {236/1-2}, 4239 pages = {505-523}, 4240 year = {2005}, 4241 petsc_uses = {KSP} 4242} 4243 4244@InProceedings{ snark2, 4245 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4246 year = {2002}, 4247 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 4248 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 4249 petsc_uses = {KSP} 4250} 4251 4252@Article{ snark1, 4253 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 4254 Tan and Feng Wang}, 4255 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 4256 journal = {Submitted to Pure and Applied Geosciences}, 4257 petsc_uses = {KSP} 4258} 4259 4260@InProceedings{ earthquake2003, 4261 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 4262 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 4263 Tiankai Tu}, 4264 year = {2003}, 4265 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 4266 booktitle = {Proceedings of SC2003}, 4267 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 4268 petsc_uses = {KSP} 4269} 4270 4271@InProceedings{ stefano12, 4272 author = {Michele De Stefano}, 4273 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 4274 booktitle = {PIERS Proceedings}, 4275 month = aug, 4276 address = {Moscow, RUSSIA}, 4277 pages = {491--495}, 4278 year = {2012}, 4279 petsc_uses = {KSP} 4280} 4281 4282%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 4283 4284% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4285% LiteralHTML: <center><img alt="" 4286% LiteralHTML: src="images/ocean.jpg"></center></p> 4287@Article{ khatiwala07, 4288 author = {Khatiwala, S.}, 4289 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 4290 journal = {Glob. Biogeochem. Cycles}, 4291 volume = {21}, 4292 doi = {10.1029/2007GB002923}, 4293 year = {2007}, 4294 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 4295} 4296 4297@Article{ dks2004, 4298 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 4299 journal = {Ocean Modelling}, 4300 year = {2004}, 4301 volume = {6(2)}, 4302 pages = {125-150}, 4303 title = {A finite-element Ocean Model: Principles and Evaluation}, 4304 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 4305 petsc_uses = {KSP} 4306} 4307 4308@Article{ danilov1, 4309 author = {S. Danilov and G. Kivman and J. Schroter}, 4310 year = {2004}, 4311 title = {Evaluation of an eddy-permitting finite-element ocean model in the {N}orth 4312 {A}tlantic}, 4313 journal = {Ocean Modelling}, 4314 petsc_uses = {KSP} 4315} 4316 4317@Article{ nerger1, 4318 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 4319 year = {2004}, 4320 title = {Data Assimilation with the Ensemble {K}alman Filter and the {SEIK} Filter applied to 4321 a Finite Element Model of the {N}orth {A}tlantic}, 4322 journal = {Journal of marine systems}, 4323 petsc_uses = {KSP} 4324} 4325 4326@Conference{ rakowsky2003self, 4327 title = {{A self-adaptive finite element model of the atmosphere}}, 4328 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 4329 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 4330 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 4331 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 4332 pages = {279}, 4333 isbn = {981238376X}, 4334 year = {2003}, 4335 organization = {World Scientific Pub Co}, 4336 petsc_uses = {KSP} 4337} 4338 4339@Article{ lauter3, 4340 author = {M. Lauter}, 4341 year = {2004}, 4342 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4343 AtmosphArenmodell}, 4344 journal = {Berichte zur Polar- und Meeresforschung}, 4345 petsc_uses = {KSP} 4346} 4347 4348@Article{ lauter2, 4349 author = {M. Lauter and D. Handorf and K. Dethloff}, 4350 year = {2004}, 4351 title = {Unsteady analytical solutions of the spherical shallow water equations}, 4352 journal = {Journal of computational physics}, 4353 petsc_uses = {KSP} 4354} 4355 4356@PhDThesis{ lauter1, 4357 author = {M. Lauter}, 4358 year = {2004}, 4359 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4360 AtmosphArenmodell}, 4361 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 4362 petsc_uses = {KSP} 4363} 4364 4365@Article{ frickenhaus1, 4366 author = {S. Frickenhaus and W. Hiller and M. Best}, 4367 year = {2005}, 4368 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 4369 parallel numerical atmosphere and ocean models}, 4370 journal = {Ocean Modelling}, 4371 volume = {10}, 4372 pages = {185--191}, 4373 petsc_uses = {KSP} 4374} 4375 4376@Article{ 0266-5611-24-3-034015, 4377 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 4378 title = {A {N}ewton-{CG} method for large-scale three-dimensional elastic full-waveform 4379 seismic inversion}, 4380 journal = {Inverse Problems}, 4381 volume = {24}, 4382 number = {3}, 4383 pages = {034015 (26pp)}, 4384 url = {http://stacks.iop.org/0266-5611/24/034015}, 4385 year = {2008}, 4386 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 4387 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 4388 iterations with inner conjugate gradient linear iterations, globalized by an 4389 Armijo backtracking line search, solved on a sequence of finer grids and higher 4390 frequencies to remain in the vicinity of the global optimum, inexactly terminated 4391 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 4392 variation operator to capture sharp interfaces, finely discretized by finite 4393 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 4394 implemented in matrix-free fashion with adjoint-based computation of reduced 4395 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 4396 waveform storage, and partitioned spatially across processors to parallelize the 4397 solutions of the forward and adjoint wave equations and the evaluation of 4398 gradient-like information. Several numerical examples demonstrate the grid 4399 independence of linear and nonlinear iterations, the effectiveness of the 4400 preconditioner, the ability to solve inverse problems with up to 17 million 4401 inversion parameters on up to 2048 processors, the effectiveness of multiscale 4402 continuation in keeping iterates in the basin of attraction of the global minimum, 4403 and the ability to fit the observational data while reconstructing the model with 4404 reasonable resolution and capturing sharp interfaces.}, 4405 petsc_uses = {KSP} 4406} 4407 4408% LiteralHTML: 4409% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 4410% LiteralHTML: 4411% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4412% LiteralHTML:<font color="#FF0000"> 4413% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 4414% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 4415% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 4416% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 4417% LiteralHTML:for a variety of these simulations.</p> 4418% LiteralHTML:</font> 4419% LiteralHTML: 4420@Article{ mills2009modeling, 4421 title = {Modeling subsurface reactive flows using leadership-class computing}, 4422 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4423 Mahinthakumar, G.K. and Smith, B.F.}, 4424 journal = {Journal of Physics: Conference Series}, 4425 volume = {180}, 4426 pages = {012062}, 4427 year = {2009}, 4428 publisher = {IOP Publishing}, 4429 petsc_uses = {KSP} 4430} 4431 4432@Conference{ mills2007simulating, 4433 title = {{Simulating subsurface flow and transport on ultrascale computers using 4434 PFLOTRAN}}, 4435 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 4436 booktitle = {Journal of Physics: Conference Series}, 4437 volume = {78}, 4438 pages = {012051}, 4439 year = {2007}, 4440 organization = {IOP Publishing}, 4441 petsc_uses = {KSP} 4442} 4443 4444@InProceedings{ mills2009, 4445 title = {Modeling subsurface reactive flows using leadership-class computing}, 4446 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4447 Mahinthakmuar, G. and Smith, B.}, 4448 booktitle = {Journal of Physics: Conference Series}, 4449 volume = {180}, 4450 pages = {102062}, 4451 year = {2009}, 4452 organization = {IOP Publishing}, 4453 petsc_uses = {KSP} 4454} 4455 4456@Article{ guo2013parallel, 4457 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 4458 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 4459 }, 4460 journal = {Advances in Water Resources }, 4461 volume = {53}, 4462 number = {0}, 4463 pages = {101 - 108}, 4464 year = {2013}, 4465 note = {}, 4466 issn = {0309-1708}, 4467 doi = {10.1016/j.advwatres.2012.10.010}, 4468 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 4469 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 4470 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 4471 preconditioner}, 4472 petsc_uses = {KSP} 4473} 4474 4475@Unpublished{ stomp, 4476 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 4477 url = {http://stomp.pnl.gov/}, 4478 petsc_uses = {KSP} 4479} 4480 4481@InProceedings{ htfc2003, 4482 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 4483 title = {Methods and Experiences For Parallelizing Flood Models}, 4484 year = {2003}, 4485 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 4486 European PVM/MPI User's Group Meeting}, 4487 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 4488 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 4489 petsc_uses = {KSP} 4490} 4491 4492@InProceedings{ hulchy-tran-astalos-fmsip, 4493 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 4494 D.Froehlich}, 4495 title = {Flood Modeling System and Its Parallelization}, 4496 year = {2002}, 4497 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 4498 Engineering}, 4499 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 4500 petsc_uses = {KSP} 4501} 4502 4503@InProceedings{ gy1, 4504 author = {J. P. Gwo and G. T. Yeh}, 4505 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 4506 Transport at Watershed Scale}, 4507 year = {2004}, 4508 booktitle = {The International Conference on Computational Methods}, 4509 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 4510 petsc_uses = {KSP} 4511} 4512 4513@Conference{ cheng2009efficient, 4514 title = {{An efficient parallel method for large-scale groundwater flow equation based on 4515 PETSc}}, 4516 author = {Cheng, T. and Ji, X. and Wang, Q.}, 4517 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 4518 Conference on}, 4519 pages = {190--193}, 4520 organization = {IEEE}, 4521 petsc_uses = {KSP} 4522} 4523 4524@Unpublished{ sfrsm, 4525 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 4526 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 4527 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 4528 its linear solves}, 4529 petsc_uses = {KSP} 4530} 4531 4532% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4533@InProceedings{ bart_omar:sc05, 4534 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 4535 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 4536 title = {Dynamic data driven inversion for terascale simulations: real-time 4537 indentification of airborne contaminants}, 4538 booktitle = {Proceedings of SC2005}, 4539 organization = {IEEE/ACM}, 4540 address = {Seattle, WA}, 4541 year = {2005}, 4542 month = nov, 4543 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 4544 lab = {SNL}, 4545 petsc_uses = {KSP} 4546} 4547 4548@InProceedings{ anton-krassimir-lscc, 4549 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 4550 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 4551 Simulations}, 4552 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 4553 volume = {2907}, 4554 year = {2003}, 4555 publisher = {Springer-Verlag}, 4556 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 4557 petsc_uses = {KSP} 4558} 4559 4560@InProceedings{ aa2001, 4561 author = {Anton Antonov}, 4562 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 4563 year = {2001}, 4564 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 4565 Sozopol, Bulgaria}, 4566 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 4567 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 4568 petsc_uses = {KSP} 4569} 4570 4571% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4572@Article{ grassley-simmons-kercher-00, 4573 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 4574 year = {2000}, 4575 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 4576 reactive transport models}, 4577 journal = {Applied Geochemistry}, 4578 volume = {17}, 4579 pages = {699--708}, 4580 lab = {LLNL} 4581} 4582 4583@Article{ glassey-nitao-03, 4584 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 4585 and Carl I. Steefel and James R. Kercher}, 4586 year = {2003}, 4587 title = {The impact of climate change on vadose zone pore waters and its implication for 4588 long-term monitoring}, 4589 journal = {Computers and Geosciences}, 4590 volume = {29}, 4591 pages = {399-411}, 4592 lab = {LLNL}, 4593 petsc_uses = {KSP} 4594} 4595 4596@Article{ steefel-depaolo-lichtner-05, 4597 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 4598 year = {2005}, 4599 title = {Reactive transport modeling: An essential tool and a new research approach for 4600 the Earth sciences}, 4601 journal = {Earth and Planetary Science Letters}, 4602 lab = {LLNL,LANL}, 4603 petsc_uses = {KSP} 4604} 4605 4606% LiteralHTML:<a name="scalinglarge"> 4607% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4608% LiteralHTML: <center><img alt="" 4609% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 4610% LiteralHTML:<font color="#FF0000"> 4611% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 4612@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 4613 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 4614 Strategies for Large-Scale Numerical Simulations}, 4615 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 4616 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 4617 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 4618 Large-Scale Systems (scalA)}, 4619 pages = {65-72}, 4620 doi = {10.1109/ScalA.2018.00012}, 4621 month = nov, 4622 year = {2018}, 4623 petsc_uses = {KSP} 4624} 4625 4626@Article{ km2004, 4627 author = {A. Keese and H. G. Matthies}, 4628 journal = {Computers and Structures}, 4629 year = {2005}, 4630 volume = {83}, 4631 pages = {1033--1047}, 4632 title = {Hierarchical parallelisation for the solution of stochastic finite element 4633 equations}, 4634 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 4635 petsc_uses = {KSP} 4636} 4637 4638@Unpublished{ hvl2002, 4639 title = {Numerical Modeling of {NAPL} Source Zone Treatment}, 4640 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 4641 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 4642 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 4643 year = {2002}, 4644 lab = {LANL}, 4645 petsc_uses = {KSP} 4646} 4647 4648@PhDThesis{ hammond2003, 4649 author = {Glenn E. Hammond}, 4650 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 4651 Transport on Supercomputers}, 4652 school = {University of Illinois at Urbana-Champaign}, 4653 year = {2003}, 4654 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 4655 petsc_uses = {KSP} 4656} 4657 4658@Unpublished{ uk, 4659 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 4660 Scale Environmental Flows and Transport Processes}, 4661 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 4662 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 4663 buildings and in Green Bay. Used PETSc for its linear solvers}, 4664 year = {1999}, 4665 petsc_uses = {KSP} 4666} 4667 4668@InProceedings{ hammond2002, 4669 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 4670 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 4671 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 4672 year = {2002}, 4673 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 4674 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 4675 Resources, Delft, The Netherlands.}, 4676 lab = {LANL}, 4677 petsc_uses = {KSP} 4678} 4679 4680@TechReport{ steefel1, 4681 author = {C. I. Steefel}, 4682 title = {Software for modeling multicomponent, multidimensional reactive transport}, 4683 year = {2001}, 4684 institution = {Lawrence Livermore National Laboratory}, 4685 number = {UCRL-MA-143182}, 4686 lab = {LLNL}, 4687 petsc_uses = {KSP} 4688} 4689 4690@Article{ steefel2, 4691 author = {C. I. Steefel and A. C. Lasaga}, 4692 title = {A coupled model for transport of multiple chemical-species and kinetic 4693 precipitation dissolution reactions with application to reactive flow in 4694 single-phase hydrothermal systems}, 4695 journal = {Americal Journal of Science}, 4696 year = {1994}, 4697 pages = {529-592}, 4698 volume = {294}, 4699 number = {5}, 4700 petsc_uses = {KSP} 4701} 4702 4703@TechReport{ steefel3, 4704 author = {C. I. Steefel and S. B. Yabusaki}, 4705 title = {{OS3D/GIMRT}, Software for Multicomponent-Multidimensional reactive transport: 4706 User's manual and programmer's guide}, 4707 year = {1996}, 4708 institution = {Pacific Northwest National Laboratory}, 4709 number = {PNNL-11166}, 4710 lab = {PNNL}, 4711 petsc_uses = {KSP} 4712} 4713 4714@Article{ 2005hvl, 4715 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 4716 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 4717 preconditioning to biogeochemical transport}, 4718 journal = {Advances in Water Resources}, 4719 year = {2005}, 4720 pages = {359--376}, 4721 volume = {28}, 4722 url = { 4723 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 4724 lab = {LANL}, 4725 petsc_uses = {KSP} 4726} 4727 4728@Article{ wang-zabar-05, 4729 author = {J Wang and N Zabaras}, 4730 journal = {Int. J. Heat and Mass Transfer}, 4731 title = {A Markov random field model of contamination source identification in porous 4732 media flow}, 4733 year = {2005}, 4734 petsc_uses = {KSP} 4735} 4736 4737@InBook{ kp1, 4738 author = {Jong G. Kim and Hyoung W. Park}, 4739 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 4740 Media}, 4741 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 4742 title = {Lecture Notes in Computer Science}, 4743 publisher = {Springer-Verlag}, 4744 volume = {3044}, 4745 year = {2004}, 4746 petsc_uses = {KSP} 4747} 4748 4749@Article{ 2001agusm...h32a06k, 4750 author = {{Kim}, J.~G. and {Kim}, J.}, 4751 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 4752 journal = {AGU Spring Meeting Abstracts}, 4753 year = {2001}, 4754 pages = {32-+}, 4755 petsc_uses = {KSP} 4756} 4757 4758@Article{ lzb2005, 4759 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 4760 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 4761 journal = {Journal of Hydraulic Engineering}, 4762 year = {2005}, 4763 volume = {131}, 4764 number = {4}, 4765 pages = {247--258}, 4766 petsc_uses = {KSP} 4767} 4768 4769@Article{ rao2005, 4770 author = {Prasada Rao}, 4771 title = {A parallel {RMA2} model for simulating large-scale free surface flows}, 4772 journal = {Environmental Modelling and Software}, 4773 year = {2005}, 4774 pages = {47--53}, 4775 petsc_uses = {KSP} 4776} 4777 4778@InProceedings{ pr1, 4779 author = {Prasada Rao}, 4780 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 4781 Hydrodynamic Flows}, 4782 year = {2003}, 4783 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 4784 Conference}, 4785 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 4786 petsc_uses = {KSP} 4787} 4788 4789@InProceedings{ lichtner2004, 4790 author = {Peter C. Lichtner and Andrew Wolfsberg}, 4791 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 4792 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 4793 Challenge Supercomputing Problem}, 4794 year = {2004}, 4795 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 4796 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 4797 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 4798 lab = {LANL}, 4799 petsc_uses = {KSP} 4800} 4801 4802% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4803@Article{ aba01:petsc-app, 4804 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 4805 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 4806 journal = {Int. J. High Performance Computing Applications}, 4807 year = {2001}, 4808 volume = {15}, 4809 number = {1}, 4810 pages = {13--21}, 4811 petsc_uses = {KSP} 4812} 4813 4814@PhDThesis{ tjb200, 4815 author = {Thomas James Byer}, 4816 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 4817 Facilities}, 4818 school = {Stanford}, 4819 year = {2000}, 4820 petsc_uses = {KSP} 4821} 4822 4823@InProceedings{ puchyr2006, 4824 author = {Peter J. Puchyr}, 4825 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 4826 {Win32} Cluster}, 4827 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 4828 note = {Paper number CIPC2006-207}, 4829 year = {2006}, 4830 petsc_uses = {KSP} 4831} 4832 4833@InProceedings{ texas98, 4834 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 4835 and G. A. Pope}, 4836 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 4837 Simulation}, 4838 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 4839 Symposium}, 4840 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 4841 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 4842 year = {1998}, 4843 petsc_uses = {KSP} 4844} 4845 4846% LiteralHTML: 4847% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 4848% LiteralHTML: 4849@Article{ farrellmitchellscottwechsung2021, 4850 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 4851 stationary incompressible {Navier-Stokes} equations}, 4852 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 4853 Wechsung}, 4854 journal = {The SMAI journal of computational mathematics}, 4855 volume = {7}, 4856 pages = {75--96}, 4857 year = {2021}, 4858 petsc_uses = {KSP} 4859} 4860 4861@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 4862 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 4863 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 4864 P MacLachlan and Ray S Tuminaro}, 4865 journal = {SIAM Journal on Scientific Computing}, 4866 number = {0}, 4867 pages = {S70--S91}, 4868 year = {2021}, 4869 petsc_uses = {KSP} 4870} 4871 4872@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 4873 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 4874 hyperelasticity}, 4875 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 4876 Oyar\'ua and Ricardo Ruiz-Baier}, 4877 journal = {Computer Methods in Applied Mechanics and Engineering}, 4878 volume = {374}, 4879 pages = {113562}, 4880 issn = {0045-7825}, 4881 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 4882 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 4883 year = {2021}, 4884 petsc_uses = {KSP} 4885} 4886 4887@Article{ farrellmitchellwechsung2018, 4888 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 4889 {Navier-Stokes} equations at high {Reynolds} number}, 4890 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 4891 journal = {SIAM Journal on Scientific Computing}, 4892 volume = {41}, 4893 number = {5}, 4894 eprint = {1810.03315}, 4895 pages = {A3073-A3096}, 4896 year = {2019}, 4897 petsc_uses = {KSP} 4898} 4899 4900@Article{ hevuikklaij2017, 4901 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 4902 discretized by a finite volume method}, 4903 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 4904 journal = {Journal of Numerical Mathematics}, 4905 volume = {25}, 4906 number = {2}, 4907 pages = {89--105}, 4908 year = {2017}, 4909 petsc_uses = {KSP} 4910} 4911 4912@InProceedings{ zou2015newton, 4913 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 4914 appearance/disappearance}, 4915 author = {Zou, L and Zhao, H and Zhang, H}, 4916 booktitle = {ANS 2015 Annual Meeting, June}, 4917 volume = {7}, 4918 number = {11}, 4919 year = {2015}, 4920 petsc_uses = {KSP} 4921} 4922 4923@Article{ guermond2009nonlinear, 4924 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 4925 Fourier/finite element technique and an interior penalty method}, 4926 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 4927 journal = {Journal of computational physics}, 4928 volume = {228}, 4929 number = {8}, 4930 pages = {2739--2757}, 4931 year = {2009}, 4932 publisher = {Elsevier}, 4933 petsc_uses = {KSP} 4934} 4935 4936@Article{ erzincanlisahin2015, 4937 title = {The numerical simulation of the wing kinematics effects on near wake topology and 4938 aerodynamic performance in hovering {D}rosophila flight}, 4939 author = {Belkis Erzincanli and Mehmet Sahin}, 4940 journal = {Computers \& Fluids}, 4941 volume = {122}, 4942 pages = {90--110}, 4943 year = {2015}, 4944 publisher = {Elsevier}, 4945 petsc_uses = {KSP} 4946} 4947 4948@Article{ ekensahin2015, 4949 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 4950 structure interaction problems}, 4951 author = {Ali Eken and Mehmet Sahin}, 4952 journal = {International Journal for Numerical Methods in Fluids}, 4953 year = {2015}, 4954 publisher = {Wiley Online Library}, 4955 petsc_uses = {KSP} 4956} 4957 4958@Article{ hwangsucai2015, 4959 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 4960 for transonic full potential equation}, 4961 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 4962 journal = {Computers \& Fluids}, 4963 volume = {110}, 4964 number = {30}, 4965 pages = {96--107}, 4966 year = {2015}, 4967 doi = {10.1016/j.compfluid.2014.04.005}, 4968 petsc_uses = {KSP} 4969} 4970 4971@Article{ yanghwangcai2016, 4972 title = {Nonlinear Preconditioning Techniques for Full-Space {L}agrange--{N}ewton Solution of 4973 {PDE}-Constrained Optimization Problems}, 4974 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 4975 journal = {SIAM Journal on Scientific Computing}, 4976 volume = {38}, 4977 number = {5}, 4978 pages = {A2756--A2778}, 4979 year = {2016}, 4980 petsc_uses = {KSP} 4981} 4982 4983@Article{ khanaidun2011, 4984 author = {Irfan Khan and Cyrus K. Aidun}, 4985 title = {Direct numerical simulation of saturated deformable porous media using parallel 4986 hybrid Lattice-{B}oltzmann and finite element method}, 4987 journal = {Int. J. Numer. Meth. Eng.}, 4988 volume = {86}, 4989 pages = {1379--1395}, 4990 year = {2011}, 4991 petsc_uses = {KSP} 4992} 4993 4994@Article{ khanaidun2014, 4995 author = {Irfan Khan and Cyrus K. Aidun}, 4996 title = {Modeling the deformation of saturate porous media using direct numerical 4997 simulation}, 4998 journal = {Int. J. Multiphase Flow}, 4999 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 5000 year = {2014}, 5001 petsc_uses = {KSP} 5002} 5003 5004@Article{ mofidi2014simulations, 5005 author = {A. Mofidi and P. M. Carrica}, 5006 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 5007 and Propeller}, 5008 journal = {Computers and Fluids}, 5009 pages = {191--203}, 5010 year = {2014}, 5011 petsc_uses = {KSP} 5012} 5013 5014@Article{ paik2014fluidstructure, 5015 author = {K. Paik and P. M. Carrica}, 5016 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 5017 Surface in a Rolling Tank}, 5018 journal = {Ocean Engineering}, 5019 pages = {201--212}, 5020 year = {2014}, 5021 petsc_uses = {KSP} 5022} 5023 5024@Article{ castro2013bubble, 5025 author = {A. M. Castro and P. M. Carrica}, 5026 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 5027 evaluation and numerical issues}, 5028 journal = {International Journal of Multiphase Flow 57}, 5029 pages = {131--150}, 5030 year = {2013}, 5031 petsc_uses = {KSP} 5032} 5033 5034@Article{ carrica2013turn, 5035 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 5036 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 5037 Dynamic Overset Grids}, 5038 journal = {Journal of Marine Science and Technology}, 5039 pages = {166--181}, 5040 year = {2013}, 5041 petsc_uses = {KSP} 5042} 5043 5044@Article{ castro2013eulerian, 5045 author = {A. M. Castro and P. M. Carrica}, 5046 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 5047 {Athena} {R}/V,}, 5048 journal = {International Shipbuilding Progress}, 5049 pages = {403--433}, 5050 year = {2013}, 5051 petsc_uses = {KSP} 5052} 5053 5054@Article{ chase2013overset, 5055 author = {N. Chase and T. Michael and P. M. Carrica}, 5056 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 5057 {Maneuvering} {Conditions}}, 5058 journal = {International Shipbuilding Progress}, 5059 pages = {171--205}, 5060 year = {2013}, 5061 petsc_uses = {KSP} 5062} 5063 5064@Article{ sadathosseini2013wu, 5065 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 5066 Stern}, 5067 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 5068 Free Surge Conditions in Short and Long Head Waves}, 5069 journal = {Ocean Engineering}, 5070 volume = {59}, 5071 pages = {240--273}, 5072 year = {2013}, 5073 petsc_uses = {KSP} 5074} 5075 5076@Article{ chase2013cfd, 5077 author = {N. Chase and P. M. Carrica}, 5078 title = {{CFD} Simulations of a Submarine Propeller and Application to Self-Propulsion of a 5079 Submarine}, 5080 journal = {Ocean Engineering}, 5081 pages = {68--80}, 5082 year = {2013}, 5083 petsc_uses = {KSP} 5084} 5085 5086@Article{ carrica2012cfd, 5087 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 5088 title = {{CFD} Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 5089 of Moving Rudders and Rotating Propellers}, 5090 journal = {Computers and Fluids 53}, 5091 pages = {117--132}, 5092 year = {2012}, 5093 petsc_uses = {KSP} 5094} 5095 5096@Article{ sakamoto2012urans, 5097 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5098 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 5099 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 5100 publisher = {Journal of Marine Science and Technology}, 5101 pages = {422--445}, 5102 year = {2012}, 5103 petsc_uses = {KSP} 5104} 5105 5106@Article{ sakamoto2012uransb, 5107 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5108 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 5109 Analysis and Validation of Local Flow Characteristics}, 5110 journal = {Journal of Marine Science and Technology}, 5111 pages = {446--468}, 5112 year = {2012}, 5113 petsc_uses = {KSP} 5114} 5115 5116@Article{ li2012dynamic, 5117 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 5118 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 5119 journal = {Renewable Energy}, 5120 pages = {285--298}, 5121 year = {2012}, 5122 petsc_uses = {KSP} 5123} 5124 5125@Article{ huang2012a, 5126 author = {J. Huang and P. M. Carrica and F. Stern}, 5127 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 5128 journal = {International Journal for Numerical Methods in Fluids}, 5129 pages = {160--180}, 5130 year = {2012}, 5131 petsc_uses = {KSP} 5132} 5133 5134@Article{ huang2012b, 5135 author = {J. Huang and P. M. Carrica and F. Stern}, 5136 title = {A geometry-based level set method for curvilinear overset grids with application 5137 to ship hydrodynamics}, 5138 journal = {International Journal for Numerical Methods in Fluids}, 5139 pages = {494--521}, 5140 year = {2012}, 5141 petsc_uses = {KSP} 5142} 5143 5144@Article{ carrica2011computations, 5145 author = {P. M. Carrica and H. Fu and F. Stern}, 5146 title = {Computations of self-propulsion free to sink and trim and of motions in head 5147 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 5148 journal = {Applied Ocean Research}, 5149 pages = {309--320}, 5150 year = {2011}, 5151 petsc_uses = {KSP} 5152} 5153 5154@Article{ bhushan2011scalability, 5155 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 5156 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 5157 Using {CFDShip}-Iowa}, 5158 journal = {International Journal of High Performance Computing Applications}, 5159 pages = {466--487}, 5160 year = {2011}, 5161 petsc_uses = {KSP} 5162} 5163 5164@Article{ castro2011full, 5165 author = {A. M. Castro and P. M. Carrica and F. Stern}, 5166 title = {Full scale self-propulsion computations using discretized propeller for the 5167 {KRISO} container ship {KCS}}, 5168 journal = {Computers and Fluids}, 5169 pages = {35--47}, 5170 year = {2011}, 5171 petsc_uses = {KSP} 5172} 5173 5174@Article{ kandasamy2011multifidelity, 5175 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5176 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5177 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing {C}atamaran 5178 for Low Wake}, 5179 journal = {Journal of Marine Science and Technology}, 5180 pages = {143--156}, 5181 year = {2011}, 5182 petsc_uses = {KSP} 5183} 5184 5185@Article{ kandasamy2011cfd, 5186 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5187 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5188 title = {{CFD} Validation Studies for a High-speed Foil-assisted Semi-planing {C}atamaran}, 5189 journal = {Journal of Marine Science and Technology}, 5190 pages = {157--167}, 5191 year = {2011}, 5192 petsc_uses = {KSP} 5193} 5194 5195@Article{ sadathosseini2011cfd, 5196 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 5197 and S. Yamamura and A. Mastuda}, 5198 title = {{CFD} System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 5199 Periodic Motion and Broaching}, 5200 journal = {Ocean Engineering}, 5201 pages = {88--110}, 5202 year = {2011}, 5203 petsc_uses = {KSP} 5204} 5205 5206@Article{ mosaviraad2010development, 5207 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 5208 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 5209 with Comparison to Regular Wave and Transient Wave Group Procedures Using 5210 {URANS}}, 5211 journal = {Ocean Engineering}, 5212 pages = {653--666}, 5213 year = {2010}, 5214 petsc_uses = {KSP} 5215} 5216 5217@Article{ carrica2010largescale, 5218 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5219 Stern}, 5220 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5221 Heave Problems for a Surface Combatant}, 5222 journal = {Computers and Fluids}, 5223 pages = {1095--1111}, 5224 year = {2010}, 5225 petsc_uses = {KSP} 5226} 5227 5228@Article{ carrica2010selfpropulsion, 5229 author = {P. M. Carrica and A. M. Castro and F. Stern}, 5230 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 5231 with Dynamic Overset Grids}, 5232 journal = {Journal of Marine Science and Technology}, 5233 pages = {316--330}, 5234 year = {2010}, 5235 petsc_uses = {KSP} 5236} 5237 5238@Article{ ismail2010evaluation, 5239 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 5240 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 5241 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 5242 journal = {International Journal of Numerical Methods in Fluids}, 5243 pages = {850--886}, 5244 year = {2010}, 5245 petsc_uses = {KSP} 5246} 5247 5248@Article{ kandasamy2010integral, 5249 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 5250 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 5251 journal = {Journal of Fluids Engineering}, 5252 pages = {101103}, 5253 year = {2010}, 5254 petsc_uses = {KSP} 5255} 5256 5257@Article{ kirk:2014de, 5258 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 5259 title = {{Modeling hypersonic entry with the fully-implicit {N}avier--{S}tokes (FIN-S) 5260 stabilized finite element flow solver}}, 5261 journal = {Computers {\&} Fluids}, 5262 year = {2014}, 5263 volume = {92}, 5264 number = {0}, 5265 pages = {281--292}, 5266 month = mar, 5267 petsc_uses = {KSP} 5268} 5269 5270@Article{ carracciuolo20111382, 5271 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 5272 in high performance computing environment}, 5273 journal = {Journal of Non-Newtonian Fluid Mechanics }, 5274 volume = {166}, 5275 number = {23--24}, 5276 pages = {1382--1395}, 5277 year = {2011}, 5278 issn = {0377-0257}, 5279 doi = {10.1016/j.jnnfm.2011.08.014}, 5280 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 5281 Maffettone and A. Murli}, 5282 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 5283 method, High performance computing}, 5284 petsc_uses = {KSP} 5285} 5286 5287@Article{ bungartzgatzhammerliebmehlneckel11, 5288 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 5289 Miriam and Neckel, Tobias}, 5290 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 5291 journal = {Computational Mechanics}, 5292 volume = {48}, 5293 number = {3}, 5294 pages = {365-376}, 5295 year = {2011}, 5296 issn = {0178-7675}, 5297 doi = {10.1007/s00466-011-0626-1}, 5298 publisher = {Springer-Verlag}, 5299 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 5300 Thermohydraulics; Two-phase flow}, 5301 language = {English}, 5302 petsc_uses = {KSP} 5303} 5304 5305@Article{ bpr:cfl, 5306 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 5307 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 5308 Equations}}, 5309 journal = {International Journal for Numerical Methods in Fluids}, 5310 year = {2009}, 5311 volume = {59}, 5312 number = {1}, 5313 pages = {1--18}, 5314 doi = {10.1002/fld.1798}, 5315 petsc_uses = {KSP} 5316} 5317 5318@InBook{ bonfiglioli_campobasso_carpentieri_2010, 5319 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 5320 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 5321 preconditioned newton-krylov solver}, 5322 publisher = {Curran Associates}, 5323 year = {2010}, 5324 url = {http://www.proceedings.com/05932.html}, 5325 petsc_uses = {KSP} 5326} 5327 5328@Article{ bonfiglioli_rans_2005, 5329 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 5330 Bernardo}, 5331 title = {RANS simulations of a junction flow}, 5332 journal = {International Journal of Computational Fluid Dynamics}, 5333 volume = {19}, 5334 number = {2}, 5335 pages = {179-189}, 5336 year = {2005}, 5337 doi = {10.1080/10618560410001729126}, 5338 petsc_uses = {KSP} 5339} 5340 5341@InCollection{ bonfiglioli__carpentieri_rans_2008, 5342 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 5343 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 5344 Italy}, 5345 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 5346 Equations Using Fluctuation Splitting Schemes}, 5347 booktitle = {Numerical Mathematics and Advanced Applications}, 5348 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 5349 publisher = {Springer Berlin Heidelberg}, 5350 isbn = {978-3-540-69777-0}, 5351 pages = {151-158}, 5352 doi = {10.1007/978-3-540-69777-0_17}, 5353 year = {2008}, 5354 petsc_uses = {KSP} 5355} 5356 5357@InCollection{ bonfiglioli__carpentieri_ens_2007, 5358 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 5359 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 5360 Italy}, 5361 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 5362 Problems on Unstructured Grids}, 5363 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 5364 series = {Lecture Notes in Computer Science}, 5365 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 5366 publisher = {Springer Berlin / Heidelberg}, 5367 isbn = {978-3-540-75754-2}, 5368 pages = {676-685}, 5369 volume = {4699}, 5370 doi = {10.1007/978-3-540-75755-9_83}, 5371 year = {2007}, 5372 petsc_uses = {KSP} 5373} 5374 5375@Article{ terrelscottknepleykirby08, 5376 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 5377 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 5378 journal = {BIT}, 5379 volume = {48}, 5380 number = {2}, 5381 year = {2008}, 5382 petsc_uses = {KSP} 5383} 5384 5385@Article{ martamadermartinsweidealonso07, 5386 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 5387 J. Alonso}, 5388 title = {A methodology for the development of discrete adjoint solvers using automatic 5389 differentiation tools}, 5390 journal = {Computational Fluid Dyanmics}, 5391 volume = {21}, 5392 pages = {307--327}, 5393 year = {2007}, 5394 petsc_uses = {KSP} 5395} 5396 5397@TechReport{ avb2008, 5398 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 5399 title = {Variational Space-time (Dis)continuous {G}alerkin Method for Linear Free Surface 5400 Waves}, 5401 year = {2008}, 5402 institution = {University of Twente, the Netherlands}, 5403 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 5404 petsc_uses = {KSP} 5405} 5406 5407@InProceedings{ bdsm2005, 5408 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 5409 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 5410 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 5411 year = {2005}, 5412 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 5413 petsc_uses = {KSP} 5414} 5415 5416@InProceedings{ ms2006, 5417 author = {S. Muller and Y. Stiriba}, 5418 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 5419 STEADY COMPRESSIBLE FLOWS}, 5420 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 5421 year = {2006}, 5422 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 5423 petsc_uses = {KSP} 5424} 5425 5426@Article{ araujoteixeiracunhagroth08, 5427 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 5428 title = {Parallel three-dimensional simulation of the injection molding process}, 5429 journal = {International Journal for Numerical Methods in Fluids}, 5430 year = {2008}, 5431 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 5432 petsc_uses = {KSP} 5433} 5434 5435@PhDThesis{ a2008, 5436 author = {A. Cubero}, 5437 title = {a parallel coupled algorithm for collocated grids and its application to Large 5438 Eddy Simulation of a turbulent wake}, 5439 school = {University of Zaragoza (Spain)}, 5440 year = {2008}, 5441 petsc_uses = {KSP} 5442} 5443 5444@Article{ afa2007, 5445 author = {A. Cubero and N. Fueyo}, 5446 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 5447 journal = {Numerical Heat Transfer, part B-Fundamentals}, 5448 volume = {56}, 5449 number = {6}, 5450 pages = {507--529}, 5451 year = {2007}, 5452 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 5453 petsc_uses = {KSP} 5454} 5455 5456@TechReport{ af2007, 5457 title = {Preconditioning based on a partially implicit implementation of Momentum 5458 Interpolation for coupled solvers}, 5459 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 5460 year = {2007}, 5461 author = {A. Cubero and N. Fueyo}, 5462 petsc_uses = {KSP} 5463} 5464 5465@InCollection{ dwight2004, 5466 author = {Richard Dwight}, 5467 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 5468 booktitle = {Computational Fluid Dynamics 2006}, 5469 editor = {H. Deconinck and E. Dick}, 5470 publisher = {Springer}, 5471 year = {2006}, 5472 url = {http://www.maths.man.ac.uk/\~{ 5473 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 5474 petsc_uses = {KSP} 5475} 5476 5477@InProceedings{ dwight2006, 5478 author = {Richard Dwight and Joel Brezillon}, 5479 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 5480 Optimization}, 5481 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 5482 AIAA-2006-0690}, 5483 year = {2006}, 5484 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 5485 petsc_uses = {KSP} 5486} 5487 5488@PhDThesis{ dwight2006a, 5489 author = {Richard Dwight}, 5490 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 5491 and Adjoint Methods on Unstructured Grids}, 5492 school = {School of Mathematics, University of Manchester}, 5493 year = {2006}, 5494 url = {http://www.maths.man.ac.uk/\~{ 5495 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 5496 petsc_uses = {KSP} 5497} 5498 5499@InProceedings{ lhdfrh, 5500 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 5501 W. Hiller}, 5502 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 5503 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 5504 March, 10-14, 2003, Munich University of Technology, German}, 5505 year = {2003}, 5506 petsc_uses = {KSP} 5507} 5508 5509@InProceedings{ brios-ying-2002, 5510 author = {George Biros and Lexing Ying and Denis Zorin}, 5511 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 5512 {Navier-Stokes} equations}, 5513 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 5514 year = {2002}, 5515 petsc_uses = {KSP} 5516} 5517 5518@InProceedings{ mohsen-straatman-ins, 5519 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 5520 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 5521 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 5522 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 5523 Systems and Applications}, 5524 pages = {11--16}, 5525 year = {2005}, 5526 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 5527 petsc_uses = {KSP} 5528} 5529 5530@TechReport{ bonglioli-icnmfd98, 5531 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 5532 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 5533 institution = {Universita della Basilicata via della Tecnica 3}, 5534 year = {1996}, 5535 author = {A. Bonglioli}, 5536 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 5537 petsc_uses = {KSP} 5538} 5539 5540@Article{ deng-piquet-ctf, 5541 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 5542 title = {A new fully coupled method for computing turbulent flows}, 5543 journal = {Computers and Fluids}, 5544 volume = {30}, 5545 pages = {445--472}, 5546 year = {2001}, 5547 petsc_uses = {KSP} 5548} 5549 5550@InProceedings{ knepleysarinsameh99b, 5551 title = {Multilevel Preconditioning for Parallel {CFD}}, 5552 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 5553 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 5554 Problems In Industrial Applications}, 5555 address = {Minneapolis, MN}, 5556 year = {1999}, 5557 petsc_uses = {KSP} 5558} 5559 5560@InProceedings{ garbey1, 5561 author = {M. Garbey and B. Hadri and W. Shyy.}, 5562 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 5563 Problems on the Grid}, 5564 booktitle = {Aerospace Sciences Meeting and Exhibit}, 5565 note = {Paper No. 2005-1386}, 5566 year = {2005}, 5567 petsc_uses = {KSP} 5568} 5569 5570@Article{ carrica2007unsteady, 5571 title = {An unsteady single-phase level set method for viscous free surface flows}, 5572 author = {Carrica, PM and Wilson, RV and Stern, F.}, 5573 journal = {International Journal for Numerical Methods in Fluids}, 5574 volume = {53}, 5575 number = {2}, 5576 pages = {229--256}, 5577 year = {2007}, 5578 publisher = {Chichester; New York: Wiley, c1981-}, 5579 petsc_uses = {KSP} 5580} 5581 5582@Article{ pctw2004, 5583 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 5584 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 5585 Spillways}, 5586 journal = {Journal of Hydraulic Research}, 5587 note = {accepted for publication}, 5588 year = {2004}, 5589 petsc_uses = {KSP} 5590} 5591 5592@Article{ wcs2004, 5593 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 5594 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 5595 Combatant}, 5596 journal = {Computers and Fluids}, 5597 note = {in press}, 5598 year = {2004}, 5599 petsc_uses = {KSP} 5600} 5601 5602@Article{ cws2005, 5603 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 5604 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 5605 journal = {Computers and Fluids}, 5606 note = {accepted for publication}, 5607 year = {2005}, 5608 petsc_uses = {KSP} 5609} 5610 5611@Article{ chndss2010, 5612 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5613 Stern}, 5614 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5615 Heave Problems for a Surface Combatant}, 5616 journal = {Computers and Fluids}, 5617 year = {2010}, 5618 volume = {39}, 5619 number = {7}, 5620 pages = {1095--1111}, 5621 petsc_uses = {KSP} 5622} 5623 5624@InProceedings{ chnkss2008, 5625 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5626 Stern}, 5627 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 5628 Grids}, 5629 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 5630 year = {2008}, 5631 petsc_uses = {KSP} 5632} 5633 5634@MastersThesis{ mtj, 5635 author = {M. T. Jozkowski}, 5636 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 5637 About Submerged Bodies}, 5638 school = {The Pennsylvania State University}, 5639 year = {2005}, 5640 petsc_uses = {KSP} 5641} 5642 5643@Article{ pp, 5644 author = {E. G. Paterson and L. J. Peltier}, 5645 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 5646 Wakes}, 5647 journal = {ASME Journal of Fluids Engineering}, 5648 note = {In press}, 5649 year = {2005}, 5650 petsc_uses = {KSP} 5651} 5652 5653@Article{ eps, 5654 author = {B. A. Edge and E. G. Paterson and G. Settles}, 5655 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 5656 journal = {ASME Journal of Fluids Engineering}, 5657 note = {In press}, 5658 year = {2005}, 5659 petsc_uses = {KSP} 5660} 5661 5662@InProceedings{ rp, 5663 author = {B. Racine and E. G. Paterson}, 5664 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 5665 Using Unsteady {RANS} {CFD}}, 5666 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 5667 year = {2005}, 5668 petsc_uses = {KSP} 5669} 5670 5671@InProceedings{ etpp, 5672 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 5673 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 5674 and DES}, 5675 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5676 year = {2004}, 5677 petsc_uses = {KSP} 5678} 5679 5680@InProceedings{ pp8, 5681 author = {E. G. Paterson and L. J. Peltier}, 5682 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 5683 refinement grids and detached-eddy simulation}, 5684 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5685 year = {2004}, 5686 petsc_uses = {KSP} 5687} 5688 5689@InProceedings{ mzwp, 5690 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 5691 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 5692 booktitle = {25th Symposium on Naval Hydrodynamics}, 5693 year = {2004}, 5694 petsc_uses = {KSP} 5695} 5696 5697@InProceedings{ ppph, 5698 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 5699 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 5700 booktitle = {25th Symposium on Naval Hydrodynamics}, 5701 year = {2004}, 5702 petsc_uses = {KSP} 5703} 5704 5705@InProceedings{ ppd, 5706 author = {E. G. Paterson and L. J. Peltier}, 5707 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 5708 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 5709 year = {2004}, 5710 petsc_uses = {KSP} 5711} 5712 5713@InProceedings{ bp, 5714 author = {W. J. Baker and E. G. and Paterson}, 5715 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 5716 Control Wing}, 5717 booktitle = {NASA/ONR Workshop on Circulation Control}, 5718 year = {2004}, 5719 petsc_uses = {KSP} 5720} 5721 5722@InProceedings{ pb, 5723 author = {E. G. Paterson and W. J. Baker}, 5724 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 5725 booktitle = {NASA/ONR Workshop on Circulation Control}, 5726 year = {2004}, 5727 petsc_uses = {KSP} 5728} 5729 5730@InProceedings{ pb3, 5731 author = {E. G. Paterson and W. J. Baker}, 5732 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 5733 Surfaces}, 5734 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 5735 year = {2004}, 5736 petsc_uses = {KSP} 5737} 5738 5739@InProceedings{ gid1, 5740 author = {G. Frank and J. D'Elia}, 5741 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 5742 year = {2004}, 5743 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 5744 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 5745 petsc_uses = {KSP} 5746} 5747 5748@InBook{ b1, 5749 author = {A.Bonfiglioli}, 5750 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 5751 year = {2001}, 5752 title = {Science and Supercomputing at CINECA}, 5753 pages = {397--400}, 5754 petsc_uses = {KSP} 5755} 5756 5757@InProceedings{ b2004, 5758 author = {L. A. Barba}, 5759 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 5760 fully meshless formulation}, 5761 year = {2004}, 5762 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 5763 note = {Submitted}, 5764 petsc_uses = {KSP} 5765} 5766 5767@InProceedings{ bl2004, 5768 author = {L. A. Barba and A. Leonard}, 5769 title = {Computation of Viscous Vortices with Fully Meshless Method}, 5770 year = {2004}, 5771 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 5772 note = {Submitted}, 5773 petsc_uses = {KSP} 5774} 5775 5776@Article{ vws1, 5777 author = {B. G. M. Van Wachem and J. C. Schouten}, 5778 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 5779 Velocity}, 5780 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 5781 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 5782 Netherlands}, 5783 journal = {AIChE}, 5784 volumne = {48}, 5785 number = {12}, 5786 month = dec, 5787 year = {2002}, 5788 petsc_uses = {KSP} 5789} 5790 5791@TechReport{ lbam1, 5792 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 5793 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 5794 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 5795 di Bari Italy}, 5796 year = {2002}, 5797 number = {25/02}, 5798 petsc_uses = {KSP} 5799} 5800 5801@Article{ kees_miller_02, 5802 author = {C. E. Kees and C. T. Miller}, 5803 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 5804 journal = {Advances in Water Resources}, 5805 year = {2002}, 5806 volume = {25}, 5807 number = {2}, 5808 pages = {159-177.}, 5809 petsc_uses = {KSP} 5810} 5811 5812@InProceedings{ lepotmeersessers2001, 5813 author = {I. Lepot and F. Meers and J.A. Essers}, 5814 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 5815 Unstructured Meshes}, 5816 year = {2001}, 5817 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 5818 url = {http://www.ulg.ac.be/aerodyn}, 5819 petsc_uses = {KSP} 5820} 5821 5822@InProceedings{ knepley98, 5823 author = {Matthew Knepley and Denis Vanderstraeten}, 5824 title = {Parallel Building Blocks for Finite Element Simulations: Application to 5825 Solid-Liquid Mixture Flows}, 5826 booktitle = {Proceedings of Parallel CFD'97}, 5827 publisher = {Elsevier}, 5828 pages = {281--287}, 5829 year = {1998}, 5830 petsc_uses = {KSP} 5831} 5832 5833@InProceedings{ pcfd97, 5834 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 5835 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 5836 publisher = {Elsevier}, 5837 year = {1998}, 5838 booktitle = {Proceedings of Parallel CFD'97}, 5839 pages = {333-344}, 5840 petsc_uses = {KSP} 5841} 5842 5843@InProceedings{ knepleysamehsari98, 5844 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 5845 title = {Parallel Simulation of Particulate Flows}, 5846 booktitle = {Solving Irregularly Structured Problems in Parallel}, 5847 editors = {A. Ferreira et al}, 5848 year = {1998}, 5849 series = {Lecture Notes in Computer Science}, 5850 volume = {1457}, 5851 pages = {226--237}, 5852 petsc_uses = {KSP} 5853} 5854 5855@Article{ gkmt98, 5856 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 5857 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 5858 Implicit {CFD}}, 5859 journal = {Int. J. High Performance Computing Applications}, 5860 year = {2000}, 5861 volume = {14}, 5862 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 5863 pages = {102-136}, 5864 petsc_uses = {KSP} 5865} 5866 5867@InProceedings{ agkks-sc99, 5868 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 5869 Smith}, 5870 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 5871 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 5872 editor = {}, 5873 publisher = {}, 5874 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 5875 year = {1999}, 5876 note = {Winner of Gordon Bell Special Prize at SC 99}, 5877 petsc_uses = {KSP} 5878} 5879 5880@Article{ gkks01, 5881 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5882 title = {High Performance Parallel Implicit {CFD}}, 5883 journal = {Journal of Parallel Computing}, 5884 year = {2001}, 5885 volume = {27}, 5886 pages = {337-362}, 5887 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 5888 petsc_uses = {KSP} 5889} 5890 5891@Article{ cristea-sofonea-02, 5892 author = {Artur Cristea and Victor Sofonea}, 5893 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 5894 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 5895 Sciences, Information Sciences}, 5896 volume = {3}, 5897 number = {3}, 5898 year = {2002}, 5899 petsc_uses = {KSP} 5900} 5901 5902@Article{ cristea2, 5903 author = {Artur Cristea and Victor Sofonea}, 5904 title = {Two component lattice Boltzmann model with flux limiter techniques}, 5905 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 5906 Sciences, Information Sciences}, 5907 volume = {4}, 5908 number = {1}, 5909 year = {2003}, 5910 pages = {59--64}, 5911 petsc_uses = {KSP} 5912} 5913 5914@Article{ cristea1, 5915 author = {Artur Cristea and Victor Sofonea}, 5916 title = {Two component lattice Boltzmann model with flux limiters}, 5917 journal = {Central European Journal of Physics}, 5918 volume = {2}, 5919 number = {2}, 5920 year = {2004}, 5921 pages = {382--396}, 5922 petsc_uses = {KSP} 5923} 5924 5925@Article{ sofnea-lamura1, 5926 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 5927 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 5928 systems}, 5929 journal = {Physical Review E}, 5930 volume = {70}, 5931 number = {4}, 5932 year = {2004}, 5933 pages = {046702-1 / 046702-9}, 5934 petsc_uses = {KSP} 5935} 5936 5937@InProceedings{ gkks01b, 5938 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5939 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 5940 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 5941 Mechanics}, 5942 editor = {}, 5943 location = {Cambridge, MA}, 5944 year = {2001}, 5945 month = jun, 5946 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 5947 petsc_uses = {KSP} 5948} 5949 5950@InProceedings{ gkks00, 5951 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5952 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 5953 Code}, 5954 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 5955 (HiPC '2000)}, 5956 editor = {}, 5957 location = {Bangalore, India}, 5958 year = {2000}, 5959 pages = {395--404}, 5960 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 5961 petsc_uses = {KSP} 5962} 5963 5964@InProceedings{ gkks-sc00, 5965 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5966 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 5967 booktitle = {Proceedings of SC2000}, 5968 editor = {}, 5969 publisher = {IEEE Computer Society}, 5970 year = {2000}, 5971 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 5972 petsc_uses = {KSP} 5973} 5974 5975@InProceedings{ knepleysamehsarin99, 5976 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 5977 title = {Design of Large Scale Parallel Simulations}, 5978 booktitle = {Proceedings of Parallel CFD'99}, 5979 editors = {A. {Ecer et al.}}, 5980 publisher = {Elsevier}, 5981 year = {1999}, 5982 petsc_uses = {KSP} 5983} 5984 5985@InProceedings{ gkks-pcfd99, 5986 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 5987 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 5988 booktitle = {Proceedings of Parallel CFD'99}, 5989 editors = {A. {Ecer et al.}}, 5990 publisher = {Elsevier}, 5991 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 5992 year = {1999}, 5993 petsc_uses = {KSP} 5994} 5995 5996@InProceedings{ kks97, 5997 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5998 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 5999 Parallelization of an Unstructured Grid Incompressible Flow Code}, 6000 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 6001 Methods}, 6002 editor = {J. Mandel et al.}, 6003 pages = {311--319}, 6004 publisher = {Wiley}, 6005 note = {}, 6006 year = {1997}, 6007 petsc_uses = {KSP} 6008} 6009 6010@InProceedings{ kks99, 6011 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6012 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 6013 Incompressible Flows on Unstructured Grids}, 6014 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6015 Methods}, 6016 editors = {C.-H. {Lai et al.}}, 6017 publisher = {Domain Decomposition Press, Bergen}, 6018 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 6019 year = {1999}, 6020 petsc_uses = {KSP} 6021} 6022 6023@InCollection{ kks97_cfd, 6024 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 6025 title = {Perspectives for {CFD} on Petaflops Systems}, 6026 booktitle = {CFD Review 1998}, 6027 editor = {M. Hafez and K. Oshima}, 6028 publisher = {World Scientific, Singapore}, 6029 pages = {1079--1096}, 6030 note = {}, 6031 year = {1998}, 6032 petsc_uses = {KSP} 6033} 6034 6035@Article{ hm99, 6036 author = {P. D. Hovland and L. C. McInnes}, 6037 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 6038 {PETSc}}, 6039 year = {2000}, 6040 journal = {Parallel Computing}, 6041 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 6042 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 6043 petsc_uses = {KSP} 6044} 6045 6046@InProceedings{ cruzbarbaknepley08, 6047 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 6048 title = {Fast Multipole Method for particle interactions: an open source parallel library 6049 component}, 6050 booktitle = {Proceedings of ParCFD2008}, 6051 year = {2008}, 6052 editor = {Tromeur-Dervout et. al.}, 6053 publisher = {Elsevier}, 6054 petsc_uses = {KSP} 6055} 6056 6057@Article{ hwangcai05, 6058 author = {F.-N. Hwang and X.-C. Cai}, 6059 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 6060 for incompressible {Navier-Stokes} equations}, 6061 journal = {J. Comput. Phys.}, 6062 volume = {204}, 6063 year = {2005}, 6064 pages = {666--691}, 6065 petsc_uses = {KSP} 6066} 6067 6068@Article{ barbaleonard07, 6069 author = {Lorena A Barba and Anthony Leonard}, 6070 title = {Emergence and evolution of tripole vortices from net-circulation initial 6071 conditions}, 6072 journal = {Phys. Fluids}, 6073 volume = {19}, 6074 pages = {017101}, 6075 year = {2007}, 6076 doi = {10.1063/1.2409734}, 6077 petsc_uses = {KSP} 6078} 6079 6080@Article{ barba07, 6081 author = {Lorena A Barba}, 6082 title = {Non-shielded multipolar vortices at high Reynolds number}, 6083 journal = {Phys. Rev. E}, 6084 volume = {73}, 6085 pages = {065303}, 6086 year = {2006}, 6087 doi = {10.1103/PhysRevE.73.065303}, 6088 petsc_uses = {KSP} 6089} 6090 6091@Article{ schofield2010multi, 6092 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 6093 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 6094 Lowrie, R.B. and Swartz, B.K.}, 6095 journal = {International Journal for Numerical Methods in Fluids}, 6096 volume = {63}, 6097 number = {8}, 6098 pages = {931--952}, 6099 year = {2010}, 6100 publisher = {Wiley Online Library}, 6101 petsc_uses = {KSP} 6102} 6103 6104% LiteralHTML: 6105% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 6106% LiteralHTML: 6107% LiteralHTML: article{DeGersem99, 6108% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 6109% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 6110% LiteralHTML: } 6111@Article{ nagler2014, 6112 title = {Sound transmission through a poroelastic layered panel}, 6113 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 6114 journal = {Computational Mechanics}, 6115 volume = {53}, 6116 number = {4}, 6117 pages = {549--560}, 6118 issn = {1432-0924}, 6119 doi = {10.1007/s00466-013-0916-x}, 6120 year = {2014}, 6121 petsc_uses = {KSP} 6122} 6123 6124@Article{ sheikh2013, 6125 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 6126 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 6127 deflation}, 6128 journal = {Numerical Linear Algebra with Applications}, 6129 volume = {20}, 6130 number = {4}, 6131 issn = {1099-1506}, 6132 doi = {10.1002/nla.1882}, 6133 pages = {645--662}, 6134 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 6135 analysis}, 6136 year = {2013}, 6137 petsc_uses = {KSP} 6138} 6139 6140@InProceedings{ silence, 6141 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 6142 Fuenmayor}, 6143 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 6144 Application to the study of acoustic behaviour of silencers}, 6145 year = {2004}, 6146 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 6147 (ECCOMAS)}, 6148 petsc_uses = {KSP} 6149} 6150 6151@Article{ degersem99, 6152 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 6153 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 6154 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 6155 journal = {COMPEL}, 6156 year = {1999}, 6157 volume = {18}, 6158 number = {3}, 6159 pages = {298--310}, 6160 bibdate = {}, 6161 petsc_uses = {KSP} 6162} 6163 6164@InProceedings{ widlund-wave-98, 6165 author = {Olof B. Widlund}, 6166 title = {Schwarz Methods for {H}elmholtz's Equation}, 6167 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6168 editor = {John A. DeSanto}, 6169 year = {1998}, 6170 publisher = {SIAM}, 6171 pages = {620--622}, 6172 address = {Philadelphia}, 6173 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6174 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6175 petsc_uses = {KSP} 6176} 6177 6178@InProceedings{ toselli-wave-98, 6179 author = {Andrea Toselli}, 6180 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 6181 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6182 editor = {John A. DeSanto}, 6183 year = {1998}, 6184 publisher = {SIAM}, 6185 address = {Philadelphia}, 6186 pages = {540--542}, 6187 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6188 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6189 petsc_uses = {KSP} 6190} 6191 6192@InProceedings{ mcinnes-wave-98, 6193 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 6194 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 6195 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6196 editor = {John A. DeSanto}, 6197 year = {1998}, 6198 publisher = {SIAM}, 6199 address = {Philadelphia}, 6200 pages = {623--625}, 6201 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6202 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6203 petsc_uses = {KSP} 6204} 6205 6206@InProceedings{ mska98, 6207 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 6208 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 6209 Parallel Computation of {H}elmholtz Problems}, 6210 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6211 editor = {J. Mandel et al.}, 6212 publisher = {AMS}, 6213 pages = {349--357}, 6214 year = {1998}, 6215 petsc_uses = {KSP} 6216} 6217 6218@InProceedings{ ccew98, 6219 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 6220 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 6221 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6222 editor = {J. Mandel et al.}, 6223 publisher = {AMS}, 6224 pages = {437-445}, 6225 year = {1998}, 6226 petsc_uses = {KSP} 6227} 6228 6229@InProceedings{ ra98a, 6230 author = {R. Susan-Resiga and H. M. Atassi}, 6231 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 6232 Problems}, 6233 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 6234 publisher = {AIAA}, 6235 pages = {86-96}, 6236 note = {AIAA paper 98-2218}, 6237 year = {1998}, 6238 petsc_uses = {KSP} 6239} 6240 6241@InProceedings{ ar98c, 6242 author = {H. M. Atassi and R. Susan-Resiga}, 6243 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 6244 General Formulation}, 6245 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6246 publisher = {ASME}, 6247 note = {NCA-25}, 6248 pages = {375-379}, 6249 year = {1998}, 6250 petsc_uses = {KSP} 6251} 6252 6253@InProceedings{ ra98b, 6254 author = {R. Susan-Resiga and H. M. Atassi}, 6255 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 6256 Numerical Implementation and Applications}, 6257 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6258 publisher = {ASME}, 6259 note = {NCA-25}, 6260 pages = {381 -388}, 6261 year = {1998}, 6262 petsc_uses = {KSP} 6263} 6264 6265@InProceedings{ cai-dd10-98, 6266 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 6267 Widlund}, 6268 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 6269 booktitle = {Domain Decomposition Methods 10}, 6270 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 6271 series = {Contemporary Mathematics}, 6272 volume = {218}, 6273 publisher = {American Mathematical Society}, 6274 address = {Providence, Rhode Island}, 6275 year = {1998}, 6276 pages = {437--445}, 6277 petsc_uses = {KSP} 6278} 6279 6280@InProceedings{ alghamdi2011petclaw, 6281 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 6282 booktitle = {Proceedings of SpringSim 2011}, 6283 publisher = {ACM}, 6284 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 6285 Kyle T. Mandli and Lisandro Dalcin}, 6286 year = {2011}, 6287 petsc_uses = {KSP} 6288} 6289 6290@Article{ pyclaw2012, 6291 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 6292 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 6293 Emmett}, 6294 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 6295 journal = {SIAM Journal on Scientific Computing}, 6296 volume = {34}, 6297 number = {4}, 6298 pages = {C210--C231}, 6299 note = {\url{http://arxiv.org/abs/1111.6583}}, 6300 year = {2012}, 6301 petsc_uses = {KSP} 6302} 6303 6304% LiteralHTML: 6305% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 6306% LiteralHTML: 6307@Article{ sojkahorakhaplacermak2018, 6308 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 6309 decomposition method}, 6310 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 6311 journal = {Applied Mathematics and Computation}, 6312 volume = {319}, 6313 pages = {586--597}, 6314 year = {2018}, 6315 petsc_uses = {KSP} 6316} 6317 6318@Article{ chencai2014, 6319 title = {A parallel two-level domain decomposition based one-shot method for shape 6320 optimization problems}, 6321 author = {Rongliang Chen and Xiao‐Chuan Cai}, 6322 journal = {International Journal for Numerical Methods in Engineering}, 6323 volume = {99}, 6324 number = {13}, 6325 year = {2014}, 6326 doi = {10.1002/nme.4711}, 6327 petsc_uses = {KSP} 6328} 6329 6330@PhDThesis{ prudencio2005, 6331 author = {Ernesto Prudencio}, 6332 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 6333 for Optimization Problems Constrained by Partial Differential Equations}, 6334 school = {University of Colorado, Boulder}, 6335 year = {2005}, 6336 petsc_uses = {KSP} 6337} 6338 6339@Article{ prudenciocai2007, 6340 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 6341 for {PDE}-constrained optimization}, 6342 author = {Ernesto Prudencio and X. C. Cai}, 6343 journal = {SIAM J. Sci. Comp.}, 6344 volume = {29}, 6345 number = {3}, 6346 pages = {964--985}, 6347 year = {2007}, 6348 petsc_uses = {KSP} 6349} 6350 6351@Article{ prudenciobyrdcai2006, 6352 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6353 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 6354 {PDE}-constrained Optimization Problems}, 6355 journal = {SIAM J. Sci. Comp.}, 6356 volume = {27}, 6357 pages = {1305--1328}, 6358 year = {2006}, 6359 petsc_uses = {KSP} 6360} 6361 6362@InProceedings{ prudenciobyrdcai2004, 6363 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 6364 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6365 booktitle = {VECPAR 2004}, 6366 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 6367 publisher = {Springer}, 6368 pages = {569--582}, 6369 year = {2004}, 6370 petsc_uses = {KSP} 6371} 6372 6373@Article{ belhamadia-fortin-pcp, 6374 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 6375 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 6376 journal = {Journal of Computational Physics}, 6377 volume = {201}, 6378 pages = {753-770}, 6379 year = {2004}, 6380 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 6381 petsc_uses = {KSP} 6382} 6383 6384@Article{ biros00, 6385 author = {George Biros and Omar Ghattas}, 6386 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 6387 journal = {SIAG-Opt Views and News}, 6388 volume = {11}, 6389 number = {2}, 6390 year = {2000}, 6391 month = aug, 6392 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 6393 petsc_uses = {KSP} 6394} 6395 6396@Article{ bmm01, 6397 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 6398 journal = {ACM Transactions on Mathematical Software}, 6399 title = {A case study in the performance and scalability of optimization algorithms}, 6400 year = {2001}, 6401 volume = {27}, 6402 number = {3}, 6403 pages = {361--376}, 6404 petsc_uses = {KSP} 6405} 6406 6407@InProceedings{ oghattas1999, 6408 author = {George Biros and Omar Ghattas}, 6409 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 6410 incompressible flows}, 6411 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 6412 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 6413 year = {1999}, 6414 petsc_uses = {KSP} 6415} 6416 6417@InProceedings{ hkms00, 6418 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 6419 PDE-constrained Optimization}, 6420 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 6421 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 6422 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 6423 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 6424 Hasco\"{e}t and Uwe Naumann}, 6425 publisher = {Springer}, 6426 year = {2002}, 6427 petsc_uses = {KSP} 6428} 6429 6430% old version: replace with biros2005pln1 6431@TechReport{ bg011, 6432 author = {George Biros and Omar Ghattas}, 6433 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 6434 Part I: The Krylov-Schur Solver}, 6435 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6436 year = {2001}, 6437 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 6438 petsc_uses = {KSP} 6439} 6440 6441% old version: replace with biros2005pln2 6442@TechReport{ bg012, 6443 author = {George Biros and Omar Ghattas}, 6444 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 6445 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 6446 Optimal Control of Steady Viscous Flows}, 6447 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6448 year = {2001}, 6449 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 6450 petsc_uses = {KSP} 6451} 6452 6453% LiteralHTML: 6454% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 6455% LiteralHTML: 6456@InProceedings{ ly2003, 6457 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 6458 title = {A New Parallel Kernel-independent Fast Multipole Method}, 6459 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 6460 year = {2003}, 6461 note = {Winner of the Best Student Paper at SC2003}, 6462 petsc_uses = {KSP} 6463} 6464 6465@Article{ yokotabarbaknepley10, 6466 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 6467 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 6468 journal = {Computer Methods in Applied Mechanics and Engineering}, 6469 volume = {199}, 6470 number = {25-28}, 6471 pages = {1793--1804}, 6472 url = {http://arxiv.org/abs/0909.5413v1}, 6473 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 6474 year = {2010}, 6475 petsc_uses = {KSP} 6476} 6477 6478@Article{ cruzknepleybarba10, 6479 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 6480 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 6481 journal = {International Journal of Numerical Methods in Engineering}, 6482 volume = {85}, 6483 number = {4}, 6484 pages = {403--428}, 6485 url = {http://arxiv.org/abs/0905.2637}, 6486 note = {\url{http://arxiv.org/abs/0905.2637}}, 6487 year = {2010}, 6488 petsc_uses = {KSP} 6489} 6490 6491% LiteralHTML: 6492% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 6493% LiteralHTML: 6494@Article{ buchanpainumplebysmedleystevenson2012, 6495 title = {A sub-grid scale finite element agglomeration multigrid method with application 6496 to the Boltzmann transport equation}, 6497 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 6498 journal = {International Journal for Numerical Methods in Engineering}, 6499 volume = {92}, 6500 number = {3}, 6501 pages = {318--342}, 6502 year = {2012}, 6503 publisher = {Wiley Online Library}, 6504 petsc_uses = {KSP} 6505} 6506 6507@Article{ magoulesahamedsuzuki2015, 6508 title = {Green computing on graphics processing units}, 6509 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 6510 journal = {Concurrency and Computation: Practice and Experience}, 6511 year = {2015}, 6512 publisher = {Wiley Online Library}, 6513 petsc_uses = {KSP} 6514} 6515 6516@InProceedings{ yanrhodes11, 6517 author = {Yan, Baoqiang and Rhodes, Philip J.}, 6518 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 6519 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 6520 series = {ICPP '11}, 6521 pages = {355--364}, 6522 year = {2011}, 6523 isbn = {978-0-7695-4510-3}, 6524 numpages = {10}, 6525 doi = {10.1109/ICPP.2011.70}, 6526 acmid = {2066965}, 6527 publisher = {IEEE Computer Society}, 6528 address = {Washington, DC, USA}, 6529 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 6530 petsc_uses = {KSP} 6531} 6532 6533@Article{ hakansson2013mdstochasticliouville, 6534 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 6535 Stulz, Eugen}, 6536 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 6537 equation study}, 6538 journal = {Phys. Chem. Chem. Phys.}, 6539 year = {2013}, 6540 volume = {15}, 6541 issue = {26}, 6542 pages = {10930-10941}, 6543 publisher = {The Royal Society of Chemistry}, 6544 doi = {10.1039/C3CP50788B}, 6545 petsc_uses = {KSP} 6546} 6547 6548@Article{ hakansson2011stochasticliouville, 6549 author = {Hakansson, Par and Nair, Prasanth B.}, 6550 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 6551 form}, 6552 journal = {Phys. Chem. Chem. Phys.}, 6553 year = {2011}, 6554 volume = {13}, 6555 issue = {20}, 6556 pages = {9578-9589}, 6557 publisher = {The Royal Society of Chemistry}, 6558 doi = {10.1039/C1CP20400A}, 6559 petsc_uses = {KSP} 6560} 6561 6562@InProceedings{ wang:lee:scidac2011, 6563 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 6564 McInnes and Todd Munson and Barry Smith}, 6565 title = {A Differential Variational Inequality Approach for the Simulation of 6566 Heterogeneous Materials}, 6567 booktitle = {Proceedings of SciDAC 2011 Conference}, 6568 year = {2011}, 6569 petsc_uses = {KSP} 6570} 6571 6572@Article{ bourdinlarsenrichardson2011, 6573 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 6574 title = {A time-discrete model for dynamic fracture based on crack regularization}, 6575 journal = {International Journal of Fracture}, 6576 volume = {168}, 6577 issue = {2}, 6578 pages = {133--143}, 6579 doi = {10.1007/s10704-010-9562-x}, 6580 year = {2011}, 6581 petsc_uses = {KSP} 6582} 6583 6584@Article{ bourdinfrancfortmarigo2008, 6585 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 6586 title = {The Variational Approach to Fracture}, 6587 journal = {J. Elasticity}, 6588 volume = {91}, 6589 issue = {1}, 6590 pages = {1--148}, 6591 doi = {10.1007/s10659-007-9107-3}, 6592 year = {2008}, 6593 petsc_uses = {KSP} 6594} 6595 6596@Article{ lahtinen2008spectrum, 6597 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 6598 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 6599 J.K.}, 6600 journal = {Annals of Physics}, 6601 volume = {323}, 6602 number = {9}, 6603 pages = {2286--2310}, 6604 year = {2008}, 6605 publisher = {Elsevier}, 6606 petsc_uses = {KSP} 6607} 6608 6609@InProceedings{ roark2004discriminative, 6610 title = {Discriminative language modeling with conditional random fields and the 6611 perceptron algorithm}, 6612 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 6613 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 6614 Linguistics}, 6615 pages = {47}, 6616 year = {2004}, 6617 organization = {Association for Computational Linguistics}, 6618 petsc_uses = {KSP} 6619} 6620 6621@Article{ roark2007discriminative, 6622 title = {Discriminative n-gram language modeling}, 6623 author = {Roark, B. and Saraclar, M. and Collins, M.}, 6624 journal = {Computer Speech \& Language}, 6625 volume = {21}, 6626 number = {2}, 6627 pages = {373--392}, 6628 year = {2007}, 6629 publisher = {Elsevier}, 6630 petsc_uses = {KSP} 6631} 6632 6633@Conference{ garcia2011parallel, 6634 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 6635 nanodevice simulators}}, 6636 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 6637 Aldegunde, M.}, 6638 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 6639 pages = {1--4}, 6640 organization = {IEEE}, 6641 petsc_uses = {KSP} 6642} 6643 6644@Conference{ wesley2006parallel, 6645 title = {{A parallel artificial neural network implementation}}, 6646 author = {Wesley-Smith, I.}, 6647 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 6648 year = {2006}, 6649 petsc_uses = {KSP} 6650} 6651 6652@Article{ hcsw1, 6653 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 6654 title = {Parallel {N}ewton--{K}rylov--{S}chwarz algorithms for the three-dimensional 6655 {P}oisson--{B}oltzmann equation in numerical simulation of colloidal particle 6656 interactions}, 6657 journal = {Computer Physics Communications}, 6658 volumne = {181}, 6659 year = {2010}, 6660 pages = {1529--1537}, 6661 petsc_uses = {KSP} 6662} 6663 6664@Article{ hh1, 6665 author = {C.-Y. Huang and F.-N. Hwang}, 6666 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 6667 bifurcation analysis of incompressible sudden expansion flows}, 6668 journal = {Applied Numerical Mathematics}, 6669 volume = {60}, 6670 year = {2010}, 6671 pages = {738--751}, 6672 petsc_uses = {KSP} 6673} 6674 6675@Article{ hwhw1, 6676 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 6677 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 6678 polynomial eigenvalue problems in quantum dot simulation}, 6679 journal = {Journal of Computational Physics}, 6680 volume = {229}, 6681 year = {2010}, 6682 pages = {2932--2947}, 6683 petsc_uses = {KSP} 6684} 6685 6686@Article{ wei2011parallel, 6687 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 6688 Application in Quantum Dot Simulation}}, 6689 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 6690 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 6691 pages = {157--164}, 6692 year = {2011}, 6693 publisher = {Springer}, 6694 petsc_uses = {KSP} 6695} 6696 6697@Article{ flores2007sequential, 6698 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 6699 equation using second-degree iterative methods}}, 6700 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 6701 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 6702 pages = {426--438}, 6703 year = {2007}, 6704 publisher = {Springer}, 6705 petsc_uses = {KSP} 6706} 6707 6708@InProceedings{ gordonbell09, 6709 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 6710 Siegel and Won Sik Yang}, 6711 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 6712 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 6713 note = {{SC'09 Gordon Bell} Prize Finalist}, 6714 year = {2009}, 6715 petsc_uses = {KSP} 6716} 6717 6718@Article{ knepleykarpeevdavidovitseisenberggillespie10, 6719 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 6720 Eisenberg and Dirk Gillespie}, 6721 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 6722 Dimensions: Ionic Solutions}, 6723 journal = {Journal of Physical Chemistry}, 6724 volume = {132}, 6725 number = {12}, 6726 pages = {124101--124111}, 6727 url = {http://arxiv.org/abs/0910.1531}, 6728 year = {2010}, 6729 petsc_uses = {KSP} 6730} 6731 6732@Article{ knepleykarpeeveisenberggillespie09, 6733 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 6734 D.}, 6735 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 6736 Functional Theory Approach}}, 6737 journal = {Biophysical Journal}, 6738 month = feb, 6739 volume = {96}, 6740 pages = {661}, 6741 doi = {10.1016/j.bpj.2008.12.3494}, 6742 year = {2009}, 6743 petsc_uses = {KSP} 6744} 6745 6746@Article{ scx2008, 6747 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 6748 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 6749 CONCRETE}, 6750 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 6751 volume = {3}, 6752 number = {4}, 6753 year = {2006}, 6754 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 6755 petsc_uses = {KSP} 6756} 6757 6758@TechReport{ kdgs2008, 6759 year = {2008}, 6760 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 6761 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 6762 Chips}, 6763 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 6764 Stortia}, 6765 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 6766 petsc_uses = {KSP} 6767} 6768 6769@Article{ springerlink:10.1007/s10915-011-9551-x, 6770 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 6771 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 6772 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 6773 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 6774 Coupled FEM/SBFEM Approach}, 6775 journal = {Journal of Scientific Computing}, 6776 publisher = {Springer Netherlands}, 6777 issn = {0885-7474}, 6778 keyword = {Mathematics and Statistics}, 6779 pages = {1-22}, 6780 doi = {10.1007/s10915-011-9551-x}, 6781 petsc_uses = {KSP} 6782} 6783 6784@TechReport{ jj2007, 6785 author = {Boris Jeremic and Guanzhou Jie}, 6786 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 6787 Problems Report}, 6788 institution = {UCD CompGeoMech 02--2007}, 6789 year = {2007}, 6790 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 6791 petsc_uses = {KSP} 6792} 6793 6794@Unpublished{ kuiper08, 6795 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 6796 author = {Rolf Kuiper}, 6797 institution = {Max-Planck-Institute for Astronomy}, 6798 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 6799 year = {2008}, 6800 petsc_uses = {KSP} 6801} 6802 6803@Article{ williamson2012multidimensional, 6804 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 6805 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 6806 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 6807 journal = {Journal of Nuclear Materials}, 6808 volume = {423}, 6809 number = {1}, 6810 pages = {149--163}, 6811 year = {2012}, 6812 publisher = {Elsevier}, 6813 petsc_uses = {KSP} 6814} 6815 6816@InProceedings{ kucukboyaci2015cobra, 6817 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 6818 analysis}, 6819 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 6820 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 6821 Nuclear Applications and the Monte Carlo Method}, 6822 pages = {1--18}, 6823 year = {2015}, 6824 petsc_uses = {KSP} 6825} 6826 6827@Article{ hales2012solving, 6828 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 6829 {K}rylov Method}, 6830 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 6831 M.R.}, 6832 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 6833 volume = {84}, 6834 number = {2}, 6835 pages = {123--153}, 6836 year = {2012}, 6837 publisher = {Tech Science Press}, 6838 petsc_uses = {KSP} 6839} 6840 6841@InProceedings{ srksyp2008, 6842 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 6843 Palmiotti}, 6844 title = {Fast reactor core simulations using the {UNIC} code}, 6845 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 6846 Power: A Sustainable Resource}, 6847 year = {2008}, 6848 petsc_uses = {KSP} 6849} 6850 6851@InProceedings{ psrlkssl2007, 6852 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 6853 Siegel and B. Smith and E. E. Lewis}, 6854 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 6855 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 6856 Supercomputing in Nuclear Applications}, 6857 year = {2007}, 6858 petsc_uses = {KSP} 6859} 6860 6861@InProceedings{ sprkssl2007, 6862 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 6863 Smith and E. E. Lewis}, 6864 title = {{PNFE} Component of the {UNIC} Code}, 6865 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 6866 Supercomputing in Nuclear Applications}, 6867 year = {2007}, 6868 petsc_uses = {KSP} 6869} 6870 6871@InProceedings{ dc-oop-03, 6872 author = {H. Digonnet and T. Coupez}, 6873 title = {Object-oriented programming for fast-and-easy development of parallel 6874 applications in forming processes simulation}, 6875 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 6876 Mechanics}, 6877 year = {2003}, 6878 petsc_uses = {KSP} 6879} 6880 6881@InProceedings{ dc-cfm-03, 6882 author = {H. Digonnet and T. Coupez}, 6883 title = {Calcul parallele en mise en forme des materiaux}, 6884 booktitle = {XVIeme Congres Francais de Mecanique}, 6885 year = {2003}, 6886 petsc_uses = {KSP} 6887} 6888 6889@InProceedings{ dsc-pcsev-04, 6890 author = {H. Digonnet and L. Silva and T. Coupez}, 6891 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 6892 booktitle = {Proceedings of ECCOMAS 2004}, 6893 year = {2004}, 6894 petsc_uses = {KSP} 6895} 6896 6897@InProceedings{ dsc-pca3fs-04, 6898 author = {H. Digonnet and L. Silva and T. Coupez}, 6899 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 6900 booktitle = {Proceedings of WCCM VI}, 6901 year = {2004}, 6902 petsc_uses = {KSP} 6903} 6904 6905@InProceedings{ dbcs-cpaac-05, 6906 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 6907 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 6908 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 6909 year = {2005}, 6910 petsc_uses = {KSP} 6911} 6912 6913@Article{ sz2010, 6914 author = {B. Smith and H. Zhang}, 6915 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 6916 Performance}, 6917 journal = {International Journal of High Performance Computing Applications}, 6918 volume = {25}, 6919 number = {4}, 6920 pages = {386--391}, 6921 year = {2011}, 6922 petsc_uses = {KSP} 6923} 6924 6925@Article{ zssz2006, 6926 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 6927 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 6928 journal = {TOMS}, 6929 url = {http://math.nist.gov/toms/Current.html#v33n2}, 6930 volumne = {33}, 6931 number = {2}, 6932 year = {2007}, 6933 petsc_uses = {KSP} 6934} 6935 6936@Article{ gs2006, 6937 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 6938 title = {The detachment of a viscous drop in a viscous solution in the presence of a 6939 soluble surfactant}, 6940 journal = {Phys. Fluids}, 6941 volume = {18}, 6942 year = {2006}, 6943 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 6944 petsc_uses = {KSP} 6945} 6946 6947@Article{ jmemsci, 6948 author = {Bo Zhou and Adam Powell}, 6949 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 6950 of Polymeric Membranes in 2D and 3D}, 6951 journal = {J. Membrane Sci.}, 6952 volume = {268}, 6953 number = {2}, 6954 pages = {150--164}, 6955 year = {2006}, 6956 month = jan, 6957 day = {15}, 6958 doi = {10.1016/j.memsci.2005.05.030}, 6959 petsc_uses = {KSP} 6960} 6961 6962@InProceedings{ vbde2002, 6963 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 6964 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 6965 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 6966 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 6967 year = {2002}, 6968 petsc_uses = {KSP} 6969} 6970 6971@InProceedings{ wid2005, 6972 author = {Alexander I. Bobenko and Peter Schrader}, 6973 title = {Discrete Willmore Flow}, 6974 booktitle = {Eurographics Symposium on Geometry Processing}, 6975 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 6976 year = {2005}, 6977 editor = {M. Desbrun and H. Pottmann}, 6978 petsc_uses = {KSP} 6979} 6980 6981@Article{ stj2003, 6982 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 6983 journal = {International Journal for Numerical Methods in Fluids}, 6984 volume = {41}, 6985 issue = {4}, 6986 title = {A numerical method for inverse design based on the inverse Euler equations}, 6987 year = {2003}, 6988 pages = {339--355}, 6989 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 6990 petsc_uses = {KSP} 6991} 6992 6993@PhDThesis{ as2001, 6994 author = {ANDREA SCASCIGHINI}, 6995 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 6996 Inverse Euler Equations}, 6997 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 6998 year = {2001}, 6999 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 7000 petsc_uses = {KSP} 7001} 7002 7003@Article{ hb2005, 7004 author = {E. McKay Hyde and Oscar P. Bruno}, 7005 journal = {Journal of Computational Physics}, 7006 volume = {202}, 7007 title = {A fast, higher-order solver for scattering by penetrable bodies in three 7008 dimensions}, 7009 year = {2005}, 7010 pages = {236--261}, 7011 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 7012 petsc_uses = {KSP} 7013} 7014 7015@MastersThesis{ d2002, 7016 author = {Matthew F Dixon}, 7017 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 7018 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 7019 school = {READING UNIVERSITY}, 7020 year = {2002}, 7021 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 7022 petsc_uses = {KSP} 7023} 7024 7025@TechReport{ gzb, 7026 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 7027 title = {Fast Parallel PageRank: A Linear System Approach}, 7028 institution = {Stanford University}, 7029 year = {2004}, 7030 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 7031 petsc_uses = {KSP} 7032} 7033 7034@PhDThesis{ yergeau-99, 7035 author = {Daniel W. Yergeau}, 7036 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 7037 SEMICONDUCTORS}, 7038 school = {Stanford}, 7039 year = {1999}, 7040 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 7041 petsc_uses = {KSP} 7042} 7043 7044@InProceedings{ rathkopf-miller-00, 7045 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 7046 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 7047 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 7048 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 7049 year = {2000}, 7050 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 7051 Physics and Mathematics and Computation into the Next Millennium}, 7052 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 7053 lab = {LLNL}, 7054 petsc_uses = {KSP} 7055} 7056 7057@Article{ bonfi-palma-pas-05, 7058 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 7059 journal = {Journal of Turbomachinery}, 7060 volume = {127}, 7061 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 7062 year = {2005}, 7063 pages = {395-401}, 7064 petsc_uses = {KSP} 7065} 7066 7067@InProceedings{ fettig-sobh-05, 7068 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 7069 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 7070 year = {2005}, 7071 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 7072 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 7073 petsc_uses = {KSP} 7074} 7075 7076@TechReport{ melnikov-matagne-05, 7077 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 7078 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 7079 title = {Spin configurations in circular and rectangular vertical quantum dots in a 7080 magnetic field: Three-dimensional self-consistent simulation}, 7081 year = {2005}, 7082 number = {Arxiv preprint cond-mat/0506585}, 7083 url = {http://arxiv.org/pdf/cond-mat/0506585}, 7084 petsc_uses = {KSP} 7085} 7086 7087@InProceedings{ richard-smedley-03, 7088 author = {Richard P. Smedley-Stevenson}, 7089 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 7090 year = {2003}, 7091 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 7092 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 7093 petsc_uses = {KSP} 7094} 7095 7096@Article{ guan-godoy-ravaioli-03, 7097 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 7098 journal = {Journal of Computational Electronics}, 7099 volume = {2}, 7100 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 7101 for Transport in a Silicon Quantum Wire Structure}, 7102 year = {2003}, 7103 pages = {335--339}, 7104 petsc_uses = {KSP} 7105} 7106 7107@Article{ ovtchinnikovcai04, 7108 author = {S. Ovtchinnikov and X.-C. Cai}, 7109 journal = {Numer. Lin. Alg. Applics}, 7110 volume = {11}, 7111 title = {One-level {N}ewton--{K}rylov--{S}chwarz algorithm for unsteady nonlinear radiation 7112 diffusion problem}, 7113 year = {2004}, 7114 pages = {867--881}, 7115 petsc_uses = {KSP} 7116} 7117 7118@Article{ mixedstress, 7119 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 7120 author = {Adam Powell and David Dussault}, 7121 journal = {Appl. Numer. Anal. Comp. Math.}, 7122 volume = {2}, 7123 number = {1}, 7124 year = {2005}, 7125 pages = {157--166}, 7126 petsc_uses = {KSP} 7127} 7128 7129@Article{ dhh2005, 7130 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 7131 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 7132 journal = {International Journal for Computation and Mathematics in Electrical and 7133 Electronic Engineering (COMPEL)}, 7134 year = {2005}, 7135 petsc_uses = {KSP} 7136} 7137 7138@Article{ dhh2004, 7139 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 7140 title = {Finite element modelling of ion convection by electrostatic forces}, 7141 journal = {IEE Proceedings Science, Measurement and Technology}, 7142 year = {2004}, 7143 volume = {151}, 7144 number = {6}, 7145 petsc_uses = {KSP} 7146} 7147 7148@Article{ adams-07b, 7149 author = {Adams M.F.}, 7150 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 7151 Frequency Response Analysis in Solid Mechanics}, 7152 journal = {Computional Mechanics}, 7153 year = {2007}, 7154 volume = {39}, 7155 number = {4}, 7156 pages = {497-507}, 7157 petsc_uses = {KSP} 7158} 7159 7160@InProceedings{ wc2004, 7161 author = {A. Wheelock and D. Cooke}, 7162 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 7163 Dimensions}, 7164 year = {2004}, 7165 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 7166 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 7167 petsc_uses = {KSP} 7168} 7169 7170@InProceedings{ allard-gouranton-ipts2002, 7171 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 7172 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 7173 year = {2002}, 7174 booktitle = {Immersive Projection Technology Symposium}, 7175 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 7176 petsc_uses = {KSP} 7177} 7178 7179@Article{ icc, 7180 author = {D Ioan and G Ciuprina and C Ciobotaru}, 7181 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 7182 journal = {IEEE Transactions on Magnetics}, 7183 year = {2000}, 7184 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 7185 petsc_uses = {KSP} 7186} 7187 7188@InProceedings{ hs1, 7189 author = {Brian J. Henz and Dale R. Shires}, 7190 title = {Development and Performance Analysis of a Parallel Finite Element Application 7191 Implemented in an Object-Oriented Programming Framework}, 7192 year = {2003}, 7193 booktitle = {PDPTA 2003}, 7194 pages = {1286-1292}, 7195 note = {Resin Transfer Modeling}, 7196 petsc_uses = {KSP} 7197} 7198 7199@TechReport{ b2000, 7200 author = {Rickard Bergstrom}, 7201 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 7202 year = {2000}, 7203 institution = {Chalmers}, 7204 number = {2000-05}, 7205 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 7206 petsc_uses = {KSP} 7207} 7208 7209@Article{ fs2004, 7210 author = {Petri Fast and Michael J. Shelley}, 7211 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 7212 Shaw Flow}, 7213 journal = {Journal of Computational Physics}, 7214 year = {2004}, 7215 volume = {195}, 7216 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 7217 pages = {117-142}, 7218 petsc_uses = {KSP} 7219} 7220 7221@MastersThesis{ wallach, 7222 author = {Hanna Wallach}, 7223 title = {Efficient Training of Conditional Random Fields}, 7224 school = {University of Edinburgh}, 7225 year = {2002}, 7226 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 7227 }osborne/msc-projects/wallach.ps.gz}, 7228 petsc_uses = {KSP} 7229} 7230 7231@Article{ something, 7232 author = {T Rylander and A Bondeson}, 7233 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 7234 equations}, 7235 journal = {Journal of Computational Physics}, 7236 year = {2002}, 7237 volume = {179}, 7238 pages = {426-438}, 7239 petsc_uses = {KSP} 7240} 7241 7242@TechReport{ uf1, 7243 author = {Uwe Fabricius}, 7244 title = {Comparison of two implementations of {AMG}-preconditioned {CG} considering an 7245 electrostatic problem}, 7246 year = {2004}, 7247 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 7248 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 7249 number = {04-1}, 7250 petsc_uses = {KSP} 7251} 7252 7253@InBook{ sg1, 7254 author = {Natalia Seoane and A.J.Garca-Loureiro}, 7255 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 7256 Equation}, 7257 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 7258 title = {Lecture Notes in Computer Science}, 7259 publisher = {Springer-Verlag}, 7260 volume = {3037}, 7261 year = {2004}, 7262 petsc_uses = {KSP} 7263} 7264 7265@Article{ nikyilmazgivisheikhipope10, 7266 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 7267 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 7268 journal = {AIAA Journal}, 7269 volume = {48}, 7270 number = {7}, 7271 pages = {1513--1522}, 7272 year = {2010}, 7273 petsc_uses = {KSP} 7274} 7275 7276@Article{ nikyilmazsheikhigivi10, 7277 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 7278 title = {Grid Resolution Effects on VSFMDF/LES}, 7279 journal = {Flow, Turbulence and Combustion}, 7280 doi = {10.1007/s10494-010-9272-5}, 7281 year = {2010}, 7282 petsc_uses = {KSP} 7283} 7284 7285@Article{ idema2013towards, 7286 title = {Towards faster solution of large power flow problems}, 7287 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 7288 and van der Sluis, Lou}, 7289 journal = {Power Systems, IEEE Transactions on}, 7290 volume = {28}, 7291 number = {4}, 7292 pages = {4918--4925}, 7293 year = {2013}, 7294 publisher = {IEEE}, 7295 petsc_uses = {KSP} 7296} 7297 7298@Article{ 6026245, 7299 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 7300 journal = {Power Systems, IEEE Transactions on}, 7301 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 7302 year = {2012}, 7303 month = feb, 7304 volume = {27}, 7305 number = {1}, 7306 pages = {390-396}, 7307 doi = {10.1109/TPWRS.2011.2165860}, 7308 issn = {0885-8950}, 7309 petsc_uses = {KSP} 7310} 7311 7312@Book{ idema2014computational, 7313 title = {Computational Methods in Power System Analysis}, 7314 author = {Idema, Reijer and Lahaye, Domenico JP}, 7315 year = {2014}, 7316 publisher = {Springer}, 7317 petsc_uses = {KSP} 7318} 7319 7320@PhDThesis{ abhyankar2011thesis, 7321 author = {Shrirang Abhyankar}, 7322 title = {Development of an implicitly coupled electromechanical and electromagnetic 7323 transients simulator for power systems}, 7324 school = {Illinois Institute of Technology}, 7325 year = {2011}, 7326 petsc_uses = {KSP} 7327} 7328 7329@InProceedings{ abhyankarhipcna11-1, 7330 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 7331 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 7332 year = {2011}, 7333 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7334 Networking and Analytics for the Power Grid}, 7335 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 7336 publisher = {ACM}, 7337 petsc_uses = {KSP} 7338} 7339 7340@InProceedings{ abhyankarhipcna11-2, 7341 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 7342 title = {Development of a parallel three-phase transient stability simulator for power 7343 systems}, 7344 year = {2011}, 7345 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7346 Networking and Analytics for the Power Grid}, 7347 publisher = {ACM}, 7348 petsc_uses = {KSP} 7349} 7350 7351@InProceedings{ abhyankarpesgeneral2012, 7352 author = {Shrirang Abhyankar and A. Flueck}, 7353 title = {An implicitly-coupled solution approach for combined electromechanical and 7354 electromagnetic transients simulation}, 7355 year = {2012}, 7356 booktitle = {Proceedings of the IEEE PES General Meeting}, 7357 publisher = {IEEE}, 7358 petsc_uses = {KSP} 7359} 7360 7361@Article{ idemalahayevuiksluis2012, 7362 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 7363 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 7364 journal = {IEEE Transactions on Power Systems}, 7365 year = {2012}, 7366 volume = {27}, 7367 pages = {390-396}, 7368 petsc_uses = {KSP} 7369} 7370 7371@Article{ korrestzavellasgalinas2013, 7372 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 7373 title = {A distributed implementation of multi-area power system state estimation on a 7374 cluster of computers }, 7375 journal = {Electric Power Systems Research }, 7376 volume = {102}, 7377 number = {0}, 7378 pages = {20 - 32}, 7379 year = {2013}, 7380 issn = {0378-7796}, 7381 doi = {10.1016/j.epsr.2013.04.002}, 7382 petsc_uses = {KSP} 7383} 7384 7385% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7386% LiteralHTML:<font color="#FF0000"> 7387% LiteralHTML: Material failure, for example, cracking of steel beams resulting 7388% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 7389% LiteralHTML: are important for prediction and prevention. PETSc has been used 7390% LiteralHTML: in a variety of studies of material failure.</p> 7391% LiteralHTML:</font> 7392% LiteralHTML: 7393@InProceedings{ gray2, 7394 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 7395 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 7396 year = {2004}, 7397 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 7398 petsc_uses = {KSP} 7399} 7400 7401@InProceedings{ gray1, 7402 author = {J. Gray and and C. Homescu and L. Petzold and Richard Alkire}, 7403 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 7404 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 7405 year = {2003}, 7406 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 7407 petsc_uses = {KSP} 7408} 7409 7410@InProceedings{ crack2, 7411 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 7412 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 7413 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 7414 Conference}, 7415 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 7416 year = {2003}, 7417 petsc_uses = {KSP} 7418} 7419 7420@TechReport{ hdams1, 7421 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 7422 Lynd Stringer}, 7423 title = {Fracture Mechanics on the Intel Itanium Architecture}, 7424 year = {2001}, 7425 institution = {Intel Corporation}, 7426 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 7427 petsc_uses = {KSP} 7428} 7429 7430@InProceedings{ ihwi, 7431 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 7432 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 7433 booktitle = {International Conference ON Computational Engineering and Sciences}, 7434 year = {2002}, 7435 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 7436 petsc_uses = {KSP} 7437} 7438 7439@InProceedings{ crack, 7440 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 7441 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 7442 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 7443 and Paul A. Wawrzynek}, 7444 title = {Parallel FEM Simulation of Crack Propagation}, 7445 booktitle = {Proceedings of Irregular 2000}, 7446 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 7447 year = {2000}, 7448 petsc_uses = {KSP} 7449} 7450 7451@InProceedings{ beaudoin98, 7452 author = {A. J. Beaudoin}, 7453 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 7454 booktitle = {Simulation of materials processing: Theory, methods, and applications - 7455 Proceedings of the Sixth International Conference, NUMIFORM'98}, 7456 editor = {J. Hu\'etink and F. P. T. Baaijens}, 7457 optvolume = {}, 7458 optnumber = {}, 7459 optseries = {}, 7460 year = {1998}, 7461 optorganization={}, 7462 publisher = {A. A. Balkema Publishers}, 7463 address = {Rotterdam, Netherlands}, 7464 month = jun, 7465 optpages = {}, 7466 petsc_uses = {KSP} 7467} 7468 7469% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7470@TechReport{ defordheld1, 7471 author = {JF DeFord and BL Held}, 7472 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 7473 year = {2002}, 7474 institution = {Simulation Technology and Applied Research}, 7475 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 7476 note = {Discusses their parallel commercial solver that uses PETSc}, 7477 petsc_uses = {KSP} 7478} 7479 7480@PhDThesis{ sande2003, 7481 author = {Hans Vande Sande}, 7482 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 7483 Quasi-Static Electromagnetic Systems}, 7484 school = {Katholieke Universiteit Leuven, Belgium}, 7485 year = {2003}, 7486 petsc_uses = {KSP} 7487} 7488 7489@Article{ sdchh2004, 7490 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 7491 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 7492 Tolerance}, 7493 journal = {IEEE Transactions on Magnetics}, 7494 year = {2004}, 7495 volume = {40}, 7496 pages = {1306--1309}, 7497 petsc_uses = {KSP} 7498} 7499 7500@Article{ holst-lindblom-etal:2004, 7501 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 7502 Scheel and Lawrence E. Kidder}, 7503 title = {Optimal constraint projection for hyperbolic evolution systems, }, 7504 journal = {Phys. Rev. D}, 7505 year = {2004}, 7506 volume = {70}, 7507 pages = {084017}, 7508 petsc_uses = {KSP} 7509} 7510 7511@Article{ marm2005, 7512 author = {Matthew Anderson and Richard A. Matzner}, 7513 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 7514 journal = {Foundations of Physics}, 7515 volume = {35}, 7516 pages = {1572--9516}, 7517 year = {2005}, 7518 petsc_uses = {KSP} 7519} 7520 7521@Article{ cook-pfeiffer:2004, 7522 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 7523 title = {Excision boundary conditions for black hole initial data}, 7524 journal = {Phys. Rev. D}, 7525 volume = {70}, 7526 pages = {104016--24}, 7527 year = {2004}, 7528 petsc_uses = {KSP} 7529} 7530 7531@Article{ pfeiffer-kidder-etal:2005, 7532 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 7533 Shoemaker}, 7534 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 7535 journal = {Phys. Rev. D}, 7536 year = {2005}, 7537 volume = {71}, 7538 pages = {024020}, 7539 petsc_uses = {KSP} 7540} 7541 7542@Article{ pfeiffer-kidder-etal:2003, 7543 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 7544 Saul A.}, 7545 title = {A multidomain spectral method for solving elliptic equations}, 7546 journal = {CPC}, 7547 year = {2003}, 7548 volume = {152}, 7549 pages = {253--273}, 7550 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 7551 For a related online version, see arXiv:gr-qc/0202096}, 7552 petsc_uses = {KSP} 7553} 7554 7555@Article{ pfeiffer-cook-teukolsky:2002, 7556 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 7557 title = {Comparing initial-data sets for binary black hole}, 7558 journal = {PRD}, 7559 year = {2002}, 7560 volume = {66}, 7561 pages = {024047}, 7562 note = {for a related online version, seearXiv:gr-qc/0203085}, 7563 petsc_uses = {KSP} 7564} 7565 7566@PhDThesis{ pfeiffer:2003, 7567 author = {Pfeiffer, Harald P.}, 7568 title = {Initial Data for Black Hole Evolutions}, 7569 school = {Cornell University}, 7570 year = {2003}, 7571 petsc_uses = {KSP} 7572} 7573 7574@TechReport{ h1, 7575 author = {Erik Schnetter}, 7576 title = {A fast apparent horizon algorithm}, 7577 year = {2002}, 7578 number = {Arxiv preprint gr-qc/0206003}, 7579 url = {http://arxiv.org/pdf/gr-qc/0206003}, 7580 petsc_uses = {KSP} 7581} 7582 7583@Article{ h2, 7584 author = {Erik Schnetter}, 7585 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 7586 year = {2003}, 7587 journal = {Class. Quantum Grav.}, 7588 pages = {4719-4737}, 7589 volume = {20}, 7590 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 7591 petsc_uses = {KSP} 7592} 7593 7594@Article{ adams-03a, 7595 author = {Adams, M.~F.}, 7596 journal = {Numerical Linear Algebra with Applications}, 7597 number = {2-3}, 7598 pages = {141-153}, 7599 title = {Algebraic multigrid methods for constrained linear systems with applications to 7600 contact problems in solid mechanics}, 7601 volume = {11}, 7602 year = {2004}, 7603 petsc_uses = {KSP} 7604} 7605 7606@Article{ vandesande1, 7607 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 7608 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 7609 year = {2003}, 7610 volume = {39}, 7611 pages = {1709--1712}, 7612 title = {Solving Nonlinear Magnetic Problems Using {N}ewton Trust Region Methods}, 7613 petsc_uses = {KSP} 7614} 7615 7616@InProceedings{ vbde1, 7617 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 7618 year = {2002}, 7619 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 7620 Uintah PSE}, 7621 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 7622 2002}, 7623 pages = {49-55}, 7624 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7625 note = {Extended abstract}, 7626 petsc_uses = {KSP} 7627} 7628 7629@Unpublished{ ep1, 7630 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 7631 author = {Bradley R. Eccleston and Todd S. Palmer}, 7632 institution = {Department of Nuclear Engineering, Oregon State University}, 7633 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 7634 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 7635 Parallel Simulations}, 7636 year = {1999}, 7637 petsc_uses = {KSP} 7638} 7639 7640@InProceedings{ teo2007scalable, 7641 title = {A scalable modular convex solver for regularized risk minimization}, 7642 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 7643 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 7644 discovery and data mining}, 7645 pages = {727--736}, 7646 year = {2007}, 7647 organization = {ACM}, 7648 petsc_uses = {KSP} 7649} 7650 7651@InProceedings{ rm02, 7652 author = {Robert Malouf}, 7653 year = {2002}, 7654 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 7655 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 7656 (CoNLL-2002)}, 7657 pages = {49-55}, 7658 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 7659 petsc_uses = {KSP} 7660} 7661 7662@Unpublished{ hrv02, 7663 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 7664 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7665 note = {Submitted to CMMSE}, 7666 petsc_uses = {KSP} 7667} 7668 7669@Article{ tmh2001, 7670 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 7671 journal = {Journal of Economic Dynamics and Control}, 7672 year = {2002}, 7673 volume = {26}, 7674 pages = {1499-1515}, 7675 title = {Solving finite difference schemes arising in trivariate option pricing}, 7676 petsc_uses = {KSP} 7677} 7678 7679@InProceedings{ a2, 7680 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 7681 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 7682 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 7683 Methods}, 7684 editor = {C.-H. Lai et al.}, 7685 publisher = {Domain Decomposition Press, Bergen}, 7686 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 7687 year = {1999}, 7688 petsc_uses = {KSP} 7689} 7690 7691@Unpublished{ mmmdcmaa-web-page, 7692 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 7693 {A}coustics {W}eb Page}, 7694 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 7695 author = {David E. Keyes}, 7696 institution = {Old Dominion University}, 7697 petsc_uses = {KSP} 7698} 7699 7700@Conference{ liu2010parallelization, 7701 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 7702 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 7703 booktitle = {International Symposium on Parallel and Distributed Processing with 7704 Applications}, 7705 pages = {528--535}, 7706 year = {2010}, 7707 organization = {IEEE}, 7708 petsc_uses = {KSP} 7709} 7710 7711@Unpublished{ oil-reservoir-sim-web-page, 7712 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 7713 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 7714 institution = {University of Texas at Austin and Argonne National Laboratory}, 7715 key = {University of Texas at Austin and Argonne National Laboratory}, 7716 petsc_uses = {KSP} 7717} 7718 7719@Article{ tmh2001b, 7720 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 7721 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 7722 year = {2001}, 7723 volume = {37}, 7724 pages = {143--146}, 7725 title = {Adapting EMAP3D to parallel processing}, 7726 petsc_uses = {KSP} 7727} 7728 7729@Article{ harbury98, 7730 author = {HK Harbury and W Porod}, 7731 journal = {VLSI Design}, 7732 year = {1998}, 7733 volume = {6}, 7734 pages = {47--51}, 7735 title = {Parallel computation for electronic waves in quantum corrals}, 7736 petsc_uses = {KSP} 7737} 7738 7739@Article{ bludszuwei98, 7740 author = {Mark Bludszuweit}, 7741 journal = {Journal of Lightwave Technology}, 7742 year = {1998}, 7743 volume = {16}, 7744 number = {7}, 7745 pages = {1336--42}, 7746 title = {Mixed Finite Element Beam Propagation Method}, 7747 petsc_uses = {KSP} 7748} 7749 7750@Article{ s1, 7751 author = {J. L. Friedman and N. Stergioulas}, 7752 journal = {Astrophysics Journal}, 7753 year = {1998}, 7754 volume = {492}, 7755 number = {301}, 7756 pages = {}, 7757 title = {}, 7758 petsc_uses = {KSP} 7759} 7760 7761@Article{ s1a, 7762 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 7763 journal = {Astrophysics Journal}, 7764 year = {1999}, 7765 volume = {510}, 7766 number = {854}, 7767 pages = {}, 7768 title = {}, 7769 petsc_uses = {KSP} 7770} 7771 7772@PhDThesis{ s2, 7773 author = {N. Stergioulas}, 7774 title = {Ph. D. thesis}, 7775 year = {1996}, 7776 institution = {University of Wisconsin-Milwaukee}, 7777 petsc_uses = {KSP} 7778} 7779 7780@InProceedings{ coral1, 7781 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7782 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 7783 Parallel Computing Environment}, 7784 booktitle = {Proceedings of the Miami TEAM Workshop}, 7785 location = {Florida International University, Department of Electrical Engineering and 7786 Computing Science}, 7787 month = nov, 7788 year = {1993}, 7789 petsc_uses = {KSP} 7790} 7791 7792@InProceedings{ coral2, 7793 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7794 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 7795 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 7796 month = dec, 7797 year = {1994}, 7798 petsc_uses = {KSP} 7799} 7800 7801@InProceedings{ coral3, 7802 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7803 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 7804 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 7805 location = {Florida International University, Department of Electrical Engineering and 7806 Computing Science}, 7807 year = {1995}, 7808 petsc_uses = {KSP} 7809} 7810 7811@InProceedings{ mijalkovic, 7812 author = {Slobodan Mijalkovi\'{c}}, 7813 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 7814 Process Simulation}, 7815 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 7816 Gent, Belgium, September 27--30, 1999.}, 7817 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 7818 optvolume = {14}, 7819 optseries = {Lecture Notes in Computational Science and Engineering}, 7820 year = {2000}, 7821 publisher = {Springer}, 7822 address = {Berlin}, 7823 optpages = {179--184}, 7824 petsc_uses = {KSP} 7825} 7826 7827@Article{ bludszuwei98a, 7828 author = {Mark Bludszuweit}, 7829 journal = {Journal of Lightwave Technology}, 7830 year = {1998}, 7831 volume = {16}, 7832 number = {7}, 7833 pages = {1336--42}, 7834 title = {Mixed Finite Element Beam Propagation Method}, 7835 petsc_uses = {KSP} 7836} 7837 7838@Article{ gilli-pauletto-1998, 7839 author = {Manfred Gilli and Giorgio Pauletto}, 7840 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 7841 journal = {Computational Economics}, 7842 year = {2000}, 7843 volume = {16}, 7844 pages = {173--186}, 7845 petsc_uses = {KSP} 7846} 7847 7848% LiteralHTML: 7849% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 7850% LiteralHTML: 7851@Article{ collierdalcincalo2013, 7852 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 7853 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 7854 journal = {arxiv}, 7855 year = {2013}, 7856 number = {1305.4452}, 7857 note = {\url{http://arxiv.org/abs/1305.4452}}, 7858 petsc_uses = {KSP} 7859} 7860 7861@Article{ collierdalcinvignalcortescalo2016, 7862 title = {PetIGA: A framework for high-performance isogeometric analysis}, 7863 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 7864 Victor M. Calo}, 7865 journal = {Computer Methods in Applied Mechanics and Engineering}, 7866 year = {2016}, 7867 petsc_uses = {KSP} 7868} 7869 7870@Misc{ petiga-web-page, 7871 author = {N. Collier and L. Dalcin and V.M. Calo}, 7872 title = {{PetIGA} {W}eb page}, 7873 url = {https://bitbucket.org/dalcinl/petiga/}, 7874 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 7875 year = {2014}, 7876 petsc_uses = {KSP} 7877} 7878 7879@Article{ logg07, 7880 author = {Logg, Anders}, 7881 title = {Automating the Finite Element Method}, 7882 journal = {Archives of Computational Methods in Engineering}, 7883 volume = {14}, 7884 number = {2}, 7885 pages = {93-138}, 7886 year = {2007}, 7887 doi = {10.1007/s11831-007-9003-9}, 7888 publisher = {Kluwer Academic Publishers}, 7889 issn = {1134-3060}, 7890 language = {English}, 7891 petsc_uses = {KSP} 7892} 7893 7894@Article{ jezequelcouturierdenis12, 7895 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 7896 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 7897 versus the PETSc library}, 7898 journal = {The Journal of Supercomputing}, 7899 volume = {59}, 7900 number = {3}, 7901 pages = {1517-1532}, 7902 year = {2012}, 7903 issn = {0920-8542}, 7904 doi = {10.1007/s11227-011-0563-y}, 7905 publisher = {Springer US}, 7906 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 7907 Sparse linear solver}, 7908 language = {English}, 7909 petsc_uses = {KSP} 7910} 7911 7912@Unpublished{ feap-web-page, 7913 title = {FEAP: A Finite Element Analysis Program}, 7914 url = {http://www.ce.berkeley.edu/projects/feap/}, 7915 author = {FEAP Team}, 7916 note = {Uses PETSc linear solvers - iterative and direct}, 7917 petsc_uses = {KSP} 7918} 7919 7920@Unpublished{ parpre-web-page, 7921 title = {{ParPre} {W}eb {P}age}, 7922 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 7923 institution = {University of Tennessee}, 7924 author = {Victor Eijkhout}, 7925 note = {This is no longer supported. A set of preconditioners built on PETSc}, 7926 petsc_uses = {KSP} 7927} 7928 7929@Unpublished{ pism, 7930 title = {{PISM}: a Parallel Ice Sheet Model}, 7931 author = {{PISM Team}}, 7932 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 7933 Sheet Model). The thickness, temperature, velocity and age of the ice are all 7934 simulated, as is the deformation of the earth underneath the ice. New techniques 7935 for fast ice dynamics, earth deformation, and verification have are included.}, 7936 note = {\url{http://www.pism-docs.org/}}, 7937 petsc_uses = {KSP} 7938} 7939 7940@Unpublished{ oofem, 7941 title = {OOFEM - an object oriented finite element package}, 7942 author = {Borek Patzak}, 7943 url = {http://www.oofem.org}, 7944 petsc_uses = {KSP} 7945} 7946 7947@Unpublished{ dks2openfvm, 7948 title = {OpenFVM - a finite volume based general purpose CFD solver}, 7949 author = {Open source development}, 7950 url = {http://openfvm.sourceforge.net/}, 7951 petsc_uses = {KSP} 7952} 7953 7954@Unpublished{ sundar-2008w, 7955 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 7956 octree meshes}, 7957 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 7958 institution = {University of Pennsylvania}, 7959 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 7960 petsc_uses = {KSP} 7961} 7962 7963@Unpublished{ khatiwala07-software, 7964 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 7965 author = {Khatiwala, S.}, 7966 institution = {Columbia University}, 7967 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 7968 petsc_uses = {KSP} 7969} 7970 7971@InBook{ jiaolima99, 7972 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 7973 chapter = {{SIFFEA}:Scalable Integrated Framework for Finite Element Analysis}, 7974 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 7975 title = {Lecture Notes in Computer Science}, 7976 publisher = {Springer-Verlag}, 7977 volume = {1732}, 7978 year = {1999}, 7979 petsc_uses = {KSP} 7980} 7981 7982@Article{ crow1, 7983 author = {C. S. Crow IV}, 7984 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 7985 journal = {Hopkins Undergraduate Research Journal}, 7986 year = {2003}, 7987 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 7988 petsc_uses = {KSP} 7989} 7990 7991@Unpublished{ petsc-python, 7992 title = {PETSc for Python}, 7993 author = {L. Dalcin}, 7994 url = {https://petsc.org/main/petsc4py}, 7995 note = {Provides Python bindings for PETSc}, 7996} 7997 7998@Unpublished{ cfdship, 7999 title = {{CFDShip-Iowa}}, 8000 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 8001 institution = {University of Iowa}, 8002 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 8003 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 8004 structured grids, designed for ship applications}, 8005 petsc_uses = {KSP} 8006} 8007 8008@Unpublished{ bvw, 8009 title = {Multiflow}, 8010 author = {Berend van Wachem}, 8011 institution = {Mechanical Engineering - Chalmers University of Technology}, 8012 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 8013 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 8014 flows.}, 8015 petsc_uses = {KSP} 8016} 8017 8018@Unpublished{ dks2, 8019 title = {FENA - A Finite Element Model for the North Atlantic}, 8020 author = {Jens Schroeter}, 8021 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 8022 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 8023 petsc_uses = {KSP} 8024} 8025 8026@TechReport{ piwonski2010idea, 8027 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 8028 and Simulation in {3-D}}, 8029 author = {Piwonski, J. and Slawig, T.}, 8030 year = {2010}, 8031 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8032 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 8033 petsc_uses = {KSP} 8034} 8035 8036@Unpublished{ metos3d-web, 8037 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 8038 author = {Piwonski, J. and Slawig, T.}, 8039 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8040 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 8041 petsc_uses = {KSP} 8042} 8043 8044@Unpublished{ magpar, 8045 author = {W. Scholz}, 8046 title = {Magpar: Parallel Micromagnetics Code}, 8047 institution = {Vienna University of Technology}, 8048 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 8049 petsc_uses = {KSP} 8050} 8051 8052@Misc{ libmesh:sourceforge, 8053 author = {}, 8054 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 8055 equations on serial and parallel platforms}, 8056 note = {[Online]}, 8057 url = {http://libmesh.github.io}, 8058 petsc_uses = {KSP} 8059} 8060 8061@Misc{ moose-web-page, 8062 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 8063 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 8064 Gaston and John Peterson and Jason Miller}, 8065 institution = {Idaho National Laboratory}, 8066 howpublished = {\url{http://mooseframework.org}}, 8067 petsc_uses = {KSP} 8068} 8069 8070@Article{ gaston2009moose, 8071 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 8072 equations}, 8073 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 8074 journal = {Nuclear Engineering and Design}, 8075 volume = {239}, 8076 number = {10}, 8077 pages = {1768--1778}, 8078 year = {2009}, 8079 publisher = {Elsevier}, 8080 petsc_uses = {KSP} 8081} 8082 8083@Article{ tonks2012object, 8084 title = {An object-oriented finite element framework for multiphysics phase field 8085 simulations}, 8086 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 8087 journal = {Computational Materials Science}, 8088 volume = {51}, 8089 number = {1}, 8090 pages = {20--29}, 8091 year = {2012}, 8092 publisher = {Elsevier}, 8093 petsc_uses = {KSP} 8094} 8095 8096@Misc{ pylithmanual, 8097 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 8098 Strand and Charles Williams}, 8099 title = {{PyLith} User Manual Version 2.0.0}, 8100 year = {2014}, 8101 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 8102 petsc_uses = {KSP} 8103} 8104 8105@Misc{ pylith-web-page, 8106 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 8107 title = {{PyLith}}, 8108 year = {2012}, 8109 url = {http://geodynamics.org/resources/pylith/}, 8110 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 8111 petsc_uses = {KSP} 8112} 8113 8114@Misc{ galemanual, 8115 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 8116 title = {Gale User Manual Version 2.0.0}, 8117 year = {2011}, 8118 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 8119 petsc_uses = {KSP} 8120} 8121 8122@Unpublished{ underworld, 8123 author = {Louis Moresi}, 8124 title = {{UnderWorld}: A Geodynamics Modelling Code}, 8125 institution = {Monash University}, 8126 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 8127 petsc_uses = {KSP} 8128} 8129 8130@Article{ moresi2007computational, 8131 title = {Computational approaches to studying non-linear dynamics of the crust and 8132 mantle}, 8133 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 8134 M{\"u}hlhaus, H.B.}, 8135 journal = {Physics of the Earth and Planetary Interiors}, 8136 volume = {163}, 8137 number = {1-4}, 8138 pages = {69--82}, 8139 year = {2007}, 8140 publisher = {Elsevier}, 8141 petsc_uses = {KSP} 8142} 8143 8144@Article{ pitt2009chaste, 8145 title = {Chaste: a test-driven approach to software development for biological modelling}, 8146 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 8147 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 8148 and Walter, A. and others}, 8149 journal = {Computer Physics Communications}, 8150 volume = {180}, 8151 number = {12}, 8152 pages = {2452--2471}, 8153 year = {2009}, 8154 publisher = {Elsevier}, 8155 petsc_uses = {KSP} 8156} 8157 8158@Misc{ fenicsproject, 8159 title = {{The FEniCS project}}, 8160 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 8161 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 8162 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 8163 url = {http://fenicsproject.org}, 8164 year = {2011}, 8165 petsc_uses = {KSP} 8166} 8167 8168@Unpublished{ snark, 8169 title = {Snark: A suite of software for geoscientific applications and a philosophy of 8170 scientific software development}, 8171 institution = {Victorian Partnership for Advanced Computing}, 8172 url = {http://vpac.org/Snark}, 8173 petsc_uses = {KSP} 8174} 8175 8176@Misc{ imoose:sourceforge, 8177 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 8178 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 8179 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 8180 note = {[Online]}, 8181 url = {http://imoose.sourceforge.net}, 8182 petsc_uses = {KSP} 8183} 8184 8185@Unpublished{ fossi, 8186 author = {Stephan Frickenhaus}, 8187 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 8188 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 8189 codes}, 8190 institution = {AWI-Bremerhaven, Germanny}, 8191 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 8192 petsc_uses = {KSP} 8193} 8194 8195@Unpublished{ fun3dweb, 8196 author = {Dinesh Kaushik}, 8197 title = {PETSC-FUN3D Benchmark Page}, 8198 institution = {ODU/ANL}, 8199 url = {http://www.mcs.anl.gov/petsc-fun3d}, 8200 note = {CFD Benchmark of some solvers in PETSc}, 8201 petsc_uses = {KSP} 8202} 8203 8204@Unpublished{ scirun, 8205 author = {SCIRun Development Team}, 8206 title = {SCIRun}, 8207 institution = {University of Utah}, 8208 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 8209 note = {SCIRun now uses PETSc linear solvers}, 8210 petsc_uses = {KSP} 8211} 8212 8213@Misc{ prometheus, 8214 author = {Mark F. Adams}, 8215 title = {Prometheus - A scalable unstructured finite element solver}, 8216 institution = {Berkeley}, 8217 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 8218 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 8219 petsc_uses = {KSP} 8220} 8221 8222@Unpublished{ illuminator, 8223 author = {Adam C. Powell, IV}, 8224 title = {Illuminator Distributed Visualization Library}, 8225 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 8226 petsc_uses = {KSP} 8227} 8228 8229@Unpublished{ rheoplast, 8230 title = {RheoPlast Phase Field Multi-Physics Code}, 8231 author = {Adam Powell and David Dussault and Bo Zhou}, 8232 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 8233 petsc_uses = {KSP} 8234} 8235 8236@Misc{ tao-web-page, 8237 title = {{Toolkit for Advanced Optimization ({TAO})} {W}eb Page}, 8238 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8239 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 8240 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8241 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 8242 petsc_uses = {KSP} 8243} 8244 8245@TechReport{ tao-user-ref, 8246 title = {{Toolkit for Advanced Optimization ({TAO}) users manual}}, 8247 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8248 and Steve Benson and Lois Curfman McInnes}, 8249 institution = {Argonne National Laboratory}, 8250 year = {2019}, 8251 number = {ANL/MCS-TM-322 - Rev 3.12}, 8252 petsc_uses = {KSP} 8253} 8254 8255% url = "http://www.mcs.anl.gov/tao", 8256@Unpublished{ mefpp-web-page, 8257 title = {{MEF++} {W}eb {P}age}, 8258 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 8259 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 8260 author = {Eric Chamberland}, 8261 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 8262 multiphysics}, 8263 petsc_uses = {KSP} 8264} 8265 8266@Unpublished{ tipetsc-titanium, 8267 title = {Ti-PETSc - an interface to PETSc from Titanium}, 8268 institution = {Berkeley}, 8269 author = {He, Yun and Liblit, Bun and Lin, Chang}, 8270 url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, 8271 year = {1999}, 8272 petsc_uses = {KSP}, 8273} 8274 8275@Unpublished{ ptatin-web-page, 8276 title = {ptatin3d}, 8277 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 8278 url = {https://bitbucket.org/jedbrown/ptatin3d}, 8279 year = {2018}, 8280 petsc_uses = {KSP} 8281} 8282 8283@Misc{ multiphase-web-page, 8284 author = {Q. Zou}, 8285 title = {Multiphase flow with {PETSc}}, 8286 institution = {LANL}, 8287 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 8288 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 8289 lab = {LANL}, 8290 petsc_uses = {KSP} 8291} 8292 8293@Misc{ electromag-web-page, 8294 title = {{EMSolve Web} page}, 8295 institution = {LLNL}, 8296 howpublished = {http://www.llnl.gov/casc/emsolve}, 8297 url = {http://www.Llnl.gov/casc/emsolve}, 8298 author = {Daniel {White et al.}}, 8299 lab = {LLNL}, 8300 petsc_uses = {KSP} 8301} 8302 8303@Unpublished{ fe-software-web-page, 8304 institution = {Kuleuven}, 8305 title = {Finite element software}, 8306 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 8307 petsc_uses = {KSP} 8308} 8309 8310@Misc{ petsc-web-page, 8311 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8312 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 8313 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8314 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8315 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8316 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8317 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8318 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8319 Zhang}, 8320 title = {{PETS}c {W}eb page}, 8321 url = {https://petsc.org/}, 8322 howpublished = {\url{https://petsc.org/}}, 8323 year = {2023} 8324} 8325 8326@Unpublished{ petsc-debian-package, 8327 author = {Adam C. Powell, IV}, 8328 title = {Debian package for PETSc}, 8329 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 8330 petsc_uses = {KSP} 8331} 8332 8333@Unpublished{ cactus, 8334 title = {Cactus Website}, 8335 url = {http://www.cactuscode.org/}, 8336 note = {Provides two interface to the PETSc solvers}, 8337 petsc_uses = {KSP} 8338} 8339 8340@Unpublished{ petsc-fem, 8341 author = {Mario Storti and Norberto Nigro}, 8342 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 8343 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 8344 url = {http://www.cimec.org.ar/petscfem}, 8345 petsc_uses = {KSP} 8346} 8347 8348@Misc{ fidap, 8349 title = {FIDAP 8.5}, 8350 howpublished = {\url{http://www.fluent.com}}, 8351 url = {http://www.fluent.com}, 8352 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 8353 solves.}, 8354 key = {FIDAP 8.5}, 8355 petsc_uses = {KSP} 8356} 8357 8358@Unpublished{ slepc, 8359 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8360 Vicente Hern\'andez and Vicent Vidal}, 8361 title = {{SLEPc} Website}, 8362 url = {http://slepc.upv.es/}, 8363 note = {Scalable Library for Eigenvalue Problem Computations}, 8364 petsc_uses = {KSP} 8365} 8366 8367@TechReport{ slepc-users-manual, 8368 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8369 Vicente Hern\'andez and Vicent Vidal}, 8370 title = {{SLEPc} Users Manual}, 8371 number = {DISC-II/24/02}, 8372 url = {http://slepc.upv.es/}, 8373 note = {Scalable Library for Eigenvalue Problem Computations}, 8374 petsc_uses = {KSP} 8375} 8376 8377@Misc{ deal.ii, 8378 title = {deal.II}, 8379 howpublished = {\url{http://www.dealii.org}}, 8380 url = {http://www.dealii.org}, 8381 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 8382 It allows PETSc linear algebra and solvers to be used underneath.}, 8383 key = {deal.II 5.0}, 8384 petsc_uses = {KSP} 8385} 8386 8387@Article{ bangerth2007deal, 8388 title = {{deal.II---A general-purpose object-oriented finite element library}}, 8389 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 8390 journal = {ACM Transactions on Mathematical Software (TOMS)}, 8391 volume = {33}, 8392 number = {4}, 8393 pages = {24--es}, 8394 issn = {0098-3500}, 8395 year = {2007}, 8396 publisher = {ACM}, 8397 petsc_uses = {KSP} 8398} 8399 8400@Misc{ globalarrays, 8401 author = {Jarek {Nieplocha et al.}}, 8402 title = {Global Arrays}, 8403 institution = {Pacific Northwest National Laboratories}, 8404 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 8405 url = {http://www.emsl.pnl.gov/docs/global}, 8406 note = {Global arrays can use PETSc linear solvers}, 8407 lab = {PNNL}, 8408 petsc_uses = {KSP} 8409} 8410 8411% LiteralHTML: 8412% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 8413% LiteralHTML: 8414@Article{ petsccommunity2022, 8415 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 8416 Community}, 8417 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 8418 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 8419 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 8420 and Hong Zhang and Junchao Zhang}, 8421 journal = {Computing in Science and Engineering}, 8422 volume = {24}, 8423 number = {03}, 8424 pages = {6--15}, 8425 issn = {1558-366X}, 8426 doi = {10.1109/MCSE.2022.3169974}, 8427 publisher = {IEEE Computer Society}, 8428 address = {Los Alamitos, CA, USA}, 8429 month = may, 8430 year = {2022}, 8431 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 8432 petsc_uses = {KSP} 8433} 8434 8435@Article{ brownknepleysmith14, 8436 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 8437 title = {Run-time extensibility and librarization of simulation software}, 8438 journal = {IEEE Computing in Science and Engineering}, 8439 month = jan, 8440 volume = {17}, 8441 number = {1}, 8442 pages = {38--45}, 8443 doi = {10.1109/MCSE.2014.95}, 8444 year = {2015}, 8445 petsc_uses = {KSP} 8446} 8447 8448@TechReport{ ass2012, 8449 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 8450 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 8451 institution = {Argonne National Laboratory}, 8452 type = {Preprint}, 8453 year = {2012}, 8454 number = {ANL/MCS-P2011-0112}, 8455 petsc_uses = {KSP} 8456} 8457 8458@TechReport{ clearyknepley99, 8459 author = {Andrew Cleary and Matthew G. Knepley}, 8460 title = {Solvers as Operators}, 8461 institution = {Lawrence Livermore National Laboratory}, 8462 type = {Technical Report}, 8463 number = {UCRL-ID-135342}, 8464 year = {1999}, 8465 petsc_uses = {KSP} 8466} 8467 8468@TechReport{ smcabbkz2012, 8469 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 8470 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 8471 title = {{PETSc's} software strategy for the design space of composable extreme-scale 8472 solvers}, 8473 institution = {Argonne National Laboratory}, 8474 type = {Preprint}, 8475 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 8476 year = {2012}, 8477 number = {ANL/MCS-P2059-0312}, 8478 petsc_uses = {KSP} 8479} 8480 8481@InProceedings{ mhwpmhs2009, 8482 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 8483 and G. E. Hammond and B. Smith}, 8484 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 8485 Toolkit {MPI} at Scale}, 8486 booktitle = {Cray Users Group Conference}, 8487 year = {2009}, 8488 petsc_uses = {KSP} 8489} 8490 8491@InProceedings{ msmhls2010, 8492 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 8493 Lichtner and B. F. Smith}, 8494 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 8495 {BlueGene} Architectures}, 8496 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 8497 year = {2010}, 8498 petsc_uses = {KSP} 8499} 8500 8501@InCollection{ msk2013, 8502 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 8503 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 8504 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8505 series = {Lecture Notes in Earth System Sciences}, 8506 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8507 Yaolin Shi}, 8508 doi = {10.1007/978-3-642-16405-7_7}, 8509 publisher = {Springer Berlin Heidelberg}, 8510 pages = {131--140}, 8511 year = {2013}, 8512 isbn = {978-3-642-16404-0}, 8513 petsc_uses = {KSP} 8514} 8515 8516@InCollection{ knepleyyuen13, 8517 author = {Matthew G. Knepley and David A. Yuen}, 8518 title = {Why Scientists and Engineers need {GPU}s today}, 8519 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8520 series = {Lecture Notes in Earth System Sciences}, 8521 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8522 Yaolin Shi}, 8523 doi = {10.1007/978-3-642-16405-7_1}, 8524 publisher = {Springer Berlin Heidelberg}, 8525 pages = {131--140}, 8526 year = {2013}, 8527 isbn = {978-3-642-16404-0}, 8528 petsc_uses = {KSP} 8529} 8530 8531@InCollection{ karpeevknepleybrune13, 8532 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 8533 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 8534 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8535 series = {Lecture Notes in Earth System Sciences}, 8536 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8537 Yaolin Shi}, 8538 doi = {10.1007/978-3-642-16405-7_30}, 8539 publisher = {Springer Berlin Heidelberg}, 8540 pages = {487--501}, 8541 year = {2013}, 8542 isbn = {978-3-642-16404-0}, 8543 petsc_uses = {KSP} 8544} 8545 8546@InCollection{ zhengetal13, 8547 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 8548 Variable Viscosity}, 8549 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8550 Zhang and Yaolin Shi}, 8551 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8552 series = {Lecture Notes in Earth System Sciences}, 8553 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8554 Yaolin Shi}, 8555 doi = {10.1007/978-3-642-16405-7_21}, 8556 publisher = {Springer Berlin Heidelberg}, 8557 pages = {321--333}, 8558 year = {2013}, 8559 isbn = {978-3-642-16404-0}, 8560 petsc_uses = {KSP} 8561} 8562 8563@Article{ zhengetal13b, 8564 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 8565 strongly variable viscosity based on {M}atlab and {CUDA}}, 8566 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8567 Zhang and Yaolin Shi}, 8568 journal = {IJHPCA}, 8569 volume = {28}, 8570 number = {1}, 8571 pages = {50--60}, 8572 doi = {10.1177/1094342013478640}, 8573 year = {2013}, 8574 petsc_uses = {KSP} 8575} 8576 8577@InBook{ s2011, 8578 author = {B. Smith}, 8579 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 8580 title = {Encyclopedia of Parallel Computing}, 8581 bookeditor = {D. Padua}, 8582 publisher = {Springer}, 8583 year = {2011}, 8584 petsc_uses = {KSP} 8585} 8586 8587@Article{ acostamejia06, 8588 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 8589 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 8590 journal = {Lecturas Matem\'aticas}, 8591 volume = {27}, 8592 year = {2006}, 8593 pages = {213--224}, 8594 petsc_uses = {KSP} 8595} 8596 8597@InProceedings{ quenettemoresisunterappelbe07, 8598 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 8599 title = {Explaining StGermain: An aspect oriented environment for building extensible 8600 computational mechanics modeling software}, 8601 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 8602 publisher = {IEEE}, 8603 pages = {1--8}, 8604 yerar = {2007}, 8605 petsc_uses = {KSP} 8606} 8607 8608@Article{ dfm1, 8609 title = {Vectorized sparse matrix multiply for compressed row storage format}, 8610 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 8611 journal = {Lecture Notes in Computer Science}, 8612 year = {2005}, 8613 pages = {99--106}, 8614 volume = {3514}, 8615 lab = {ORNL}, 8616 petsc_uses = {KSP} 8617} 8618 8619@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 8620 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 8621 Vandewalle and Stefaan Poedts}, 8622 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 8623 Scientific Computing Software}, 8624 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 8625 year = {2005}, 8626 note = {Lecture Notes in Computer Science}, 8627 volume = {3514}, 8628 publisher = {Springer-Verlag GmbH}, 8629 petsc_uses = {KSP} 8630} 8631 8632@InProceedings{ dalcin-paz-storti, 8633 author = {L. Dalcin and R. Paz and M. Storti}, 8634 title = {Desarrollo de Aplicaciones Paralelas en Python}, 8635 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 8636 Bariloche, Argentina}, 8637 year = {2004}, 8638 petsc_uses = {KSP} 8639} 8640 8641@Article{ mpi-python, 8642 author = {L. Dalcin and R. Paz and M. Storti}, 8643 title = {MPI for Python}, 8644 journal = {Journal of Parallel and Distributed Computing}, 8645 year = {2005}, 8646 petsc_uses = {KSP} 8647} 8648 8649@Unpublished{ hrv02a, 8650 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 8651 author = {V. Hernandex and J. E. Roman and V. Vidal}, 8652 note = {Submited to VecPar 2002}, 8653 year = {2002}, 8654 petsc_uses = {KSP} 8655} 8656 8657@Article{ knyazev2007block, 8658 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 8659 {PETSc}}, 8660 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 8661 journal = {SIAM Journal on Scientific Computing}, 8662 volume = {29}, 8663 pages = {2224-2239}, 8664 doi = {10.1137/060661624}, 8665 year = {2007}, 8666 petsc_uses = {KSP} 8667} 8668 8669@MastersThesis{ aarrestad-master, 8670 author = {Asbjorn Hoiland Aarrestad}, 8671 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 8672 school = {University of Bergen}, 8673 month = aug, 8674 year = {2003}, 8675 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 8676 note = {Implemented Runge-Kutta methods using PETSc}, 8677 petsc_uses = {KSP} 8678} 8679 8680@PhDThesis{ kaushik-phd, 8681 author = {D. K. Kaushik}, 8682 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 8683 Differential Equations on Unstructured Grids}, 8684 school = {Old Dominion University}, 8685 month = dec, 8686 year = {2002}, 8687 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 8688 petsc_uses = {KSP} 8689} 8690 8691@TechReport{ rb1, 8692 author = {Rickard Bergstrom}, 8693 title = {Object Oriented Implementation of a General Finite Element Code}, 8694 number = {2002-13}, 8695 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 8696 year = {2002}, 8697 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 8698 note = {Discribes a finite element software package that uses PETSc for its solvers}, 8699 petsc_uses = {KSP} 8700} 8701 8702@InProceedings{ dbl1, 8703 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 8704 title = {A Parallel General Purpose Finite Element System}, 8705 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 8706 publisher = {SIAM}, 8707 year = {1999}, 8708 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 8709 note = {Describes software that uses PETSc for its parallel linear solves}, 8710 petsc_uses = {KSP} 8711} 8712 8713@Article{ p1, 8714 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 8715 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 8716 and B. Smith}, 8717 journal = {Parallel Computing}, 8718 year = {2002}, 8719 pages = {1811--1831}, 8720 volume = {28 (12)}, 8721 petsc_uses = {KSP} 8722} 8723 8724@Article{ automatic-ad, 8725 author = {Paul Hovland and Boyana Norris and Barry Smith}, 8726 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 8727 year = {2005}, 8728 journal = {Future Generation Computer Systems}, 8729 volume = {21}, 8730 number = {8}, 8731 pages = {1426--1438}, 8732 petsc_uses = {KSP} 8733} 8734 8735@TechReport{ remote-math, 8736 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 8737 Smith}, 8738 title = {Remote Access to Mathematical Software}, 8739 number = {ANL/MCS-P889-0601}, 8740 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8741 month = jun, 8742 year = {2001}, 8743 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 8744 petsc_uses = {KSP} 8745} 8746 8747@InProceedings{ gropp98, 8748 author = {William D. Gropp}, 8749 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 8750 publisher = {SIAM}, 8751 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8752 Scientific and Engineering Computing}, 8753 year = {1999}, 8754 pages = {21-29}, 8755 petsc_uses = {KSP} 8756} 8757 8758@InProceedings{ knepleysarin99, 8759 author = {Matthew Knepley and Vivek Sarin}, 8760 title = {Algorithm Development for Large Scale Computing}, 8761 publisher = {SIAM}, 8762 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8763 Scientific and Engineering Computing}, 8764 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 8765 year = {1999}, 8766 petsc_uses = {KSP} 8767} 8768 8769@InBook{ bgms00, 8770 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8771 chapter = {Software for the Scalable Solution of {PDEs}}, 8772 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 8773 title = {CRPC Handbook of Parallel Computing}, 8774 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 8775 and A. White}, 8776 publisher = {Morgan Kaufmann Publishers}, 8777 year = {2002}, 8778 petsc_uses = {KSP} 8779} 8780 8781@InProceedings{ hovland_norris_smith98, 8782 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 8783 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 8784 Computations}, 8785 publisher = {SIAM}, 8786 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8787 Scientific and Engineering Computing}, 8788 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 8789 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 8790 year = {1999}, 8791 pages = {129-137}, 8792 petsc_uses = {KSP} 8793} 8794 8795@InProceedings{ efficient, 8796 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8797 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 8798 Libraries}, 8799 booktitle = {Modern Software Tools in Scientific Computing}, 8800 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 8801 publisher = {Birkhauser Press}, 8802 pages = {163--202}, 8803 year = {1997}, 8804 petsc_uses = {KSP} 8805} 8806 8807% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 8808@TechReport{ petsc-user-ref, 8809 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8810 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 8811 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8812 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8813 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8814 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8815 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8816 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8817 Zhang}, 8818 title = {{PETSc/TAO} Users Manual}, 8819 institution = {Argonne National Laboratory}, 8820 number = {ANL-21/39 - Revision 3.20}, 8821 doi = {10.2172/2205494}, 8822 year = {2023} 8823} 8824 8825% url = {https://petsc.org/release} 8826@TechReport{ petsc-developers, 8827 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 8828 title = {{PETS}c Developers Guide}, 8829 institution = {Argonne National Laboratory}, 8830 number = {ANL-18/18}, 8831 year = {2018}, 8832 url = {https://petsc.org/release/developers}, 8833 petsc_uses = {KSP} 8834} 8835 8836@Unpublished{ alice-memory-snooper, 8837 author = {Ibrahima Ba and Barry~F. Smith}, 8838 title = {The {ALICE} Memory Snooper}, 8839 year = {1999}, 8840 petsc_uses = {KSP} 8841} 8842 8843@TechReport{ petsc-user-ref-polish, 8844 author = {Marcin Bojko and Piotr Krzyzanowski}, 8845 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 8846 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 8847 year = {1998}, 8848 note = {An introduction to PETSc in Polish}, 8849 petsc_uses = {KSP} 8850} 8851 8852@InProceedings{ abghmn00, 8853 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 8854 High-Performance Scientific Computing}, 8855 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 8856 Norris}, 8857 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 8858 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 8859 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 8860 Hasco\"{e}t and Uwe Naumann}, 8861 publisher = {Springer}, 8862 year = {2002}, 8863 petsc_uses = {KSP} 8864} 8865 8866@Unpublished{ petsc-mpi-paper, 8867 author = {Lois Curfman McInnes and Barry F. Smith}, 8868 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 8869 Libraries}, 8870 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 8871 month = jun, 8872 year = {1995}, 8873 petsc_uses = {KSP} 8874} 8875 8876@InProceedings{ miss-paper, 8877 author = {William D. Gropp and Barry F. Smith}, 8878 title = {Scalable, Extensible, and Portable Numerical Libraries}, 8879 publisher = {IEEE}, 8880 year = {1994}, 8881 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 8882 address = {Mississippi State University}, 8883 pages = {87--93}, 8884 keyword = {numerical libraries, scientific computing, parallel computing}, 8885 petsc_uses = {KSP} 8886} 8887 8888@InProceedings{ snes-paper, 8889 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8890 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 8891 Minimization Problems}, 8892 publisher = {IEEE}, 8893 year = {1995}, 8894 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 8895 address = {Mississippi State University}, 8896 pages = {60-67}, 8897 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 8898 petsc_uses = {KSP} 8899} 8900 8901@Article{ dsneutral, 8902 author = {Barry F. Smith and William D. Gropp}, 8903 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 8904 Sparse Linear Systems}, 8905 journal = {Scientific Programming}, 8906 volume = {5}, 8907 pages = {329--336}, 8908 key = {GroppSmith96 ! KSP design}, 8909 year = {1996}, 8910 petsc_uses = {KSP} 8911} 8912 8913@InProceedings{ bgms98, 8914 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8915 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 8916 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8917 Scientific and Engineering Computing}, 8918 publisher = {SIAM}, 8919 pages = {58-67}, 8920 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 8921 year = {1998}, 8922 petsc_uses = {KSP} 8923} 8924 8925@Article{ hkm98, 8926 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 8927 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 8928 {PDE} Computation}, 8929 journal = {Advances in Engineering Software}, 8930 volume = {29}, 8931 pages = {415-424}, 8932 year = {1998}, 8933 petsc_uses = {KSP} 8934} 8935 8936@TechReport{ pdpta99, 8937 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 8938 Smith}, 8939 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 8940 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 8941 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 8942 Vegas, Nevada}, 8943 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8944 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 8945 number = {ANL/MCS-P751-0599}, 8946 year = {1999}, 8947 petsc_uses = {KSP} 8948} 8949 8950@InProceedings{ bbh:com, 8951 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 8952 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 8953 Computing}}, 8954 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 8955 Euro-Par Conference, Munich, Germany, August/September 2000}, 8956 year = {2000}, 8957 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 8958 volume = {1900}, 8959 series = {Lecture Notes in Computer Science}, 8960 pages = {86--94}, 8961 address = {Berlin}, 8962 publisher = {Springer}, 8963 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 8964 petsc_uses = {KSP} 8965} 8966 8967@InProceedings{ overture00, 8968 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8969 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 8970 Components}, 8971 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 8972 booktitle = {Proceedings of the International Federation for Information Processing Working 8973 Conference on Software Architectures for Scientific Computing, Kluwer}, 8974 year = {2000}, 8975 pages = {57--68}, 8976 petsc_uses = {KSP} 8977} 8978 8979@TechReport{ smith97, 8980 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 8981 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 8982 number = {ANL/MCS-P701}, 8983 author = {Barry F. Smith}, 8984 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8985 petsc_uses = {KSP} 8986} 8987 8988@Article{ smith98, 8989 author = {Barry Smith}, 8990 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 8991 journal = {SIGNUM Newsletter}, 8992 year = {1998}, 8993 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 8994 petsc_uses = {KSP} 8995} 8996 8997@TechReport{ ad-petsc-tm, 8998 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 8999 {PETSc}}, 9000 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 9001 year = {1997}, 9002 type = {Technical Memorandum}, 9003 institution = {ANL}, 9004 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 9005 number = {ANL/MCS-TM-233}, 9006 petsc_uses = {KSP} 9007} 9008 9009% LiteralHTML: 9010% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 9011% LiteralHTML: 9012@PhDThesis{ klotzthesis2019, 9013 author = {Thomas S. Klotz}, 9014 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 9015 Biology}, 9016 school = {Rice University}, 9017 year = {2019}, 9018 petsc_uses = {KSP} 9019} 9020 9021@Article{ klotzbardhanknepley2018, 9022 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 9023 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 9024 journal = {arXiv e-prints}, 9025 eprint = {1708.06028}, 9026 archiveprefix = {arXiv}, 9027 primaryclass = {math.na}, 9028 year = {2018}, 9029 note = {\url{http://arxiv.org/abs/1708.06028}}, 9030 petsc_uses = {KSP} 9031} 9032 9033@Misc{ brown2016, 9034 title = {Threading Tradeoffs in Domain Decomposition}, 9035 author = {Jed Brown}, 9036 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 9037 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 9038 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 9039 year = {2016}, 9040 petsc_uses = {KSP} 9041} 9042 9043@Article{ changnakshatralaknepleyjohnsson2017, 9044 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 9045 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 9046 Johnsson}, 9047 journal = {Concurency: Practice and Experience}, 9048 volume = {30}, 9049 number = {11}, 9050 eprint = {1705.03625}, 9051 doi = {10.1002/cpe.4401}, 9052 year = {2017}, 9053 petsc_uses = {KSP} 9054} 9055 9056@Article{ changfabienknepleymills2018, 9057 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 9058 spectrum analysis}, 9059 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 9060 journal = {SIAM Journal on Scientific Computing}, 9061 volume = {40}, 9062 number = {6}, 9063 pages = {C779--C802}, 9064 eprint = {1802.07832}, 9065 doi = {10.1137/18M1172260}, 9066 year = {2018}, 9067 petsc_uses = {KSP} 9068} 9069 9070@Article{ joshaghanichangnakshatralaknepley2019, 9071 title = {Composable solvers for the four-field double porosity/permeability model}, 9072 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 9073 Knepley}, 9074 journal = {Journal of Computational Physics}, 9075 volume = {386}, 9076 pages = {428--466}, 9077 doi = {10.1016/j.jcp.2019.02.020}, 9078 year = {2019}, 9079 petsc_uses = {KSP} 9080} 9081 9082@InProceedings{ barralknepleylangepiggottgorman2016, 9083 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 9084 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 9085 and Gerard J. Gorman}, 9086 booktitle = {25th International Meshing Roundtable}, 9087 editor = {Steve Owen and Hang Si}, 9088 month = sep, 9089 address = {Washington, DC}, 9090 pages = {1--5}, 9091 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 9092 year = {2016}, 9093 petsc_uses = {KSP} 9094} 9095 9096@Article{ adamsbrownknepleysamtaney2016, 9097 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 9098 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 9099 journal = {SIAM Journal on Scientific Computing}, 9100 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 9101 epub = {http://arxiv.org/abs/1406.7808}, 9102 volume = {8}, 9103 number = {4}, 9104 pages = {C426--C440}, 9105 doi = {10.1137/140975127}, 9106 year = {2016}, 9107 petsc_uses = {KSP} 9108} 9109 9110@InProceedings{ maysananruppknepleysmith2016, 9111 title = {Extreme-Scale Multigrid Components within {PETSc}}, 9112 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 9113 Smith}, 9114 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 9115 series = {PASC '16}, 9116 isbn = {978-1-4503-4126-4}, 9117 location = {Lausanne, Switzerland}, 9118 pages = {5:1--5:12}, 9119 articleno = {5}, 9120 numpages = {12}, 9121 doi = {10.1145/2929908.2929913}, 9122 acmid = {2929913}, 9123 publisher = {ACM}, 9124 address = {New York, NY, USA}, 9125 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 9126 preconditioning}, 9127 year = {2016}, 9128 petsc_uses = {KSP} 9129} 9130 9131@Article{ liu2015field, 9132 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 9133 author = {Lulu Liu and David E Keyes}, 9134 journal = {SIAM Journal on Scientific Computing}, 9135 volume = {37}, 9136 number = {3}, 9137 pages = {A1388--A1409}, 9138 year = {2015}, 9139 publisher = {SIAM}, 9140 petsc_uses = {KSP} 9141} 9142 9143@Article{ lujiaomissirlis2014, 9144 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 9145 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 9146 journal = {Numerical Linear Algebra with Applications}, 9147 volume = {21}, 9148 number = {2}, 9149 pages = {221--238}, 9150 year = {2014}, 9151 publisher = {Wiley Online Library}, 9152 petsc_uses = {KSP} 9153} 9154 9155@Article{ badiamartinprincipe2013, 9156 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 9157 solid mechanics}, 9158 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 9159 journal = {International Journal for Numerical Methods in Engineering}, 9160 volume = {96}, 9161 number = {4}, 9162 pages = {203--230}, 9163 year = {2013}, 9164 petsc_uses = {KSP} 9165} 9166 9167@Article{ morganknepleysananscott2016, 9168 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 9169 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 9170 journal = {Concurrency and Computation: Practice and Experience}, 9171 volume = {28}, 9172 pages = {4532--4542}, 9173 year = {2016}, 9174 url = {http://arxiv.org/abs/1602.04873}, 9175 doi = {10.1002/cpe.3820}, 9176 petsc_uses = {KSP} 9177} 9178 9179@Article{ morgansananknepleymills2020, 9180 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 9181 solvers}, 9182 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 9183 journal = {The International Journal of High Performance Computing Applications}, 9184 volume = {35}, 9185 issue = {1}, 9186 doi = {10.1177/1094342020966835}, 9187 url = {https://doi.org/10.1177/1094342020966835}, 9188 eprint = {https://doi.org/10.1177/1094342020966835}, 9189 year = {2020}, 9190 petsc_uses = {KSP} 9191} 9192 9193@Article{ msz2013, 9194 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 9195 author = {M. McCourt and B. F. Smith and H. Zhang}, 9196 journal = {SIAM Journal on Matrix Analysis and Applications}, 9197 year = {2015}, 9198 note = {To appear}, 9199 petsc_uses = {KSP} 9200} 9201 9202@Article{ bassi2014agglomeration, 9203 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 9204 free}, 9205 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 9206 journal = {Mathematical Models and Methods in Applied Sciences}, 9207 volume = {24}, 9208 number = {08}, 9209 pages = {1495--1539}, 9210 year = {2014}, 9211 publisher = {World Scientific}, 9212 petsc_uses = {KSP} 9213} 9214 9215@Article{ jhuranidemkowicz12, 9216 author = {{Jhurani}, C. and {Demkowicz}, L.}, 9217 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 9218 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 9219 journal = {Computer Methods in Applied Mechanics and Engineering}, 9220 volume = {213}, 9221 pages = {418-426}, 9222 year = {2012}, 9223 month = mar, 9224 doi = {10.1016/j.cma.2011.06.003}, 9225 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 9226 petsc_uses = {KSP} 9227} 9228 9229@Article{ yangcai11, 9230 author = {Yang, Haijian and Cai, Xiao-Chuan}, 9231 title = {Parallel Two-Grid Semismooth {N}ewton--{K}rylov--{S}chwarz Method for Nonlinear 9232 Complementarity Problems}, 9233 journal = {J. Sci. Comput.}, 9234 issue_date = {May 2011}, 9235 volume = {47}, 9236 number = {2}, 9237 month = may, 9238 pages = {258--280}, 9239 year = {2011}, 9240 issn = {0885-7474}, 9241 numpages = {23}, 9242 doi = {10.1007/s10915-010-9436-4}, 9243 acmid = {1971246}, 9244 publisher = {Plenum Press}, 9245 address = {New York, NY, USA}, 9246 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 9247 preconditioners, Semismooth Newton, Two-level methods}, 9248 petsc_uses = {KSP} 9249} 9250 9251@Article{ rheinbach09, 9252 author = {Rheinbach, Oliver}, 9253 title = {Parallel Iterative Substructuring in Structural Mechanics}, 9254 journal = {Archives of Computational Methods in Engineering}, 9255 volume = {16}, 9256 number = {4}, 9257 pages = {425-463}, 9258 year = {2009}, 9259 issn = {1134-3060}, 9260 doi = {10.1007/s11831-009-9035-4}, 9261 publisher = {Springer Netherlands}, 9262 language = {English}, 9263 petsc_uses = {KSP} 9264} 9265 9266@Article{ knepleyterrel2013, 9267 author = {Matthew G. Knepley and Andy R. Terrel}, 9268 title = {Finite Element Integration on {GPUs}}, 9269 journal = {{ACM} Transactions on Mathematical Software}, 9270 volume = {39}, 9271 number = {2}, 9272 accepted = {17 April 2012}, 9273 year = {2013}, 9274 abstract = {We present a novel finite element integration method for low order elements on 9275 GPUs. We achieve more than 100GF for element integration on first order 9276 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 9277 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 9278 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 9279 url = {http://arxiv.org/abs/1103.0066}, 9280 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 9281 petsc_uses = {KSP} 9282} 9283 9284@Article{ knepleyruppterrel2016, 9285 title = {Finite Element Integration with Quadrature on the GPU}, 9286 journal = {ArXiv e-prints}, 9287 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 9288 version = {1}, 9289 date = {2016-07-14}, 9290 eprinttype = {arxiv}, 9291 eprintclass = {cs.MS}, 9292 eprint = {1607.04245v1}, 9293 petsc_uses = {KSP} 9294} 9295 9296@Article{ klawonnlanserrheinbach2014, 9297 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 9298 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 9299 journal = {SIAM Journal on Scientific Computing}, 9300 volume = {36}, 9301 number = {2}, 9302 pages = {A737--A765}, 9303 year = {2014}, 9304 petsc_uses = {KSP} 9305} 9306 9307@Article{ bruneknepleysmithtu15, 9308 title = {Composing Scalable Nonlinear Algebraic Solvers}, 9309 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 9310 journal = {SIAM Review}, 9311 volume = {57}, 9312 number = {4}, 9313 pages = {535--565}, 9314 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 9315 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 9316 doi = {10.1137/130936725}, 9317 year = {2015}, 9318 petsc_uses = {KSP} 9319} 9320 9321@Article{ mszm2014, 9322 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 9323 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9324 volume = {40}, 9325 pages = {17--31}, 9326 year = {2014}, 9327 journal = {Parallel Computing}, 9328 doi = {10.1016/j.parco.2013.10.001}, 9329 petsc_uses = {KSP} 9330} 9331 9332@TechReport{ mszm2012, 9333 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 9334 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9335 year = {2012}, 9336 number = {ANL/MCS-P2097-0512}, 9337 institution = {Argonne National Laboratory}, 9338 petsc_uses = {KSP} 9339} 9340 9341@InProceedings{ bkmms2012, 9342 author = {Jed Brown and Matthew G. Knepley and David A. May and Lois C. McInnes and Barry 9343 F. Smith}, 9344 title = {Composable linear solvers for multiphysics}, 9345 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 9346 Computing} ({ISPDC} 2012)}, 9347 year = {2012}, 9348 doi = {10.1109/ISPDC.2012.16}, 9349 publisher = {IEEE Computer Society}, 9350 pages = {55--62}, 9351 petsc_uses = {KSP} 9352} 9353 9354@Article{ bourdinbucuroudet2009, 9355 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 9356 title = {Optimal Partitions for Eigenvalues}, 9357 journal = {SIAM J. Sci. Comput.}, 9358 volume = {31}, 9359 number = {6}, 9360 pages = {4100--4114}, 9361 year = {2009}, 9362 petsc_uses = {KSP} 9363} 9364 9365@InBook{ kimnbourdin2007, 9366 author = {J.-H. Kimn and Blaise Bourdin}, 9367 title = {Numerical implementation of overlapping balancing domain decomposition methods on 9368 unstructured meshes}, 9369 editor = {O. B. Widlund and D. E. Keyes}, 9370 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 9371 series = {Lecture Notes in Computational Science and Engineering}, 9372 number = {55}, 9373 publisher = {Springer-Verlag}, 9374 pages = {309--315}, 9375 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 9376 year = {2007}, 9377 petsc_uses = {KSP} 9378} 9379 9380@Article{ bjm2005, 9381 author = {AH Baker and ER Jessup and T Manteuffel}, 9382 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 9383 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 9384 year = {2005}, 9385 petsc_uses = {KSP} 9386} 9387 9388@Unpublished{ sundar-2008a, 9389 author = {R.S. Sampath and G. Biros}, 9390 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 9391 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9392 petsc_uses = {KSP} 9393} 9394 9395@Article{ sundar-2008, 9396 author = {H. Sundar and R.S. Sampath and G. Biros}, 9397 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 9398 journal = {SIAM Journal on Scientific Computing}, 9399 year = {2008}, 9400 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9401 petsc_uses = {KSP} 9402} 9403 9404@InProceedings{ sundar-2007, 9405 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 9406 title = {Low-constant parallel algorithms for finite element simulations using linear 9407 octrees}, 9408 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 9409 year = {2007}, 9410 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9411 petsc_uses = {KSP} 9412} 9413 9414@InProceedings{ adams-98a, 9415 author = {Adams, Mark ~F.}, 9416 title = {A Parallel Maximal Independent Set Algorithm}, 9417 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 9418 year = {1998}, 9419 petsc_uses = {KSP} 9420} 9421 9422@Article{ akcelik2005ddd, 9423 title = {{Dynamic data-driven inversion for terascale simulations: real-time 9424 identification of airborne contaminants}}, 9425 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 9426 van Bloemen Waanders, B.}, 9427 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 9428 year = {2005}, 9429 publisher = {IEEE Computer Society Washington, DC, USA}, 9430 petsc_uses = {KSP} 9431} 9432 9433@InBook{ akcelik-2006, 9434 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 9435 Bloemen Waanders}, 9436 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 9437 title = {Frontiers of Parallel Computing}, 9438 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 9439 publisher = {SIAM}, 9440 year = {2006}, 9441 petsc_uses = {KSP} 9442} 9443 9444@Article{ dt, 9445 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 9446 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 9447 Convection Diffusion Equations}, 9448 journal = {The Journal of Supercomputing}, 9449 year = {2004}, 9450 pages = {235--253}, 9451 volume = {28}, 9452 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 9453 petsc_uses = {KSP} 9454} 9455 9456@PhDThesis{ hwang2004, 9457 author = {Feng-Nan Hwang}, 9458 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 9459 Computational Fluid Dynamics}, 9460 school = {University of Colorado at Boulder}, 9461 year = {2004}, 9462 petsc_uses = {KSP} 9463} 9464 9465@PhDThesis{ baker, 9466 author = {{A. H.} Baker}, 9467 title = {On improving the performance of the linear solver restarted {GMRES}}, 9468 school = {University of Colorado at Boulder}, 9469 year = {2003}, 9470 petsc_uses = {KSP} 9471} 9472 9473@TechReport{ klawonnrheinbach601, 9474 author = {Axel Klawonn and Oliver Rheinbach}, 9475 title = {A Parallel Implementation of Dual-Primal {FETI-DP} Methods for Three Dimensional 9476 Linear Elasticity Using a Transformation of Basis}, 9477 institution = {Universit\"at Duisburg-Essen}, 9478 year = {2005}, 9479 type = {Technical Report}, 9480 number = {SM-E-601}, 9481 petsc_uses = {KSP} 9482} 9483 9484@TechReport{ klawonnrheinbach609, 9485 author = {Axel Klawonn and Oliver Rheinbach}, 9486 title = {Inexact FETI-DP Methods}, 9487 institution = {Universit\"at Duisburg-Essen}, 9488 year = {2005}, 9489 type = {Technical Report}, 9490 number = {SM-E-609}, 9491 petsc_uses = {KSP} 9492} 9493 9494@TechReport{ klawonnrheinbach607, 9495 author = {Axel Klawonn and Oliver Rheinbach}, 9496 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 9497 institution = {Universit\"at Duisburg-Essen}, 9498 year = {2005}, 9499 type = {Technical Report}, 9500 number = {SM-E-607}, 9501 petsc_uses = {KSP} 9502} 9503 9504@Article{ kul-natraj-pbp, 9505 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 9506 title = {Performance of a parallel mixed finite element implementation for fourth order 9507 clamped anisotropic plate bending problems in distributed memory environments}, 9508 journal = {Applied Mathematics and Computation}, 9509 volume = {155}, 9510 year = {2004}, 9511 number = {3}, 9512 pages = {753--777}, 9513 petsc_uses = {KSP} 9514} 9515 9516@Article{ bramkamp2006uej, 9517 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 9518 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 9519 journal = {Computers \& Fluids}, 9520 volume = {35}, 9521 number = {10}, 9522 pages = {1063--1073}, 9523 doi = {10.1016/j.compfluid.2005.10.003}, 9524 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 9525 derivation of the analytic flux Jacobian can become quite complicated depending on 9526 the complexity of the numerical flux calculation. Practically, the derivation of 9527 the exact Jacobian by hand is an unrealistic option because of the enormous 9528 man-hour investment needed. In this work, automatic differentiation is used to 9529 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 9530 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 9531 approximated by first-order forward differences. For a two-dimensional airfoil 9532 under three different flight conditions (quasi-incompressible flow, compressible 9533 subsonic flow, and transonic flow), we show that the robustness and performance of 9534 the present finite volume scheme is significantly improved by using exact 9535 Jacobians.}, 9536 year = {2006}, 9537 petsc_uses = {KSP} 9538} 9539 9540@Article{ shahbazi1, 9541 author = {Khosro Shahbazi}, 9542 title = {An explicit expression for the penalty parameter of the interior penalty method}, 9543 journal = {Journal of Computational Physics}, 9544 volume = {205}, 9545 year = {2005}, 9546 pages = {401--407}, 9547 petsc_uses = {KSP} 9548} 9549 9550@TechReport{ kk, 9551 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 9552 author = {Hans-Peter Kersken and Uwe Kuster}, 9553 year = {1999}, 9554 institution = {University of Stuttgart}, 9555 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 9556 number = {310}, 9557 petsc_uses = {KSP} 9558} 9559 9560@Article{ miha-mija, 9561 author = {M. D. Mihajlovi and S. Mijalkovi}, 9562 title = {A component decomposition preconditioning for 3D stress analysis problems}, 9563 journal = {Numerical Linear Algebra with Applications}, 9564 volume = {9}, 9565 year = {2002}, 9566 pages = {567--583}, 9567 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 9568 petsc_uses = {KSP} 9569} 9570 9571@Article{ bjm, 9572 author = {M Benzi and W Joubert and G Mateescu}, 9573 journal = {Electronic Transactions on Numerical Analysis}, 9574 year = {1999}, 9575 volume = {8}, 9576 pages = {88--114}, 9577 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 9578 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 9579 petsc_uses = {KSP} 9580} 9581 9582@PhDThesis{ hyde, 9583 author = {EMK Hyde}, 9584 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 9585 school = {Caltech}, 9586 year = {2003}, 9587 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 9588 petsc_uses = {KSP} 9589} 9590 9591@Article{ km2003, 9592 author = {A. Keese and H. G. Matthies}, 9593 journal = {Proceedings in Applied Mathematics and Mechanics}, 9594 year = {2003}, 9595 volume = {2}, 9596 pages = {485--486}, 9597 title = {Parallel Solution of Stochastic PDEs}, 9598 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 9599 petsc_uses = {KSP} 9600} 9601 9602@Article{ whszss, 9603 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 9604 and Otmar Scherzer and H. Siegfried Stiehl}, 9605 journal = {Real Time Imaging}, 9606 year = {2001}, 9607 volume = {7}, 9608 pages = {31--45}, 9609 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 9610 approaches}, 9611 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 9612 petsc_uses = {KSP} 9613} 9614 9615@TechReport{ baker1, 9616 title = {An Efficient Block Variant of GMRES}, 9617 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 9618 year = {2003}, 9619 type = {Technical Report}, 9620 institution = {University of Colorado, Boulder}, 9621 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 9622 number = {CU-CS-957-03}, 9623 petsc_uses = {KSP} 9624} 9625 9626@InProceedings{ mc2003, 9627 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 9628 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 9629 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9630 Methods}, 9631 pages = {639--646}, 9632 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9633 note = {}, 9634 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9635 year = {2003}, 9636 petsc_uses = {KSP} 9637} 9638 9639@InProceedings{ kt2003, 9640 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 9641 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 9642 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9643 Methods}, 9644 pages = {615--622}, 9645 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9646 note = {}, 9647 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9648 year = {2003}, 9649 petsc_uses = {KSP} 9650} 9651 9652@InProceedings{ krw2003, 9653 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 9654 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 9655 3D}, 9656 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9657 Methods}, 9658 pages = {361--368}, 9659 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9660 note = {}, 9661 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9662 year = {2003}, 9663 petsc_uses = {KSP} 9664} 9665 9666@InProceedings{ hc2003, 9667 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 9668 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 9669 Nonlinear Preconditioning}, 9670 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9671 Methods}, 9672 pages = {201--208}, 9673 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9674 note = {}, 9675 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9676 year = {2003}, 9677 petsc_uses = {KSP} 9678} 9679 9680@InProceedings{ g2003, 9681 author = {P. Goldfeld}, 9682 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 9683 (Generalized) {Stokes} and Parallel Implementation}, 9684 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9685 Methods}, 9686 pages = {209--216}, 9687 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9688 publisher = {National Autonomous University of Mexico (UNAM)}, 9689 note = {}, 9690 url = {http://www.ddm.org/DD14}, 9691 year = {2003}, 9692 petsc_uses = {KSP} 9693} 9694 9695@InProceedings{ dhv2003, 9696 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 9697 title = {Toward scalable {FETI} algorithm for variational inequalities with applications to 9698 composites}, 9699 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9700 Methods}, 9701 pages = {395--401}, 9702 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9703 publisher = {National Autonomous University of Mexico (UNAM)}, 9704 note = {}, 9705 url = {http://www.ddm.org/DD14}, 9706 year = {2003}, 9707 petsc_uses = {KSP} 9708} 9709 9710@InProceedings{ dhsv2002, 9711 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9712 title = {Scalabilities of {FETI} for variational inequalities and contact shape 9713 optimization}, 9714 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9715 Methods}, 9716 pages = {359--367}, 9717 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9718 publisher = {CIMNE, Barcelona, Spain}, 9719 note = {}, 9720 url = {http://www.ddm.org/DD13}, 9721 year = {2002}, 9722 petsc_uses = {KSP} 9723} 9724 9725@InProceedings{ cky2002, 9726 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 9727 title = {A Nonlinear Additive {S}chwarz Preconditioned Inexact {N}ewton Method for Shocked 9728 Duct Flows}, 9729 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9730 Methods}, 9731 pages = {343--350}, 9732 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9733 publisher = {CIMNE, Barcelona, Spain}, 9734 note = {}, 9735 url = {http://www.ddm.org/DD13}, 9736 year = {2002}, 9737 petsc_uses = {KSP} 9738} 9739 9740@Conference{ li-etal:03, 9741 author = {Li, Z. and Lanteri S. and Saad, Y.}, 9742 title = {Multiplicative-additive preconditioning combination for general sparse linear 9743 systems}, 9744 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 9745 Matrix Problems in Scientific and Industrial Applications}, 9746 address = {Napa, California, USA}, 9747 date = {october 27-29}, 9748 year = {2003}, 9749 petsc_uses = {KSP} 9750} 9751 9752@Article{ bashir2008hessian, 9753 title = {Hessian-based model reduction for large-scale systems with initial-condition 9754 inputs}, 9755 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 9756 J.}, 9757 journal = {International journal for numerical methods in engineering}, 9758 volume = {73}, 9759 number = {6}, 9760 pages = {844--868}, 9761 year = {2008}, 9762 publisher = {Wiley Online Library}, 9763 petsc_uses = {KSP} 9764} 9765 9766@Article{ bashir2007hessian, 9767 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 9768 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 9769 K.}, 9770 journal = {Computational Science--ICCS 2007}, 9771 pages = {1010--1017}, 9772 year = {2007}, 9773 publisher = {Springer}, 9774 petsc_uses = {KSP} 9775} 9776 9777@Article{ akcelik2011fast, 9778 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 9779 inverse problems based on low-rank partial {H}essian approximations}, 9780 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 9781 Waanders, B. and Wilcox, L.}, 9782 journal = {SIAM Journal on Scientific Computing}, 9783 volume = {33}, 9784 number = {1}, 9785 year = {2011}, 9786 petsc_uses = {KSP} 9787} 9788 9789@InProceedings{ ff2003, 9790 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 9791 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 9792 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 9793 year = {2003}, 9794 petsc_uses = {KSP} 9795} 9796 9797@InProceedings{ d2b2004, 9798 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 9799 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 9800 Ordering Strategies}, 9801 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 9802 year = {2004}, 9803 petsc_uses = {KSP} 9804} 9805 9806@InProceedings{ d2v2005, 9807 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 9808 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 9809 Flow Equations}, 9810 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 9811 year = {2005}, 9812 petsc_uses = {KSP} 9813} 9814 9815@InProceedings{ dvs2006, 9816 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 9817 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 9818 Mixed Convection Equations}, 9819 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 9820 year = {2006}, 9821 petsc_uses = {KSP} 9822} 9823 9824@Article{ dsv2006, 9825 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 9826 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 9827 Flow Equations}, 9828 journal = {Computational Fluid Dynamics}, 9829 year = {2006}, 9830 volume = {15}, 9831 number = {1}, 9832 petsc_uses = {KSP} 9833} 9834 9835@Article{ lahaye03, 9836 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 9837 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 9838 journal = {J. Comput. Appl. Math.}, 9839 year = {2004}, 9840 pages = {267--275}, 9841 volume = {168}, 9842 petsc_uses = {KSP} 9843} 9844 9845@TechReport{ brmn, 9846 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 9847 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 9848 year = {2002}, 9849 type = {Technical Report}, 9850 institution = {ANL}, 9851 number = {ANL/MCS-P993-0902}, 9852 note = {To appear in Future Generation Computer Systems}, 9853 petsc_uses = {KSP} 9854} 9855 9856@InProceedings{ mnbr, 9857 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 9858 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 9859 Algorithms}, 9860 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 9861 Mechanics}, 9862 year = {2003}, 9863 petsc_uses = {KSP} 9864} 9865 9866@InProceedings{ bmnr, 9867 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 9868 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 9869 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 9870 Applications, Lecture notes in Computer Science 2677}, 9871 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 9872 pages = {828--839}, 9873 year = {2003}, 9874 petsc_uses = {KSP} 9875} 9876 9877@Article{ ph03, 9878 author = {M. Pernice and R. D. Hornung}, 9879 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 9880 journal = {Computing and Visualization in Science}, 9881 year = {2003}, 9882 lab = {LANL}, 9883 petsc_uses = {KSP} 9884} 9885 9886@Article{ adams-02, 9887 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 9888 journal = {J. Comp. Phys.}, 9889 number = {2}, 9890 pages = {593-610}, 9891 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 9892 volume = {188}, 9893 year = {2003}, 9894 petsc_uses = {KSP} 9895} 9896 9897@InProceedings{ adams2001distributed, 9898 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 9899 smoothers}, 9900 author = {Adams, M.F.}, 9901 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 9902 pages = {14--14}, 9903 year = {2001}, 9904 organization = {IEEE}, 9905 petsc_uses = {KSP} 9906} 9907 9908@PhDThesis{ els01, 9909 author = {Ulrich Elsner}, 9910 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 9911 algorithms}, 9912 school = {Technical University Chemnitz}, 9913 year = {2002}, 9914 publisher = {Logos Verlag, Berlin}, 9915 isbn = {3-89722-923-4}, 9916 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 9917 different graph partitioning algorithms}, 9918 petsc_uses = {KSP} 9919} 9920 9921@TechReport{ ckk02, 9922 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 9923 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 9924 year = {2002}, 9925 type = {Technical Report}, 9926 institution = {ODU}, 9927 url = {http://www.math.odu.edu/\~{ }keyes}, 9928 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 9929 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 9930 Methods}, 9931 petsc_uses = {KSP} 9932} 9933 9934@Article{ gpw2002, 9935 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 9936 Heterogeneous Problems in Linear Elasticity}, 9937 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 9938 year = {2003}, 9939 pages = {283--324}, 9940 volume = {95}, 9941 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 9942 journal = {Numerische Mathematik}, 9943 petsc_uses = {KSP} 9944} 9945 9946@Article{ dh1, 9947 title = {Scalability and FETI based algorithm for large discretized variational 9948 inequalities}, 9949 author = {Z Dostal and D Horak}, 9950 year = {2003}, 9951 pages = {347--357}, 9952 volume = {61}, 9953 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 9954 journal = {Mathematics and Computers in Simulation}, 9955 petsc_uses = {KSP} 9956} 9957 9958@InProceedings{ dhsv1, 9959 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9960 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 9961 title = {36 Scalabilities of {FETI} for Variational Inequalities and Contact Shape 9962 Optimization}, 9963 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9964 Methods}, 9965 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 9966 Kuznetsov}, 9967 petsc_uses = {KSP} 9968} 9969 9970@Article{ lahaye02, 9971 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 9972 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 9973 journal = {IEEEMAGN}, 9974 year = {2002}, 9975 volume = {38}, 9976 number = {2}, 9977 pages = {413-416}, 9978 petsc_uses = {KSP} 9979} 9980 9981@Article{ ckm01, 9982 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 9983 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 9984 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 9985 fluid dynamics}, 9986 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 9987 year = {2002}, 9988 volume = {40}, 9989 pages = {1463--1470}, 9990 petsc_uses = {KSP} 9991} 9992 9993@InProceedings{ cky01, 9994 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 9995 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 9996 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 9997 duct flow}, 9998 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9999 Methods}, 10000 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10001 Kuznetsov}, 10002 year = {2002}, 10003 petsc_uses = {KSP} 10004} 10005 10006@Article{ ck02, 10007 author = {X.-C. Cai and D. E. Keyes}, 10008 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 10009 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 10010 journal = {SIAM J. Sci. Comput.}, 10011 year = {2002}, 10012 pages = {183--200}, 10013 volume = {24}, 10014 petsc_uses = {KSP} 10015} 10016 10017@Article{ c04, 10018 author = {Feng-Nan Hwang and X.-C. Cai}, 10019 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 10020 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 10021 for incompressible {Navier-Stokes} equations}, 10022 journal = {Journal of Computational Physics}, 10023 year = {2005}, 10024 volume = {204}, 10025 pages = {666--691}, 10026 petsc_uses = {KSP} 10027} 10028 10029@Article{ hc06, 10030 author = {Feng-Nan Hwang and X.-C. Cai}, 10031 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 10032 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 10033 Algorithms}, 10034 journal = {Computer Methods in Applied Mechanics and Engineering}, 10035 year = {2006}, 10036 volume = {196}, 10037 pages = {1603--1611}, 10038 petsc_uses = {KSP} 10039} 10040 10041@InProceedings{ adams-01, 10042 author = {Mark F. Adams}, 10043 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 10044 Smoothers}, 10045 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 10046 address = {Denver, Colorado}, 10047 month = nov, 10048 year = {2001}, 10049 petsc_uses = {KSP} 10050} 10051 10052@Book{ 1dl, 10053 author = {Domenico Lahaye}, 10054 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 10055 Computations}, 10056 year = {2001}, 10057 publisher = {Katholieke Universiteit Leuven}, 10058 notes = {Thesis}, 10059 petsc_uses = {KSP} 10060} 10061 10062@Article{ adams-00, 10063 author = {Adams, M.~F.}, 10064 journal = {International Journal for Numerical Methods in Engineering}, 10065 number = {8}, 10066 pages = {1241-1262}, 10067 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 10068 Deformation Elasticity and Plasticity}, 10069 volume = {48}, 10070 year = {2000}, 10071 petsc_uses = {KSP} 10072} 10073 10074@Article{ adams2002evaluation, 10075 author = {Adams, M.~F.}, 10076 journal = {International Journal for Numerical Methods in Engineering}, 10077 number = {1}, 10078 pages = {519-534}, 10079 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 10080 Problems in Solid Mechanics}, 10081 volume = {55}, 10082 year = {2002}, 10083 petsc_uses = {KSP} 10084} 10085 10086@Article{ lahaye00, 10087 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 10088 title = {Algebraic Multigrid for Complex Symmetric Systems}, 10089 journal = {IEEEMAGN}, 10090 year = {2000}, 10091 volume = {36}, 10092 number = {4}, 10093 pages = {1535--1538}, 10094 petsc_uses = {KSP} 10095} 10096 10097@InProceedings{ adams-99c, 10098 author = {Mark F. Adams and J. Demmel}, 10099 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 10100 Finite Element Problems}, 10101 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 10102 address = {Portland, Oregon}, 10103 month = nov, 10104 year = {1999}, 10105 petsc_uses = {KSP} 10106} 10107 10108@Article{ chan95, 10109 author = {T. Chan and B. Smith and J. Zou}, 10110 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 10111 Grids}, 10112 journal = {Numer. Math.}, 10113 year = {1995}, 10114 volume = {73}, 10115 pages = {149--167}, 10116 petsc_uses = {KSP} 10117} 10118 10119@TechReport{ adams-csd-98-993, 10120 pages = {11}, 10121 year = {1998}, 10122 type = {Technical Report}, 10123 number = {CSD-98-993}, 10124 institution = {University of California, Berkeley}, 10125 title = {A Parallel Maximal Independent Set Algorithm}, 10126 bibdate = {March 11, 1998}, 10127 author = {Mark F. Adams and James Demmel}, 10128 abstract = {The parallel construction of maximal independent sets is a useful building block 10129 for many algorithms in the computational sciences, including graph coloring and 10130 multigrid coarse grid creation on unstructured meshes. We present an efficient 10131 asynchronous maximal independent set algorithm for use on parallel computers, for 10132 ``well partitioned'' graphs, that arise from finite element (FE) models. For 10133 appropriately partitioned bounded degree graphs, it is shown that the running time 10134 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 10135 improvement over the previous best P-RAM complexity for this class of graphs. We 10136 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 10137 model is indicative of the performance one can expect with practical partitions on 10138 graphs from FE problems.}, 10139 month = mar, 10140 petsc_uses = {KSP} 10141} 10142 10143@Article{ benzigolubliesen2005, 10144 title = {Numerical solution of saddle point problems}, 10145 author = {Michele Benzi and Gene H. Golub and J\"org Liesen}, 10146 volume = {14}, 10147 journal = {Acta Numerica}, 10148 pages = {1-–137}, 10149 doi = {10.1017/S0962492904000212}, 10150 year = {2005} 10151} 10152 10153@Article{ mardal2011preconditioning, 10154 title = {Preconditioning discretizations of systems of partial differential equations}, 10155 author = {Kent-Andre Mardal and Ragnar Winther}, 10156 journal = {Numerical Linear Algebra with Applications}, 10157 volume = {18}, 10158 number = {1}, 10159 pages = {1--40}, 10160 year = {2011} 10161} 10162 10163@TechReport{ k676, 10164 year = {1994}, 10165 type = {Technical Report}, 10166 number = {TR1994-676}, 10167 institution = {New York University}, 10168 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 10169 Term}, 10170 author = {Axel Klawonn}, 10171 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 10172 petsc_uses = {KSP} 10173} 10174 10175@Book{ ak1, 10176 author = {Axel Klawonn}, 10177 title = {Preconditioners for Indefinite Problems}, 10178 year = {1995}, 10179 publisher = {Westfalishen Wilhelms-Universitat Munster}, 10180 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 10181 notes = {Thesis}, 10182 petsc_uses = {KSP} 10183} 10184 10185@TechReport{ knepleykarpeev05, 10186 pages = {41}, 10187 year = {2005}, 10188 type = {Technical Report}, 10189 number = {ANL/MCS-P1295-1005}, 10190 institution = {Argonne National Laboratory}, 10191 title = {Flexible Representation of Computational Meshes}, 10192 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10193 abstract = {}, 10194 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 10195 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 10196 month = oct, 10197 petsc_uses = {DMPlex} 10198} 10199 10200@TechReport{ knepleykarpeev07a, 10201 pages = {14}, 10202 year = {2007}, 10203 type = {Technical Report}, 10204 number = {ANL/MCS-P1455-0907}, 10205 institution = {Argonne National Laboratory}, 10206 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10207 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10208 abstract = {}, 10209 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 10210 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 10211 month = feb, 10212 petsc_uses = {DMPlex} 10213} 10214 10215@Article{ knepleykarpeev09, 10216 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10217 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10218 journal = {Scientific Programming}, 10219 volume = {17}, 10220 number = {3}, 10221 pages = {215--230}, 10222 year = {2009}, 10223 doi = {10.3233/SPR-2009-0249}, 10224 url = {http://arxiv.org/abs/0908.4427}, 10225 note = {\url{http://arxiv.org/abs/0908.4427}}, 10226 petsc_uses = {DMPlex} 10227} 10228 10229@Article{ biezuner2012computing, 10230 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 10231 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 10232 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 10233 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 10234 Sublinear Supersolutions}, 10235 journal = {Journal of Scientific Computing}, 10236 publisher = {Springer Netherlands}, 10237 issn = {0885-7474}, 10238 keyword = {Mathematics and Statistics}, 10239 pages = {180--201}, 10240 volume = {52}, 10241 issue = {1}, 10242 year = {2012}, 10243 doi = {10.1007/s10915-011-9540-0}, 10244 petsc_uses = {KSP} 10245} 10246 10247% LiteralHTML: 10248% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 10249% LiteralHTML: 10250@Book{ knepley2017, 10251 title = {Computational Science I}, 10252 author = {Matthew G. Knepley}, 10253 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 10254 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 10255 publisher = {PETSc}, 10256 year = {2017}, 10257 petsc_uses = {KSP} 10258} 10259 10260@Article{ verleyeuser, 10261 title = {{User friendly permeability predicting software for technical textiles}}, 10262 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 10263 Roose, D.}, 10264 journal = {status: published}, 10265 issn = {1560-6074}, 10266 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 10267 petsc_uses = {KSP} 10268} 10269 10270@Book{ pacheco, 10271 author = {Peter Pacheco}, 10272 title = {Parallel Programming with MPI}, 10273 year = {1997}, 10274 publisher = {Morgan-Kaufmann}, 10275 note = {Devotes a couple of sections to PETSc}, 10276 petsc_uses = {KSP} 10277} 10278 10279@Book{ 1sbg, 10280 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 10281 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 10282 Differential Equations}, 10283 year = {1996}, 10284 publisher = {Cambridge University Press}, 10285 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 10286 petsc_uses = {KSP} 10287} 10288 10289@Misc{ petsc-fem:homepage, 10290 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 10291 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 10292 G. Rodriguez and G. Filippini}, 10293 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 10294 petsc_uses = {KSP} 10295} 10296 10297@Misc{ petsc4py-web-page, 10298 author = {Lisandro Dalcin}, 10299 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 10300 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 10301 note = {http://code.google.com/p/petsc4py/}, 10302 petsc_uses = {KSP} 10303} 10304 10305@Article{ libmeshpaper06, 10306 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 10307 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 10308 Simulations}}, 10309 journal = {Engineering with Computers}, 10310 volume = {22}, 10311 number = {3--4}, 10312 pages = {237--254}, 10313 year = {2006}, 10314 doi = {10.1007/s00366-006-0049-3}, 10315 petsc_uses = {KSP} 10316} 10317 10318@Misc{ sisiphus:homepage, 10319 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 10320 High-Resolution, Unstructured Simulations}, 10321 author = {T. {Tautges et al.}}, 10322 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 10323 petsc_uses = {KSP} 10324} 10325 10326@Misc{ pflotran:homepage, 10327 title = {{PFLOTRAN} project}, 10328 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 10329 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 10330 howpublished = {\url{http://pflotran.org/}}, 10331 petsc_uses = {KSP} 10332} 10333 10334@Misc{ pism:homepage, 10335 title = {{PISM}: A Parallel Ice Sheet Model}, 10336 author = {E. {Bueler et al.}}, 10337 howpublished = {\url{http://pism-docs.org}}, 10338 petsc_uses = {KSP} 10339} 10340 10341@Misc{ dohp:homepage, 10342 title = {Dohp: Dual order $hp$-finite elements}, 10343 author = {J. Brown}, 10344 howpublished = {\url{http://dohp.org}}, 10345 petsc_uses = {KSP} 10346} 10347 10348@Article{ mccourtrognlienetal12, 10349 title = {Improving parallel scalability for edge plasma transport simulations with neutral 10350 gas species}, 10351 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 10352 journal = {Computational Science and Discovery}, 10353 year = {2012}, 10354 volume = {5}, 10355 number = {014012}, 10356 doi = {10.1088/1749-4699/5/1/014012}, 10357 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 10358 2011)}, 10359 petsc_uses = {KSP} 10360} 10361 10362@Misc{ petclaw-github, 10363 title = {Pet{C}law Software}, 10364 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 10365 year = {2011}, 10366 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 10367 petsc_uses = {KSP} 10368} 10369 10370@Misc{ pyclaw-web-page, 10371 author = {Kyle T. Mandli and David I. Ketcheson and others}, 10372 title = {{PyClaw} software}, 10373 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 10374 url = {http://clawpack.github.io/doc/pyclaw/}, 10375 year = {2012}, 10376 petsc_uses = {KSP} 10377} 10378 10379@Article{ ketcheson2011highorder, 10380 title = {High-order wave propagation algorithms for general hyperbolic systems}, 10381 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 10382 year = {2011}, 10383 note = {submitted}, 10384 petsc_uses = {KSP} 10385} 10386 10387@Article{ biros2005pln1, 10388 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 10389 optimization. Part I: The {Krylov-Schur} solver}}, 10390 author = {Biros, G. and Ghattas, O.}, 10391 journal = {SIAM Journal on Scientific Computing}, 10392 volume = {27}, 10393 number = {2}, 10394 pages = {687--713}, 10395 year = {2005}, 10396 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10397 petsc_uses = {KSP} 10398} 10399 10400@Article{ biros2005pln2, 10401 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 10402 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 10403 optimal control of steady viscous flows}, 10404 author = {Biros, G. and Ghattas, O.}, 10405 journal = {SIAM Journal on Scientific Computing}, 10406 volume = {27}, 10407 number = {2}, 10408 pages = {714--739}, 10409 year = {2005}, 10410 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10411 petsc_uses = {KSP} 10412} 10413 10414@Misc{ issm:homepage, 10415 title = {{I}ce {S}heet {S}ystem {M}odel}, 10416 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 10417 year = {2010}, 10418 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 10419 petsc_uses = {KSP} 10420} 10421 10422@Article{ morlighem2010spatial, 10423 title = {Spatial patterns of basal drag inferred using control methods from a 10424 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 10425 {A}ntarctica}, 10426 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 10427 Aubry, D.}, 10428 journal = {Geophysical Research Letters}, 10429 volume = {37}, 10430 number = {14}, 10431 pages = {L14502}, 10432 year = {2010}, 10433 publisher = {American Geophysical Union}, 10434 petsc_uses = {KSP} 10435} 10436 10437@Article{ jardin2012plasmas, 10438 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 10439 of tokamak plasmas}, 10440 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 10441 journal = {Computational Science \& Discovery}, 10442 volume = {5}, 10443 number = {1}, 10444 url = {http://stacks.iop.org/1749-4699/5/014002}, 10445 year = {2012}, 10446 petsc_uses = {KSP} 10447} 10448 10449@Article{ cmz2016, 10450 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10451 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 10452 journal = {Journal of Scientific Computing}, 10453 publisher = {Springer}, 10454 pages = {803--825}, 10455 volume = {68}, 10456 issue = {2}, 10457 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 10458 doi = {10.1007/s10915-015-0159-4}, 10459 year = {2016}, 10460 note = {Also preprint ANL/MCS-P3039-0912}, 10461 petsc_uses = {KSP} 10462} 10463 10464@Article{ knepleybrownruppsmith13, 10465 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 10466 title = {Achieving High Performance with Unified Residual Evaluation}, 10467 journal = {ArXiv e-prints}, 10468 eprint = {1309.1204}, 10469 archiveprefix = {arXiv}, 10470 primaryclass = {cs.MS}, 10471 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 10472 Engineering, Finance, and Science}, 10473 year = {2013}, 10474 month = sep, 10475 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 10476 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10477 petsc_uses = {KSP} 10478} 10479 10480@Book{ fenicsbook, 10481 title = {Automated Solution of Differential Equations by the Finite Element Method: The 10482 FEniCS Book}, 10483 series = {Lecture Notes in Computational Science and Engineering}, 10484 volume = {84}, 10485 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 10486 publisher = {Springer}, 10487 isbn = {978-3-642-23098-1}, 10488 year = {2012}, 10489 petsc_uses = {KSP} 10490} 10491 10492@Article{ demidovahnertruppgottschling12, 10493 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 10494 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 10495 journal = {ArXiv e-prints}, 10496 archiveprefix = {arXiv}, 10497 eprint = {1212.6326}, 10498 primaryclass = {cs.MS}, 10499 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 10500 Parallel, and Cluster Computing, Physics - Computational Physics}, 10501 year = {2012}, 10502 month = dec, 10503 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 10504 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10505 petsc_uses = {KSP} 10506} 10507 10508@InProceedings{ viennacl, 10509 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 10510 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 10511 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 10512 year = {2010}, 10513 pages = {51-56}, 10514 petsc_uses = {KSP} 10515} 10516 10517@Article{ knepleybrownmcinnessmithruppadams2015, 10518 title = {Exascale Computing without Threads}, 10519 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10520 Karl Rupp and Mark Adams}, 10521 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 10522 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10523 Scientific Software Architecture for Portability and Performance}, 10524 doi = {10.6084/m9.figshare.5824950.v1}, 10525 year = {2015}, 10526 petsc_uses = {KSP} 10527} 10528 10529@Article{ knepleybrownmcinnessmithruppadams2015b, 10530 title = {Overview of the {PETSc} Library}, 10531 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10532 Karl Rupp and Mark Adams}, 10533 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 10534 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10535 Scientific Software Architecture for Portability and Performance}, 10536 year = {2015}, 10537 petsc_uses = {KSP} 10538} 10539 10540@InCollection{ balaybrownknepleymcinnessmith2015, 10541 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 10542 Smith}, 10543 title = {Providing Mixed Language and Legacy Support within a Library}, 10544 editor = {J. Carver}, 10545 booktitle = {Software Engineering for Science}, 10546 publisher = {Taylor \& Francis}, 10547 year = {2015}, 10548 petsc_uses = {KSP} 10549} 10550 10551@Article{ ruppbalaybrownknepleymcinnessmith2015, 10552 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 10553 Software}, 10554 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 10555 McInnes and Barry F. Smith}, 10556 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 10557 Productivity Challenges}, 10558 journal = {ArXiv e-prints}, 10559 archiveprefix = {arXiv}, 10560 eprint = {1510.01122}, 10561 year = {2015}, 10562 petsc_uses = {KSP} 10563} 10564 10565@InProceedings{ knepley2013accurately, 10566 title = {Accurately Citing Software and Algorithms Used in Publications}, 10567 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 10568 F.}, 10569 year = {2013}, 10570 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10571 (WSSSPE), held at SC13}, 10572 doi = {10.6084/m9.figshare.785731}, 10573 petsc_uses = {KSP} 10574} 10575 10576@InProceedings{ milleretal2013, 10577 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 10578 Strategies Developed for {FASTMath}}, 10579 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 10580 Barry Smith}, 10581 year = {2013}, 10582 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10583 (WSSSPE), held at SC13}, 10584 doi = {10.6084/m9.figshare.789055}, 10585 petsc_uses = {KSP} 10586} 10587 10588@TechReport{ dudsonetal2012, 10589 title = {Improved Nonlinear Solvers in {BOUT++}}, 10590 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 10591 institution = {Argonne National Laboratory}, 10592 number = {ANL/MCS-P3025-0812}, 10593 year = {2012}, 10594 petsc_uses = {KSP} 10595} 10596 10597@Misc{ brown13, 10598 author = {J. Brown}, 10599 title = {Scalable Repository Workflows}, 10600 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10601 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10602 year = {2013}, 10603 petsc_uses = {KSP} 10604} 10605 10606@Misc{ starforest11, 10607 title = {Star forests as a parallel communication model}, 10608 author = {Jed Brown}, 10609 url = {https://jedbrown.org/files/StarForest.pdf}, 10610 year = {2011}, 10611 petsc_uses = {KSP} 10612} 10613 10614@Misc{ brownknepleysmith13, 10615 author = {J. Brown and M. Knepley and B. Smith}, 10616 title = {Run-time Extensibility: Anything Less is Unsustainable}, 10617 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10618 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10619 year = {2013}, 10620 petsc_uses = {KSP} 10621} 10622 10623@Article{ jzhaoyliwkliu15, 10624 author = {J. Zhao and Y. Li and W.K. Liu}, 10625 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 10626 via {XFEM}}, 10627 journal = {Computational Mechanics}, 10628 year = {2015}, 10629 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 10630 petsc_uses = {KSP} 10631} 10632 10633@Article{ alisic14, 10634 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 10635 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 10636 journal = {J. Geophys. Res.}, 10637 year = {2014}, 10638 volume = {119}, 10639 number = {7}, 10640 pages = {5903-5920}, 10641 doi = {10.1002/2013JB010906}, 10642 petsc_uses = {KSP} 10643} 10644 10645@Article{ rhebergen14, 10646 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 10647 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 10648 journal = {SIAM J. Sci. Comp.}, 10649 year = {2014}, 10650 volume = {36}, 10651 number = {4}, 10652 pages = {1960-1977}, 10653 doi = {10.1137/130946678}, 10654 petsc_uses = {KSP} 10655} 10656 10657@Article{ allwright14, 10658 author = {J. Allwright and R.F. Katz}, 10659 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 10660 journal = {Geophys. J. Int.}, 10661 year = {2014}, 10662 volume = {199}, 10663 number = {3}, 10664 pages = {1608--1624}, 10665 doi = {10.1093/gji/ggu345}, 10666 petsc_uses = {KSP} 10667} 10668 10669@Misc{ gropp10, 10670 author = {William D. Gropp}, 10671 title = {Update on libraries for {B}lue {W}aters}, 10672 address = {Bordeaux, France}, 10673 year = {2010}, 10674 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 10675 petsc_uses = {KSP} 10676} 10677 10678@InProceedings{ mayknepley2017, 10679 title = {{DMSwarm}: Particles in {PETSc}}, 10680 author = {Dave A May and Matthew G Knepley}, 10681 booktitle = {EGU General Assembly Conference Abstracts}, 10682 volume = {19}, 10683 pages = {10133}, 10684 year = {2017}, 10685 petsc_uses = {KSP} 10686} 10687 10688@InProceedings{ adamsbrownknepley2013, 10689 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 10690 title = {Low-communication techniques for extreme-scale multilevel solvers}, 10691 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 10692 organization = {DOE Office of Advanced Scientific Computing Research}, 10693 year = {2013}, 10694 petsc_uses = {KSP} 10695} 10696 10697@Article{ bhallagriffithknepleyadamsguy2017, 10698 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 10699 boundary equations}, 10700 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 10701 Adams and Robert D. Guy}, 10702 journal = {arXiv e-prints}, 10703 eprint = {1612.02208}, 10704 year = {2017}, 10705 note = {\url{http://arxiv.org/abs/1612.02208}}, 10706 petsc_uses = {KSP} 10707} 10708 10709@Article{ zampini2016pcbddc, 10710 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 10711 author = {Zampini, Stefano}, 10712 journal = {SIAM Journal on Scientific Computing}, 10713 volume = {38}, 10714 number = {5}, 10715 pages = {S282--S306}, 10716 year = {2016}, 10717 publisher = {SIAM}, 10718 petsc_uses = {KSP} 10719} 10720 10721@Article{ jolivetromanzampini2020, 10722 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 10723 robust multilevel overlapping {Schwarz} preconditioners}, 10724 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 10725 journal = {Computers and Mathematics with Applications}, 10726 volume = {84}, 10727 pages = {277--295}, 10728 year = {2020} 10729} 10730 10731@Article{ zampinitu2017, 10732 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 10733 porous media}, 10734 author = {Stefano Zampini and Xuemin Tu}, 10735 journal = {SIAM Journal of Scientific Computing}, 10736 volume = {39}, 10737 number = {4}, 10738 pages = {A1389--A1415}, 10739 year = {2017} 10740} 10741 10742@Article{ ohwidlundzampinidohrmann2017, 10743 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 10744 constraints for {Raviart-Thomas} vector fields}, 10745 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 10746 journal = {Mathematics of Computation}, 10747 volume = {87}, 10748 number = {310}, 10749 pages = {659--692}, 10750 year = {2017} 10751} 10752 10753@Article{ veigapavarinoscacchiwidlundzampini2016, 10754 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 10755 preconditioners}, 10756 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 10757 Stefano Zampini}, 10758 journal = {SIAM Journal of Scientific Computing}, 10759 volume = {39}, 10760 number = {1}, 10761 pages = {A281--A302}, 10762 year = {2016} 10763} 10764 10765@Article{ pavarinoscacchiwidlundzampini2018, 10766 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 10767 analysis}, 10768 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 10769 journal = {Mathematical Models and Methods in Applied Sciences}, 10770 volume = {28}, 10771 number = {7}, 10772 pages = {1337--1370}, 10773 year = {2018} 10774} 10775 10776@Article{ bergervergiatwaisman2017, 10777 title = {An overlapping Domain Decomposition preconditioning method for monolithic 10778 solution of shear bands}, 10779 author = {Luc Berger-Vergiat and Haim Waisman}, 10780 journal = {Computer Methods in Applied Mechanics and Engineering}, 10781 volume = {318}, 10782 pages = {33--60}, 10783 year = {2017}, 10784 petsc_uses = {KSP} 10785} 10786 10787@Article{ abhyankarmaldonadosmithzhang2020, 10788 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 10789 Simulations}, 10790 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 10791 H. Zhang}, 10792 journal = {ACM Transactions on Mathematical Software}, 10793 volume = {46}, 10794 number = {1}, 10795 year = {2020}, 10796 doi = {10.1145/3344587}, 10797 petsc_uses = {KSP} 10798} 10799 10800@InProceedings{ zhangellpack2018, 10801 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 10802 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 10803 {AVX-512}}, 10804 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 10805 year = {2018}, 10806 petsc_uses = {KSP} 10807} 10808 10809@Misc{ petsc-user-meetings:website, 10810 title = {{PETSc User Meetings}}, 10811 key = {PETSc User Meetings}, 10812 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 10813 petsc_uses = {KSP} 10814} 10815 10816@Article{ flexible-bicgstab-chen16, 10817 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10818 author = {J. Chen and L.C. McInnes and H. Zhang}, 10819 journal = {Journal of Scientific Computing}, 10820 volume = {68}, 10821 number = {2}, 10822 month = jul, 10823 year = {2016}, 10824 pages = {803--825}, 10825 doi = {10.1007/s10915-015-0159-4}, 10826 petsc_uses = {KSP} 10827} 10828 10829@Misc{ petsc-extensibility2016, 10830 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 10831 title = {{Extensibility in PETSc}}, 10832 note = {SIAM News, available via 10833 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 10834 year = {2016}, 10835 petsc_uses = {KSP} 10836} 10837 10838@Misc{ error-estimation-whitepaper2017, 10839 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 10840 title = {End-to-end error estimation and control}, 10841 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 10842 doi = {10.6084/m9.figshare.5339866}, 10843 year = {2017}, 10844 petsc_uses = {KSP} 10845} 10846 10847@Misc{ petsc-user-support15, 10848 title = {On the Evolution of User Support Topics in Computational Science and Engineering 10849 Software}, 10850 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 10851 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 10852 15-16, 2015}, 10853 year = {2015}, 10854 petsc_uses = {KSP} 10855} 10856 10857@InBook{ petsc-mixed-language-support2016, 10858 title = {Numerical Library Support for High-Performance Mixed Language Applications and 10859 Legacy Code}, 10860 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 10861 booktitle = {Software Engineering for Science}, 10862 editors = {J. Carver et al.}, 10863 publisher = {CRC Press}, 10864 pages = {201--214}, 10865 year = {2016}, 10866 petsc_uses = {KSP} 10867} 10868 10869@InProceedings{ konolige2018parallel, 10870 title = {A Parallel Solver for Graph {L}aplacians}, 10871 author = {Tristan Konolige and Jed Brown}, 10872 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 10873 doi = {10.1145/3218176.3218227}, 10874 note = {Best Paper Award}, 10875 archiveprefix = {arXiv}, 10876 eprint = {1705.06266}, 10877 year = {2018}, 10878 petsc_uses = {KSP} 10879} 10880 10881@InProceedings{ werner-kimn2019, 10882 title = {Parallel implementation of {AC} optimal power flow and time-constrained optimal 10883 power flow using high-performance computing}, 10884 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 10885 Jung-Han Kimn}, 10886 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 10887 note = {Best Paper in Track}, 10888 year = {2019}, 10889 petsc_uses = {KSP} 10890} 10891 10892@MastersThesis{ rinaldo-ceresoli18, 10893 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 10894 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 10895 Applications}, 10896 school = {Politecnico di Milano}, 10897 year = {2018}, 10898 month = apr, 10899 petsc_uses = {KSP} 10900} 10901 10902@Article{ sananschneppmay2016, 10903 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 10904 author = {P. Sanan and S. M. Schnepp and D. A. May}, 10905 journal = {SIAM Journal on Scientific Computing}, 10906 volume = {38}, 10907 number = {5}, 10908 pages = {C441-C470}, 10909 year = {2016}, 10910 doi = {10.1137/15M1049130}, 10911 petsc_uses = {KSP} 10912} 10913 10914@Article{ petscsf2022, 10915 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 10916 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 10917 Smith, Barry F. and Zampini, Stefano}, 10918 journal = {IEEE Transactions on Parallel and Distributed Systems}, 10919 title = {The {PetscSF} Scalable Communication Layer}, 10920 year = {2022}, 10921 volume = {33}, 10922 number = {4}, 10923 pages = {842-853}, 10924 doi = {10.1109/TPDS.2021.3084070} 10925} 10926 10927@Article{ brandt2000, 10928 title = {General highly accurate algebraic coarsening}, 10929 author = {Achi Brandt}, 10930 journal = {Electronic Transactions on Numerical Analysis}, 10931 volume = {10}, 10932 number = {9680}, 10933 pages = {1--20}, 10934 issn = {10689613}, 10935 year = {2000} 10936} 10937 10938@Article{ dalcinpazklercosimo2011, 10939 title = {Parallel distributed computing using Python}, 10940 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 10941 journal = {Advances in Water Resources}, 10942 volume = {34}, 10943 number = {9}, 10944 pages = {1124 - 1139}, 10945 note = {New Computational Methods and Software Tools}, 10946 issn = {0309-1708}, 10947 doi = {10.1016/j.advwatres.2011.04.013}, 10948 year = {2011} 10949} 10950 10951@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 10952 title = {Cython: The Best of Both Worlds}, 10953 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 10954 Seljebotn,Dag Sverre and Smith,Kurt }, 10955 journal = {Computing in Science \& Engineering}, 10956 volume = {13}, 10957 number = {2}, 10958 pages = {31-39}, 10959 doi = {10.1109/MCSE.2010.118}, 10960 year = {2011} 10961} 10962 10963@Article{ dalcinpazstorti2005, 10964 title = {MPI for Python}, 10965 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 10966 journal = {Journal of Parallel and Distributed Computing}, 10967 volume = {65}, 10968 number = {9}, 10969 pages = {1108 - 1115}, 10970 issn = {0743-7315}, 10971 doi = {10.1016/j.jpdc.2005.03.010}, 10972 year = {2005} 10973} 10974 10975@Article{ dalcincolliervignalcortescalo2016, 10976 title = {PetIGA: A framework for high-performance isogeometric analysis}, 10977 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 10978 Calo}, 10979 journal = {Computer Methods in Applied Mechanics and Engineering}, 10980 volume = {308}, 10981 pages = {151 - 181}, 10982 issn = {0045-7825}, 10983 doi = {10.1016/j.cma.2016.05.011}, 10984 year = {2016} 10985} 10986 10987@Article{ collierpardodalcinpaszynskicalo2012, 10988 title = {The cost of continuity: A study of the performance of isogeometric finite 10989 elements using direct solvers}, 10990 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 10991 Calo}, 10992 journal = {Computer Methods in Applied Mechanics and Engineering}, 10993 volume = {213-216}, 10994 pages = {353 - 361}, 10995 issn = {0045-7825}, 10996 doi = {10.1016/j.cma.2011.11.002}, 10997 year = {2012} 10998} 10999 11000@Article{ collierdalcinpardocalo2013, 11001 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 11002 Elements}, 11003 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 11004 journal = {SIAM Journal on Scientific Computing}, 11005 volume = {35}, 11006 number = {2}, 11007 pages = {A767-A784}, 11008 doi = {10.1137/120881038}, 11009 year = {2013} 11010} 11011 11012@Article{ dunning2017jump, 11013 title = {{JuMP}: a modeling language for mathematical optimization}, 11014 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 11015 journal = {SIAM Review}, 11016 volume = {59}, 11017 number = {2}, 11018 pages = {295--320}, 11019 year = {2017}, 11020 publisher = {SIAM} 11021} 11022 11023@InProceedings{ prudencioschulz2011, 11024 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 11025 Estimation, Simulation and Optimization}, 11026 author = {Ernesto E Prudencio and Karl W Schulz}, 11027 booktitle = {European Conference on Parallel Processing}, 11028 pages = {398--407}, 11029 year = {2011} 11030} 11031 11032@Misc{ rol-website, 11033 key = {ROL}, 11034 title = {{Rapid Optimization Library} Website}, 11035 howpublished = {\url{https://trilinos.org/packages/rol}}, 11036 year = {2018} 11037} 11038 11039@Article{ more1994line, 11040 title = {Line search algorithms with guaranteed sufficient decrease}, 11041 author = {Mor{\'e}, Jorge J and Thuente, David J}, 11042 journal = {ACM Transactions on Mathematical Software}, 11043 volume = {20}, 11044 number = {3}, 11045 pages = {286--307}, 11046 year = {1994}, 11047 publisher = {ACM} 11048} 11049 11050@Article{ griewank2000algorithm, 11051 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 11052 adjoint mode of computational differentiation}, 11053 author = {Griewank, Andreas and Walther, Andrea}, 11054 journal = {ACM Transactions on Mathematical Software}, 11055 volume = {26}, 11056 number = {1}, 11057 pages = {19--45}, 11058 year = {2000}, 11059 publisher = {ACM} 11060} 11061 11062@Article{ metcalf2011seven, 11063 title = {The seven ages of fortran}, 11064 author = {Metcalf, Michael}, 11065 journal = {Journal of Computer Science \& Technology}, 11066 volume = {11}, 11067 year = {2011} 11068} 11069 11070@Article{ giraldo_2013, 11071 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 11072 model of the atmosphere {(NUMA)}}, 11073 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 11074 journal = {SIAM Journal on Scientific Computing}, 11075 year = {2013}, 11076 number = {5}, 11077 pages = {B1162-B1194}, 11078 volume = {35}, 11079 doi = {10.1137/120876034} 11080} 11081 11082@Article{ constantinescu_tr2016b, 11083 author = {Constantinescu, E.M.}, 11084 title = {Estimating Global Errors in Time Stepping}, 11085 journal = {ArXiv e-prints}, 11086 archiveprefix = {arXiv}, 11087 eprint = {1503.05166}, 11088 primaryclass = {math.NA}, 11089 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 11090 year = {2016}, 11091 month = mar, 11092 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 11093 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 11094} 11095 11096@Article{ pareschi_2005, 11097 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 11098 with Relaxation}, 11099 author = {L. Pareschi and G. Russo}, 11100 journal = {Journal of Scientific Computing}, 11101 year = {2005}, 11102 number = {1}, 11103 pages = {129--155}, 11104 volume = {25} 11105} 11106 11107@Article{ kennedy_2003, 11108 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 11109 author = {C.A. Kennedy and M.H. Carpenter}, 11110 journal = {Appl. Numer. Math.}, 11111 year = {2003}, 11112 number = {1-2}, 11113 pages = {139--181}, 11114 volume = {44}, 11115 doi = {10.1016/S0168-9274(02)00138-1}, 11116 publisher = {Elsevier Science Publishers B. V.} 11117} 11118 11119@Unpublished{ boscarino_tr2011, 11120 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 11121 equations in the diffusion limit}, 11122 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 11123 note = {Arxiv preprint arXiv:1110.4375}, 11124 year = {2011} 11125} 11126 11127@Article{ ascher_1997, 11128 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 11129 equations}, 11130 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 11131 journal = {Applied Numerical Mathematics}, 11132 year = {1997}, 11133 pages = {151--167}, 11134 volume = {25} 11135} 11136 11137@Book{ ascherpetzold1998, 11138 title = {Computer methods for ordinary differential equations and differential-algebraic 11139 equations}, 11140 author = {Uri M Ascher and Linda R Petzold}, 11141 volume = {61}, 11142 publisher = {SIAM}, 11143 year = {1998} 11144} 11145 11146@Article{ colomesbadia2016, 11147 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 11148 equations}, 11149 author = {Oriol Colom{\'e}s and Santiago Badia}, 11150 journal = {International Journal for Numerical Methods in Engineering}, 11151 volume = {105}, 11152 number = {5}, 11153 pages = {372--400}, 11154 year = {2016} 11155} 11156 11157@Article{ sandu_1997, 11158 title = {Benchmarking stiff {ODE} solvers for atmospheric chemistry problems {II}: 11159 {R}osenbrock solvers}, 11160 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 11161 Potra}, 11162 journal = {Atmospheric Environment}, 11163 year = {1997}, 11164 number = {20}, 11165 pages = {3459--3472}, 11166 volume = {31}, 11167 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 11168 task is the integration of the stiff systems of ordinary differential equations 11169 describing the chemical transformations. It is therefore of interest to 11170 systematically search for stiff solvers which can be identified as close to 11171 optimal for atmospheric applications. In this paper we continue our investigation 11172 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 11173 and compare eight solvers on a set of seven box-models used in present day models. 11174 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 11175 application when they are provided with highly efficient sparse matrix techniques 11176 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 11177 the literature, viz. and 4, and two are new and specially developed for air 11178 quality applications, viz. 3 and 3. } 11179} 11180 11181@Article{ rang_2005, 11182 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 11183 equations of index 1}, 11184 author = {Rang, J. and Angermann, L.}, 11185 journal = {BIT Numerical Mathematics}, 11186 year = {2005}, 11187 number = {4}, 11188 pages = {761--787}, 11189 volume = {45}, 11190 publisher = {Springer} 11191} 11192 11193@Article{ gottliebketchesonshu2009, 11194 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 11195 title = {{High order strong stability preserving time discretizations}}, 11196 journal = {Journal of Scientific Computing}, 11197 volume = {38}, 11198 number = {3}, 11199 pages = {251--289}, 11200 doi = {10.1007/s10915-008-9239-z}, 11201 year = {2009} 11202} 11203 11204@Article{ ketcheson_2008, 11205 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 11206 Low-Storage Implementations}, 11207 author = {D.I. Ketcheson}, 11208 journal = {SIAM Journal on Scientific Computing}, 11209 year = {2008}, 11210 number = {4}, 11211 pages = {2113--2136}, 11212 volume = {30}, 11213 doi = {10.1137/07070485X}, 11214 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 11215 RungeKutta methods}, 11216 publisher = {SIAM} 11217} 11218 11219@Article{ jansen_2000, 11220 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 11221 equations with a stabilized finite element method}, 11222 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 11223 journal = {Computer Methods in Applied Mechanics and Engineering}, 11224 year = {2000}, 11225 number = {3}, 11226 pages = {305--319}, 11227 volume = {190}, 11228 publisher = {Elsevier} 11229} 11230 11231@Article{ butcher_2007, 11232 title = {Error propagation of general linear methods for ordinary differential equations}, 11233 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 11234 journal = {Journal of Complexity}, 11235 year = {2007}, 11236 number = {4-6}, 11237 pages = {560--580}, 11238 volume = {23}, 11239 abstract = {We discuss error propagation for general linear methods for ordinary differential 11240 equations up to terms of order p+2, where p is the order of the method. These 11241 results are then applied to the estimation of local discretization errors for 11242 methods of order p and for the adjacent order p+1. The results of numerical 11243 experiments confirm the reliability of these estimates. This research has 11244 applications in the design of robust stepsize and order changing strategies for 11245 algorithms based on general linear methods.}, 11246 doi = {10.1016/j.jco.2007.01.009}, 11247 issn = {0885-064X} 11248} 11249 11250@Article{ constantinescu_a2010a, 11251 title = {Extrapolated implicit-explicit time stepping}, 11252 author = {E.M. Constantinescu and A. Sandu}, 11253 journal = {SIAM Journal on Scientific Computing}, 11254 year = {2010}, 11255 number = {6}, 11256 pages = {4452-4477}, 11257 volume = {31}, 11258 comment = {Preprint \# ANL/MCS-P1612-0409}, 11259 doi = {10.1137/080732833} 11260} 11261 11262@InProceedings{ devito2011liszt, 11263 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 11264 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 11265 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 11266 Aiken, Alex and Duraisamy, Karthik and others}, 11267 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 11268 Networking, Storage and Analysis}, 11269 pages = {9}, 11270 year = {2011}, 11271 organization = {ACM} 11272} 11273 11274@Article{ devito2011designing, 11275 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 11276 author = {DeVito, Zachary and Hanrahan, Pat}, 11277 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 11278 year = {2011} 11279} 11280 11281@Misc{ pgasintro, 11282 author = {Tim Stitt}, 11283 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 11284 Model}, 11285 note = {\url{http://cnx.org/content/m20649/latest/}} 11286} 11287 11288@InProceedings{ el2006upc, 11289 title = {UPC: unified parallel C}, 11290 author = {El-Ghazawi, Tarek and Smith, Lauren}, 11291 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 11292 pages = {27}, 11293 year = {2006}, 11294 organization = {ACM} 11295} 11296 11297@InProceedings{ numrich1998co, 11298 title = {Co-Array Fortran for parallel programming}, 11299 author = {Numrich, Robert W and Reid, John}, 11300 booktitle = {ACM Sigplan Fortran Forum}, 11301 volume = {17}, 11302 number = {2}, 11303 pages = {1--31}, 11304 year = {1998}, 11305 organization = {ACM} 11306} 11307 11308@Article{ aiken1997titanium, 11309 title = {Titanium: A high-performance Java dialect}, 11310 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 11311 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 11312 Geoff and Semenzato, Luigi and others}, 11313 year = {1997} 11314} 11315 11316@Article{ charles2005x10, 11317 title = {X10: an object-oriented approach to non-uniform cluster computing}, 11318 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 11319 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 11320 Sarkar, Vivek}, 11321 journal = {Acm Sigplan Notices}, 11322 volume = {40}, 11323 number = {10}, 11324 pages = {519--538}, 11325 year = {2005}, 11326 publisher = {ACM} 11327} 11328 11329@Article{ chamberlain2007parallel, 11330 title = {Parallel programmability and the chapel language}, 11331 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 11332 journal = {International Journal of High Performance Computing Applications}, 11333 volume = {21}, 11334 number = {3}, 11335 pages = {291--312}, 11336 year = {2007}, 11337 publisher = {SAGE Publications} 11338} 11339 11340@InProceedings{ charmppoopsla93, 11341 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 11342 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 11343 editor = {Paepcke, A.}, 11344 fulleditor = {Paepcke, Andreas}, 11345 pages = {91--108}, 11346 month = sep, 11347 year = {1993}, 11348 booktitle = {{Proceedings of OOPSLA'93}}, 11349 publisher = {{ACM Press}} 11350} 11351 11352@InProceedings{ hewitt1973universal, 11353 title = {A universal modular actor formalism for artificial intelligence}, 11354 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 11355 booktitle = {Proceedings of the 3rd international joint conference on Artificial 11356 intelligence}, 11357 pages = {235--245}, 11358 year = {1973}, 11359 organization = {Morgan Kaufmann Publishers Inc.} 11360} 11361 11362@Book{ yonezawa1990abcl, 11363 title = {ABCL: an object-oriented concurrent system}, 11364 author = {Yonezawa, Akinori}, 11365 year = {1990}, 11366 publisher = {MIT press} 11367} 11368 11369@InProceedings{ dally1988object, 11370 title = {Object-oriented concurrent programming in CST}, 11371 author = {Dally, William J and Chien, Andrew A}, 11372 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 11373 applications: Architecture, software, computer systems, and general issues-Volume 11374 1}, 11375 pages = {434--439}, 11376 year = {1988}, 11377 organization = {ACM} 11378} 11379 11380@Article{ grimshaw1993easy, 11381 title = {Easy-to-use object-oriented parallel processing with Mentat}, 11382 author = {Grimshaw, Andrew S.}, 11383 journal = {Computer}, 11384 volume = {26}, 11385 number = {5}, 11386 pages = {39--51}, 11387 year = {1993}, 11388 publisher = {IEEE} 11389} 11390 11391@InProceedings{ gannon1991object, 11392 title = {Object oriented parallelism: pC++ ideas and experiments}, 11393 author = {Gannon, Dennis and Lee, JK}, 11394 booktitle = {Proceedings of}, 11395 pages = {13--23}, 11396 year = {1991} 11397} 11398 11399@InProceedings{ lau1992object, 11400 title = {An object-oriented class library for scalable parallel heuristic search}, 11401 author = {Lau, Wing-cheong and Singh, Vineet}, 11402 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 11403 pages = {252--267}, 11404 year = {1992}, 11405 organization = {Springer} 11406} 11407 11408@Book{ chase1989amber, 11409 title = {The Amber system: Parallel programming on a network of multiprocessors}, 11410 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 11411 Littlefield, Richard}, 11412 volume = {23}, 11413 number = {5}, 11414 year = {1989}, 11415 publisher = {ACM} 11416} 11417 11418@InProceedings{ kaiser2009parallex, 11419 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 11420 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 11421 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 11422 pages = {394--401}, 11423 year = {2009}, 11424 organization = {IEEE} 11425} 11426 11427@TechReport{ ipm, 11428 author = {Barry F. Smith}, 11429 title = {A New Parallel Programming Model for Computer Simulation}, 11430 institution = {Argonne National Laboratory}, 11431 year = {2014}, 11432 number = {ANL/MCS-P5135-0414} 11433} 11434 11435@Article{ groppsnir, 11436 author = {William Gropp and Marc Snir}, 11437 title = {Programming for Exascale Computers}, 11438 journal = {Computing in Science and Engineering}, 11439 volume = {15}, 11440 number = {6}, 11441 issn = {1521-9615}, 11442 year = {2013}, 11443 pages = {27-35}, 11444 doi = {10.1109/MCSE.2013.96}, 11445 publisher = {IEEE Computer Society}, 11446 address = {Los Alamitos, CA} 11447} 11448 11449@Book{ mpi3, 11450 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 11451 author = {Message Passing Interface Forum}, 11452 year = {2012}, 11453 publisher = {High Performance Computing Center Stuttgart (HLRS)} 11454} 11455 11456@Book{ openmp4, 11457 title = {OpenMP Application Program Interface, Version 4.0}, 11458 year = {2013}, 11459 publisher = {OpenMP Architecture Review Board} 11460} 11461 11462@InProceedings{ hartono2009annotation, 11463 title = {Annotation-based empirical performance tuning using {Orio}}, 11464 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 11465 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 11466 Symposium on}, 11467 pages = {1--11}, 11468 year = {2009}, 11469 organization = {IEEE} 11470} 11471 11472@Book{ toselli2005domain, 11473 title = {Domain Decomposition Methods: Algorithms and Theory}, 11474 author = {Toselli, Andrea and Widlund, Olof B}, 11475 volume = {34}, 11476 year = {2005}, 11477 publisher = {Springer} 11478} 11479 11480@InBook{ st2016, 11481 author = {Barry F. Smith and Xumin Tu}, 11482 chapter = {Domain Decomposition}, 11483 title = {Encyclopedia of Applied and Computational Mathematics}, 11484 bookeditor = {B. Engquist}, 11485 publisher = {Springer}, 11486 pages = {375--381}, 11487 year = {2016} 11488} 11489 11490@TechReport{ saws, 11491 author = {Matt Otten and Jed Brown and Barry F. Smith}, 11492 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 11493 institution = {Argonne National Laboratory}, 11494 year = {2013} 11495} 11496 11497@Article{ smith1997domain, 11498 title = {Domain Decomposition Methods for Partial Differential Equations}, 11499 author = {Smith, B.F.}, 11500 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 11501 volume = {4}, 11502 pages = {225--244}, 11503 year = {1997}, 11504 publisher = {Citeseer} 11505} 11506 11507@Article{ spillane2011abstract, 11508 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 11509 in the overlaps}, 11510 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 11511 Scheichl, R}, 11512 journal = {NuMa-Report}, 11513 volume = {7}, 11514 pages = {2007}, 11515 year = {2011} 11516} 11517 11518@InProceedings{ jolivet2013scalabledd, 11519 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 11520 problems}, 11521 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 11522 Prud'homme, Christophe}, 11523 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 11524 Networking, Storage and Analysis}, 11525 pages = {80}, 11526 year = {2013}, 11527 organization = {ACM} 11528} 11529 11530@Book{ ks2000, 11531 author = {D. Kinderlehrer and G. Stampacchia}, 11532 publisher = {Society for Industrial Mathematics}, 11533 title = {An Introduction to Variational Inequalities and Their Applications}, 11534 year = {2000} 11535} 11536 11537@Article{ wan2000energy, 11538 title = {An energy-minimizing interpolation for robust multigrid methods}, 11539 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 11540 journal = {SIAM Journal on Scientific Computing}, 11541 volume = {21}, 11542 number = {4}, 11543 pages = {1632--1649}, 11544 year = {2000}, 11545 publisher = {Philadelphia, PA: SIAM, c1993-} 11546} 11547 11548@Article{ chansmith1994, 11549 title = {Domain decomposition and multigrid algorithms for elliptic problems on 11550 unstructured meshes}, 11551 author = {Chan, T.F. and Smith, B.F.}, 11552 journal = {Electronic Transactions on Numerical Analysis}, 11553 volume = {2}, 11554 pages = {171--182}, 11555 year = {1994} 11556} 11557 11558@TechReport{ proto-fsp, 11559 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 11560 and Michael Zarnstorff and Michael Zika}, 11561 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 11562 institution = {Princeton Plasma Physics Laboratory}, 11563 year = {2010}, 11564 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 11565} 11566 11567@Article{ hirvijoki2021, 11568 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 11569 particle-in-cell codes}, 11570 journal = {Plasma Phys. Control. Fusion}, 11571 author = {Eero Hirvijoki}, 11572 note = {in press}, 11573 doi = {10.1088/1361-6587/abe884}, 11574 year = {2021} 11575} 11576 11577@Article{ ipsen2001, 11578 author = {Ilse C. F. Ipsen}, 11579 journal = {SIAM J. Sci. Comput.}, 11580 pages = {1050--1051}, 11581 volume = {23}, 11582 publisher = {SIAM}, 11583 title = {A Note on Preconditioning Nonsymmetric Matrices}, 11584 year = {2001} 11585} 11586 11587% Random papers on solvers for GPUs 11588@InProceedings{ gpus-suck, 11589 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 11590 title = { On the Limits of {GPU} Acceleration}, 11591 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 11592 year = {2010}, 11593 publisher = {USENIX} 11594} 11595 11596@InProceedings{ 882364, 11597 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 11598 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11599 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 11600 year = {2003}, 11601 isbn = {1-58113-709-5}, 11602 pages = {917--924}, 11603 location = {San Diego, California}, 11604 doi = {10.1145/1201775.882364}, 11605 publisher = {ACM}, 11606 address = {New York, NY} 11607} 11608 11609@Conference{ feng2008multigrid, 11610 author = {Feng, Z. and Li, P.}, 11611 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 11612 date-added = {2010-08-19 15:57:06 -0500}, 11613 date-modified = {2010-08-19 15:57:06 -0500}, 11614 pages = {647--654}, 11615 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 11616 year = {2008} 11617} 11618 11619@Conference{ goodnight2003multigrid, 11620 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 11621 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 11622 date-added = {2010-08-19 15:45:20 -0500}, 11623 date-modified = {2010-08-19 15:45:20 -0500}, 11624 organization = {Eurographics Association}, 11625 pages = {102--111}, 11626 title = {A multigrid solver for boundary value problems using programmable graphics 11627 hardware}, 11628 year = {2003} 11629} 11630 11631@Article{ buatois2007concurrent, 11632 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 11633 date-added = {2010-08-19 15:45:02 -0500}, 11634 date-modified = {2010-08-19 15:45:02 -0500}, 11635 journal = {High Performance Computing and Communications}, 11636 pages = {358--371}, 11637 publisher = {Citeseer}, 11638 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 11639 year = {2007} 11640} 11641 11642@Article{ joldes2010real, 11643 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 11644 date-added = {2010-08-19 15:44:41 -0500}, 11645 date-modified = {2010-08-19 15:44:41 -0500}, 11646 journal = {Computer Methods in Applied Mechanics and Engineering}, 11647 publisher = {Elsevier}, 11648 title = {Real-time nonlinear finite element computations on {GPU}-application to 11649 neurosurgical simulation}, 11650 year = {2010} 11651} 11652 11653@Misc{ aharon2005gpu, 11654 author = {Aharon, S.}, 11655 date-added = {2010-08-19 15:44:32 -0500}, 11656 date-modified = {2010-08-19 15:44:32 -0500}, 11657 month = apr, 11658 note = {US Patent App. 11/115,642}, 11659 publisher = {Google Patents}, 11660 title = {{GPU}-based Finite Element}, 11661 year = {2005} 11662} 11663 11664@Article{ cevahir2009fast, 11665 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 11666 date-added = {2010-08-19 15:44:01 -0500}, 11667 date-modified = {2010-08-19 15:44:01 -0500}, 11668 journal = {Computational Science--ICCS 2009}, 11669 pages = {893--903}, 11670 publisher = {Springer}, 11671 title = {Fast conjugate gradients with multiple {GPU}s}, 11672 year = {2009} 11673} 11674 11675@Article{ maier1995symmetric, 11676 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 11677 date-added = {2010-08-19 15:43:57 -0500}, 11678 date-modified = {2010-08-19 15:43:57 -0500}, 11679 journal = {Computational Mechanics}, 11680 number = {1}, 11681 pages = {115--129}, 11682 publisher = {Springer}, 11683 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 11684 plasticity}, 11685 volume = {17}, 11686 year = {1995} 11687} 11688 11689@Article{ corrigan-running, 11690 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 11691 date-added = {2010-08-19 15:43:47 -0500}, 11692 date-modified = {2010-08-19 15:43:47 -0500}, 11693 journal = {International Journal for Numerical Methods in Fluids}, 11694 publisher = {John Wiley \& Sons}, 11695 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 11696} 11697 11698@InProceedings{ volkov08, 11699 author = {Vasily Volkov and James W. Demmel}, 11700 title = {Benchmarking GPUs to tune dense linear algebra}, 11701 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 11702 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 11703 year = {2008} 11704} 11705 11706@TechReport{ cray-mvmult, 11707 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 11708 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 11709 institution = {School of Computer Science, Carnegie Mellon University}, 11710 number = {CMU-CS-93-173}, 11711 month = aug, 11712 year = {1993} 11713} 11714 11715@Conference{ bell2009implementing, 11716 author = {Bell, N. and Garland, M.}, 11717 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 11718 and Analysis}, 11719 date-added = {2010-08-19 15:43:42 -0500}, 11720 date-modified = {2010-08-19 15:43:42 -0500}, 11721 organization = {ACM}, 11722 pages = {1--11}, 11723 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 11724 processors}, 11725 year = {2009} 11726} 11727 11728@Article{ bell2008efficient, 11729 author = {Bell, N. and Garland, M.}, 11730 date-added = {2010-08-19 15:43:36 -0500}, 11731 date-modified = {2010-08-19 15:43:36 -0500}, 11732 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 11733 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 11734 year = {2008} 11735} 11736 11737@Article{ cohen-fast, 11738 author = {Cohen, J. and Molemaker, M.J.}, 11739 date-added = {2010-08-19 15:43:34 -0500}, 11740 date-modified = {2010-08-19 15:43:34 -0500}, 11741 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 11742 pages = {414}, 11743 publisher = {DEStech Publications}, 11744 title = {A fast double precision CFD code using CUDA} 11745} 11746 11747@Article{ kazhdan2008streaming, 11748 author = {Kazhdan, M. and Hoppe, H.}, 11749 date-added = {2010-08-19 15:43:32 -0500}, 11750 date-modified = {2010-08-19 15:43:32 -0500}, 11751 journal = {ACM Transactions on Graphics (TOG)}, 11752 number = {3}, 11753 pages = {21}, 11754 publisher = {ACM}, 11755 title = {Streaming multigrid for gradient-domain operations on large images}, 11756 volume = {27}, 11757 year = {2008} 11758} 11759 11760@Article{ bonnet1998symmetric, 11761 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 11762 date-added = {2010-08-19 15:43:18 -0500}, 11763 date-modified = {2010-08-19 15:43:18 -0500}, 11764 journal = {Appl. Mech. Rev}, 11765 pages = {669--704}, 11766 title = {Symmetric {G}alerkin boundary element method.}, 11767 volume = {51}, 11768 year = {1998} 11769} 11770 11771@Conference{ zamith2007gpu, 11772 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 11773 Valente, L.}, 11774 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 11775 Entertainment}, 11776 date-added = {2010-08-19 15:43:14 -0500}, 11777 date-modified = {2010-08-19 15:43:14 -0500}, 11778 pages = {37--43}, 11779 title = {The {GPU} used as a math co-processor in real time applications}, 11780 year = {2007} 11781} 11782 11783@Article{ baskaran2009optimizing, 11784 author = {Baskaran, M.M. and Bordawekar, R.}, 11785 date-added = {2010-08-19 15:42:56 -0500}, 11786 date-modified = {2010-08-19 15:42:56 -0500}, 11787 journal = {IBM Research Report RC24704, IBM}, 11788 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 11789 year = {2009} 11790} 11791 11792@Misc{ szeliski2006locally, 11793 author = {Szeliski, R.}, 11794 date-added = {2010-08-19 15:42:45 -0500}, 11795 date-modified = {2010-08-19 15:42:45 -0500}, 11796 month = jul, 11797 note = {US Patent App. 11/459,724}, 11798 publisher = {Google Patents}, 11799 title = {Locally adapted hierarchical basis preconditioning}, 11800 year = {2006} 11801} 11802 11803@Article{ jung2006cholesky, 11804 author = {Jung, J.H. and O'Leary, D.P.}, 11805 date-added = {2010-08-19 15:42:34 -0500}, 11806 date-modified = {2010-08-19 15:42:34 -0500}, 11807 journal = {Scholarly Paper, University of Maryland}, 11808 publisher = {Citeseer}, 11809 title = {Cholesky decomposition and linear programming on a {GPU}}, 11810 year = {2006} 11811} 11812 11813@Conference{ filipovic2009gpu, 11814 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 11815 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 11816 date-added = {2010-08-19 15:42:33 -0500}, 11817 date-modified = {2010-08-19 15:42:33 -0500}, 11818 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 11819 Results}, 11820 year = {2009} 11821} 11822 11823@Article{ taylor2009modelling, 11824 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 11825 Atkinson, D. and Ourselin, S.}, 11826 date-added = {2010-08-19 15:42:23 -0500}, 11827 date-modified = {2010-08-19 15:42:23 -0500}, 11828 journal = {Medical Image Analysis}, 11829 number = {2}, 11830 pages = {234--244}, 11831 publisher = {Elsevier}, 11832 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 11833 solution and {GPU} execution}, 11834 volume = {13}, 11835 year = {2009} 11836} 11837 11838@Conference{ owens2007survey, 11839 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 11840 and Lefohn, A.E. and Purcell, T.J.}, 11841 booktitle = {Computer Graphics Forum}, 11842 date-added = {2010-08-19 15:42:21 -0500}, 11843 date-modified = {2010-08-19 15:42:21 -0500}, 11844 number = {1}, 11845 organization = {John Wiley \& Sons}, 11846 pages = {80--113}, 11847 title = {A survey of general-purpose computation on graphics hardware}, 11848 volume = {26}, 11849 year = {2007} 11850} 11851 11852@Article{ strzodka2005scientific, 11853 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 11854 date-added = {2010-08-19 15:42:18 -0500}, 11855 date-modified = {2010-08-19 15:42:18 -0500}, 11856 journal = {Simulation Modelling Practice and Theory}, 11857 number = {8}, 11858 pages = {667--680}, 11859 publisher = {Elsevier}, 11860 title = {Scientific computation for simulations on programmable graphics hardware}, 11861 volume = {13}, 11862 year = {2005} 11863} 11864 11865@Conference{ rumpf2001using, 11866 author = {Rumpf, M. and Strzodka, R.}, 11867 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 11868 (VIIP-01)}, 11869 date-added = {2010-08-19 15:42:15 -0500}, 11870 date-modified = {2010-08-19 15:42:15 -0500}, 11871 organization = {Citeseer}, 11872 pages = {193--202}, 11873 title = {Using graphics cards for quantized FEM computations}, 11874 year = {2001} 11875} 11876 11877@Article{ sirtori1992galerkin, 11878 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 11879 date-added = {2010-08-19 15:42:14 -0500}, 11880 date-modified = {2010-08-19 15:42:14 -0500}, 11881 journal = {International Journal for Numerical Methods in Engineering}, 11882 number = {2}, 11883 pages = {255--282}, 11884 publisher = {John Wiley \& Sons}, 11885 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 11886 implementation}, 11887 volume = {35}, 11888 year = {1992} 11889} 11890 11891@Article{ tejada2005large, 11892 author = {Tejada, E. and Ertl, T.}, 11893 date-added = {2010-08-19 15:42:09 -0500}, 11894 date-modified = {2010-08-19 15:42:09 -0500}, 11895 journal = {Simulation Modelling Practice and Theory}, 11896 number = {8}, 11897 pages = {703--715}, 11898 publisher = {Elsevier}, 11899 title = {Large steps in {GPU}-based deformable bodies simulation}, 11900 volume = {13}, 11901 year = {2005} 11902} 11903 11904@Article{ goddeke2008using, 11905 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 11906 and Becker, C. and Turek, S.}, 11907 date-added = {2010-08-19 15:42:06 -0500}, 11908 date-modified = {2010-08-19 15:42:06 -0500}, 11909 journal = {International Journal of Computational Science and Engineering}, 11910 number = {1}, 11911 pages = {36--55}, 11912 publisher = {Inderscience}, 11913 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 11914 volume = {4}, 11915 year = {2008} 11916} 11917 11918@Article{ garland2008parallel, 11919 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 11920 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 11921 date-added = {2010-08-19 15:41:51 -0500}, 11922 date-modified = {2010-08-19 15:41:51 -0500}, 11923 journal = {IEEE Micro}, 11924 number = {4}, 11925 pages = {13--27}, 11926 title = {Parallel computing experiences with CUDA}, 11927 volume = {28}, 11928 year = {2008} 11929} 11930 11931@Article{ wong1985method, 11932 author = {Wong, SH and Ciric, IR}, 11933 date-added = {2010-08-19 15:41:48 -0500}, 11934 date-modified = {2010-08-19 15:41:48 -0500}, 11935 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 11936 and Electronic Engineering}, 11937 publisher = {MCB UP Ltd}, 11938 title = {Method of conformal transformation for the finite-element solution of 11939 axisymmetric exterior-field problems}, 11940 volume = {4}, 11941 year = {1985} 11942} 11943 11944@Article{ turek-feast, 11945 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 11946 H.}, 11947 date-added = {2010-08-19 15:41:47 -0500}, 11948 date-modified = {2010-08-19 15:41:47 -0500}, 11949 journal = {Concurrency and Computation: Practice and Experience}, 11950 publisher = {John Wiley \& Sons}, 11951 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 11952 elements} 11953} 11954 11955@Article{ abedi2006space, 11956 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 11957 date-added = {2010-08-19 15:41:46 -0500}, 11958 date-modified = {2010-08-19 15:41:46 -0500}, 11959 journal = {Computer Methods in Applied Mechanics and Engineering}, 11960 number = {25-28}, 11961 pages = {3247--3273}, 11962 publisher = {Elsevier}, 11963 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 11964 element-wise momentum balance}, 11965 volume = {195}, 11966 year = {2006} 11967} 11968 11969@Conference{ georgii2005interactiveb, 11970 author = {Georgii, J. and Westermann, R.}, 11971 booktitle = {Proceedings of VMV}, 11972 date-added = {2010-08-19 15:41:36 -0500}, 11973 date-modified = {2010-08-19 15:41:36 -0500}, 11974 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 11975 year = {2005} 11976} 11977 11978@Article{ mosegaard2005gpu, 11979 author = {Mosegaard, J. and others}, 11980 date-added = {2010-08-19 15:41:35 -0500}, 11981 date-modified = {2010-08-19 15:41:35 -0500}, 11982 publisher = {IEEE Computer Society}, 11983 title = {{GPU} accelerated surgical simulators for complex morphology}, 11984 year = {2005} 11985} 11986 11987@Article{ meyer2007particle, 11988 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 11989 date-added = {2010-08-19 15:41:33 -0500}, 11990 date-modified = {2010-08-19 15:41:33 -0500}, 11991 journal = {IEEE Transactions on Visualization and Computer Graphics}, 11992 pages = {1015--1026}, 11993 publisher = {Published by the IEEE Computer Society}, 11994 title = {Particle systems for efficient and accurate high-order finite element 11995 visualization}, 11996 year = {2007} 11997} 11998 11999@Conference{ rumpf2001nonlinear, 12000 author = {Rumpf, M. and Strzodka, R.}, 12001 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 12002 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 12003 date-added = {2010-08-19 15:41:29 -0500}, 12004 date-modified = {2010-08-19 15:41:29 -0500}, 12005 organization = {Springer Verlag Wien}, 12006 pages = {75}, 12007 title = {Nonlinear diffusion in graphics hardware}, 12008 year = {2001} 12009} 12010 12011@Article{ georgii2005interactive, 12012 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 12013 date-added = {2010-08-19 15:41:28 -0500}, 12014 date-modified = {2010-08-19 15:41:28 -0500}, 12015 journal = {Simulation and Visualisation}, 12016 pages = {247--258}, 12017 publisher = {Citeseer}, 12018 title = {Interactive simulation of deformable bodies on {GPU}s}, 12019 volume = {2005}, 12020 year = {2005} 12021} 12022 12023@Article{ harish2007accelerating, 12024 author = {Harish, P. and Narayanan, P.}, 12025 date-added = {2010-08-19 15:41:27 -0500}, 12026 date-modified = {2010-08-19 15:41:27 -0500}, 12027 journal = {High Performance Computing--HiPC 2007}, 12028 pages = {197--208}, 12029 publisher = {Springer}, 12030 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 12031 year = {2007} 12032} 12033 12034@Article{ keunings1995parallel, 12035 author = {Keunings, R.}, 12036 date-added = {2010-08-19 15:41:19 -0500}, 12037 date-modified = {2010-08-19 15:41:19 -0500}, 12038 journal = {Computers and Chemical Engineering}, 12039 number = {6}, 12040 pages = {647--670}, 12041 publisher = {Oxford; New York: Pergamon Press, 1977-}, 12042 title = {Parallel finite element algorithms applied to computational rheology}, 12043 volume = {19}, 12044 year = {1995} 12045} 12046 12047@Conference{ taylor2007real, 12048 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12049 booktitle = {Proceedings of the 10th international conference on Medical image computing and 12050 computer-assisted intervention-Volume Part I}, 12051 date-added = {2010-08-19 15:41:17 -0500}, 12052 date-modified = {2010-08-19 15:41:17 -0500}, 12053 organization = {Springer-Verlag}, 12054 pages = {701--708}, 12055 title = {Real-time nonlinear finite element analysis for surgical simulation using 12056 graphics processing units}, 12057 year = {2007} 12058} 12059 12060@Article{ liu2000finite, 12061 author = {Liu, R. and Li, DY}, 12062 date-added = {2010-08-19 15:41:16 -0500}, 12063 date-modified = {2010-08-19 15:41:16 -0500}, 12064 journal = {Materials Science and Engineering A}, 12065 number = {1-2}, 12066 pages = {169--175}, 12067 publisher = {Elsevier}, 12068 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 12069 volume = {277}, 12070 year = {2000} 12071} 12072 12073@Conference{ kakadiaris1994active, 12074 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 12075 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 12076 date-added = {2010-08-19 15:41:15 -0500}, 12077 date-modified = {2010-08-19 15:41:15 -0500}, 12078 organization = {Citeseer}, 12079 pages = {980--980}, 12080 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 12081 physics-based approach}, 12082 year = {1994} 12083} 12084 12085@Conference{ de2004gpu, 12086 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 12087 booktitle = {Proceedings of Eurohaptics}, 12088 date-added = {2010-08-19 15:41:14 -0500}, 12089 date-modified = {2010-08-19 15:41:14 -0500}, 12090 organization = {Citeseer}, 12091 pages = {44--51}, 12092 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 12093 volume = {2004}, 12094 year = {2004} 12095} 12096 12097@Book{ taflove1995computational, 12098 author = {Taflove, A. and Hagness, S.C.}, 12099 date-added = {2010-08-19 15:41:14 -0500}, 12100 date-modified = {2010-08-19 15:41:14 -0500}, 12101 publisher = {Artech House Norwood, MA}, 12102 title = {Computational electrodynamics}, 12103 year = {1995} 12104} 12105 12106@Conference{ galoppo2005lu, 12107 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 12108 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 12109 date-added = {2010-08-19 15:41:13 -0500}, 12110 date-modified = {2010-08-19 15:41:13 -0500}, 12111 organization = {IEEE Computer Society}, 12112 pages = {3}, 12113 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 12114 hardware}, 12115 year = {2005} 12116} 12117 12118@Conference{ ryoo2008optimization, 12119 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 12120 and Hwu, W.W.}, 12121 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 12122 parallel programming}, 12123 date-added = {2010-08-19 15:41:12 -0500}, 12124 date-modified = {2010-08-19 15:41:12 -0500}, 12125 organization = {ACM}, 12126 pages = {73--82}, 12127 title = {Optimization principles and application performance evaluation of a multithreaded 12128 {GPU} using CUDA}, 12129 year = {2008} 12130} 12131 12132@Conference{ micikevicius20093d, 12133 author = {Micikevicius, P.}, 12134 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 12135 Units}, 12136 date-added = {2010-08-19 15:41:11 -0500}, 12137 date-modified = {2010-08-19 15:41:11 -0500}, 12138 organization = {ACM}, 12139 pages = {79--84}, 12140 title = {3D finite difference computation on {GPU}s using {CUDA}}, 12141 year = {2009} 12142} 12143 12144@Conference{ zhou2004pixel, 12145 author = {Zhou, Y. and Garland, M. and Haber, R.}, 12146 booktitle = {IEEE Visualization, 2004}, 12147 date-added = {2010-08-19 15:41:03 -0500}, 12148 date-modified = {2010-08-19 15:41:03 -0500}, 12149 pages = {425--432}, 12150 title = {Pixel-exact rendering of spacetime finite element solutions}, 12151 year = {2004} 12152} 12153 12154@Article{ komatitsch2009porting, 12155 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 12156 date-added = {2010-08-19 15:41:01 -0500}, 12157 date-modified = {2010-08-19 15:41:01 -0500}, 12158 journal = {Journal of Parallel and Distributed Computing}, 12159 number = {5}, 12160 pages = {451--460}, 12161 publisher = {Elsevier}, 12162 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 12163 graphics cards using CUDA}, 12164 volume = {69}, 12165 year = {2009} 12166} 12167 12168@Article{ komatitsch1998spectral, 12169 author = {Komatitsch, D. and Vilotte, J.P.}, 12170 date-added = {2010-08-19 15:40:59 -0500}, 12171 date-modified = {2010-08-19 15:40:59 -0500}, 12172 journal = {Bulletin of the Seismological Society of America}, 12173 number = {2}, 12174 pages = {368--392}, 12175 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 12176 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 12177 of 2D and 3D geological structures}, 12178 volume = {88}, 12179 year = {1998} 12180} 12181 12182@Article{ wu2005improved, 12183 author = {Wu, W. and Heng, P.A.}, 12184 date-added = {2010-08-19 15:40:59 -0500}, 12185 date-modified = {2010-08-19 15:40:59 -0500}, 12186 journal = {The Visual Computer}, 12187 number = {8}, 12188 pages = {707--716}, 12189 publisher = {Springer}, 12190 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 12191 cutting and deformation}, 12192 volume = {21}, 12193 year = {2005} 12194} 12195 12196@Article{ taylor2008high, 12197 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12198 date-added = {2010-08-19 15:40:57 -0500}, 12199 date-modified = {2010-08-19 15:40:57 -0500}, 12200 journal = {IEEE transactions on medical imaging}, 12201 number = {5}, 12202 pages = {650}, 12203 title = {High-speed nonlinear finite element analysis for surgical simulation using 12204 graphics processing units.}, 12205 volume = {27}, 12206 year = {2008} 12207} 12208 12209@Conference{ bolz2003sparse, 12210 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 12211 booktitle = {ACM SIGGRAPH 2003 Papers}, 12212 date-added = {2010-08-19 15:40:55 -0500}, 12213 date-modified = {2010-08-19 15:40:55 -0500}, 12214 organization = {ACM}, 12215 pages = {924}, 12216 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 12217 year = {2003} 12218} 12219 12220@Article{ wu2004hybrid, 12221 author = {Wu, W. and Heng, P.A.}, 12222 date-added = {2010-08-19 15:40:54 -0500}, 12223 date-modified = {2010-08-19 15:40:54 -0500}, 12224 journal = {Computer Animation and Virtual Worlds}, 12225 number = {3-4}, 12226 pages = {219--227}, 12227 publisher = {John Wiley \& Sons}, 12228 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 12229 3D soft tissue cutting}, 12230 volume = {15}, 12231 year = {2004} 12232} 12233 12234% ---------------------------------------------------------------------------------------------------------------- 12235@TechReport{ davis97, 12236 author = {T. Davis}, 12237 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 12238 institution = {University of Florida}, 12239 year = {1997} 12240} 12241 12242@Article{ davis2011, 12243 author = {Davis, T. A. and Hu, Y.}, 12244 title = {The {U}niversity of {F}lorida sparse matrix collection}, 12245 journal = {ACM Transactions on Mathematical Software}, 12246 volume = {38}, 12247 issue = {1}, 12248 year = {2011}, 12249 pages = {1--25} 12250} 12251 12252@Article{ davis2004algorithm, 12253 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 12254 author = {Davis, Timothy A}, 12255 journal = {ACM Transactions on Mathematical Software}, 12256 volume = {30}, 12257 number = {2}, 12258 pages = {196--199}, 12259 year = {2004}, 12260 publisher = {ACM} 12261} 12262 12263@TechReport{ streams, 12264 author = {J. D. McCalpin}, 12265 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 12266 institution = {University of Virginia}, 12267 url = {http://www.cs.virginia.edu/stream}, 12268 year = {1995} 12269} 12270 12271@Article{ areusken_1988b, 12272 author = {A. Reusken}, 12273 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 12274 mildly nonlinear boundary value problems}, 12275 journal = {Numer. Math.}, 12276 volume = {52}, 12277 year = {1988}, 12278 pages = {251--277} 12279} 12280 12281@Article{ areusken_1988c, 12282 author = {A. Reusken}, 12283 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 12284 journal = {Numer. Math.}, 12285 volume = {53}, 12286 year = {1988}, 12287 pages = {663--686} 12288} 12289 12290@Unpublished{ mgnet, 12291 title = {Multigrid Net; http://www.mgnet.org/}, 12292 author = {Craig Douglas}, 12293 note = {Contains enormous bibliography on multigrid publications}, 12294 year = {2009} 12295} 12296 12297@Unpublished{ copper, 12298 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 12299 author = {}, 12300 note = {Held bi-annually}, 12301 year = {2009} 12302} 12303 12304@Book{ wessling1992, 12305 author = {Pieter Wesseling}, 12306 title = {An Introduction to Multigrid Methods}, 12307 year = {2004}, 12308 publisher = {R. T. Edwards} 12309} 12310 12311@Book{ bhm2000, 12312 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 12313 title = {A Multigrid Tutorial}, 12314 year = {2000}, 12315 publisher = {SIAM} 12316} 12317 12318@Book{ trottenberg2001multigrid, 12319 title = {{Multigrid}}, 12320 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 12321 isbn = {012701070X}, 12322 year = {2001}, 12323 publisher = {Academic Press} 12324} 12325 12326@TechReport{ brandt1984, 12327 author = {Achi Brandt}, 12328 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 12329 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 12330 number = {GMD-Studien Nr. 85}, 12331 year = {1984} 12332} 12333 12334@Article{ yavneh1998coarse, 12335 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 12336 author = {Yavneh, I.}, 12337 journal = {SIAM Journal on Scientific Computing}, 12338 volume = {19}, 12339 number = {5}, 12340 pages = {1682--1699}, 12341 year = {1998}, 12342 publisher = {Society for Industrial and Applied Mathematics} 12343} 12344 12345@Article{ wan2003phase, 12346 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 12347 author = {Wan, WL and Chan, T.F.}, 12348 journal = {SIAM Journal on Scientific Computing}, 12349 volume = {25}, 12350 pages = {857}, 12351 year = {2003} 12352} 12353 12354@Article{ imex, 12355 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 12356 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 12357 journal = {SIAM Journel on Numerical Analysis}, 12358 volume = {32}, 12359 number = {3}, 12360 pages = {797--823}, 12361 year = {1995} 12362} 12363 12364@Article{ ow1, 12365 author = {T. Washio and C. W. Oosterlee}, 12366 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 12367 Recirculating Flow}, 12368 journal = {SIAM Journal on Scientific Computing}, 12369 volume = {21}, 12370 number = {5}, 12371 pages = {1670--1690}, 12372 year = {2000} 12373} 12374 12375@Article{ vm1, 12376 author = {V. A. Mousseau}, 12377 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 12378 Heat Conduction}, 12379 journal = {Journal Of Computational Physics}, 12380 volume = {200}, 12381 pages = {104--132}, 12382 year = {2004} 12383} 12384 12385@Article{ vm2, 12386 author = {V. A. Mousseau}, 12387 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 12388 journal = {Journal Of Heat Transfer}, 12389 volume = {127}, 12390 pages = {531--539}, 12391 year = {2005} 12392} 12393 12394@Misc{ salome1, 12395 author = {Laurent Dada and Daniel Caruge}, 12396 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 12397 Simulation}, 12398 year = {2005}, 12399 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 12400 note = {Presentation at an ESA/ESTEC conference} 12401} 12402 12403@InProceedings{ downar1, 12404 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 12405 A. Mousseau and D. E. Ebert}, 12406 title = {Application of a generalized interface module to the coupling of {PARCS} with 12407 both {RELAP5} and {TRAC-M}}, 12408 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 12409 year = {1999} 12410} 12411 12412@Article{ lopez1, 12413 author = {A. P. Lopez and J. B. Sandova}, 12414 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 12415 thermal-hydraulics}, 12416 journal = {Annals of Nuclear Energy}, 12417 volume = {32(6)}, 12418 pages = {621--634}, 12419 year = {2005} 12420} 12421 12422@InProceedings{ og-1996, 12423 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 12424 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 12425 Transport Code}, 12426 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 12427 Transport Codes}, 12428 editor = {}, 12429 publisher = {}, 12430 pages = {}, 12431 note = {Paris, France}, 12432 month = dec, 12433 year = {1996} 12434} 12435 12436@Article{ wo-2000, 12437 author = {P. Warner and C. R. E. de Oliveira}, 12438 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 12439 {EVENT} for Shielding Applications}, 12440 journal = {J. Nucl. Sci. and Tech.}, 12441 volume = {Supplement 1}, 12442 pages = {466--470}, 12443 year = {2000} 12444} 12445 12446@Unpublished{ gnep-web, 12447 author = {{U.S. Department of Energy}}, 12448 title = {Global Nuclear Energy Partnership ({GNEP})}, 12449 note = {\url{ http://www.gnep.energy.gov}}, 12450 year = {2007} 12451} 12452 12453@Book{ lewis-miller-1984, 12454 author = {E. E. Lewis and W. F. Miller, Jr.}, 12455 title = {Computational Methods of Neutron Transport}, 12456 address = {}, 12457 publisher = {Wiley}, 12458 year = {1984} 12459} 12460 12461@Article{ couple1, 12462 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 12463 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 12464 THE {IBM-704}}, 12465 journal = {Nuclear Sci. and Eng.}, 12466 year = {1959}, 12467 pages = {113--115}, 12468 volume = {2(1)} 12469} 12470 12471@InProceedings{ weber1, 12472 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 12473 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 12474 and component design}, 12475 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 12476 year = {2000} 12477} 12478 12479@Misc{ gnep:report, 12480 author = {Phillip Finck and David Keyes and Rick Stevens}, 12481 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 12482 Nuclear Energy Systems}}, 12483 year = {2006} 12484} 12485 12486@Misc{ subsurface-workshop-ref, 12487 author = {D. {Zachman (Chair)}}, 12488 title = {{Computational Subsurface Sciences Workshop}}, 12489 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 12490} 12491 12492@Misc{ fusion:report, 12493 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 12494 Panel}}, 12495 author = {{Fusion Energy Sciences Advisory Committee}}, 12496 year = {2002}, 12497 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 12498} 12499 12500@Misc{ hecrtf:report, 12501 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 12502 key = {HECRTF}, 12503 year = {2004}, 12504 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 12505} 12506 12507@Misc{ doesc20years, 12508 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 12509 key = {Office of Science, U.S. Department of Energy}, 12510 year = {2003}, 12511 howpublished = {Office of Science, U.S. Department of Energy, see 12512 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 12513} 12514 12515@PhDThesis{ karpeev-thesis, 12516 author = {D. A. Karpeyev}, 12517 title = {Geometric Integrators for Hamiltonian PDEs}, 12518 school = {Old Dominion University}, 12519 year = {2002} 12520} 12521 12522@InCollection{ fjp:ima, 12523 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12524 title = {The Scalability of Mesh Improvement Algorithms}, 12525 booktitle = {Algorithms for Parallel Processing}, 12526 publisher = {Springer-Verlag}, 12527 volume = {105}, 12528 series = {The IMA Volumes in Mathematics and Its Applications}, 12529 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 12530 year = {1998}, 12531 pages = {185--212} 12532} 12533 12534@InProceedings{ poet, 12535 author = {Rob Armstrong and Alex Cheung}, 12536 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 12537 for Scientific Distributed Computing}, 12538 booktitle = {Proceedings of {HICSS97}}, 12539 year = {1997} 12540} 12541 12542@Misc{ pseware-web-page, 12543 author = {}, 12544 title = {{PSEware} {Web} page}, 12545 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 12546 key = {{PSEware} {Web} page} 12547} 12548 12549@Article{ epperly2011high, 12550 title = {High-performance language interoperability for scientific computing through 12551 {B}abel}, 12552 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 12553 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 12554 journal = {International Journal of High Performance Computing Applications}, 12555 pages = {1094342011414036}, 12556 year = {2011}, 12557 publisher = {SAGE Publications} 12558} 12559 12560@Misc{ babel-web-page, 12561 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 12562 title = {{Babel} {Web} page}, 12563 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 12564} 12565 12566@Misc{ infospheres-web-page, 12567 author = {K.~M. {Chandy et al.}}, 12568 title = {{Infospheres} {W}eb page}, 12569 note = {\url{http://www.infospheres.caltech.edu}}, 12570 key = {{Infospheres} {Web} page} 12571} 12572 12573@Misc{ hammond, 12574 author = {Glenn Hammond}, 12575 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 12576 communication} 12577} 12578 12579@Misc{ ornl, 12580 author = {Oak Ridge National Laboratory}, 12581 title = {Private communication via petsc-maint email support} 12582} 12583 12584@Unpublished{ cumulvs-web-page, 12585 author = {}, 12586 title = {{Cumulvs} {W}eb page}, 12587 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 12588 key = {{Cumulvs} {W}eb page} 12589} 12590 12591@Article{ nonlineargmres, 12592 author = {T. Washio and C. W. Oosterlee}, 12593 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 12594 journal = {ETNA}, 12595 year = {1997}, 12596 pages = {271--290}, 12597 volume = {6} 12598} 12599 12600@Article{ pcice, 12601 author = {Richard C. Martineau and Ray A. Berry}, 12602 title = {The pressure-corrected ICE finite element method for compressible flows on 12603 unstructured meshes}, 12604 journal = {Journal of Computational Physics}, 12605 year = {2004}, 12606 pages = {659--685}, 12607 volume = {198(2)} 12608} 12609 12610@Article{ cumulvs97, 12611 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 12612 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 12613 Applications}, 12614 journal = {International Journal of Supercomputing Applications}, 12615 year = {1997} 12616} 12617 12618@TechReport{ daly2012interagency, 12619 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 12620 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 12621 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 12622 Paul Woodward}, 12623 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 12624 year = {2012}, 12625 publisher = {US Department of Defense} 12626} 12627 12628@Article{ karpeev1, 12629 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 12630 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 12631 journal = {J. Comp. Phys.}, 12632 year = {2001}, 12633 pages = {116--148}, 12634 volume = {173} 12635} 12636 12637@InProceedings{ scirun97, 12638 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 12639 title = {The {SCIRun} Computational Steering System}, 12640 booktitle = {Modern Software Tools in Scientific Computing}, 12641 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 12642 publisher = {Birkhauser Press}, 12643 year = {1997} 12644} 12645 12646@TechReport{ szyld, 12647 author = {Valeria Simoncini and Daniel B. Szyld}, 12648 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 12649 Computing}, 12650 year = {2002}, 12651 institution = {Department of Mathematics, Temple University}, 12652 number = {02-4-12} 12653} 12654 12655@TechReport{ pdelab, 12656 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 12657 and C. C. Chui and S. Markus}, 12658 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 12659 for {PDE} Based Applications}, 12660 year = {1994}, 12661 institution = {Department of Computer Sciences, Purdue University}, 12662 number = {CSD-TR-94-021} 12663} 12664 12665@Unpublished{ ilu-web-page, 12666 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 12667 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 12668 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 12669} 12670 12671@Unpublished{ doe2k-web-page, 12672 title = {{DOE2000 Initiative} {W}eb page}, 12673 note = {http://www.mcs.anl.gov/DOE2000}, 12674 key = {DOE2000 Initiative} 12675} 12676 12677@Misc{ pvode-web-page, 12678 title = {{PVODE} {W}eb Page}, 12679 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 12680 author = {A. {Hindmarsh et al.}} 12681} 12682 12683@Book{ szyperski97, 12684 author = {Clemens Szyperski}, 12685 title = {Component Software: Beyond Object-Oriented Programming}, 12686 publisher = {ACM Press}, 12687 address = {New York}, 12688 year = {1997} 12689} 12690 12691@Unpublished{ petsc:coloringuse, 12692 title = {Code for computing sparse {J}acobians}, 12693 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12694 institution = {Argonne National Laboratory} 12695} 12696 12697@Unpublished{ petsc:external, 12698 author = {B. F. {Smith et al.}}, 12699 title = {{External Software Used by PETSc}}, 12700 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12701 institution = {Argonne National Laboratory} 12702} 12703 12704@Unpublished{ petsc:use-by-external-packages, 12705 author = {B. F. {Smith et al.}}, 12706 title = {{Software Packages that Use or Interface to PETSc}}, 12707 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 12708 institution = {Argonne National Laboratory} 12709} 12710 12711@Unpublished{ petsc:prizes, 12712 author = {B. F. {Smith et al.}}, 12713 title = {{Prizes Won Using PETSc}}, 12714 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12715 institution = {Argonne National Laboratory} 12716} 12717 12718@Unpublished{ petsc:csgf, 12719 author = {B. F. {Smith et al.}}, 12720 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 12721 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12722 institution = {Argonne National Laboratory} 12723} 12724 12725@Unpublished{ flash-web-page, 12726 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 12727 {W}eb Page}, 12728 note = {http://www.asci.uchicago.edu}, 12729 author = {R. {Rosner et al.}}, 12730 institution = {University of Chicago} 12731} 12732 12733@Unpublished{ esi-web-page, 12734 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 12735 note = {http://z.ca.sandia.gov/esi}, 12736 author = {R. {Clay et al.}} 12737} 12738 12739@Unpublished{ infobus-web-page, 12740 title = {{I}nfo{B}us {W}eb Page}, 12741 note = {http://www.java.sun.com/beans/infobus}, 12742 key = {infobus} 12743} 12744 12745@Unpublished{ xray-web-page, 12746 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 12747 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 12748 note = {http://www.mcs.anl.gov/xray/}, 12749 institution = {Argonne National Laboratory} 12750} 12751 12752@InProceedings{ kohn98, 12753 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 12754 title = {Language Interoperability Mechanisms for High-Performance Scientific 12755 Applications}, 12756 publisher = {SIAM}, 12757 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12758 Scientific and Engineering Computing}, 12759 year = {1999}, 12760 pages = {30-39} 12761} 12762 12763@InProceedings{ kohn01, 12764 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 12765 title = {Divorcing Language Dependencies from a Scientific Software Library}, 12766 publisher = {SIAM}, 12767 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 12768 year = {2001} 12769} 12770 12771@InProceedings{ freitag_jones_plassmann98, 12772 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12773 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 12774 publisher = {SIAM}, 12775 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12776 Scientific and Engineering Computing}, 12777 year = {1999}, 12778 pages = {215-224} 12779} 12780 12781@Book{ templates, 12782 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 12783 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 12784 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 12785 Methods}, 12786 publisher = {SIAM}, 12787 year = {1994}, 12788 address = {Philadelphia, PA} 12789} 12790 12791@InProceedings{ parasha2, 12792 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 12793 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 12794 {PDE} Solutions}, 12795 booktitle = {SC97 Proceedings}, 12796 publisher = {IEEE Computer Society Press}, 12797 year = {1997} 12798} 12799 12800@TechReport{ parasha, 12801 author = {M. Parashar and J. C. Browne}, 12802 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 12803 Techniques}, 12804 institution = {Department of Computer Science, University of Texas at Austin}, 12805 year = {1995} 12806} 12807 12808@Article{ parti, 12809 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 12810 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 12811 Memory Architectures}, 12812 journal = {Journal of Parallel and Distributed Computing}, 12813 year = {1994}, 12814 volume = {22}, 12815 pages = {462--478} 12816} 12817 12818@Article{ mparti, 12819 author = {G. Agrawal and A. Sussman and J. Saltz}, 12820 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 12821 Block Structured Applications}, 12822 journal = {IEEE Trans. on Parallel and Distributed Systems}, 12823 volume = {6}, 12824 number = {7}, 12825 year = {1995} 12826} 12827 12828@Article{ gropp-lusk-doss-skjellum, 12829 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 12830 title = {A high-performance, portable implementation of the {MPI} Message Passing 12831 Interface standard}, 12832 journal = {Parallel Computing}, 12833 year = {1996}, 12834 volume = {22}, 12835 pages = {789--828} 12836} 12837 12838@InProceedings{ lam, 12839 author = {Greg Burns and Raja Daoud and James Vaigl}, 12840 title = {{LAM}: An Open Cluster Environment for {MPI}}, 12841 booktitle = {Proceedings of Supercomputing Symposium '94}, 12842 editor = {John W. Ross}, 12843 publisher = {University of Toronto}, 12844 pages = {379--386}, 12845 year = {1994} 12846} 12847 12848@Article{ cs99, 12849 author = {X.-C. Cai and M. Sarkis}, 12850 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 12851 systems}, 12852 journal = {SIAM J. Scientific Computing}, 12853 year = {1999}, 12854 volume = {21}, 12855 pages = {792-797} 12856} 12857 12858@Article{ cai2003restricted, 12859 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 12860 positive definite linear systems}, 12861 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 12862 journal = {SIAM Journal on Numerical Analysis}, 12863 volume = {41}, 12864 issue = {1}, 12865 pages = {1209--1231}, 12866 year = {2003}, 12867 doi = {10.1137/S0036142901389621} 12868} 12869 12870@TechReport{ caisaad, 12871 author = {Xiao-Chuan Cai and Youcef Saad}, 12872 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 12873 institution = {Army High Performance Computing Research Center, University of Minnesota }, 12874 year = {1993}, 12875 number = {Preprint 93-027 }, 12876 note = {SIAM J. Sci. Comp. (submitted)} 12877} 12878 12879@Book{ ruminations, 12880 author = {Andrew Koenig and Barbara Moo}, 12881 title = {Ruminations on C++}, 12882 year = {1996}, 12883 publisher = {Addison-Wesley} 12884} 12885 12886@Book{ mpi-complete, 12887 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 12888 Dongarra}, 12889 title = {{MPI}: The Complete Reference}, 12890 year = {1995}, 12891 publisher = {MIT Press} 12892} 12893 12894@Unpublished{ tcl-tk-web-page, 12895 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 12896 note = {http://www.sunlabs.com/research/tcl/}, 12897 year = {1996}, 12898 month = aug 12899} 12900 12901@Misc{ mpich-web-page, 12902 author = {William Gropp and {et. al.}}, 12903 title = {{MPICH} {W}eb page}, 12904 key = {MPICH}, 12905 url = {http://www.mpich.org}, 12906 howpublished = {\url{http://www.mpich.org}} 12907} 12908 12909@Article{ mpi-final, 12910 author = {MPI Forum}, 12911 title = {{MPI}: A Message-Passing Interface Standard}, 12912 journal = {International J. Supercomputing Applications}, 12913 volume = {8}, 12914 number = {3/4}, 12915 year = {1994}, 12916 key = {MPI Standard - final} 12917} 12918 12919@Unpublished{ npb-web-page, 12920 key = {NAS Parallel Benchmarks}, 12921 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 12922 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 12923 year = {1996}, 12924 month = dec 12925} 12926 12927@Book{ george81, 12928 title = {Computer Solution of Large Sparse Positive Definite Systems}, 12929 author = {Alan George and Joseph W. Liu}, 12930 publisher = {Prentice-Hall}, 12931 year = {1981}, 12932 key = {SparseDirect} 12933} 12934 12935@Book{ p4-book, 12936 title = {Portable Programs for Parallel Processors}, 12937 publisher = {Holt, Rinehart, {and} Winston}, 12938 year = {1987}, 12939 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 12940 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 12941 key = {P4Book} 12942} 12943 12944@Article{ stones, 12945 author = {H. L. Stone}, 12946 title = {Iterative solution of implicit approximations of multidimensional partial 12947 differential equations}, 12948 journal = {SIAM J. Numerical Analysis}, 12949 pages = {87--113}, 12950 volumne = {5}, 12951 year = {1968} 12952} 12953 12954@Article{ parallelstones, 12955 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 12956 title = {Parallel versions of {S}tones strongly implicit algorithm}, 12957 journal = {Concurrency and Computation: Practice and Experience}, 12958 pages = {1049--1062}, 12959 volumne = {13}, 12960 year = {2001} 12961} 12962 12963@Article{ p4-paper, 12964 author = {Ralph Butler and Ewing Lusk}, 12965 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 12966 journal = {Journal of Parallel Computing}, 12967 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 12968 Division preprint P362-0493)}, 12969 year = {1993} 12970} 12971 12972@TechReport{ picl, 12973 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 12974 title = {{PICL}: A portable instrumented communications library}, 12975 institution = {Oak Ridge National Laboratory}, 12976 number = {TM-11130}, 12977 year = {1990}, 12978 key = {PICL} 12979} 12980 12981@TechReport{ upshot, 12982 author = {Virginia Herrarte and Ewing Lusk}, 12983 title = {Studying Parallel Program Behavior with {U}pshot}, 12984 institution = {Argonne National Laboratory}, 12985 number = {ANL-91/15}, 12986 month = aug, 12987 year = {1991}, 12988 key = {Upshot} 12989} 12990 12991@TechReport{ p4-manual, 12992 author = {Ralph Butler and Ewing Lusk}, 12993 title = {User's Guide to the p4 Parallel Programming System}, 12994 institution = {Argonne National Laboratory}, 12995 number = {ANL-92/17}, 12996 month = oct, 12997 year = {1992}, 12998 key = {p4-Manual} 12999} 13000 13001@InProceedings{ oldparti, 13002 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 13003 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 13004 booktitle = {Proceedings of Supercomputing '93}, 13005 pages = {578--587}, 13006 year = {1993} 13007} 13008 13009@Article{ parti2, 13010 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 13011 and J. Saltz}, 13012 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 13013 journal = {ACM SIGPLAN Notices}, 13014 year = {1995}, 13015 pages = {68-79}, 13016 volume = {30}, 13017 number = {8} 13018} 13019 13020@Article{ parti3, 13021 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 13022 title = {Run-Time Parallelization and Scheduling of Loops}, 13023 journal = {IEEE Trans. Computers}, 13024 year = {1991}, 13025 pages = {604-612}, 13026 volume = {40}, 13027 number = {5} 13028} 13029 13030@InProceedings{ disz-lusk:wamtrace, 13031 author = {Terrence Disz and Ewing Lusk}, 13032 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 13033 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13034 year = {1987}, 13035 pages = {46--53} 13036} 13037 13038@InProceedings{ gorlick-kesselman:gauge, 13039 author = {Michael Gorlick and Carl Kesselman}, 13040 title = {Timing {Prolog} programs without Clocks}, 13041 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13042 year = {1996}, 13043 publisher = {Birkhauser} 13044} 13045 13046@TechReport{ aztec, 13047 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 13048 title = {Aztec User's Guide Version 1.1}, 13049 institution = {Sandia National Laboratories}, 13050 month = oct, 13051 year = {1995}, 13052 number = {SAND95/1559} 13053} 13054 13055@TechReport{ aztec2, 13056 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 13057 title = {Official {Aztec} User's Guide Version 2.1}, 13058 institution = {Sandia National Laboratories}, 13059 year = {1999} 13060} 13061 13062@Book{ taylor-chandy:pcn, 13063 author = {Chandy, M. and Taylor, S.}, 13064 title = {An Introduction to Parallel Programming}, 13065 year = {1991}, 13066 publisher = {Jones and Bartlett} 13067} 13068 13069@Book{ foster-taylor:strand, 13070 title = {Strand: New Concepts in Parallel Programming}, 13071 author = {Ian Foster and Stephen Taylor}, 13072 publisher = {Prentice-Hall}, 13073 adress = { Englewood Cliffs, New Jersey}, 13074 year = {1990} 13075} 13076 13077@Article{ aurora, 13078 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 13079 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 13080 Carlsson and A. Ciepielewski and B. Hausman}, 13081 title = {The Aurora OR-Parallel Prolog System}, 13082 journal = {New Generation Computing}, 13083 volume = {7}, 13084 number = {3}, 13085 year = {1990}, 13086 pages = {243--271} 13087} 13088 13089@TechReport{ roo, 13090 author = {E. Lusk and W. McCune and J. Slaney}, 13091 title = {Roo---a Parallel Theorem Prover}, 13092 institution = {Argonne National Laboratory}, 13093 number = {MCS--TM--149}, 13094 year = {1991} 13095} 13096 13097@TechReport{ heath-etheridge:vppp, 13098 author = {M. T. Heath and J. A. Etheridge}, 13099 title = {Visualizing the Performance of Parallel Programs}, 13100 institution = {Oak Ridge National Laboratory}, 13101 number = {ORNL TM-11813}, 13102 year = {1991} 13103} 13104 13105@TechReport{ chem:vis, 13106 author = {Ewing L. Lusk}, 13107 title = {Performance Visualization for Parallel Programs}, 13108 institution = {Argonne National Laboratory}, 13109 number = {ANL/MCS--P287--0192}, 13110 year = {1991}, 13111 note = {(to appear in {\em Theoretica Chimica Acta})} 13112} 13113 13114@TechReport{ picltrace, 13115 author = {P.~H.~Worley}, 13116 title = {A new {PICL} trace file format}, 13117 institution = {Oak Ridge National Laboratory}, 13118 number = {ORNL TM-12125}, 13119 month = jun, 13120 year = {1992} 13121} 13122 13123@InProceedings{ hideo, 13124 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 13125 title = {Inference of Phylogenetic trees using maximum likelihood}, 13126 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 13127 year = {1992}, 13128 pages = {247--262} 13129} 13130 13131@InProceedings{ dw90, 13132 author = {M. Dryja and O. Widlund}, 13133 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 13134 Problems}, 13135 booktitle = {Third International Symposium on Domain Decomposition Methods}, 13136 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 13137 year = {1990}, 13138 pages = {3-21}, 13139 publisher = {SIAM}, 13140 address = {Philadelphia}, 13141 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 13142 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 13143 references, good introduction to the theory. No computations}, 13144 key = {DryjaWidlund90 !AS} 13145} 13146 13147@Unpublished{ rosing, 13148 author = {Matt Rosing and Joel Saltz}, 13149 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 13150 key = {LowLatency}, 13151 note = {manuscript, 1992} 13152} 13153 13154@TechReport{ jp:incomplete, 13155 author = {Mark T. Jones and Paul E. Plassmann}, 13156 title = {An Improved Incomplete {C}holesky Factorization}, 13157 institution = {Argonne National Laboratory}, 13158 address = {Argonne, IL}, 13159 type = {Preprint}, 13160 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 13161 number = {MCS-P206-0191}, 13162 year = {1991}, 13163 key = {jones} 13164} 13165 13166@InCollection{ jp:ima, 13167 author = {Mark Jones and Paul Plassmann}, 13168 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 13169 booktitle = {Graph Theory and Sparse Matrix Computation}, 13170 publisher = {Springer-Verlag}, 13171 series = {The IMA Volumes in Mathematics and Its Applications}, 13172 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 13173 volume = {56}, 13174 year = {1993}, 13175 pages = {229--245} 13176} 13177 13178@Article{ pw98, 13179 author = {M. Pernice and H. F. Walker}, 13180 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 13181 journal = {SIAM J. Sci. Stat. Comput.}, 13182 year = {1998}, 13183 volume = {19}, 13184 pages = {302--318} 13185} 13186 13187@TechReport{ ysmp83, 13188 key = {Eisenstat}, 13189 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13190 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13191 institution = {Department of Computer Science, Yale University}, 13192 number = {YALE/DCS/RR-265}, 13193 month = apr, 13194 year = {1983} 13195} 13196 13197@InBook{ ysmp84, 13198 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13199 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13200 title = {Elliptic Problem Solvers II}, 13201 publisher = {Academic Press}, 13202 pages = {45--52}, 13203 editors = {G. Birkhoff and A. Schoenstadt}, 13204 year = {1984} 13205} 13206 13207@TechReport{ sparsekit, 13208 key = {Saad}, 13209 author = {Youcef Saad}, 13210 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 13211 institution = {Center for Supercomputing Research and Development, University of Illinois at 13212 Urbana-Champaign}, 13213 number = {1029}, 13214 year = {1990} 13215} 13216 13217@TechReport{ pde-user-ref, 13218 author = {Barry F. Smith}, 13219 title = {Extensible {PDE} Solvers Package Users Manual}, 13220 institution = {Argonne National Laboratory}, 13221 month = sep, 13222 year = {1994}, 13223 number = {ANL-93/40}, 13224 key = {Smith94 ! PDE} 13225} 13226 13227@TechReport{ bs-user-ref, 13228 author = {Mark T. Jones and Paul E. Plassmann}, 13229 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 13230 of Sparse Linear Systems}, 13231 institution = {Argonne National Laboratory}, 13232 month = dec, 13233 year = {1995}, 13234 number = {ANL-95/48} 13235} 13236 13237@TechReport{ snes-user-ref, 13238 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 13239 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 13240 institution = {Argonne National Laboratory}, 13241 month = feb, 13242 year = {1995}, 13243 number = {ANL/MCS-TM-193}, 13244 key = {GroppMcInnesSmith95 ! SNES} 13245} 13246 13247@TechReport{ sles-user-ref, 13248 author = {William D. Gropp and Barry F. Smith}, 13249 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 13250 institution = {Argonne National Laboratory}, 13251 month = mar, 13252 year = {1993}, 13253 number = {ANL-93/8}, 13254 key = {GroppSmith93 ! SLES} 13255} 13256 13257@TechReport{ chameleon-user-ref, 13258 author = {William D. Gropp and Barry F. Smith}, 13259 title = {Chameleon Parallel programming tools Users Manual}, 13260 institution = {Argonne National Laboratory}, 13261 month = mar, 13262 year = {1993}, 13263 number = {ANL-93/23}, 13264 key = {GroppSmith93 ! Chameleon} 13265} 13266 13267@Article{ euclid2, 13268 author = {D. Hysom and A. Pothen}, 13269 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 13270 journal = {SIAM J. Sci. Comput.}, 13271 volume = {22}, 13272 number = {6}, 13273 pages = {2194--2215} 13274} 13275 13276@TechReport{ euclid1, 13277 author = {D. Hysom and A. Pothen}, 13278 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 13279 Solution of Sparse Linear Systems)}, 13280 institution = {Old Dominion University}, 13281 year = {2001} 13282} 13283 13284@TechReport{ ksp-user-ref, 13285 author = {William D. Gropp and Barry F. Smith}, 13286 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 13287 Methods}, 13288 institution = {Argonne National Laboratory}, 13289 month = aug, 13290 year = {1993}, 13291 number = {ANL-93/30}, 13292 key = {GroppSmith93 ! KSP} 13293} 13294 13295@TechReport{ mpi-chameleon, 13296 author = {William D. Gropp and Ewing Lusk}, 13297 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 13298 institution = {Argonne National Laboratory}, 13299 month = dec, 13300 year = {1992}, 13301 number = {ANL-92/47}, 13302 key = {GroppLusk92 ! MPI} 13303} 13304 13305@TechReport{ blockcomm-fortran, 13306 author = {William D. Gropp}, 13307 title = {Block{C}omm for {F}ortran}, 13308 institution = {Argonne National Laboratory}, 13309 month = may, 13310 year = {1993}, 13311 number = {ANL-93/00 (to appear)}, 13312 key = {Gropp93 ! BlockComm} 13313} 13314 13315@TechReport{ autodocument, 13316 author = {William D. Gropp}, 13317 title = {Automatic documentation of {C} programs}, 13318 institution = {Argonne National Laboratory}, 13319 month = may, 13320 year = {1993}, 13321 number = {ANL-93/00}, 13322 key = {Gropp93 ! Autodoc} 13323} 13324 13325@TechReport{ zipcode, 13326 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 13327 Manfred Morari}, 13328 title = {The {Z}ipcode message-passing system}, 13329 institution = {Lawrence Livermore National Laboratory}, 13330 month = sep, 13331 year = {1992}, 13332 number = {Unpublished}, 13333 key = {Skjellum92 ! Zipcode} 13334} 13335 13336@Article{ paragraph, 13337 author = {Michael T. Heath and Jennifer Etheridge Finger}, 13338 title = {Visualizing performance of parallel programs}, 13339 journal = {IEEE Software}, 13340 volume = {8}, 13341 number = {5}, 13342 month = sep, 13343 year = {1991}, 13344 pages = {29--39}, 13345 key = {Heath91 ! Paragraph} 13346} 13347 13348@Article{ gropp90, 13349 author = {William Gropp and Edward Smith}, 13350 title = {Computational Fluid Dynamics on Parallel Processors}, 13351 journal = {Computers and Fluids}, 13352 volume = {18}, 13353 year = {1990}, 13354 pages = {289--304}, 13355 key = {Gropp90 ! performance} 13356} 13357 13358@Article{ foster92, 13359 author = {Ian Foster and William Gropp and Rick Stevens}, 13360 title = {The parallel scalability of the spectral transform method}, 13361 journal = {Monthly Weather Review}, 13362 volume = {120}, 13363 year = {1992}, 13364 pages = {835--850}, 13365 key = {Foster92 ! performance} 13366} 13367 13368@InBook{ fgn, 13369 author = {R. Freund and G. H. Golub and N. Nachtigal}, 13370 title = {Iterative Solution of Linear Systems}, 13371 series = {Acta Numerica}, 13372 year = {1992}, 13373 publisher = {Cambridge University Press}, 13374 pages = {57--100} 13375} 13376 13377@TechReport{ nachtigal90, 13378 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 13379 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13380 institution = {Massachusetts Institute of Technology}, 13381 month = mar, 13382 year = {1990}, 13383 number = {90-2}, 13384 key = {Nachtigal | Krylov} 13385} 13386 13387@Article{ nachtigal1992fnm, 13388 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13389 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 13390 journal = {SIAM Journal on Matrix Analysis and Applications}, 13391 volume = {13}, 13392 pages = {778}, 13393 year = {1992}, 13394 publisher = {SIAM} 13395} 13396 13397@TechReport{ embree1999descriptive, 13398 title = {How descriptive are {GMRES} convergence bounds}, 13399 author = {Embree, M.}, 13400 year = {1999}, 13401 number = {08}, 13402 institution = {Oxford University Computing Laboratory} 13403} 13404 13405@Article{ vorst92, 13406 author = {H. van der Vorst}, 13407 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 13408 of nonsymmetric linear systems}, 13409 journal = {SIAM J. Sci. Stat. Comput.}, 13410 year = {1992}, 13411 volume = {13}, 13412 pages = {631--644} 13413} 13414 13415@Article{ eisenstat81, 13416 author = {S. Eisenstat}, 13417 title = {Efficient Implementation of a Class of {CG} Methods}, 13418 journal = {SIAM J. Sci. Stat. Comput.}, 13419 year = {1981}, 13420 volume = {2}, 13421 pages = {1--4} 13422} 13423 13424@Manual{ ibm-essl, 13425 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 13426 Reference}, 13427 organization = {IBM}, 13428 year = {1992}, 13429 key = {IBM-ESSL} 13430} 13431 13432@Manual{ ibm-eui, 13433 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 13434 Release 2.0}, 13435 organization = {IBM}, 13436 month = jun, 13437 year = {1994}, 13438 key = {IBM-EUI} 13439} 13440 13441@Manual{ ibm-euih, 13442 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 13443 organization = {IBM}, 13444 author = {Peter Hochschild}, 13445 year = {1993}, 13446 key = {IBM-EUIH} 13447} 13448 13449@TechReport{ mpi, 13450 title = {Document for a Standard Message-Passing Interface}, 13451 author = {Message Passing Interface Forum}, 13452 institution = {University of Tennessee}, 13453 number = {CS-93-214}, 13454 month = nov, 13455 year = {1993}, 13456 key = {MPI Standard} 13457} 13458 13459@Unpublished{ mpi-final-web, 13460 author = {Message Passing Interface Forum}, 13461 title = {{MPI}: A Message-Passing Interface Standard}, 13462 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 13463 year = {1994}, 13464 month = may 13465} 13466 13467@Book{ hockney-jesshope, 13468 author = {R. W. Hockney and C. R. Jesshope}, 13469 title = {Parallel Computers 2}, 13470 publisher = {Adam Hilger}, 13471 year = {1988} 13472} 13473 13474@Book{ cm-fortran, 13475 author = {{Thinking Machines Corporation}}, 13476 title = {Users Manual for CM-Fortran}, 13477 publisher = {Thinking Machines Corporation}, 13478 year = {1993} 13479} 13480 13481@TechReport{ chang93, 13482 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 13483 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 13484 institution = {Yale Department of Computer Science}, 13485 number = {YALEU/DCS/RR-994}, 13486 month = nov, 13487 year = {1993}, 13488 key = {BDD|diag} 13489} 13490 13491@InProceedings{ gropplevine93, 13492 author = {N. Galbreath and W. Gropp and D. Levine}, 13493 title = {Applications-Driven Parallel {I/O}}, 13494 booktitle = {Proceedings of Supercomputing '93}, 13495 year = {1993}, 13496 pages = {462--471} 13497} 13498 13499@Book{ siegle85, 13500 author = {H. J. Siegel}, 13501 title = {Interconnection Networks for Large Scale Parallel Processing}, 13502 publisher = {Lexington Books}, 13503 year = {1985}, 13504 key = {Network Comparison} 13505} 13506 13507@Article{ lawrie75, 13508 author = {D. H. Lawrie}, 13509 title = {Access and alignment of data in an array processor}, 13510 journal = {IEEE Transactions on Computers}, 13511 volume = {C-24}, 13512 number = {12}, 13513 month = dec, 13514 year = {1975}, 13515 pages = {1145--1155}, 13516 key = {Omega Network} 13517} 13518 13519@Book{ knuth1986, 13520 title = {The {\TeX}{Book}}, 13521 author = {Donald Ervin Knuth and Duane Bibby}, 13522 volume = {1993}, 13523 year = {1986}, 13524 publisher = {Addison-Wesley Reading, Massachusetts} 13525} 13526 13527@Book{ lamport86, 13528 author = {Leslie Lamport}, 13529 title = {{LaTeX}: A document preparation system}, 13530 publisher = {Addison-Wesley}, 13531 year = {1986}, 13532 key = {Latex Manual} 13533} 13534 13535@InProceedings{ gropp-lusk:unix-tools, 13536 author = {William Gropp and Ewing Lusk}, 13537 title = {Scalable {U}nix Tools on Parallel Processors}, 13538 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 13539 publisher = {IEEE}, 13540 pages = {56--62} 13541} 13542 13543@InProceedings{ jp:bell_prize, 13544 author = {Mark Jones and Paul Plassmann}, 13545 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 13546 Applications}, 13547 booktitle = {Proceedings of Supercomputing '92}, 13548 publisher = {IEEE Computer Society Press}, 13549 year = {1992}, 13550 pages = {551--560} 13551} 13552 13553@COMMENT{WEB, CWEB references (for doctext)} 13554@TechReport{ web, 13555 author = {Donald E. Knuth}, 13556 title = {The {\tt WEB} system of structured documentation}, 13557 institution = {Computer Science Department, Stanford University}, 13558 year = {1983}, 13559 number = {980}, 13560 month = sep 13561} 13562 13563@Article{ literatepgm, 13564 author = {Donald E. Knuth}, 13565 title = {Literate Programming}, 13566 journal = {Computer Journal}, 13567 year = {1984}, 13568 volume = {27}, 13569 number = {2}, 13570 pages = {91--111} 13571} 13572 13573@Unpublished{ cweb-code, 13574 author = {Silvio Levy and Donald E. Knuth}, 13575 title = {CWEB}, 13576 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 13577} 13578 13579@Article{ jp:scalable, 13580 author = {Mark Jones and Paul Plassmann}, 13581 title = {Scalable Iterative Solution of Sparse Linear Systems}, 13582 journal = {Parallel Computing}, 13583 volume = {20}, 13584 number = {5}, 13585 month = may, 13586 year = {1994}, 13587 pages = {753--773} 13588} 13589 13590@Article{ jp:pcolor, 13591 author = {Mark T. Jones and Paul E. Plassmann}, 13592 title = {A Parallel Graph Coloring Heuristic}, 13593 journal = {SIAM J. Sci. Comput.}, 13594 volume = {14}, 13595 number = {3}, 13596 pages = {654-669}, 13597 year = {1993} 13598} 13599 13600@TechReport{ block_solve, 13601 author = {Mark T. Jones and Paul E. Plassmann}, 13602 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 13603 Sparse Linear Systems}, 13604 institution = {Argonne National Laboratory}, 13605 year = {1992}, 13606 number = {ANL-92/46}, 13607 key = {JonesPlassmann92 ! block_solve} 13608} 13609 13610@InProceedings{ supercond, 13611 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 13612 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 13613 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 13614 Conference}, 13615 month = feb, 13616 year = {1994}, 13617 key = {McInnesPalumbo94 ! superconductivity } 13618} 13619 13620@Unpublished{ preosti:93, 13621 author = {Gianfranco Preosti}, 13622 title = { }, 13623 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 13624 year = {1993}, 13625 key = {preosti93 ! GL-tilt3d} 13626} 13627 13628@Unpublished{ more:93, 13629 author = {Jorge J. Mor\'{e}}, 13630 title = { }, 13631 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 13632 {A}rgonne {N}ational {L}aboratory}, 13633 year = {1993}, 13634 key = {more93 ! MINPACK-2} 13635} 13636 13637@Article{ brownsaad:90, 13638 author = {Peter N. Brown and Youcef Saad}, 13639 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 13640 journal = {SIAM J. Sci. Stat. Comput.}, 13641 year = {1990}, 13642 volume = {11}, 13643 pages = {450-481} 13644} 13645 13646@Book{ using-mpi, 13647 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 13648 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 13649 publisher = {MIT Press}, 13650 year = {1994} 13651} 13652 13653@Book{ using-mpi2, 13654 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 13655 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 13656 publisher = {MIT Press}, 13657 year = {1999} 13658} 13659 13660@Article{ hs:52, 13661 author = {Magnus R. Hestenes and Eduard Steifel}, 13662 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 13663 journal = {J. Research of the National Bureau of Standards}, 13664 year = {1952}, 13665 volume = {49}, 13666 pages = {409-436} 13667} 13668 13669@Article{ so:89, 13670 author = {Peter Sonneveld}, 13671 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 13672 journal = {SIAM J. Sci. Stat. Comput.}, 13673 year = {1989}, 13674 volume = {10}, 13675 pages = {36-52} 13676} 13677 13678@Article{ v:92, 13679 author = {{H. A.} {van der Vorst}}, 13680 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 13681 of nonsymmetric linear systems}, 13682 journal = {SIAM J. Sci. Stat. Comput.}, 13683 volume = {13}, 13684 year = {1992}, 13685 pages = {631-644} 13686} 13687 13688@Article{ f:93, 13689 author = {Roland W. Freund}, 13690 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 13691 Systems}, 13692 journal = {SIAM J. Sci. Stat. Comput.}, 13693 volume = {14}, 13694 year = {1993}, 13695 pages = {470-482} 13696} 13697 13698@Article{ ish:89, 13699 author = {S. Ishizuka}, 13700 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 13701 journal = {Combustion and Flame}, 13702 volume = {75}, 13703 year = {1989}, 13704 pages = {367-379} 13705} 13706 13707@Book{ williams89, 13708 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 13709 author = {F.A. Williams}, 13710 publisher = {Addison-Wesley}, 13711 year = {1989}, 13712 pages = {367-379} 13713} 13714 13715@Book{ ra75, 13716 author = {R. Aris}, 13717 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 13718 publisher = {Oxford}, 13719 year = {1975} 13720} 13721 13722@Book{ bebernes89, 13723 author = {J. Bebernes and D. Eberly}, 13724 title = {Mathematical Problems from Combustion Theory}, 13725 publisher = {Springer-Verlag}, 13726 series = {Applied Mathematical Sciences 83}, 13727 year = {1989} 13728} 13729 13730@InProceedings{ kikuchi89, 13731 author = {F. Kikuchi}, 13732 booktitle = { Computing Methods in Applied Sciences and Engineering}, 13733 editor = {R. Glowinski and J. L. Lions}, 13734 publisher = {Springer-Verlag}, 13735 series = {Lecture Notes in Mathematics}, 13736 title = {Finite element approximations to bifurcation problems of turning point type}, 13737 year = {1977} 13738} 13739 13740@Article{ rg85, 13741 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 13742 title = {Continuation-conjugate Gradient Methods for the Least Squares Solution of 13743 Nonlinear Boundary Problems}, 13744 journal = {SIAM J. Sci. Stat. Comput.}, 13745 volume = {6}, 13746 year = {1985}, 13747 pages = {793-832} 13748} 13749 13750@InProceedings{ whitfield91, 13751 author = {D. Whitfield and L. Taylor}, 13752 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13753 Schemes}, 13754 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 13755 misc = {AIAA-91-1539}, 13756 pages = {134-145}, 13757 year = {1991} 13758} 13759 13760@InProceedings{ quinlan1, 13761 author = {M. Lemke and D. Quinlan}, 13762 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 13763 Architecture-Independent Development of Structured Grid Applications}, 13764 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 13765 publisher = {Springer Verlag}, 13766 year = {1992} 13767} 13768 13769@InProceedings{ quinlan2, 13770 author = {R. Parsons and D. Quinlan}, 13771 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 13772 Computations}, 13773 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 13774 year = {1994} 13775} 13776 13777% ***** Overview of functionality in Diffpack 13778@InBook{ dpoverview, 13779 author = {Bruaset, A. M. and Langtangen, H. P.}, 13780 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13781 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 13782 {Diffpack}}, 13783 publisher = {Birkh{\"{a}}user}, 13784 pages = {61--90}, 13785 year = {1997} 13786} 13787 13788% ***** Short overview of Diffpack 13789@InCollection{ dpoverview2, 13790 author = {Bruaset, A. M. and Langtangen, H. P.}, 13791 editor = {A. Sydow}, 13792 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 13793 and Applied Mathematics}, 13794 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 13795 pages = {553--558}, 13796 volume = {4}, 13797 year = {1997} 13798} 13799 13800% ***** Comprehensive documentation of Diffpack and 13801% associated numerical methods: 13802@Book{ dpbook, 13803 author = {H. P. Langtangen}, 13804 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 13805 Software. Part I}, 13806 series = {Lecture Notes in Computational Science and Engineering}, 13807 publisher = {Springer-Verlag}, 13808 year = {1998} 13809} 13810 13811% ***** Design issues of the linear solvers in Diffpack, serves also as a 13812% collection of examples on O-O in numerical computing 13813@Article{ ambhpl97a, 13814 author = {A. M. Bruaset and H. P. Langtangen }, 13815 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 13816 journal = {Transactions on Mathematical Software}, 13817 volume = {23 }, 13818 pages = {50--80}, 13819 year = {1997} 13820} 13821 13822@Misc{ dpurl, 13823 author = {{Diffpack Web page}}, 13824 howpublished = {\url{http://www.diffpack.com}} 13825} 13826 13827% ***** General intro to object-oriented numerics for "FORTRAN programmers" 13828@InCollection{ oonintro, 13829 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 13830 editor = {D{\ae}hlen, M. and Tveito, A.}, 13831 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13832 title = {Object-Oriented Numerics}, 13833 publisher = {Birkh{\"{a}}user}, 13834 year = {1997} 13835} 13836 13837% ***** Efficiency comparison: BLAS 1, Diffpack, C, 13838% and finite element applications (F77 vs Diffpack) 13839@InCollection{ dpefficiency, 13840 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 13841 H. P. and Miller, C. T.}, 13842 editor = {D{\ae}hlen, M. and Tveito, A.}, 13843 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13844 title = {On the Efficiency of {C++} in Scientific Computing}, 13845 publisher = {Birkh{\"{a}}user}, 13846 pages = {91--118}, 13847 year = {1997} 13848} 13849 13850% ***** Parallel concept in Diffpack: 13851@InCollection{ dpparallel, 13852 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 13853 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 13854 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 13855 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 13856 Simulators}, 13857 publisher = {Springer--Verlag}, 13858 series = {Lecture Notes in Computer Science}, 13859 pages = {161--168}, 13860 year = {1997} 13861} 13862 13863% ***** DD and ML methods in Diffpack: 13864@InCollection{ dpddml, 13865 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 13866 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 13867 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 13868 title = {Domain decomposition and multilevel methods in Diffpack}, 13869 year = {1997} 13870} 13871 13872@InProceedings{ bsca98, 13873 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 13874 Alexander}, 13875 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 13876 Optimization}, 13877 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 13878 Scientific and Engineering Computing}, 13879 editor = {Mike Henderson et al.}, 13880 pages = {165-173}, 13881 year = {1998} 13882} 13883 13884@Book{ scalapack-user-guide, 13885 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 13886 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 13887 Stanley and D. Walker and R. C. Whaley}, 13888 title = {Sca{LAPACK} Users' Guide}, 13889 publisher = {SIAM}, 13890 address = {Philadelphia, PA}, 13891 year = {1997} 13892} 13893 13894@InProceedings{ keyes99, 13895 author = {D. E. Keyes}, 13896 title = {How Scalable is Domain Decomposition in Practice?}, 13897 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 13898 Methods}, 13899 editor = {C.-H. Lai et al.}, 13900 publisher = {Domain Decomposition Press, Bergen}, 13901 note = {To appear}, 13902 year = {1999} 13903} 13904 13905@Article{ fun3d, 13906 author = {W. K. Anderson and D. L. Bonhaus}, 13907 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 13908 grids}, 13909 journal = {Computers and Fluids}, 13910 year = {1994}, 13911 volume = {23}, 13912 pages = {1--21} 13913} 13914 13915% ------------------------------------------------------------------------- 13916% ------------------------------------------------------------------------- 13917@Article{ torczon, 13918 author = {Dennis, Jr., J. E. and V.~Torczon}, 13919 title = {Direct Search Methods on Parallel Machines}, 13920 journal = {SIAM J. Optimization}, 13921 volume = {1}, 13922 pages = {448--474}, 13923 year = {1991}, 13924 key = {Torczon !PDS} 13925} 13926 13927@InProceedings{ wt91, 13928 author = {D. L. Whitfield and L. K. Taylor}, 13929 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13930 Schemes}, 13931 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 13932 misc = {AIAA-91-1539}, 13933 pages = {134-145}, 13934 year = {1991} 13935} 13936 13937@Article{ ew96, 13938 author = {S. C. Eisenstat and H. F. Walker}, 13939 title = {Choosing the forcing terms in an inexact {N}ewton method}, 13940 journal = {SIAM J. Scientific Computing}, 13941 volume = {17}, 13942 year = {1996}, 13943 pages = {16--32} 13944} 13945 13946@Book{ thi93, 13947 author = {{Thinking Machines Corporation}}, 13948 title = {Users Manual for CM-Fortran}, 13949 publisher = {Thinking Machines Corporation}, 13950 year = {1993} 13951} 13952 13953@Book{ mortonmayers94, 13954 author = {K. W. Morton and D. F. Mayers}, 13955 title = {Numerical Solution of Partial Differential Equations}, 13956 publisher = {Press Syndicate of the University of Cambridge}, 13957 year = {1994} 13958} 13959 13960@Book{ heath97, 13961 author = {Michael T. Heath}, 13962 title = {Scientific Computing: An Introductory Survey}, 13963 publisher = {McGraw Hill}, 13964 year = {1997} 13965} 13966 13967@Article{ captools96, 13968 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 13969 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 13970 Performance on the Parallelization of Structured Mesh Codes}, 13971 journal = {Parallel Computing}, 13972 volume = {22}, 13973 pages = {197-226}, 13974 year = {1996} 13975} 13976 13977@Misc{ nastran-web-page, 13978 author = {{MSC Software Corporation}}, 13979 title = {{NASTRAN} {W}eb page}, 13980 howpublished = {\url{http://www.mechsolutions.com/products/nastran/}}, 13981 year = {2024} 13982} 13983 13984@Book{ hpf, 13985 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 13986 Zosel}, 13987 title = {The High Performance Fotran Handbook}, 13988 publisher = {MIT Press}, 13989 year = {1994} 13990} 13991 13992@InProceedings{ keyes98, 13993 author = {D. E. Keyes}, 13994 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 13995 Architectures}, 13996 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 13997 editors = {M. D. Salas and W. K. Anderson}, 13998 ppublisher = {Elsevier}, 13999 year = {1998} 14000} 14001 14002@InProceedings{ pooma-atlas, 14003 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 14004 J. V. W. Reynders and M. Tholburn}, 14005 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 14006 Applications}, 14007 year = {1995}, 14008 month = dec, 14009 booktitle = {Supercomputing '95 Proceedings} 14010} 14011 14012% --------------------------------------------------------------------------------- 14013% New bib entries for CRPC paper 14014@Misc{ mgnet-web-page, 14015 author = {Craig C. Douglas}, 14016 title = {{MGNet Web page}}, 14017 note = {See {\tt http://\-www.mgnet.org}} 14018} 14019 14020@Misc{ dagh-web-page, 14021 author = {M. Parashar and J. C. Browne}, 14022 title = {{DAGH Web page}}, 14023 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 14024} 14025 14026@Misc{ parasol-web-page, 14027 key = {PARASOL}, 14028 title = {{PARASOL Web page}}, 14029 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 14030} 14031 14032@Misc{ pooma-web-page, 14033 author = {{POOMA Web page}}, 14034 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 14035} 14036 14037@Misc{ mudpack-web-page, 14038 author = {John C. Adams}, 14039 title = {{MUDPACK Web page}}, 14040 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 14041} 14042 14043@Misc{ pellpack-web-page, 14044 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 14045 title = {{Parallel ELLPACK Web page}}, 14046 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 14047} 14048 14049@InProceedings{ pellpack95, 14050 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 14051 Catlin and S. Weerawarana and T.S. Papatheodorou}, 14052 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 14053 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 14054 address = {Albuquerque, NM}, 14055 year = {1995} 14056} 14057 14058@Misc{ nhse-web-page, 14059 author = {{National High-Performance Software Exchange Web page}}, 14060 note = {See {\tt http://\-www.nhse.org}} 14061} 14062 14063@Misc{ doug-web-page, 14064 author = {Mark J. Hagger and Linda Stals}, 14065 title = {{DOUG Web Page}}, 14066 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 14067} 14068 14069@TechReport{ doug97, 14070 author = {Mark J. Hagger}, 14071 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 14072 institution = {Mathematical Sciences, University of Bath}, 14073 year = {1997}, 14074 number = {9706}, 14075 note = {Advances in Computational Mathematics (to appear)} 14076} 14077 14078@Misc{ ug-web-page, 14079 author = {{UG Web Page}}, 14080 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 14081} 14082 14083@Article{ ug97, 14084 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 14085 Rentz-Reichert and C. Wieners}, 14086 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 14087 journal = {Computing and Visualization in Science}, 14088 year = {1997}, 14089 volume = {}, 14090 pages = {} 14091} 14092 14093@Misc{ vecfem-web-page, 14094 author = {Lutz Grosz}, 14095 title = {{VECFEM Web Page}}, 14096 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 14097} 14098 14099@Misc{ atlas-web-page, 14100 author = {R. Clint {Whaley et al.}}, 14101 title = {{ATLAS Web Page}}, 14102 howpublished = {\url{http://math-atlas.sourceforge.net}} 14103} 14104 14105@Misc{ fenics-web-page, 14106 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 14107 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 14108 title = {{FEniCS Web Page}}, 14109 note = {\url{http://www.fenicsproject.org}}, 14110 year = {2005} 14111} 14112 14113@Misc{ matlab-web-page, 14114 author = {{The} {MathWorks}}, 14115 title = {{Matlab} {Web} page}, 14116 url = {http://www.mathworks.com} 14117} 14118 14119@Misc{ phipac-web-page, 14120 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 14121 and D. Lam}, 14122 title = {{PHiPAC Web Page}}, 14123 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 14124} 14125 14126@InProceedings{ kelp, 14127 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 14128 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 14129 booktitle = {Irregular '96}, 14130 year = {1996} 14131} 14132 14133@Unpublished{ kelp-web-page, 14134 author = {Scott Baden}, 14135 title = {{KeLP} {W}eb page}, 14136 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 14137} 14138 14139@InProceedings{ hk99, 14140 author = {R. Hornung and S. Kohn}, 14141 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 14142 Framework}, 14143 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 14144 Scientific and Engineering Computing}, 14145 pages = {235-244}, 14146 year = {1999}, 14147 note = {See \url{http://www.llnl.gov/CASC/samrai}} 14148} 14149 14150@Unpublished{ samrai-web-page, 14151 title = {{SAMRAI} {W}eb Page}, 14152 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 14153 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 14154} 14155 14156@Misc{ overture-web-page, 14157 author = {William Henshaw and Kyle Chand}, 14158 title = {{Overture} {W}eb page}, 14159 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 14160} 14161 14162@InProceedings{ overture99, 14163 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 14164 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 14165 on Overlapping Grids}, 14166 publisher = {SIAM}, 14167 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14168 Scientific and Engineering Computing}, 14169 year = {1999}, 14170 pages = {215-224}, 14171 note = {See \url{http://www.llnl.gov/CASC/Overture}} 14172} 14173 14174@InProceedings{ diffpack, 14175 author = {A.M. Bruaset and H.P. Langtangen}, 14176 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 14177 {D}iffpack}, 14178 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 14179 year = {1997}, 14180 pages = {61--90}, 14181 publisher = {Birkhauser Press} 14182} 14183 14184@Article{ dongarra:1984:ila, 14185 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 14186 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 14187 Machine}, 14188 journal = {SIAM Review}, 14189 volume = {26}, 14190 number = {1}, 14191 pages = {91--112}, 14192 month = jan, 14193 year = {1984}, 14194 coden = {SIREAD}, 14195 issn = {0036-1445 (print), 1095-7200 (electronic)}, 14196 mrclass = {65F10 (65F30)}, 14197 mrnumber = {85c:65032}, 14198 bibdate = {Mon Jan 20 1997}, 14199 abstract = {The authors examine common implementations of linear algebra algorithms, such as 14200 matrix-vector multiplication, matrix-matrix multiplication and the solution of 14201 linear equations. The different versions are examined for efficiency on a computer 14202 architecture which uses vector processing and has pipelined instruction execution. 14203 By using the advanced architectural features of such machines, one can usually 14204 achieve maximum performance, and tremendous improvements in terms of execution 14205 speed can be seen over conventional computers.}, 14206 classification= {723; 921}, 14207 journalabr = {SIAM Rev}, 14208 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 14209 mathematical programming; vector pipeline machine} 14210} 14211 14212@Book{ qv99, 14213 author = {Alfio Quarteroni and Alberto Valli}, 14214 title = {Domain Decomposition Methods for Partial Differential Equations}, 14215 publisher = {Oxford Science Publications}, 14216 address = {Oxford}, 14217 year = {1999} 14218} 14219 14220@Book{ ksv97, 14221 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 14222 title = {Parallel Numerical Algorithms}, 14223 publisher = {Kluwer Academic Publishers}, 14224 address = {the Netherlands}, 14225 year = {1997} 14226} 14227 14228@Book{ hackbusch94, 14229 author = {Wolfgang Hackbusch}, 14230 title = {Iterative Solution of Large Sparse Systems of Equations}, 14231 publisher = {Springer-Verlag}, 14232 address = {New York}, 14233 year = {1994} 14234} 14235 14236@Article{ hackbusch1980fast, 14237 title = {Fast solution of elliptic control problems}, 14238 author = {Hackbusch, W.}, 14239 journal = {Journal of Optimization Theory and Applications}, 14240 volume = {31}, 14241 number = {4}, 14242 pages = {565--581}, 14243 year = {1980}, 14244 publisher = {Springer} 14245} 14246 14247@Book{ hackbusch1985multi, 14248 title = {{Multi-grid methods and applications}}, 14249 author = {Hackbusch, W.}, 14250 isbn = {3540127615}, 14251 issn = {0179-3632}, 14252 year = {1985}, 14253 publisher = {Springer Verlag} 14254} 14255 14256@Book{ axelsson94, 14257 author = {Owe Axelsson}, 14258 title = {Iterative Solution Methods}, 14259 publisher = {Cambridge University Press}, 14260 address = {Cambridge}, 14261 year = {1994} 14262} 14263 14264@Book{ saad96, 14265 author = {Yousef Saad}, 14266 title = {Iterative Methods for Sparse Linear Systems}, 14267 publisher = {PWS Publishing Company}, 14268 address = {Boston}, 14269 year = {1996} 14270} 14271 14272@Book{ saad2003, 14273 title = {Iterative Methods for Sparse Linear Systems}, 14274 author = {Saad, Yousef}, 14275 doi = {10.1016/S1570-579X(01)80025-2}, 14276 edition = {2nd}, 14277 publisher = {SIAM}, 14278 year = {2003} 14279} 14280 14281@Book{ vandervorst03, 14282 author = {Henk A. {van der Vorst}}, 14283 title = {Iterative Krylov Methods for Large Linear Systems}, 14284 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 14285 year = {2003} 14286} 14287 14288@Book{ koniges00, 14289 editor = {Alice E. Koniges}, 14290 title = {Industrial Strength Parallel Computing}, 14291 publisher = {Morgan Kaufmann Publishers}, 14292 address = {San Francisco}, 14293 year = {2000} 14294} 14295 14296@Misc{ fftw-web-page, 14297 key = {Fftw}, 14298 title = {{FFTW} {Web} page}, 14299 note = {\texttt{http://www.fftw.org/}}, 14300 annote = {fast FFT. Parallel versions with MPI and Cilk} 14301} 14302 14303@InProceedings{ frigojohnson93, 14304 author = {Matteo Frigo and Steven G. Johnson}, 14305 title = {The Design and Implementation of {FFTW3}}, 14306 booktitle = {Proceedings of the IEEE}, 14307 volume = {93}, 14308 number = {2}, 14309 pages = {216--231}, 14310 year = {2005} 14311} 14312 14313@Book{ kelley95, 14314 author = {C. T. Kelley}, 14315 title = {Iterative Methods for Linear and Nonlinear Equations}, 14316 year = {1995}, 14317 publisher = {SIAM}, 14318 address = {Philadelphia} 14319} 14320 14321@Unpublished{ spai-web-page, 14322 title = {{SPAI} {W}eb {P}age}, 14323 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 14324 author = {Steven Bernard and Marcus Grote}, 14325 institution = {NASA Ames Research Center and ETH Zurich} 14326} 14327 14328@Article{ gh97, 14329 author = {M. J. Grote and T. Huckle}, 14330 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 14331 year = {1997}, 14332 journal = {SIAM J. of Scient. Comput.}, 14333 volume = {18}, 14334 pages = {838-853} 14335} 14336 14337@Article{ zhang96, 14338 author = {Wen Zhang}, 14339 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 14340 simulation of a sintering process}, 14341 year = {1996}, 14342 journal = {Appl. Numer. Math.}, 14343 volume = {20}, 14344 pages = {235-244} 14345} 14346 14347@Article{ zhang98, 14348 author = {Wen Zhang and Ian Gladwell}, 14349 title = {The sintering of two particles by surface and grain boundary diffusion - a 14350 three-dimensional numerical study}, 14351 journal = {Comp. Mater. Sci.}, 14352 year = {1998}, 14353 volume = {12} 14354} 14355 14356@InProceedings{ mollerschwartzbach01, 14357 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 14358 title = {The Pointer Assertion Logic Engine}, 14359 booktitle = {ACM Proceedings of PLDI'01}, 14360 year = {2001} 14361} 14362 14363@InProceedings{ klarlandschwartzbach97, 14364 author = {Nils Klarland and Michael I. Schwartzbach}, 14365 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 14366 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 14367 publisher = {USENIX}, 14368 month = oct, 14369 year = {1997}, 14370 address = {Santa Barbara, CA} 14371} 14372 14373@InProceedings{ conselmarlet98, 14374 author = {C. Consel and R. Marlet}, 14375 title = {Architecturing software using a methodology for language development}, 14376 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 14377 Implementations, Logics and Programs}, 14378 year = {1998}, 14379 pages = {170-174}, 14380 month = sep, 14381 address = {Pisa, Italy} 14382} 14383 14384@Misc{ sundials:homepage, 14385 author = {C. {Woodward et al.}}, 14386 title = {{SUNDIALS {W}eb page}}, 14387 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 14388} 14389 14390@article{gardner2022sundials, 14391 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 14392 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 14393 journal = {ACM Transactions on Mathematical Software (TOMS)}, 14394 publisher = {ACM}, 14395 year = {2022}, 14396 doi = {10.1145/3539801} 14397} 14398 14399@Misc{ sundials-user-ref, 14400 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14401 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 14402 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 14403 and Dan Shumaker and Carol Woodward}, 14404 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14405 number = {UCRL-JP-200037}, 14406 year = {2003} 14407} 14408 14409@Article{ sundials05, 14410 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 14411 and C. Woodward}, 14412 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14413 journal = {ACM Transactions on Mathematical Software}, 14414 volume = {31}, 14415 number = {3}, 14416 pages = {363--396}, 14417 year = {2005} 14418} 14419 14420@InProceedings{ serban2005cvodes, 14421 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 14422 author = {Serban, Radu and Hindmarsh, Alan C}, 14423 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 14424 Dynamics and Control, Long Beach, CA}, 14425 year = {2005} 14426} 14427 14428@Article{ pvode99, 14429 author = {G. Byrne and A. Hindmarsh}, 14430 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 14431 journal = {Int. J. High Perf. Comput. Apps.}, 14432 volume = {13}, 14433 number = {4}, 14434 year = {1999}, 14435 pages = {354 -- 365} 14436} 14437 14438@Article{ cvode95, 14439 author = {S. Cohen and A. Hindmarsh}, 14440 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 14441 journal = {Computers in Physics}, 14442 volume = {10}, 14443 number = {2}, 14444 year = {1996}, 14445 pages = {138 -- 143} 14446} 14447 14448@TechReport{ ifpack, 14449 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 14450 author = {Marzio Sala and Michael Heroux}, 14451 institution = {Sandia National Laboratories}, 14452 number = {SAND2005-0662}, 14453 year = {2005} 14454} 14455 14456@TechReport{ kinsol-user-ref, 14457 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 14458 Computers}, 14459 author = {Allan Taylor and Alan Hindmarsh}, 14460 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14461 number = {UCRL-ID-131185}, 14462 year = {1998} 14463} 14464 14465@Article{ fiardmanteuffelmccormick98, 14466 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 14467 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 14468 numerical results}, 14469 journal = {SIAM J. Sci. Comp.}, 14470 year = {1998}, 14471 volume = {19}, 14472 pages = {1958--1979} 14473} 14474 14475@InProceedings{ vuduc02, 14476 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 14477 Rajesh Nishtala and Benjamin Lee}, 14478 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 14479 booktitle = {Proceedings of Supercomputing}, 14480 year = {2002}, 14481 month = nov, 14482 address = {Baltimore} 14483} 14484 14485@Article{ beckerbraackrannacher1999, 14486 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 14487 elements}, 14488 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 14489 journal = {Combustion Theory and Modelling}, 14490 volume = {3}, 14491 pages = {503--534}, 14492 year = {1999} 14493} 14494 14495@Article{ beckerrannacher01, 14496 author = {R. Becker and R. Rannacher}, 14497 title = {An optimal control approach to a posteriori error estimation in finite element 14498 methods}, 14499 journal = {Acta Numerica}, 14500 year = {2001}, 14501 volume = {10}, 14502 pages = {1--102} 14503} 14504 14505@Article{ babuskamiller84a, 14506 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14507 title = {The post-processing approach in the finite element method, {I}: Calculations of 14508 displacements, stresses, and other higher derivatives of the displacements}, 14509 journal = {Int. J. Numer. Meth. Eng.}, 14510 year = {1984}, 14511 volume = {20}, 14512 pages = {1085--1109} 14513} 14514 14515@Article{ babuskamiller84b, 14516 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14517 title = {The post-processing approach in the finite element method, {II}: The calculation 14518 of stress intensity factors}, 14519 journal = {Int. J. Numer. Meth. Eng.}, 14520 year = {1984}, 14521 volume = {20}, 14522 pages = {1111--1129} 14523} 14524 14525@Article{ babuskamiller84c, 14526 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14527 title = {The post-processing approach in the finite element method, {III}: A posteriori 14528 error estimation and adaptive mesh refinement}, 14529 journal = {Int. J. Numer. Meth. Eng.}, 14530 year = {1984}, 14531 volume = {20}, 14532 pages = {2311--2324} 14533} 14534 14535@Unpublished{ jtb-web-page, 14536 title = {{The Java Tree Builder}}, 14537 note = {See \url{http://www.cs.purdue.edu/jtb}}, 14538 author = {Jens Palsberg}, 14539 institution = {Purdue University} 14540} 14541 14542@Unpublished{ palsberg98, 14543 title = {Why Visitors?}, 14544 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 14545 author = {Jens Palsberg}, 14546 institution = {Purdue University}, 14547 year = {1998} 14548} 14549 14550@Unpublished{ ply-web-page, 14551 title = {{PLY (Python Lex-Yacc)}}, 14552 note = {\url{http://systems.cs.chicago.edu/ply}}, 14553 author = {David Beazley}, 14554 institution = {University of Chicago} 14555} 14556 14557@Misc{ adic-web-page, 14558 title = {{ADIC Web page}}, 14559 note = {\url{http://www.mcs.anl.gov/autodiff}}, 14560 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 14561 institution = {Argonne National Laboratory} 14562} 14563 14564@Article{ naumann02, 14565 author = {Uwe Naumann}, 14566 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 14567 computational graph}, 14568 journal = {Mathematical Programming (to appear)}, 14569 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 14570 year = {2003} 14571} 14572 14573@Article{ kaper1, 14574 author = {H. G. Kaper and T. J. Kaper}, 14575 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 14576 journal = {Physica D}, 14577 year = {2002}, 14578 pages = {66--93}, 14579 volume = {165} 14580} 14581 14582@Misc{ veltisto-web-page, 14583 author = {George Biros}, 14584 title = {{Veltisto Web page}}, 14585 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 14586} 14587 14588@Article{ karypiskumar98, 14589 author = {George Karypis and Vipin Kumar}, 14590 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 14591 Ordering}, 14592 journal = {Journal of Parallel and Distributed Computing}, 14593 volume = {48}, 14594 pages = {71--85}, 14595 year = {1998} 14596} 14597 14598@TechReport{ karypiskumar97, 14599 author = {Karypis, George and Kumar, V.}, 14600 institution = {Department of Computer Science, University of Minnesota}, 14601 keywords = {graph partitioning; ParMetis}, 14602 note = {http://www.cs.umn.edu/~metis}, 14603 number = {97-060}, 14604 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 14605 year = {1997} 14606} 14607 14608@Misc{ parmetis-web-page, 14609 author = {George {Karypis et al.}}, 14610 title = {{ParMETIS Web page}}, 14611 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 14612 year = {2005} 14613} 14614 14615@Misc{ sparskit-web-page, 14616 author = {Yousef {Saad et al.}}, 14617 title = {{SPARSKIT Web page}}, 14618 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 14619} 14620 14621@Misc{ dscpack-web-page, 14622 author = {Padma Raghavan}, 14623 title = {{DSCPACK Web page}}, 14624 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 14625} 14626 14627@Misc{ gaussian-web-page, 14628 author = {}, 14629 title = {{Gaussian Web page}}, 14630 note = {\url{http://gaussian.com}}, 14631 key = {{Gaussian} {Web} page} 14632} 14633 14634@Book{ lapack-user-guide, 14635 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 14636 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 14637 Sorensen}, 14638 title = {LAPACK Users' Guide, Third Edition}, 14639 publisher = {SIAM}, 14640 year = {1999} 14641} 14642 14643@Manual{ nwchem4.1, 14644 author = {High Performance Computational Chemistry Group}, 14645 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 14646 year = {2002}, 14647 organization = {Pacific Northwest National Laboratory}, 14648 address = {Richland, Washington 99325-0999 USA}, 14649 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 14650} 14651 14652@TechReport{ tchem, 14653 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 14654 author = {Cosmin Safta and Habib Najm and Omar Knio}, 14655 institution = {Sandia National Laboratories}, 14656 number = {SAND2011-3282}, 14657 year = {2011} 14658} 14659 14660@Misc{ scidac-web-page, 14661 author = {}, 14662 title = {{{SciDAC Initiative Web page}}}, 14663 note = {\url{http://www.osti.gov/scidac}}, 14664 key = {{SciDAC Initiative Web page}} 14665} 14666 14667@Misc{ cmrs:homepage, 14668 author = {Amitava {Bhattacharjee (PI)}}, 14669 title = {{Center for Magnetic Reconnection Studies}}, 14670 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 14671} 14672 14673@Misc{ tops:homepage, 14674 author = {David {Keyes (PI)}}, 14675 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 14676 howpublished = {\url{http://scalablesolvers.org}} 14677} 14678 14679@Misc{ tstt:homepage, 14680 author = {David Brown and Jim Glimm and Lori Freitag}, 14681 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 14682 howpublished = {\url{http://www.tstt-scidac.org}}, 14683 year = {2005} 14684} 14685 14686@Misc{ petsc:applications, 14687 author = {B. F. {Smith et al.}}, 14688 title = {{Scientific Applications Using {PETSc}}}, 14689 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 14690} 14691 14692@Misc{ petsc:users, 14693 author = {B. F. {Smith et al.}}, 14694 title = {{PETSc User Statistics}}, 14695 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 14696} 14697 14698@Misc{ cemm:homepage, 14699 author = {Steve {Jardin (PI)}}, 14700 title = {{Center for Extended MHD Modeling}}, 14701 howpublished = {\url{http://w3.pppl.gov/CEMM}} 14702} 14703 14704@Misc{ m3d:homepage, 14705 author = {Steve {Jardin et al.}}, 14706 title = {{M3D Web page}}, 14707 howpublished = {\url{http://w3.pppl.gov/m3d}} 14708} 14709 14710@Misc{ nimrod:homepage, 14711 author = {Carl R. {Sovinec et al.}}, 14712 title = {{NIMROD Web page}}, 14713 howpublished = {http://nimrodteam.org} 14714} 14715 14716@Misc{ grace-web-page, 14717 author = {Manish {Parashar et al.}}, 14718 title = {{GrACE Web Page}}, 14719 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 14720} 14721 14722@Misc{ accel1, 14723 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 14724 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 14725 author = {K. Ko and R. Ryne (PIs)} 14726} 14727 14728@Unpublished{ katzspiegelman03, 14729 author = {Richard F. Katz and Marc Spiegelman}, 14730 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 14731 advection-diffusion problems}, 14732 note = {Columbia University, in preparation} 14733} 14734 14735@Misc{ acts:homepage, 14736 author = {}, 14737 title = {{Advanced CompuTational Software (ACTS) Web page}}, 14738 howpublished = {\url{http://acts.nersc.gov}}, 14739 key = {{Advanced CompuTational Software (ACTS) Web page}} 14740} 14741 14742@Article{ superlu99, 14743 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 14744 Joseph W. H. Liu}, 14745 title = {A supernodal approach to sparse partial pivoting}, 14746 journal = {SIAM J. Matrix Analysis and Applications}, 14747 year = {1999}, 14748 volume = {20}, 14749 number = {3}, 14750 pages = {720-755} 14751} 14752 14753@Misc{ superlu:homepage, 14754 author = {J. Demmel and J. Gilbert and X. Li}, 14755 title = {{SuperLU Web page}}, 14756 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 14757} 14758 14759@InProceedings{ ccf98, 14760 author = {E. Chow and A. Cleary and R. Falgout}, 14761 title = {Design of the hypre Preconditioner Library}, 14762 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14763 Scientific and Engineering Computing}, 14764 publisher = {SIAM}, 14765 year = {1999} 14766} 14767 14768@TechReport{ hypre-users-manual, 14769 author = {R. Falgout}, 14770 title = {{hypre} Users Manual}, 14771 number = {Revision 2.28}, 14772 institution = {Lawrence Livermore National Laboratory}, 14773 year = {2023}, 14774 url = {https://hypre.readthedocs.io/} 14775} 14776 14777@Misc{ hypre:homepage, 14778 author = {R. Falgout}, 14779 title = {{hypre Web page}}, 14780 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 14781} 14782 14783@InProceedings{ trilinos:gpu, 14784 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 14785 title = {A Light-weight API for Portable Multicore Programming}, 14786 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 14787 Network-Based Processing (PDP)}, 14788 pages = {601--606}, 14789 publisher = {IEEE}, 14790 year = {2010} 14791} 14792 14793@InProceedings{ heroux2004design, 14794 title = {The design of {T}rilinos}, 14795 author = {Heroux, Michael A and Sala, Marzio}, 14796 booktitle = {International Workshop on Applied Parallel Computing}, 14797 pages = {620--628}, 14798 year = {2004}, 14799 organization = {Springer} 14800} 14801 14802@Misc{ trilinos:homepage, 14803 author = {M. {Heroux et al.}}, 14804 title = {{Trilinos Web page}}, 14805 howpublished = {{\tt http://trilinos.sandia.gov/}} 14806} 14807 14808@Article{ trilinos:overview, 14809 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 14810 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 14811 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 14812 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 14813 Kendall S. Stanley}, 14814 title = {An overview of the {T}rilinos project}, 14815 journal = {ACM Transactions on Mathematical Software}, 14816 volume = {31}, 14817 number = {3}, 14818 year = {2005}, 14819 issn = {0098-3500}, 14820 pages = {397--423}, 14821 publisher = {ACM Press}, 14822 doi = {10.1145/1089014.1089021} 14823} 14824 14825@Misc{ rythmos:homepage, 14826 author = {T. Coffey and R. Bartlett}, 14827 title = {Rythmos: Transient Integration of Differential Equations}, 14828 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 14829} 14830 14831@Misc{ triangle:homepage, 14832 author = {J. {Shewchuk}}, 14833 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 14834 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 14835 year = {2005} 14836} 14837 14838@Misc{ tetgen:homepage, 14839 author = {Hang {Si}}, 14840 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 14841 Triangulator}}, 14842 howpublished = {\url{http://tetgen.berlios.de}}, 14843 year = {2005} 14844} 14845 14846@Misc{ opencascade:homepage, 14847 author = {{OpenCASCADE SAS}}, 14848 title = {{Open CASCADE Technology (OCCT)}}, 14849 howpublished = {\url{https://dev.opencascade.org/}}, 14850 year = {2024} 14851} 14852 14853@Misc{ eigen:homepage, 14854 author = {Benoit Jacob and Ga\"el Guennebaud}, 14855 title = {{Eigen} {W}eb page}, 14856 key = {Jacob}, 14857 url = {http://eigen.tuxfamily.org/}, 14858 howpublished = {\url{http://eigen.tuxfamily.org/}}, 14859 year = {2015} 14860} 14861 14862@Misc{ dune:homepage, 14863 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 14864 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 14865 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 14866 Oliver Sander}, 14867 title = {{DUNE} {W}eb page}, 14868 key = {Bastian}, 14869 url = {http://www.dune-project.org/}, 14870 howpublished = {\url{http://www.dune-project.org/}}, 14871 year = {2015} 14872} 14873 14874@Misc{ thrust, 14875 author = {N. Bell and J. Hoberock}, 14876 title = {The {T}hrust Library}, 14877 howpublished = {{\tt http://code.google.com/p/thrust/}}, 14878 year = {2010} 14879} 14880 14881@Misc{ cusp, 14882 author = {N. Bell and M. Garland}, 14883 title = {The {C}usp Library}, 14884 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 14885 year = {2010} 14886} 14887 14888@Misc{ cig:homepage, 14889 author = {M. {Gurnis et al.}}, 14890 title = {{Computational Infrastructure for Geodynamics}}, 14891 howpublished = {\url{http://www.geodynamics.org}} 14892} 14893 14894@Article{ maltsevselkov00, 14895 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 14896 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 14897 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 14898 metabolic reconstruction}, 14899 journal = {Nucleic Acids Res.}, 14900 year = {2000}, 14901 month = jan, 14902 pages = {123-125}, 14903 volume = {28}, 14904 number = {1} 14905} 14906 14907@Article{ more:coloring, 14908 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 14909 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 14910 journal = {SIAM Journal on Numerical Analysis}, 14911 year = {1983}, 14912 month = feb, 14913 pages = {187--209}, 14914 volume = {20}, 14915 number = {1} 14916} 14917 14918@Article{ selkovmaltsev97, 14919 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 14920 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 14921 data}, 14922 journal = {Gene}, 14923 year = {1997}, 14924 pages = {GC11-GC26}, 14925 volume = {197}, 14926 number = {1-2} 14927} 14928 14929@Unpublished{ rocketcenter, 14930 title = {Center for Simulation of Advanced Rockets}, 14931 note = {http://www.csar.uiuc.edu}, 14932 institution = {University of Illinois at Urbana-Champaign} 14933} 14934 14935@Article{ kirby03, 14936 title = {A posteriori error estimates for the mixed hybrid finite element method}, 14937 author = {Robert C Kirby}, 14938 journal = {Computational Geosciences}, 14939 volume = {7}, 14940 pages = {197--214}, 14941 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 14942 year = {2003} 14943} 14944 14945@Article{ kirby2003b, 14946 title = {On the convergence of high resolution methods with multiple time scales for 14947 hyperbolic conservation laws}, 14948 author = {Robert C Kirby}, 14949 journal = {Mathematics of computation}, 14950 volume = {72}, 14951 number = {243}, 14952 pages = {1239--1250}, 14953 year = {2003} 14954} 14955 14956@Article{ dawsonkirby2001, 14957 title = {High resolution schemes for conservation laws with locally varying time steps}, 14958 author = {Clint Dawson and Robert C Kirby}, 14959 journal = {SIAM Journal on Scientific Computing}, 14960 volume = {22}, 14961 number = {6}, 14962 pages = {2256--2281}, 14963 year = {2001}, 14964 publisher = {SIAM} 14965} 14966 14967@Article{ dawsonkirby1999, 14968 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 14969 a dynamically changing mesh}, 14970 author = {Clint Dawson and Robert C Kirby}, 14971 journal = {SIAM Journal on Numerical Analysis}, 14972 volume = {37}, 14973 number = {2}, 14974 pages = {423--442}, 14975 year = {1999}, 14976 publisher = {SIAM} 14977} 14978 14979@Article{ barthlarson00, 14980 author = {T. J. Barth and M. G. Larson}, 14981 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 14982 Hyperbolic Systems}, 14983 journal = {LNCS}, 14984 year = {2000}, 14985 volume = {11}, 14986 publisher = {Spinger-Verlag} 14987} 14988 14989@Article{ xu1, 14990 author = {J. Xu}, 14991 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 14992 journal = {SIAM Review}, 14993 volume = {34}, 14994 pages = {581--613}, 14995 year = {1992} 14996} 14997 14998@Article{ brandt77, 14999 author = {Achi Brandt}, 15000 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 15001 journal = {Mathematics of Computation}, 15002 month = apr, 15003 year = {1977}, 15004 pages = {333--390}, 15005 volume = {31}, 15006 number = {138}, 15007 doi = {10.2307/2006422} 15008} 15009 15010@Article{ brandt1979multigrid, 15011 title = {{Multigrid solutions to elliptic flow problems}}, 15012 author = {Brandt, A. and Dinar, N.}, 15013 journal = {Numerical Methods for Partial Differential Equations}, 15014 pages = {53--147}, 15015 year = {1979} 15016} 15017 15018@InCollection{ brandt1979singular, 15019 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 15020 author = {Achi Brandt}, 15021 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 15022 editor = {Hemker, Pieter W. and Miller, John J.H.}, 15023 pages = {53--142}, 15024 year = {1979}, 15025 publisher = {Academic Press} 15026} 15027 15028@Article{ amge1, 15029 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 15030 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 15031 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 15032 journal = {SIAM J. Scientific Computing}, 15033 volume = {22}, 15034 pages = {1570--1592}, 15035 year = {2000} 15036} 15037 15038@Book{ bramble1, 15039 author = {J. H. Bramble}, 15040 title = {Multigrid Methods}, 15041 publisher = {Longman Scientific and Technical}, 15042 address = {Essex, England}, 15043 year = {1993} 15044} 15045 15046@Book{ arpack98, 15047 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 15048 title = {ARPACK, Users' Guide}, 15049 publisher = {SIAM}, 15050 year = {1998} 15051} 15052 15053@Article{ bbder96, 15054 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 15055 title = {Algorithmic bombardment for the iterative solution of linear systems: A 15056 polyIterative approach}, 15057 journal = {J. of Computational and Applied Mathematics}, 15058 year = {1996}, 15059 volume = {74}, 15060 pages = {91--110} 15061} 15062 15063@Article{ egks94, 15064 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 15065 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 15066 journal = {SIAM J. Scientific Computing}, 15067 year = {1994}, 15068 volume = {15}, 15069 number = {3}, 15070 pages = {681--703} 15071} 15072 15073@Article{ dftb02, 15074 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 15075 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 15076 diamond grain boundaries,}, 15077 journal = {Phys. Rev}, 15078 year = {2002}, 15079 volume = {B65}, 15080 pages = {045403} 15081} 15082 15083@InBook{ lsa, 15084 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 15085 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 15086 title = {The linear system analyzer}, 15087 series = {enabling technologies for computational science}, 15088 year = {2002}, 15089 publisher = {Kluwer}, 15090 location = {Dordrecht} 15091} 15092 15093@Article{ kk97, 15094 author = {Carl T. Kelley and David E. Keyes}, 15095 title = {Convergence analysis of pseudo-transient continuation}, 15096 journal = {SIAM J. Numerical Analysis}, 15097 year = {1998}, 15098 volume = {35}, 15099 pages = {508--523} 15100} 15101 15102@Article{ swtm01, 15103 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 15104 journal = {Journal of Computational Physics}, 15105 year = {2001}, 15106 volume = {172}, 15107 number = {2}, 15108 pages = {472--514}, 15109 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 15110 Method} 15111} 15112 15113@TechReport{ zhou03, 15114 author = {Y. Zhou}, 15115 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 15116 IIGD, RQI and Newton} Updates}, 15117 institution = {Argonne National Laboratory}, 15118 number = {ANL/MCS-P1074-0803}, 15119 note = {Submitted to Numerical Linear Algebra with Applications}, 15120 year = {2003} 15121} 15122 15123@Unpublished{ mtwm03, 15124 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 15125 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 15126 Detailed analysis of one-dimensional applications}, 15127 note = {to appear in the Journal of Chemical Physics}, 15128 year = {2003} 15129} 15130 15131@Article{ singhjosephheslaglowinskipan00, 15132 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 15133 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 15134 particulate flows}, 15135 journal = {J. Non-Newtonian Fluid Mech.}, 15136 volume = {91}, 15137 pages = {165--188}, 15138 year = {2000} 15139} 15140 15141@Book{ joseph02, 15142 author = {Daniel D. Joseph}, 15143 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 15144 publisher = {Springer-Verlag}, 15145 month = mar, 15146 year = {2002}, 15147 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 15148} 15149 15150@Misc{ triangle-web-page, 15151 author = {Jonathan R. Shewchuk}, 15152 title = {{Triangle Web} page}, 15153 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 15154} 15155 15156@InCollection{ shewchuk96, 15157 author = {Jonathan R. Shewchuk}, 15158 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 15159 Triangulator}, 15160 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 15161 editor = {Ming C. Lin and Dinesh Manocha}, 15162 series = {Lecture Notes in Computer Science}, 15163 volume = {1148}, 15164 publisher = {Springer-Verlag}, 15165 pages = {203--222}, 15166 month = may, 15167 year = {1996}, 15168 note = {From the First ACM Workshop on Applied Computational Geometry} 15169} 15170 15171@Article{ leaf1, 15172 author = {Transient Dynamics of Pinning of Domain Walls}, 15173 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 15174 journal = {J. Magnetism and Magnetic Materials}, 15175 volume = {241}, 15176 pages = {118--123}, 15177 year = {2002} 15178} 15179 15180@Article{ leaf2, 15181 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 15182 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 15183 Superconductivity}, 15184 journal = {SIAM J. Sci. Comp.}, 15185 volume = {23}, 15186 pages = {1944--1959}, 15187 year = {2002} 15188} 15189 15190@Article{ leaf3, 15191 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 15192 title = {Hysteresis in Layered Spring Magnets}, 15193 journal = { Discreet and Continuous Dynamical Systems, Series B}, 15194 volume = {1}, 15195 pages = {219--232}, 15196 year = {2001} 15197} 15198 15199@Article{ leaf4, 15200 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 15201 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 15202 journal = {J. Phys. D Appl. Phys.}, 15203 volume = {35}, 15204 pages = {2339--2343}, 15205 year = {2002} 15206} 15207 15208@Article{ leaf5, 15209 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 15210 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 15211 journal = {Submitted to Phys. Rev. B.}, 15212 note = {Submitted}, 15213 year = {2003} 15214} 15215 15216@Article{ graysumpternoidbarnes01, 15217 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 15218 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 15219 Nanospheres}, 15220 journal = {Chem. Phys. Lett.}, 15221 volume = {333}, 15222 pages = {308--313}, 15223 year = {2001} 15224} 15225 15226@InProceedings{ petsc-efficient, 15227 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 15228 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 15229 Libraries}, 15230 booktitle = {Modern Software Tools in Scientific Computing}, 15231 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 15232 publisher = {Birkh{\"{a}}user Press}, 15233 pages = {163--202}, 15234 year = {1997} 15235} 15236 15237@Article{ mumps01, 15238 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 15239 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 15240 journal = {SIAM Journal on Matrix Analysis and Applications}, 15241 volume = {23}, 15242 number = {1}, 15243 pages = {15--41}, 15244 year = {2001} 15245} 15246 15247@Article{ mumps19, 15248 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 15249 Multicore Architectures}}, 15250 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 15251 journal = {ACM Transactions on Mathematical Software}, 15252 volume = {45}, 15253 issue = {1}, 15254 pages = {2:1--2:26}, 15255 year = {2019} 15256} 15257 15258@Article{ zoltan06, 15259 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 15260 \c{C}ataly\"urek and Robert H. Bisseling}, 15261 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 15262 journal = {SIAM Parallel Processing for Scientific Computing}, 15263 month = feb, 15264 year = {2006} 15265} 15266 15267@Article{ lidemmel03, 15268 author = {Xiaoye S. Li and James W. Demmel}, 15269 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 15270 unsymmetric linear systems}, 15271 journal = {ACM Transactions on Mathematical Software}, 15272 year = {2003}, 15273 month = jun, 15274 volume = {29}, 15275 number = {2}, 15276 pages = {110--140} 15277} 15278 15279@TechReport{ superlu, 15280 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 15281 title = {{SuperLU} Users' Guide}, 15282 number = {LBNL-44289}, 15283 institution = {Lawrence Berkeley National Laboratory}, 15284 year = {2003}, 15285 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 15286} 15287 15288@TechReport{ trilinos-overview03, 15289 title = {{An Overview of {T}rilinos}}, 15290 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 15291 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 15292 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 15293 Willenbring and Alan Williams}, 15294 institution = {Sandia National Laboratories}, 15295 number = {SAND2003-2927}, 15296 year = {2003} 15297} 15298 15299@TechReport{ trilinos-users-guide, 15300 title = {{Trilinos} Users Guide}, 15301 author = {Michael A. Heroux and James M. Willenbring}, 15302 institution = {Sandia National Laboratories}, 15303 number = {SAND2003-2952}, 15304 url = {http://trilinos.sandia.gov/}, 15305 year = {2003} 15306} 15307 15308@Article{ pilut01, 15309 author = {David Hysom and Alex Pothen}, 15310 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 15311 journal = {SIAM Journal on Scientific Computing}, 15312 volume = {22}, 15313 pages = {2194--2215}, 15314 year = {2001} 15315} 15316 15317@TechReport{ boomeramg00, 15318 author = {V.~E. Henson and U.~M. Yang}, 15319 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 15320 institution = {Lawrence Livermore National Laboratory}, 15321 number = {UCRL-JC-133948}, 15322 year = {2000} 15323} 15324 15325@InCollection{ baker2012scaling, 15326 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 15327 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 15328 and Schulz, Martin and Yang, Ulrike Meier}, 15329 booktitle = {Competence in High Performance Computing 2010}, 15330 pages = {215--226}, 15331 year = {2012}, 15332 publisher = {Springer} 15333} 15334 15335@Article{ knollkeyes:04, 15336 author = {D. A. Knoll and D. E. Keyes}, 15337 year = {2004}, 15338 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 15339 journal = {J. Comp. Phys.}, 15340 volume = {193}, 15341 pages = {357-397} 15342} 15343 15344@Article{ chacon02, 15345 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 15346 title = {An implicit nonlinear reduced resistive {MHD} solver}, 15347 journal = {J. Comput. Phys}, 15348 volume = {188}, 15349 year = {2002}, 15350 pages = {15--36} 15351} 15352 15353@Article{ mousseau03, 15354 author = {V. A. Mousseau and D. A. Knoll}, 15355 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 15356 Radiation Diffusion}, 15357 journal = {J. Comput. Physics}, 15358 year = {2003} 15359} 15360 15361@Article{ mousseau00, 15362 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 15363 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 15364 Radiation Diffusion}, 15365 journal = {J. Comput. Physics}, 15366 year = {2000}, 15367 pages = {743--765}, 15368 volume = {160} 15369} 15370 15371@Unpublished{ facets:homepage, 15372 author = {John {Cary (PI)}}, 15373 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 15374 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 15375} 15376 15377@Unpublished{ cpes:homepage, 15378 author = {{C.S.} {Chang (PI)}}, 15379 title = {{Center for Plasma Edge Simulation (CPES)}}, 15380 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 15381} 15382 15383@Misc{ epsi:homepage, 15384 author = {{C.S.} {Chang (PI)}}, 15385 title = {{Center for Edge Physics Simulation (EPSI)}}, 15386 note = {\url{http://epsi.pppl.gov}} 15387} 15388 15389@Unpublished{ groundwater-scidac2:web, 15390 author = {Peter {Lichtner (PI)}}, 15391 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15392 Advanced Computing}, 15393 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 15394} 15395 15396@Misc{ pflotran:web, 15397 author = {Peter {Lichtner (PI)}}, 15398 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15399 Advanced Computing}}, 15400 note = {\url{http://ees.lanl.gov/pflotran/}} 15401} 15402 15403@Misc{ accel-scidac2-solicitation, 15404 author = {{DOE Office of Science}}, 15405 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 15406 year = {2006}, 15407 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 15408} 15409 15410@Article{ nieter04, 15411 author = {C. Nieter and J. R. Cary}, 15412 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 15413 journal = {J. Comp. Phys.}, 15414 year = {2004}, 15415 volume = {196}, 15416 pages = {448} 15417} 15418 15419@Article{ synergia06, 15420 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 15421 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 15422 journal = {J. Comp. Phys.}, 15423 year = {2006}, 15424 volume = {211}, 15425 pages = {229-248} 15426} 15427 15428@Unpublished{ stoltz07, 15429 author = {P. H. Stoltz}, 15430 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 15431 year = {2007}, 15432 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 15433 Albuquerque, NM, 2007} 15434} 15435 15436@Misc{ iter:homepage, 15437 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15438 year = {2007}, 15439 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15440 howpublished = {\url{http://www.iter.org}} 15441} 15442 15443@Misc{ epp2010, 15444 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 15445 Council}}, 15446 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 15447 Particle Physics}, 15448 year = {2006}, 15449 howpublished = {The National Academies Press, ISBN: 0309101948} 15450} 15451 15452@Misc{ post-fsp-report, 15453 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 15454 and P.~Colella and S.~C.~Jardin}, 15455 title = {{Report of Fusion Simulation Project Steering Committee}}, 15456 month = aug, 15457 year = {2004}, 15458 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 15459} 15460 15461@Misc{ fsp:workshop2011, 15462 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15463 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15464 month = feb, 15465 year = {2011}, 15466 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 15467} 15468 15469@Book{ hazeltine-meiss-book, 15470 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 15471 title = {Plasma Confinement}, 15472 year = {1991}, 15473 publisher = {Addison-Wesley, Redwood City, CA} 15474} 15475 15476@Article{ falgout05a, 15477 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15478 title = {Conceptual Interfaces in hypre}, 15479 journal = {Future Generation Computer Systems}, 15480 note = {Special issue on PDE software}, 15481 volume = {22}, 15482 year = {2005}, 15483 pages = {239--251} 15484} 15485 15486@Article{ falgout05b, 15487 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15488 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 15489 journal = {ACM Trans. Math. Softw.}, 15490 volume = {31}, 15491 year = {2005}, 15492 pages = {326--350} 15493} 15494 15495@Unpublished{ compass:homepage, 15496 author = {Panagiotis {Spentzouris (PI)}}, 15497 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 15498 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 15499} 15500 15501@Unpublished{ cmsnf:homepage, 15502 author = {{Todd Allen, Director}}, 15503 title = {{Center for Materials Science of Nuclear Fuel}}, 15504 note = {Energy Frontier Research Center, see 15505 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 15506} 15507 15508@Unpublished{ dvi-materials:project, 15509 author = {{L.~C.} {McInnes (PI)}}, 15510 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 15511 note = {{SciDAC}-e project}, 15512 year = {2011} 15513} 15514 15515@Misc{ scidac:homepage, 15516 author = {{DOE Office of Science}}, 15517 title = {{Scientific Discovery through Advanced Computing}}, 15518 year = {2007}, 15519 howpublished = {\url{http://www.scidac.gov}} 15520} 15521 15522@Misc{ corba, 15523 author = {{Object Management Group}}, 15524 year = {2007}, 15525 title = {{Common Object Request Broker Architecture (CORBA)}}, 15526 howpublished = {\url{http://www.corba.org}} 15527} 15528 15529@Article{ uedge, 15530 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 15531 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 15532 Divertor Tokamak}, 15533 journal = {J. Plasma Physics}, 15534 year = {1999}, 15535 volume = {6}, 15536 pages = {1851}, 15537 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 15538} 15539 15540@Article{ bout, 15541 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 15542 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 15543 journal = {J. Plasma Physics}, 15544 year = {2000}, 15545 volume = {7}, 15546 pages = {1951}, 15547 note = {} 15548} 15549 15550@Article{ bout++, 15551 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 15552 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 15553 journal = {Computer Physics Communications}, 15554 year = {2009}, 15555 volume = {180}, 15556 issue = {9}, 15557 pages = {1467 -- 1480}, 15558 note = {} 15559} 15560 15561@Article{ tempest, 15562 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 15563 and G. Kerbel and W.M. Nevins and T. Rognlien}, 15564 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 15565 journal = {Bull. Am. Phys. Soc. }, 15566 year = {2005}, 15567 volume = {50}, 15568 number = {86}, 15569 pages = {CP1}, 15570 note = {} 15571} 15572 15573@Article{ ccahpc, 15574 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 15575 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 15576 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 15577 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 15578 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 15579 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 15580 and Theresa L. Windus and Shujia Zhou}, 15581 title = {A Component Architecture for High-Performance Scientific Computing}, 15582 journal = {Intl. J. High-Perf. Computing Appl.}, 15583 volume = {20}, 15584 pages = {163--202}, 15585 year = {2006}, 15586 note = {ACTS Collection special issue} 15587} 15588 15589@Misc{ cca-forum:homepage, 15590 author = {{Common Component Architecture Forum}}, 15591 note = {\url{http://www.cca-forum.org}}, 15592 year = {2010} 15593} 15594 15595@Misc{ petsc:driven-cavity-example, 15596 title = {{PETSc Driven Cavity Example Code}}, 15597 author = {B. F. {Smith et al.}}, 15598 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 15599} 15600 15601@Misc{ petsc-dm:webpage, 15602 author = {B. F. {Smith et al.}}, 15603 title = {{PETSc DM Webpage}}, 15604 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 15605 year = {2018} 15606} 15607 15608@Misc{ unic-ref, 15609 author = {Giuseppe Palmiotti}, 15610 title = {{UNIC} Neutronics Software}, 15611 note = {Nuclear Engineering Division, Argonne National Laboratory} 15612} 15613 15614% ----------------------------------------------------------------------- 15615% Model coupling refs 15616@Book{ greve-blatter, 15617 author = {Ralf Greve and Heinz Blatter}, 15618 title = {Dynamics of Ice Sheets and Glaciers}, 15619 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 15620 publisher = {Springer}, 15621 year = {2009} 15622} 15623 15624@Misc{ doe-isicles, 15625 key = {ISICLES}, 15626 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 15627 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 15628} 15629 15630@Article{ safta2011tchem, 15631 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 15632 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 15633 journal = {Sandia Report, SAND2011-3282}, 15634 year = {2011} 15635} 15636 15637@Misc{ chemkin-website, 15638 key = {chemkin}, 15639 title = {ANSYS Chemkin-Pro Website}, 15640 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 15641 year = {2017} 15642} 15643 15644@Misc{ mct-website, 15645 key = {MCT}, 15646 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 15647 howpublished = {\url{http://www.mcs.anl.gov/mct}} 15648} 15649 15650@Article{ larson:05, 15651 author = {Jay Larson and Robert Jacob and Everest Ong}, 15652 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 15653 Multi-Physics Parallel Coupled Models}, 15654 journal = {Int. J. High Perf. Comp. App.}, 15655 year = {2005}, 15656 pages = {277--292} 15657} 15658 15659@Article{ dennis2012computational, 15660 title = {Computational performance of ultra-high-resolution capability in the Community 15661 Earth System Model}, 15662 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 15663 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 15664 journal = {International Journal of High Performance Computing Applications}, 15665 volume = {26}, 15666 number = {1}, 15667 pages = {5--16}, 15668 year = {2012}, 15669 publisher = {SAGE Publications} 15670} 15671 15672@InProceedings{ bettge01, 15673 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 15674 year = {2001}, 15675 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 15676 Backroads}, 15677 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15678 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15679 pages = {148 -- 156}, 15680 series = {Lecture Notes in Computer Science}, 15681 volume = {2073}, 15682 publisher = {Springer-Verlag} 15683} 15684 15685@InProceedings{ jacob01, 15686 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 15687 year = {2001}, 15688 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 15689 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15690 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15691 series = {Lecture Notes in Computer Science}, 15692 volume = {2073}, 15693 publisher = {Springer-Verlag} 15694} 15695 15696@Article{ chen2008new, 15697 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 15698 design}, 15699 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 15700 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 15701 journal = {Chinese Science Bulletin}, 15702 volume = {53}, 15703 number = {22}, 15704 pages = {3433--3445}, 15705 year = {2008}, 15706 publisher = {Springer} 15707} 15708 15709@InProceedings{ baum01, 15710 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 15711 and C. Charman}, 15712 year = {2001}, 15713 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 15714 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15715 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15716 series = {Lecture Notes in Computer Science}, 15717 volume = {2073}, 15718 publisher = {Springer-Verlag} 15719} 15720 15721@InProceedings{ lefantzi03, 15722 author = {S. Lefantzi and J. Ray}, 15723 year = {2003}, 15724 title = {A Component-based Scientific Toolkit for Reacting Flows}, 15725 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 15726 volume = {2}, 15727 publisher = {Elsevier} 15728} 15729 15730@Article{ boville98, 15731 author = {B. A. Boville and P. R. Gent}, 15732 title = {The {NCAR} Climate System Model, Version One}, 15733 journal = {Journal of Climate}, 15734 volume = {11}, 15735 year = {1998}, 15736 pages = {1115--1130} 15737} 15738 15739@Misc{ paraschivoiu99, 15740 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 15741 title = {Multi-domain multi-model formulation for compressible flows: Conservative 15742 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 15743 note = {AIAA Paper 99-0784}, 15744 year = {1999} 15745} 15746 15747@Article{ peszynska, 15748 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 15749 title = {Mortar upscaling for multiphysics flow in porous media}, 15750 journal = {Computational Geosciences} 15751} 15752 15753@TechReport{ wheeler00, 15754 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 15755 title = {A distributed computing portal for coupling multi-physics and multiple domains in 15756 porous media}, 15757 institution = {University of Texas at Austin}, 15758 number = {TICAM 00-03}, 15759 year = {2000} 15760} 15761 15762@TechReport{ peszynska00, 15763 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 15764 title = {Multiphysics Coupling of Codes}, 15765 institution = {University of Texas at Austin}, 15766 number = {TICAM 00-02}, 15767 year = {2000} 15768} 15769 15770@Article{ joshaghanijoodatnakshatrala2019, 15771 title = {A stabilized mixed discontinuous Galerkin formulation for double 15772 porosity/permeability model}, 15773 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 15774 journal = {Computer Methods in Applied Mechanics and Engineering}, 15775 volume = {352}, 15776 pages = {508--560}, 15777 year = {2019} 15778} 15779 15780@InProceedings{ cai99, 15781 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 15782 title = {An explicit multi-model compressible flow formulation based on the full potential 15783 equation and the {Euler} equations on {3D} unstructured meshes}, 15784 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 15785 Methods}, 15786 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 15787 year = {1999} 15788} 15789 15790@Article{ he05, 15791 author = {Yun He and Chris H. Q. Ding}, 15792 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 15793 Architectures}, 15794 year = {2005}, 15795 volume = {19}, 15796 pages = {329--240}, 15797 number = {3}, 15798 journal = {Int. Journal of High Performance Computing Applications} 15799} 15800 15801@InProceedings{ uiuc-rocket-center02, 15802 author = {W. A. Dick and M. T. Heath}, 15803 title = {Whole System Simulation of Solid Propellant Rockets}, 15804 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 15805 month = jul, 15806 year = {2002} 15807} 15808 15809@InProceedings{ toth04, 15810 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 15811 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 15812 Oehmke}, 15813 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 15814 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 15815 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 15816 Sun-Earth Connection}, 15817 year = {2004}, 15818 publisher = {Elsevier}, 15819 pages = {383--397} 15820} 15821 15822@Misc{ csdrm:web, 15823 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 15824 Shepherd}, 15825 title = {{Center for Simulation of Dynamic Response of Materials}}, 15826 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 15827} 15828 15829@Misc{ csar:web, 15830 author = {M. {Heath (Director)}}, 15831 title = {{Center for Simulation of Advanced Rockets}}, 15832 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 15833} 15834 15835@Misc{ csafe:web, 15836 author = {D. {Pershing (Director)}}, 15837 title = {{Center for Simulation of Accidental Fires and Explosions}}, 15838 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 15839} 15840 15841@Misc{ cits:web, 15842 author = {P. {Moin (Director)}}, 15843 title = {{Center for Integrated Turbulence Simulations}}, 15844 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 15845} 15846 15847@Misc{ flash:web, 15848 author = {D. {Lamb (Director)}}, 15849 title = {{Center for Integrated Turbulence Simulations}}, 15850 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 15851} 15852 15853@TechReport{ utah-csafe03, 15854 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 15855 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 15856 Problems, Part 1: Algorithm Development}, 15857 institution = {University of Utah, Center for the Simulation of Accidental Fires and 15858 Explosions}, 15859 year = {2003} 15860} 15861 15862@InBook{ shepherd07, 15863 author = {M. Shepherd and E. Seol and B. FrantzDale}, 15864 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 15865 year = {2007}, 15866 booktitle = {CRC Handbook of Dynamic System Modeling}, 15867 publisher = {Wiley}, 15868 pages = {1--41}, 15869 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 15870} 15871 15872@InProceedings{ cactus02, 15873 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 15874 Radke and Edward Seidel and John Shalf}, 15875 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 15876 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 15877 year = {2002}, 15878 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 15879} 15880 15881@Misc{ cactus:homepage, 15882 author = {G. {Allen et al.}}, 15883 title = {{Cactus Web page}}, 15884 howpublished = {\url{http://cactuscode.org}} 15885} 15886 15887@Misc{ open-grid-forum:web, 15888 key = {{Open Grid Forum}}, 15889 title = {{Open Grid Forum}}, 15890 note = {See \url{http://www.ogf.org}} 15891} 15892 15893@Misc{ nox:web, 15894 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 15895 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 15896 note = {See \url{http://software.sandia.gov/nox}} 15897} 15898 15899@Misc{ chombo:web, 15900 author = {P. {Colella (PI)}}, 15901 title = {{Chombo}}, 15902 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 15903} 15904 15905@Article{ lanzkron96, 15906 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 15907 title = {An Analysis of Approximate Nonlinear Elimination}, 15908 journal = {SIAM J. Sci. Comput.}, 15909 volume = {17}, 15910 year = {1996}, 15911 pages = {538--559} 15912} 15913 15914@Article{ jiang95, 15915 author = {J. Jiang and P. Forsyth}, 15916 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 15917 Equations}, 15918 journal = {Computers and Fluids}, 15919 volume = {24}, 15920 pages = {753--770}, 15921 year = {1995} 15922} 15923 15924@Article{ young90, 15925 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 15926 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 15927 journal = {Int. J. Numer. Methods Fluids}, 15928 volume = {11}, 15929 pages = {1075--1095}, 15930 year = {1990} 15931} 15932 15933@Article{ fishwick04, 15934 author = {Paul A. Fishwick}, 15935 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 15936 to Interrelating Model Structures}, 15937 journal = {SCS Trans. on Simulation}, 15938 note = {Special Issue in Grand Challenges in Computer Simulation}, 15939 year = {2004} 15940} 15941 15942@Article{ fishwick03, 15943 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 15944 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 15945 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 15946 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 15947 year = {2003} 15948} 15949 15950@InProceedings{ kirner00, 15951 author = {T. G. Kirner and V. F. Martins}, 15952 title = {Development of an Information Visualization Tool Using Virtual Reality}, 15953 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 15954 year = {2000}, 15955 pages = {604--606} 15956} 15957 15958@InProceedings{ orso03, 15959 author = {A. Orso and J. Jones and M. J. Harrold}, 15960 title = {Visualization of Program-Execution Data for Deployed Software}, 15961 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 15962 year = {2003}, 15963 pages = {67--76} 15964} 15965 15966@Book{ tiller01, 15967 author = {M. Tiller}, 15968 title = {Introduction to Physical System Modeling with Modelica}, 15969 series = {Kluwer International Series inEngineering and Computer Science}, 15970 volume = {615}, 15971 publisher = {Kluwer}, 15972 year = {2001} 15973} 15974 15975@Article{ buck94, 15976 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 15977 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 15978 journal = {Int. Journal of Computer Simulation}, 15979 volume = {4}, 15980 pages = {155--182}, 15981 year = {1994} 15982} 15983 15984@Article{ mu95, 15985 author = {M. Mu and J.R. Rice}, 15986 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 15987 journal = {Comp. Syst. Engr.}, 15988 volume = {6}, 15989 year = {1995}, 15990 pages = {87--95} 15991} 15992 15993@TechReport{ drashansky96, 15994 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 15995 author = {R. Drashansky and A. Joshi and J. R. Rice}, 15996 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 15997 year = {1996} 15998} 15999 16000@Article{ michopoulos05, 16001 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 16002 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 16003 journal = {Journal of Computing and Information Science in Engineering}, 16004 volume = {5}, 16005 issue = {3}, 16006 pages = {198--213}, 16007 year = {2005} 16008} 16009 16010@Article{ dubey09, 16011 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 16012 Multiphysics Simulation Code}, 16013 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 16014 Siegel and K. Weide}, 16015 journal = {Parallel Computing}, 16016 volume = {35}, 16017 issue = {10 -- 11}, 16018 pages = {512 -- 522}, 16019 year = {2009} 16020} 16021 16022@Book{ bottloring95, 16023 author = {Raoul Bott and Loring W. Tu}, 16024 title = {Differential Forms in Algebraic Topology}, 16025 publisher = {Springer}, 16026 year = {1995} 16027} 16028 16029@Book{ kobayashinomizu96, 16030 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 16031 title = {Foundations of Differential Geometry}, 16032 publisher = {Wiley-Interscience}, 16033 year = {1996} 16034} 16035 16036@Article{ hornungkohn02, 16037 author = {Richard D. Hornung and Scott R. Kohn}, 16038 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 16039 journal = {Concurrency and Computation: Practice and Experience}, 16040 volume = {14}, 16041 pages = {347--368}, 16042 year = {2002} 16043} 16044 16045@InProceedings{ concepts06, 16046 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 16047 Gabriel Dos Reis and Andrew Lumsdaine}, 16048 title = {Concepts: Linguistic Support for Generic Programming in C++}, 16049 booktitle = {Proceedings of OOPSLA 2006}, 16050 year = {2006}, 16051 pages = {???--???} 16052} 16053 16054@Book{ hatcher02, 16055 author = {Hatcher, Allen}, 16056 title = {Algebraic Topology}, 16057 publisher = {Cambridge University Press}, 16058 year = {2002} 16059} 16060 16061@Book{ gammahelmjohnsonvlissides95, 16062 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 16063 development, offering timeless and elegant solutions to common problems in 16064 software design. It describes patterns for managing object creation, composing 16065 objects into larger structures, and coordinating control flow between objects. The 16066 book provides numerous examples where using composition rather than inheritance 16067 can improve the reusability and flexibility of code. Note, though, that it's not a 16068 tutorial but a catalog that you can use to find an object-oriented design pattern 16069 that's appropriate for the needs of your particular application--a selection for 16070 virtuoso programmers who appreciate (or require) consistent, well-engineered 16071 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 16072 more valuable than ever! 16073 16074 Use the contents of the CD to create your own design documents and reusable 16075 components. The CD contains: 23 patterns you can cut and paste into your own 16076 design documents; sample code demonstrating pattern implementation; complete 16077 Design Patterns content in standard HTML format, with numerous hyperlinked 16078 cross-references; accessed through a standard web browser; Java-based dynamic 16079 search mechanism, enhancing online search capabilities; graphical user environment, 16080 allowing ease of navigation. 16081 16082 First published in 1995, this landmark work on object-oriented software design 16083 presents a catalog of simple and succinct solutions to common design problems. 16084 Created by four experienced designers, the 23 patterns contained herein have 16085 become an essential resource for anyone developing reusable object-oriented 16086 software. In response to reader demand, the complete text and pattern catalog are 16087 now available on CD-ROM. This electronic version of Design Patterns enables 16088 programmers to install the book directly onto a computer or network for use as an 16089 online reference for creating reusable object-oriented software. 16090 16091 The authors first describe what patterns are and how they can help you in the 16092 design process. They then systematically name, explain, evaluate, and catalog 16093 recurring designs in object-oriented systems. All patterns are compiled from 16094 real-world examples and include code that demonstrates how they may be implemented 16095 in object-oriented programming languages such as C++ and Smalltalk. Readers who 16096 already own the book will want the CD to take advantage of its dynamic search 16097 mechanism and ready-to-install patterns.}}, 16098 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 16099 citeulike-article-id={115158}, 16100 howpublished = {Hardcover}, 16101 isbn = {0201633612}, 16102 keywords = {1995 algorithms architecture book books computer computing design design-pattern 16103 design-patterns design_patterns designpatterns development diplom entwurfsmuster 16104 four gang gof java mathgamespatterns no-tag object object-orientation 16105 object-oriented of oo-patterns oop oriented pattern patterns programming se 16106 software software-development software-engineering software_design 16107 softwareengineering standard}, 16108 month = jan, 16109 publisher = {{Addison-Wesley Professional}}, 16110 title = {Design Patterns}, 16111 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 16112 year = {1995} 16113} 16114 16115@InProceedings{ chaco95, 16116 author = {Bruce Hendrickson and Robert Leland}, 16117 title = {A multilevel algorithm for partitioning graphs}, 16118 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 16119 (CDROM)}, 16120 year = {1995}, 16121 isbn = {0-89791-816-9}, 16122 pages = {28}, 16123 location = {San Diego, California, United States}, 16124 doi = {10.1145/224170.224228}, 16125 publisher = {ACM Press}, 16126 address = {New York} 16127} 16128 16129@Book{ aleksandrov98, 16130 author = {Aleksandrov, Pavel S.}, 16131 title = {Combinatorial Topology}, 16132 publisher = {Dover}, 16133 volume = {3}, 16134 year = {1998} 16135} 16136 16137@Book{ steenrod99, 16138 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 16139 importance in modern physics--such as in gauge theory. This book, a succinct 16140 introduction to the subject by renown mathematician Norman Steenrod, was the first 16141 to present the subject systematically. 16142 16143 It begins with a general introduction to bundles, including such topics as 16144 differentiable manifolds and covering spaces. The author then provides brief 16145 surveys of advanced topics, such as homotopy theory and cohomology theory, before 16146 using them to study further properties of fibre bundles. The result is a classic 16147 and timeless work of great utility that will appeal to serious mathematicians and 16148 theoretical physicists alike. }}, 16149 author = {Steenrod, Norman}, 16150 citeulike-article-id={712999}, 16151 howpublished = {Paperback}, 16152 isbn = {0691005486}, 16153 keywords = {fibre_bundles topology}, 16154 month = apr, 16155 publisher = {{Princeton University Press}}, 16156 title = {The Topology of Fibre Bundles. (PMS-14)}, 16157 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 16158 year = {1999} 16159} 16160 16161@Book{ bredon97, 16162 author = {Bredon, Glen E.}, 16163 title = {Sheaf Theory}, 16164 publisher = {Springer}, 16165 pages = {524}, 16166 series = {Graduate Texts in Mathematics}, 16167 year = {1997} 16168} 16169 16170@TechReport{ tautgesmeyers04, 16171 title = {{MOAB}: A Mesh-Oriented Database}, 16172 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 16173 Ernst}, 16174 institution = {Sandia National Laboratories}, 16175 number = {SAND2004-1592}, 16176 month = apr, 16177 year = {2004} 16178} 16179 16180@Article{ tautges04, 16181 author = {Timothy J. Tautges}, 16182 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 16183 journal = {Engineering With Computers}, 16184 volume = {20}, 16185 pages = {286--293}, 16186 year = {2004} 16187} 16188 16189@InProceedings{ meyers02, 16190 author = {Ray Meyers et. al}, 16191 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 16192 booktitle = {8th International conference on numerical grid generation in computational field 16193 simulations}, 16194 month = jun, 16195 year = {2002} 16196} 16197 16198@InProceedings{ seolshepard05, 16199 author = {E. S. Seol and Mark S. Shephard}, 16200 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 16201 Analysis}, 16202 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 16203 year = {2005} 16204} 16205 16206@Article{ lishephardbeall2005, 16207 title = {3D anisotropic mesh adaptation by mesh modification}, 16208 author = {Xiangrong Li and Mark S Shephard and Mark W Beall}, 16209 journal = {Computer methods in applied mechanics and engineering}, 16210 volume = {194}, 16211 number = {48-49}, 16212 pages = {4915--4950}, 16213 year = {2005}, 16214} 16215 16216@Article{ lushephardtendulkarbeall2014, 16217 title = {Parallel mesh adaptation for high-order finite element methods with curved element geometry}, 16218 author = {Qiukai Lu and Mark S Shephard and Saurabh Tendulkar and Mark W Beall}, 16219 journal = {Engineering with Computers}, 16220 volume = {30}, 16221 pages = {271--286}, 16222 year = {2014}, 16223} 16224 16225@Article{ beallwalshshephard04, 16226 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 16227 title = {A comparison of techniques for geometry access related to mesh generation}, 16228 journal = {Engineering With Computers}, 16229 volume = {20}, 16230 number = {3}, 16231 pages = {210--221}, 16232 year = {2004} 16233} 16234 16235@Article{ careyandersoncarneskirk04, 16236 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 16237 Kirk}, 16238 title = {Some aspects of adaptive grid technology related to boundary and interior 16239 layers}, 16240 journal = {Journal of Computational Applied Mathematics}, 16241 volume = {166}, 16242 number = {1}, 16243 pages = {55--86}, 16244 year = {2004} 16245} 16246 16247@PhDThesis{ gralthesis, 16248 author = {Guntram Berti}, 16249 title = {Generic Software Components for Scientific Computing}, 16250 school = {TU Cottbus}, 16251 year = {2000}, 16252 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 16253} 16254 16255@Article{ whitehead1949, 16256 title = {Combinatorial homotopy. I}, 16257 author = {John HC Whitehead}, 16258 journal = {Bulletin of the American Mathematical Society}, 16259 volume = {55}, 16260 number = {3. P1}, 16261 pages = {213--245}, 16262 year = {1949}, 16263 publisher = {American Mathematical Society} 16264} 16265 16266@Article{ beylkincoifmanrokhlin91, 16267 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 16268 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 16269 journal = {Communications on Pure and Applied Mathematics}, 16270 volume = {44}, 16271 pages = {141--183}, 16272 year = {1991} 16273} 16274 16275@Book{ wesseling92, 16276 author = {Pieter Wesseling}, 16277 title = {An Introduction to Multigrid Methods}, 16278 publisher = {John Wiley and Sons}, 16279 year = {1992} 16280} 16281 16282@Book{ grakakos04, 16283 author = {Loukas Grakakos}, 16284 title = {Classical and Modern Fourier Analysis}, 16285 publisher = {Pearson Education}, 16286 address = {New Jersey}, 16287 year = {2004} 16288} 16289 16290@Misc{ hlib-web-page, 16291 key = {HLib}, 16292 title = {{HLib} {Web} page}, 16293 note = {{\texttt{http://www.hlib.org/}}}, 16294 annote = {Hierarchical matrices for fast integral transform} 16295} 16296 16297@Article{ hackbusch99, 16298 author = {Wolfgang Hackbusch}, 16299 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 16300 Introduction to {$\mathcal H$}-matrices}, 16301 journal = {Computing}, 16302 volume = {62}, 16303 pages = {89--108}, 16304 year = {1999} 16305} 16306 16307@TechReport{ kay1999green, 16308 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 16309 equations}, 16310 author = {Kay, D. and Loghin, D.}, 16311 year = {1999}, 16312 institution = {Oxford University Computing Laboratory}, 16313 number = {99/06} 16314} 16315 16316@Article{ bebendorf2003existence, 16317 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 16318 elliptic operators with {$L^\infty$}-coefficients}, 16319 author = {Bebendorf, M. and Hackbusch, W.}, 16320 journal = {Numerische Mathematik}, 16321 volume = {95}, 16322 number = {1}, 16323 pages = {1--28}, 16324 year = {2003}, 16325 publisher = {Springer} 16326} 16327 16328@Article{ hackbusch2005direct, 16329 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 16330 H$}-matrix approximation}, 16331 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 16332 journal = {Computing and Visualization in Science}, 16333 volume = {8}, 16334 number = {3}, 16335 pages = {179--188}, 16336 year = {2005}, 16337 publisher = {Springer} 16338} 16339 16340@TechReport{ duphof2003, 16341 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 16342 Logg and L. R. Scott}, 16343 title = {The {FE}ni{CS} project}, 16344 institution = {Chalmers Finite Element Center Preprint Series}, 16345 number = {2003--21}, 16346 year = {2003} 16347} 16348 16349@Article{ flame01, 16350 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 16351 Geijn}, 16352 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 16353 journal = {Transactions on Mathematical Software}, 16354 volume = {27}, 16355 number = {4}, 16356 year = {2001}, 16357 pages = {422--455} 16358} 16359 16360@Article{ puschel05, 16361 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 16362 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 16363 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 16364 Nick Rizzolo}, 16365 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 16366 journal = {Proceedings of the IEEE}, 16367 volume = {93}, 16368 number = {2}, 16369 year = {2005}, 16370 note = {special issue on "Program Generation, Optimization, and Adaptation"} 16371} 16372 16373@Article{ kirbylogg06, 16374 author = {Robert C. Kirby and Anders Logg}, 16375 title = {A compiler for variational forms}, 16376 journal = {ACM Transactions on Mathematical Software}, 16377 volume = {32}, 16378 number = {3}, 16379 year = {2006}, 16380 issn = {0098-3500}, 16381 pages = {417--444}, 16382 doi = {10.1145/1163641.1163644}, 16383 publisher = {ACM Press}, 16384 address = {New York, NY} 16385} 16386 16387@Article{ kirbylogg07, 16388 author = {Robert C. Kirby and Anders Logg}, 16389 title = {Efficient compilation of a class of variational forms}, 16390 journal = {ACM Transactions on Mathematical Software}, 16391 volume = {33}, 16392 number = {3}, 16393 year = {2007}, 16394 issn = {0098-3500}, 16395 pages = {17}, 16396 doi = {10.1145/1268769.1268771}, 16397 publisher = {ACM Press}, 16398 address = {New York, NY} 16399} 16400 16401@Article{ bankdupont81, 16402 author = {Randolph Bank and Todd Dupont}, 16403 title = {An optimal order process for solving finite element equations}, 16404 journal = {Mathematics of Computation}, 16405 volume = {36}, 16406 pages = {35--51}, 16407 year = {1981} 16408} 16409 16410@TechReport{ adams00, 16411 author = {Mark F. Adams}, 16412 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 16413 in solid mechanics}, 16414 institution = {UC Berkeley}, 16415 number = {CSD-00-1103}, 16416 year = {2000}, 16417 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 16418} 16419 16420@Article{ bergengradlhuelsemannruede06, 16421 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 16422 title = {A Massively Parallel Multigrid Method for Finite Elements}, 16423 journal = {Computing in Science \& Engineering}, 16424 volume = {8}, 16425 number = {6}, 16426 pages = {56--62}, 16427 year = {2006} 16428} 16429 16430@MastersThesis{ brunethesis08, 16431 author = {Peter R. Brune}, 16432 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 16433 school = {University of Chicago}, 16434 address = {Chicago, IL}, 16435 year = {2008}, 16436 month = feb 16437} 16438 16439@Article{ arnoldwinther02, 16440 author = {Douglas N. Arnold and Ragnar Winther}, 16441 title = {Mixed finite elements for elasticity}, 16442 journal = {Numerische Mathematik}, 16443 volume = {92}, 16444 number = {3}, 16445 month = sep, 16446 year = {2002}, 16447 pages = {401--419}, 16448 doi = {10.1007/s002110100348} 16449} 16450 16451@Article{ arnoldfalkwinther06, 16452 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 16453 title = {Finite element exterior calculus, homological techniques, and applications}, 16454 journal = {Acta Numerica}, 16455 year = {2006}, 16456 volume = {15}, 16457 pages = {1--155}, 16458 publisher = {Cambridge University Press}, 16459 doi = {10.1017/S0962492906210018} 16460} 16461 16462@Article{ kirby04, 16463 author = {Robert C. Kirby}, 16464 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 16465 functions}, 16466 journal = {ACM Transactions on Mathematical Software}, 16467 volume = {30}, 16468 number = {4}, 16469 year = {2004}, 16470 issn = {0098-3500}, 16471 pages = {502--516}, 16472 doi = {10.1145/1039813.1039820}, 16473 publisher = {ACM Press}, 16474 address = {New York, NY} 16475} 16476 16477@Article{ kirby06, 16478 author = {Robert C. Kirby}, 16479 title = {Optimizing {FIAT} with level 3 {BLAS}}, 16480 journal = {ACM Transactions on Mathematical Software}, 16481 volume = {32}, 16482 number = {2}, 16483 year = {2006}, 16484 issn = {0098-3500}, 16485 pages = {223--235}, 16486 doi = {10.1145/1141885.1141889}, 16487 publisher = {ACM Press}, 16488 address = {New York, NY} 16489} 16490 16491@Misc{ bluecrystal08, 16492 author = {{B}lue {C}rystal Cluster}, 16493 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 16494 year = {2008}, 16495 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 16496} 16497 16498@Article{ beylkin95, 16499 author = {Gregory Beylkin}, 16500 title = {On the Fast Fourier Transform of Functions With Singularities}, 16501 journal = {Applied and Computational Harmonic Analysis}, 16502 volume = {2}, 16503 pages = {363--381}, 16504 year = {1995} 16505} 16506 16507@InProceedings{ riehl08, 16508 author = {Jonathan Riehl}, 16509 title = {Implementing the MyFEM Embedded Domain-specific Language}, 16510 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 16511 Development (DSPD'08)}, 16512 address = {Nashville, TN}, 16513 year = {2008} 16514} 16515 16516@Article{ appel85, 16517 author = {Andrew W. Appel}, 16518 date-added = {2008-02-27 12:23:39 +0000}, 16519 date-modified = {2008-02-27 12:24:02 +0000}, 16520 doi = {10.1137/0906008}, 16521 journal = {SIAM Journal on Scientific and Statistical Computing}, 16522 keywords = {treecodes}, 16523 number = {1}, 16524 pages = {85-103}, 16525 publisher = {SIAM}, 16526 title = {An Efficient Program for Many-Body Simulation}, 16527 volume = {6}, 16528 year = {1985} 16529} 16530 16531@Article{ ewald21, 16532 author = {{Ewald}, P.~P.}, 16533 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 16534 journal = {Annalen der Physik}, 16535 year = {1921}, 16536 volume = {369}, 16537 pages = {253-287}, 16538 doi = {10.1002/andp.19213690304}, 16539 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 16540 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16541} 16542 16543@Article{ greengardrokhlin87, 16544 author = {L. Greengard and V. Rokhlin}, 16545 date-added = {2008-02-15 18:43:55 +0000}, 16546 date-modified = {2008-02-26 20:09:11 +0000}, 16547 doi = {10.1016/0021-9991(87)90140-9}, 16548 journal = {J. Comput.\ Phys.}, 16549 keywords = {FMM}, 16550 number = {2}, 16551 pages = {325--348}, 16552 title = {A Fast Algorithm for Particle Simulations}, 16553 url = {citeseer.ist.psu.edu/greengard87fast.html}, 16554 volume = {73}, 16555 year = {1987}, 16556 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 16557} 16558 16559@Article{ greengardrokhlin97, 16560 author = {L. Greengard and V. Rokhlin}, 16561 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 16562 Dimensions}, 16563 journal = {Acta Numerica}, 16564 volume = {6}, 16565 year = {1997}, 16566 pages = {229--269} 16567} 16568 16569@Article{ luchenghuangmccammon06, 16570 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 16571 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 16572 systems}, 16573 journal = {PNAS}, 16574 doi = {10.1073/pnas.0605166103}, 16575 volume = {102}, 16576 number = {51}, 16577 year = {2006}, 16578 pages = {19314--19319} 16579} 16580 16581@Article{ schussnadlereisenberg01, 16582 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 16583 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 16584 from a molecular model}, 16585 journal = {Physical Review E}, 16586 volume = {64}, 16587 number = {3}, 16588 year = {2001} 16589} 16590 16591@Book{ hairerlubichwanner02, 16592 author = {E. Hairer and Ch. Lubich and G. Wanner}, 16593 title = {Geometric Numerical Integration}, 16594 publisher = {Springer-Verlag}, 16595 address = {Berlin Heidelberg}, 16596 year = {2002} 16597} 16598 16599@Article{ holstbakerwang00, 16600 author = {M. Holst and N. Baker and F. Wang}, 16601 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 16602 equation on massively parallel computers}, 16603 journal = {Journal of Computational Chemistry}, 16604 volume = {21}, 16605 year = {2000} 16606} 16607 16608@Book{ hockneyeastwood81, 16609 author = {R. Hockney and J. Eastwood}, 16610 title = {Computer simulation using particles}, 16611 publisher = {McGraw-Hill}, 16612 address = {New York}, 16613 year = {1981} 16614} 16615 16616@Article{ lutydavistironigunsteren94, 16617 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 16618 Gunsteren}, 16619 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 16620 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 16621 journal = {Molecular Simulation}, 16622 volume = {14}, 16623 number = {1}, 16624 year = {1994}, 16625 pages = {11--20} 16626} 16627 16628@Book{ briggshensonmccormick00, 16629 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 16630 title = {A Multigrid Tutorial (2nd ed.)}, 16631 year = {2000}, 16632 isbn = {0-89871-462-1}, 16633 publisher = {Society for Industrial and Applied Mathematics}, 16634 address = {Philadelphia, PA} 16635} 16636 16637@Article{ chartier2003spectral, 16638 title = {Spectral AMGe ($\rho$ AMGe)}, 16639 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 16640 McCormick, S and Ruge, J and Vassilevski, PS}, 16641 journal = {SIAM Journal on Scientific Computing}, 16642 volume = {25}, 16643 number = {1}, 16644 pages = {1--26}, 16645 year = {2003}, 16646 publisher = {SIAM} 16647} 16648 16649@Article{ galvis2010domain, 16650 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 16651 media}, 16652 author = {Galvis, Juan and Efendiev, Yalchin}, 16653 journal = {Multiscale Modeling \& Simulation}, 16654 volume = {8}, 16655 number = {4}, 16656 pages = {1461--1483}, 16657 year = {2010}, 16658 publisher = {SIAM} 16659} 16660 16661@Book{ brennerscott02, 16662 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 16663 title = {The mathematical theory of finite element methods}, 16664 year = {2002}, 16665 isbn = {0-38795-451-1}, 16666 publisher = {Springer}, 16667 pages = {361} 16668} 16669 16670@Book{ trefethenbau97, 16671 author = {Lloyd N. Trefethen and David {Bau, III}}, 16672 title = {Numerical Linear Algebra}, 16673 publisher = {Society for Industrial and Applied Mathematics}, 16674 address = {Philadelphia, PA}, 16675 pages = {xii + 361}, 16676 year = {1997}, 16677 isbn = {0-89871-361-7}, 16678 isbn-13 = {978-0-89871-361-9}, 16679 lccn = {QA184 .T74 1997}, 16680 mrclass = {65-01 (65-02 65Fxx)}, 16681 mrnumber = {MR1444820 (98k:65002)}, 16682 mrreviewer = {Moody T. Chu}, 16683 bibdate = {Wed Jan 07 15:23:19 1998}, 16684 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 16685} 16686 16687@Article{ liptonreagan2014, 16688 title = {Quantum Algorithms via Linear Algebra: A Primer}, 16689 author = {Richard J Lipton and Kenneth W Regan}, 16690 pages = {206}, 16691 isbn = {978-0-26202-839-4}, 16692 year = {2014} 16693} 16694 16695@InProceedings{ rhea08, 16696 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 16697 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 16698 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16699 booktitle = {Proceedings of IEEE/ACM SC '08}, 16700 year = {2008} 16701} 16702 16703@Misc{ bursteddewilcox09, 16704 author = {Carsten Burstedde and Lucas~C. Wilcox}, 16705 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 16706 note = {in preparation} 16707} 16708 16709@Article{ skeeltezcanhardy02, 16710 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 16711 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 16712 journal = {J. Comp. Chem.}, 16713 volume = {23}, 16714 pages = {673--684}, 16715 year = {2002} 16716} 16717 16718@Article{ verschelde99, 16719 author = {Jan Verschelde}, 16720 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 16721 homotopy continuation}, 16722 journal = {ACM Trans. Math. Softw.}, 16723 volume = {25}, 16724 number = {2}, 16725 issn = {0098-3500}, 16726 pages = {251--276}, 16727 doi = {10.1145/317275.317286}, 16728 publisher = {ACM}, 16729 address = {New York, NY}, 16730 year = {1999} 16731} 16732 16733@InProceedings{ sommeseverscheldewampler08, 16734 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 16735 title = {Solving Polynomial Systems Equation by Equation}, 16736 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 16737 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 16738 pages = {133--152}, 16739 publisher = {Springer-Verlag}, 16740 year = {2008} 16741} 16742 16743@Article{ phanthientanner77, 16744 author = {N. Phan-Thien and R.~I. Tanner}, 16745 title = {A new constitutive equation derived from network theory}, 16746 journal = {J. Non-Newt. Fluid Mech.}, 16747 volume = {2}, 16748 pages = {353}, 16749 year = {1977} 16750} 16751 16752@Manual{ sage, 16753 key = {SAGE}, 16754 author = {W.\thinspace{}A. Stein and others}, 16755 organization = {The Sage~Development Team}, 16756 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 16757 note = {{\tt http://www.sagemath.org}}, 16758 year = {2009} 16759} 16760 16761@Misc{ bateshauensteinsommesewampler06, 16762 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 16763 Wampler}, 16764 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 16765 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 16766} 16767 16768@Article{ archer09, 16769 author = {A. J. Archer}, 16770 collaboration = {}, 16771 title = {Dynamical density functional theory for molecular and colloidal fluids: A 16772 microscopic approach to fluid mechanics}, 16773 publisher = {AIP}, 16774 year = {2009}, 16775 journal = {The Journal of Chemical Physics}, 16776 volume = {130}, 16777 number = {1}, 16778 eid = {014509}, 16779 numpages = {8}, 16780 pages = {014509}, 16781 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 16782 transition; statistical distributions; stochastic processes}, 16783 doi = {10.1063/1.3054633} 16784} 16785 16786@Article{ giesekus1966, 16787 author = {Hanswalter Giesekus}, 16788 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 16789 journal = {Rheologica Acta}, 16790 publisher = {Springer Berlin / Heidelberg}, 16791 volume = {5}, 16792 number = {1}, 16793 month = mar, 16794 year = {1966}, 16795 doi = {10.1007/BF01973575}, 16796 pages = {29-35} 16797} 16798 16799@Article{ baaijens98, 16800 author = {F.P. Baaijens}, 16801 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 16802 journal = {Journal of Non-Newtonian Fluid Mechanics}, 16803 volume = {79}, 16804 year = {1998}, 16805 pages = {361--385} 16806} 16807 16808@Book{ joseph90, 16809 author = {D.~D. Joseph}, 16810 title = {Fluid Dynamics of Viscoelastic Liquids}, 16811 publisher = {Springer}, 16812 address = {New York, NY}, 16813 year = {1990} 16814} 16815 16816@Article{ oldroyd50, 16817 author = {J.~G. Oldroyd}, 16818 title = {On the Formulation of Rheological Equations of State}, 16819 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 16820 Sciences}, 16821 volume = {200}, 16822 year = {1950}, 16823 pages = {523--541} 16824} 16825 16826@InProceedings{ bynasungroppthakur04, 16827 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 16828 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 16829 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 16830 year = {2004} 16831} 16832 16833@Book{ pozrikidis07, 16834 author = {C. Pozrikidis}, 16835 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 16836 publisher = {Kluwer (Springer)}, 16837 pages = {675}, 16838 year = {2001}, 16839 isbn = {0792373510} 16840} 16841 16842@Misc{ kritzkeyesfsp07, 16843 author = {A. Kritz and D. Keyes}, 16844 title = {{Fusion Simulation Project Workshop Report}}, 16845 month = jul, 16846 year = {2007}, 16847 note = {Available via 16848 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 16849} 16850 16851@Misc{ dahlburg02, 16852 author = {J. {Dahlburg (Chair)}}, 16853 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 16854 year = {2002}, 16855 note = {Available via 16856 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 16857} 16858 16859@Misc{ brown08, 16860 author = {D. {Brown (Chair)}}, 16861 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 16862 to the Future}}, 16863 year = {2008}, 16864 howpublished = {Office of Science, U.S. Department of Energy}, 16865 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 16866} 16867 16868@Misc{ crosscutting10, 16869 author = {D. Brown and P. {Messina (Chairs)}}, 16870 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 16871 Exascale}}, 16872 year = {2010}, 16873 howpublished = {Office of Science, U.S. Department of Energy}, 16874 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 16875} 16876 16877@Misc{ extreme-scale-solvers-workshop12, 16878 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 16879 L.C. McInnes and E. Ng and S. Wild}, 16880 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 16881 Architectures}, 16882 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 16883 note = {{Washington, DC}, March 8-9, 2012}, 16884 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 16885 year = {2012} 16886} 16887 16888@Misc{ monizrosner09, 16889 author = {{E. Moniz and R. Rosner}}, 16890 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 16891 and Simulation at the Extreme Scale}}, 16892 month = may, 16893 year = {2009}, 16894 note = {See 16895 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 16896} 16897 16898@Misc{ blanford08, 16899 author = {{R. Blandord (Chair)}}, 16900 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 16901 Computing at the Extreme Scale}}, 16902 month = dec, 16903 year = {2008}, 16904 note = {See 16905 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 16906} 16907 16908@Misc{ exascale07, 16909 author = {H. Simon and T. Zacharia and R. Stevens}, 16910 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 16911 year = {2007}, 16912 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 16913} 16914 16915@Misc{ ascrbreakthroughs08, 16916 author = {{Panel on Recent Significant Advancements in Computational Science}}, 16917 title = {Breakthroughs}, 16918 year = {2008}, 16919 note = {See 16920 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 16921} 16922 16923@Misc{ petsc-rd100-2009, 16924 author = {{R\&D Magazine}}, 16925 title = {{PETSc} {R}\&{D} 100 Award}, 16926 year = {2009}, 16927 note = {See 16928 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 16929} 16930 16931@Article{ compass-scidac08, 16932 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 16933 R. Ryne}, 16934 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 16935 Computational Science for Future Accelerators and Accelerator Technologies}, 16936 journal = {J. Phys.: Conf. Ser.}, 16937 volume = {125}, 16938 year = {2008}, 16939 pages = {012001}, 16940 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 16941} 16942 16943@Article{ compass-amundson-scidac08, 16944 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 16945 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 16946 Stoltz}, 16947 journal = {J. Phys.: Conf. Ser.}, 16948 volume = {125}, 16949 year = {2008} 16950} 16951 16952@InProceedings{ muszala09, 16953 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 16954 Simulations}, 16955 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 16956 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 16957 {(CBHPC 2009)}}, 16958 year = {2009} 16959} 16960 16961@Article{ gaston09, 16962 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 16963 Equations}, 16964 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 16965 journal = {Nuclear Engineering and Design}, 16966 volume = {239}, 16967 number = {10}, 16968 year = {2009}, 16969 pages = {1768 -- 1778} 16970} 16971 16972@Article{ gaston09b, 16973 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 16974 Engineering}, 16975 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 16976 and C. Permann and W. Taitano}, 16977 journal = {J. Phys.: Conf. Ser.}, 16978 volume = {180}, 16979 year = {2009}, 16980 pages = {012012} 16981} 16982 16983@Article{ newman09, 16984 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 16985 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 16986 author = {Chris Newman and Glen Hansen and Derek Gaston}, 16987 journal = {Journal of Nuclear Materials}, 16988 volume = {392}, 16989 issue = {1}, 16990 year = {2009}, 16991 pages = {6 -- 15} 16992} 16993 16994@Misc{ www:fenics, 16995 author = {{FE}ni{CS}}, 16996 title = {{FE}ni{CS} Project}, 16997 howpublished = {\url{http://www.fenics.org/}}, 16998 year = {2018} 16999} 17000 17001@InProceedings{ zwart08, 17002 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 17003 Systems}, 17004 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 17005 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 17006 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 17007 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 17008 booktitle = {Proceedings of ICCS 2008}, 17009 year = {2008} 17010} 17011 17012@Article{ klocknerwarburtonbridgehesthaven09, 17013 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 17014 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 17015 journal = {J. Comput. Phys.}, 17016 volume = {228}, 17017 number = {21}, 17018 year = {2009}, 17019 issn = {0021-9991}, 17020 pages = {7863--7882}, 17021 doi = {10.1016/j.jcp.2009.06.041}, 17022 publisher = {Academic Press Professional}, 17023 address = {San Diego, CA} 17024} 17025 17026@PhDThesis{ rankin99, 17027 author = {Rankin, W. T.}, 17028 keywords = {FMM, parallel FMM}, 17029 school = {Department of Electrical and Computer Engineering, Duke University}, 17030 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 17031 year = {1999} 17032} 17033 17034@InProceedings{ warrensalmon93, 17035 abstract = {We report on an efficient adaptive N-body method which we have recently designed 17036 and implemented. The algorithm computes the forces on an arbitrary distribution of 17037 bodies in a time which scales as N log N with the particle number. The accuracy of 17038 the force calculations is analytically bounded, and can be adjusted via a user 17039 defined parameter between a few percent relative accuracy, down to machine 17040 arithmetic accuracy. Instead of using pointers to indicate the topology of the 17041 tree, we identify...}, 17042 address = {New York}, 17043 author = {Warren, Michael S. and Salmon, John K.}, 17044 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 17045 citeulike-article-id={580952}, 17046 keywords = {oct-tree}, 17047 pages = {12--21}, 17048 publisher = {ACM}, 17049 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 17050 year = {1993}, 17051 doi = {10.1145/169627.169640}, 17052 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 17053} 17054 17055@Unpublished{ cruzwccm10, 17056 author = {Felipe A. Cruz}, 17057 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 17058 note = {Presentation at WCCM 2010, Sydney Australia}, 17059 year = {2010} 17060} 17061 17062@Article{ mcguffee06, 17063 author = {S.~R. {McGuffee} and A.~H. Elcock}, 17064 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 17065 of salt, {pH}, point mutations, and protein concentration in simulations of 17066 1000-molecule systems}, 17067 journal = {Journal of the American Chemical Society}, 17068 volume = {128}, 17069 pages = {12098--12110}, 17070 year = {2006} 17071} 17072 17073@Article{ nilsencaihoylandlangtangen10, 17074 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 17075 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 17076 in Python}}, 17077 journal = {ArXiv e-prints}, 17078 archiveprefix = {arXiv}, 17079 eprint = {1002.0705}, 17080 primaryclass = {cs.DC}, 17081 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 17082 - Programming Languages}, 17083 year = {2010}, 17084 month = feb, 17085 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 17086 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 17087} 17088 17089@Misc{ mcinnes:siam09:minisymposium, 17090 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 17091 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 17092 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 17093 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 17094 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 17095 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 17096 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 17097 Austin).} 17098} 17099 17100@Misc{ mcinnes:fsp-summary:feb2011, 17101 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 17102 title = {Solvers and Time Integration Breakout Summary}, 17103 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 17104 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 17105} 17106 17107@Misc{ dvi-materials:siamcse11, 17108 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 17109 Materials}, 17110 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 17111 Smith and L. Wang}, 17112 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 17113 and Engineering, March 3, 2011} 17114} 17115 17116@Misc{ jamroz:cemm10, 17117 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 17118 author = {B. Jamroz and S. Kruger and T. Austin}, 17119 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 17120} 17121 17122@Misc{ kruger:feb4-2011, 17123 title = {personal communication}, 17124 author = {S. Kruger}, 17125 note = {February, 2011} 17126} 17127 17128@Article{ elman1996, 17129 author = {H.C. Elman}, 17130 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 17131 viscosity}, 17132 journal = {SIAM J. Sci. Comput.}, 17133 volume = {20}, 17134 year = {1996}, 17135 pages = {1299--1316} 17136} 17137 17138@Article{ kayloghinwathen2002, 17139 author = {D. Kay and D. Loghin and A. Wathen}, 17140 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 17141 journal = {SIAM J. Sci. Comput.}, 17142 volume = {24}, 17143 year = {2002}, 17144 pages = {237--256} 17145} 17146 17147@Article{ elmanhowleshadidshuttleworthtuminaro2006, 17148 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 17149 title = {Block preconditioners based on approximate commutators}, 17150 journal = {SIAM J. Sci. Comput.}, 17151 volume = {27}, 17152 number = {5}, 17153 year = {2006}, 17154 pages = {1651--1668} 17155} 17156 17157@Article{ braesssarazin1997, 17158 author = {Dietrich Braess and Regina Sarazin}, 17159 title = {An efficient smoother for the {Stokes} problem}, 17160 journal = {Applied Numerical Mathematics}, 17161 volume = {23}, 17162 number = {1}, 17163 year = {1997}, 17164 pages = {3--19}, 17165 doi = {10.1016/S0168-9274(96)00059-1} 17166} 17167 17168@Article{ wright2001large, 17169 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 17170 author = {Wright, T.G. and Trefethen, L.N.}, 17171 journal = {SIAM Journal on Scientific Computing}, 17172 volume = {23}, 17173 pages = {591}, 17174 year = {2001} 17175} 17176 17177@Misc{ wright2002eigtool, 17178 title = {Eig{T}ool}, 17179 author = {Wright, T.G. and Trefethen, LN}, 17180 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 17181 year = {2002} 17182} 17183 17184@Misc{ visit-web-site, 17185 key = {{VisIt}}, 17186 title = {{VisIt web site}}, 17187 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 17188 url = {http://wci.llnl.gov/codes/visit/}, 17189 year = {2011} 17190} 17191 17192@Book{ trefethen1996, 17193 title = {Finite difference and spectral methods for ordinary and partial differential 17194 equations}, 17195 author = {Lloyd Nicholas Trefethen}, 17196 year = {1996}, 17197 publisher = {Cornell University-Department of Computer Science and Center for Applied 17198 Mathematics} 17199} 17200 17201@Book{ trefethen2005spectra, 17202 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 17203 author = {Trefethen, L.N. and Embree, M.}, 17204 year = {2005}, 17205 publisher = {Princeton University Press} 17206} 17207 17208@Article{ gomez2010isogeometric, 17209 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 17210 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 17211 journal = {Computer Methods in Applied Mechanics and Engineering}, 17212 volume = {199}, 17213 number = {25-28}, 17214 pages = {1828--1840}, 17215 issn = {0045-7825}, 17216 year = {2010}, 17217 publisher = {Elsevier} 17218} 17219 17220@Article{ gomez2008isogeometric, 17221 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 17222 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 17223 journal = {Computer Methods in Applied Mechanics and Engineering}, 17224 volume = {197}, 17225 number = {49-50}, 17226 pages = {4333--4352}, 17227 year = {2008}, 17228 publisher = {Elsevier} 17229} 17230 17231@Misc{ fastmath:project, 17232 author = {Lori {Diachin (PI)}}, 17233 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 17234 (FASTMath) Institute}}, 17235 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 17236} 17237 17238@Misc{ exascale-software:proposal, 17239 author = {Peter {Beckman (PI)}}, 17240 title = {{Exascale Software Center}}, 17241 note = {proposal to DOE} 17242} 17243 17244@Misc{ imex:project, 17245 author = {Barry {Smith (PI)}}, 17246 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 17247 Multimodel PDEs}}, 17248 note = {DOE ASCR applied math project} 17249} 17250 17251@Misc{ intel-mic:website, 17252 author = {Intel}, 17253 title = {{Many Integrated Core Architecture}}, 17254 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 17255} 17256 17257@Article{ dudson:2009, 17258 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 17259 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 17260 journal = {Computer Physics Communications}, 17261 volume = {180}, 17262 pages = {1467}, 17263 year = {2009} 17264} 17265 17266@Article{ umansky:2009, 17267 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 17268 title = {{Status and verification of edge plasma turbulence code BOUT}}, 17269 journal = {Computer Physics Communications}, 17270 year = {2009}, 17271 volume = {180}, 17272 pages = {887-903} 17273} 17274 17275@Article{ xu:1998, 17276 author = {X.Q. Xu and R.H. Cohen}, 17277 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 17278 journal = {Computer Physics Communications}, 17279 year = {1998}, 17280 volume = {36}, 17281 number = {1-2}, 17282 pages = {158} 17283} 17284 17285@Article{ tron:1999, 17286 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 17287 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 17288 journal = {SIAM Journal on Optimization}, 17289 volume = {9}, 17290 number = {4}, 17291 pages = {1100-1127}, 17292 year = {1999} 17293} 17294 17295@Article{ stubenamg, 17296 author = {K. St\"{u}ben}, 17297 title = {A review of algebraic multigrid}, 17298 journal = {J. Comput. Appl. Math.}, 17299 volume = {128}, 17300 number = {1-2}, 17301 year = {2001}, 17302 issn = {0377-0427}, 17303 pages = {281--309}, 17304 doi = {10.1016/S0377-0427(00)00516-1}, 17305 publisher = {Elsevier Science Publishers B. V.}, 17306 address = {Amsterdam, The Netherlands, The Netherlands} 17307} 17308 17309@Article{ feuchtermg, 17310 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 17311 title = {Bridging the gap between geometric and algebraic multigrid methods}, 17312 journal = {Computing and visualization in science}, 17313 publisher = {Springer}, 17314 volume = {6}, 17315 number = {1}, 17316 year = {2003}, 17317 pages = {1--13} 17318} 17319 17320@Article{ chowmgsmoothness, 17321 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 17322 only attempts to interpolate in the directions of geometrical smoothness. These 17323 directions are determined by analyzing samples of algebraically smooth error, e. 17324 Neighboring grid points i and j are called smoothly coupled if e i and e j are 17325 consistently nearby in value. In addition, these dierences may be used to dene 17326 interpolation weights. These new ideas may be incorporated into the algebraic 17327 multigrid method. Test results show that the new method can have much lower grid 17328 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 17329 author = {Chow, Edmond}, 17330 citeulike-article-id={7675372}, 17331 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17332 journal = {American Journal of Mathematics}, 17333 keywords = {fem, multigrid}, 17334 pages = {197--215}, 17335 posted-at = {2010-08-17 23:29:51}, 17336 priority = {2}, 17337 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 17338 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17339 volume = {65}, 17340 year = {2001} 17341} 17342 17343@Article{ jonesamge, 17344 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 17345 elements) method based on element agglomeration. In the method, coarse grid 17346 elements are formed by agglomerating fine grid elements. Compatible interpolation 17347 operators are constructed which yield coarse grid basis functions with a minimal 17348 energy property. Heuristics based on interpolation quality measures are used to 17349 guide the agglomeration procedure. The performance of the resulting method is 17350 demonstrated in two-level numerical experiments.}}, 17351 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 17352 citeulike-article-id={8598569}, 17353 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17354 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 17355 journal = {SIAM Journal on Scientific Computing}, 17356 keywords = {amg, fem, multigrid}, 17357 number = {1}, 17358 pages = {109--133}, 17359 posted-at = {2011-01-13 18:05:55}, 17360 priority = {2}, 17361 publisher = {SIAM}, 17362 title = {{AMGE Based on Element Agglomeration}}, 17363 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17364 volume = {23}, 17365 year = {2001} 17366} 17367 17368@Article{ saad1993, 17369 author = {Saad, Youcef}, 17370 doi = {10.1137/0914028}, 17371 issn = {10648275}, 17372 journal = {SIAM Journal on Scientific Computing}, 17373 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 17374 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 17375 precondition-,preconditioned conju-,subject classi cations,variable 17376 preconditioners}, 17377 number = {2}, 17378 pages = {461--469}, 17379 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 17380 volume = {14}, 17381 year = {1993} 17382} 17383 17384@Misc{ path:homepage, 17385 author = {S. Dirkse and M. Ferris and T. Munson}, 17386 title = {{{PATH} {W}eb page}}, 17387 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 17388} 17389 17390@Article{ ketcheson2008, 17391 author = {David I Ketcheson}, 17392 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 17393 Low-Storage Implementations}, 17394 volume = {30}, 17395 journal = {SIAM Journal on Scientific Computing}, 17396 year = {2008}, 17397 pages = {2113--2136} 17398} 17399 17400@Article{ elman2009boundary, 17401 title = {{Boundary conditions in approximate commutator preconditioners for the 17402 Navier-Stokes equations}}, 17403 author = {Elman, H.C. and Tuminaro, R.}, 17404 journal = {Electronic Transactions on Numerical Analysis}, 17405 volume = {35}, 17406 pages = {257--280}, 17407 year = {2009} 17408} 17409 17410@Article{ elman2008tcp, 17411 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 17412 incompressible Navier-Stokes equations}}, 17413 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 17414 R.}, 17415 journal = {Journal of Computational Physics}, 17416 volume = {227}, 17417 number = {1}, 17418 pages = {1790--1808}, 17419 year = {2008}, 17420 publisher = {Academic Press}, 17421 url = {http://chess.cs.umd.edu/~elman/papers/tax.pdf} 17422} 17423 17424@Article{ arioli2013, 17425 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 17426 author = {Arioli, Mario}, 17427 journal = {SIAM Journal on Matrix Analysis and Applications}, 17428 volume = {34}, 17429 number = {2}, 17430 pages = {571--592}, 17431 year = {2013}, 17432 publisher = {SIAM} 17433} 17434 17435@Book{ wesseling2009, 17436 title = {Principles of computational fluid dynamics}, 17437 author = {Wesseling, Pieter}, 17438 volume = {29}, 17439 year = {2009}, 17440 publisher = {Springer Science \& Business Media} 17441} 17442 17443@Article{ silvester2001efficient, 17444 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 17445 incompressible flow}}, 17446 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 17447 journal = {Journal of Computational and Applied Mathematics}, 17448 volume = {128}, 17449 number = {1-2}, 17450 pages = {261--279}, 17451 issn = {0377-0427}, 17452 year = {2001}, 17453 publisher = {Elsevier} 17454} 17455 17456@Article{ elman1999bfbt, 17457 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 17458 viscosity}}, 17459 author = {Elman, H.C.}, 17460 journal = {SIAM Journal on Scientific Computing}, 17461 volume = {20}, 17462 number = {4}, 17463 pages = {1299--1316}, 17464 issn = {1064-8275}, 17465 year = {1999}, 17466 publisher = {Citeseer} 17467} 17468 17469@Article{ elman2006bpb, 17470 title = {{Block preconditioners based on approximate commutators}}, 17471 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 17472 journal = {SIAM Journal on Scientific Computing}, 17473 volume = {27}, 17474 number = {5}, 17475 pages = {1651--1668}, 17476 year = {2006}, 17477 publisher = {Philadelphia, PA: SIAM, c1993-} 17478} 17479 17480@Article{ olshanskii2006analysis, 17481 title = {{Analysis of a Stokes interface problem}}, 17482 author = {Olshanskii, M.A. and Reusken, A.}, 17483 journal = {Numerische Mathematik}, 17484 volume = {103}, 17485 number = {1}, 17486 pages = {129--149}, 17487 issn = {0029-599X}, 17488 year = {2006}, 17489 publisher = {Springer} 17490} 17491 17492@Article{ patankar1972cph, 17493 title = {{A calculation procedure for heat, mass and momentum transfer in 17494 three-dimensional parabolic flows}}, 17495 author = {Patankar, S.V. and Spalding, D.B.}, 17496 journal = {Int. J. Heat Mass Transfer}, 17497 volume = {15}, 17498 pages = {1787--1806}, 17499 year = {1972} 17500} 17501 17502@Article{ rannacher1992simple, 17503 title = {{Simple nonconforming quadrilateral Stokes element}}, 17504 author = {Rannacher, R. and Turek, S.}, 17505 journal = {Numerical Methods for Partial Differential Equations}, 17506 volume = {8}, 17507 number = {2}, 17508 pages = {97--111}, 17509 issn = {1098-2426}, 17510 year = {1992}, 17511 publisher = {Wiley Online Library} 17512} 17513 17514@Article{ rannacher2000finite, 17515 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 17516 author = {Rannacher, R.}, 17517 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 17518 pages = {191}, 17519 isbn = {3764364149}, 17520 year = {2000}, 17521 publisher = {Birkhauser} 17522} 17523 17524@Article{ vanka1986block, 17525 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 17526 variables}}, 17527 author = {Vanka, S.P.}, 17528 journal = {Journal of Computational Physics}, 17529 volume = {65}, 17530 number = {1}, 17531 pages = {138--158}, 17532 issn = {0021-9991}, 17533 year = {1986}, 17534 publisher = {Elsevier} 17535} 17536 17537@Article{ eisenstat1983variational, 17538 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 17539 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 17540 journal = {SIAM Journal on Numerical Analysis}, 17541 volume = {20}, 17542 number = {2}, 17543 pages = {345--357}, 17544 year = {1983}, 17545 publisher = {JSTOR} 17546} 17547 17548@InProceedings{ burstedde2008scalable, 17549 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 17550 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 17551 T. and Wilcox, L.C. and Zhong, S.}, 17552 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 17553 pages = {62}, 17554 year = {2008}, 17555 organization = {IEEE Press} 17556} 17557 17558@Article{ burstedde2009parallel, 17559 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 17560 flow problems}, 17561 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 17562 journal = {Computer Methods in Applied Mechanics and Engineering}, 17563 volume = {198}, 17564 number = {21-26}, 17565 pages = {1691--1700}, 17566 year = {2009}, 17567 publisher = {Elsevier} 17568} 17569 17570@Article{ stadler2010dynamics, 17571 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 17572 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 17573 Ghattas, O.}, 17574 journal = {Science}, 17575 volume = {329}, 17576 number = {5995}, 17577 pages = {1033}, 17578 year = {2010}, 17579 publisher = {American Association for the Advancement of Science} 17580} 17581 17582@Article{ tackley2008modelling, 17583 title = {Modelling compressible mantle convection with large viscosity contrasts in a 17584 three-dimensional spherical shell using the yin-yang grid}, 17585 author = {Tackley, P.J.}, 17586 journal = {Physics of the Earth and Planetary Interiors}, 17587 volume = {171}, 17588 number = {1-4}, 17589 pages = {7--18}, 17590 year = {2008}, 17591 publisher = {Elsevier} 17592} 17593 17594@Article{ moresizhonggurnis96, 17595 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 17596 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 17597 viscosity}, 17598 journal = {Physics of the Earth and Planetary Interiors}, 17599 volume = {97}, 17600 pages = {83-–94}, 17601 year = {1996} 17602} 17603 17604@Article{ moresisolomatov95, 17605 author = {Louis N. Moresi and V. S. Solomatov}, 17606 title = {Numerical investigation of {2D} convection with extremely large viscosity 17607 variations}, 17608 journal = {Physics of Fluids}, 17609 volume = {7}, 17610 number = {9}, 17611 pages = {2154-–2162}, 17612 year = {1995} 17613} 17614 17615@Article{ chenmolnar83, 17616 author = {W.-P. Chen and P. Molnar}, 17617 title = {Focal depths of intra-continental and intraplate earthquakes and their 17618 implications for the thermal and mechanical properties of the lithosphere}, 17619 journal = {Journal of Geophysical Research}, 17620 volume = {88}, 17621 pages = {4183–-4214}, 17622 year = {1983} 17623} 17624 17625@Article{ jackson02, 17626 author = {J. Jackson}, 17627 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 17628 journal = {GSA Today}, 17629 volume = {12}, 17630 pages = {4–-10}, 17631 year = {2002} 17632} 17633 17634@Article{ burovwatts06, 17635 author = {E.B. Burov and A.B. Watts}, 17636 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 17637 brulee?}, 17638 journal = {GSA Today}, 17639 volume = {16}, 17640 pages = {4–-10}, 17641 year = {2006} 17642} 17643 17644@InProceedings{ yang:brent:2002, 17645 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 17646 Parallel Distributed Memory Architectures}, 17647 author = {Laurence T. Yang and Richard Brent}, 17648 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 17649 for Parallel Processing}, 17650 year = {2002}, 17651 publisher = {IEEE} 17652} 17653 17654@Article{ demmel2008communication, 17655 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 17656 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 17657 journal = {Arxiv preprint arXiv:0808.2664}, 17658 year = {2008} 17659} 17660 17661@Article{ demmel09, 17662 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 17663 title = {Communication-optimal Iterative Methods}, 17664 journal = {Journal of Physics: Conf. Series}, 17665 volume = {180}, 17666 year = {2009} 17667} 17668 17669@TechReport{ parms04, 17670 author = {Yousef Saad and Masha Sosonkina}, 17671 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 17672 linear systems user's guide}, 17673 number = {UMSI2004-8}, 17674 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 17675 year = {2004} 17676} 17677 17678@Article{ picard1890, 17679 author = {Emile Picard}, 17680 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 17681 m\'ethode des approximations successives}, 17682 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 17683 volume = {4}, 17684 number = {6}, 17685 pages = {145--210}, 17686 year = {1890}, 17687 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 17688} 17689 17690@Book{ rall1969, 17691 author = {Louis B. Rall}, 17692 title = {Computational solution of nonlinear operator equations}, 17693 publisher = {Krieger Pub Co.}, 17694 pages = {225}, 17695 year = {1969} 17696} 17697 17698@Article{ fletcherreeves1964, 17699 author = {R. Fletcher and C. M. Reeves}, 17700 title = {Function Minimization by Conjugate Gradients}, 17701 journal = {Computer Journal}, 17702 volume = {7}, 17703 pages = {149–-154}, 17704 year = {1964} 17705} 17706 17707@InBook{ mcinnesallanetal06, 17708 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 17709 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 17710 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 17711 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 17712 editor = {A.~M.~Bruaset and A.~Tveito}, 17713 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 17714 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 17715 publisher = {Springer}, 17716 year = {2006}, 17717 number = {51}, 17718 series = {Lecture Notes in Computational Science and Engineering}, 17719 pages = {327--381}, 17720 doi = {10.1016/S0167-8191(02)00191-6} 17721} 17722 17723@Article{ cyrshadidtuminaro12, 17724 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 17725 equations}, 17726 journal = {Journal of Computational Physics}, 17727 volume = {231}, 17728 number = {2}, 17729 pages = {345 - 363}, 17730 year = {2012}, 17731 issn = {0021-9991}, 17732 doi = {10.1016/j.jcp.2011.09.001}, 17733 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 17734} 17735 17736@Article{ keyesmcinneswoodwardetal13, 17737 title = {Multiphysics Simulations: Challenges and Opportunities}, 17738 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 17739 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 17740 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 17741 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 17742 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 17743 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 17744 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 17745 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 17746 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 17747 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 17748 journal = {International Journal of High Performance Computing Applications}, 17749 month = feb, 17750 year = {2013}, 17751 volume = {27}, 17752 number = {1}, 17753 pages = {4--83}, 17754 doi = {10.1177/1094342012468181}, 17755 note = {Special issue}, 17756 abstract = {We consider multiphysics applications from algorithmic and architectural 17757 perspectives, where ``algorithmic'' includes both mathematical analysis and 17758 computational complexity and ``architectural'' includes both software and hardware 17759 environments. Many diverse multiphysics applications can be reduced, en route to 17760 their computational simulation, to a common algebraic coupling paradigm. 17761 Mathematical analysis of multiphysics coupling in this form is not always 17762 practical for realistic applications, but model problems representative of 17763 applications discussed herein can provide insight. A variety of software 17764 frameworks for multiphysics applications have been constructed and refined within 17765 disciplinary communities and executed on leading-edge computer systems. We examine 17766 several of these, expose some commonalities among them, and attempt to extrapolate 17767 best practices to future systems. From our study, we summarize challenges and 17768 forecast opportunities.} 17769} 17770 17771@Misc{ rosner10, 17772 author = {Robert {Rosner (Chair)}}, 17773 title = {{The Opportunities and Challenges of Exascale Computing}}, 17774 year = {2010}, 17775 howpublished = {Office of Science, U.S. Department of Energy}, 17776 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 17777} 17778 17779@Misc{ kogge2008exascale, 17780 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 17781 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 17782 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 17783 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 17784 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 17785 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 17786 howpublished = {DARPA}, 17787 year = {2008}, 17788 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 17789} 17790 17791@Misc{ doegrandchallengeworkshops, 17792 key = {Office of Science, U.S. Department of Energy}, 17793 title = {{Scientific Grand Challenges Workshop Series}}, 17794 howpublished = {Office of Science, U.S. Department of Energy, see 17795 \url{http://extremecomputing.labworks.org/workshops.stm}} 17796} 17797 17798@Misc{ lawrence2011, 17799 key = {Lawrence}, 17800 title = {{Ernest Orlando Lawrence Award Winners}}, 17801 howpublished = {U.S. Department of Energy, {\footnotesize 17802 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 17803 year = {2011} 17804} 17805 17806@Article{ murphy2000npi, 17807 title = {{A note on preconditioning for indefinite linear systems}}, 17808 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 17809 journal = {SIAM Journal on Scientific Computing}, 17810 volume = {21}, 17811 number = {6}, 17812 pages = {1969--1972}, 17813 year = {2000}, 17814 publisher = {Philadelphia, PA: SIAM, c1993-} 17815} 17816 17817@Article{ elman2011bouyancy, 17818 title = {Fast iterative solvers for buoyancy driven flow problems}, 17819 journal = {Journal of Computational Physics}, 17820 volume = {230}, 17821 number = {10}, 17822 pages = {3900 - 3914}, 17823 year = {2011}, 17824 note = {}, 17825 issn = {0021-9991}, 17826 doi = {10.1016/j.jcp.2011.02.014}, 17827 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 17828 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 17829 Adaptivity, Preconditioning, Algebraic multigrid} 17830} 17831 17832@Article{ dongarrabeckman11, 17833 author = {J. Dongarra and P. Beckman and et al.}, 17834 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 17835 journal = {Int. J. High Perf. Comput. Applics.}, 17836 volume = {25}, 17837 year = {2011}, 17838 pages = {3--60} 17839} 17840 17841@Article{ mandel1999energy, 17842 title = {Energy optimization of algebraic multigrid bases}, 17843 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 17844 journal = {Computing}, 17845 volume = {62}, 17846 number = {3}, 17847 pages = {205--228}, 17848 year = {1999}, 17849 publisher = {Springer} 17850} 17851 17852@Article{ vanek1996algebraic, 17853 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 17854 problems}, 17855 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 17856 journal = {Computing}, 17857 volume = {56}, 17858 number = {3}, 17859 pages = {179--196}, 17860 year = {1996}, 17861 publisher = {Springer} 17862} 17863 17864@Article{ vanek2001convergence, 17865 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 17866 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 17867 journal = {Numerische Mathematik}, 17868 volume = {88}, 17869 number = {3}, 17870 pages = {559--579}, 17871 year = {2001}, 17872 publisher = {Springer} 17873} 17874 17875@Article{ brannick2007algebraic, 17876 title = {Algebraic multigrid methods based on compatible relaxation and energy 17877 minimization}, 17878 author = {Brannick, J. and Zikatanov, L.}, 17879 journal = {Domain decomposition methods in science and engineering XVI}, 17880 pages = {15--26}, 17881 year = {2007}, 17882 publisher = {Springer} 17883} 17884 17885@Article{ brannickfalgout2010, 17886 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 17887 author = {James J. Brannick and Robert D. Falgout}, 17888 journal = {SIAM Journal on Scientific Computing}, 17889 volume = {32}, 17890 number = {3}, 17891 pages = {1393--1416}, 17892 url = {http://epubs.siam.org/doi/10.1137/090772216}, 17893 doi = {10.1137/090772216}, 17894 issn = {1064-8275}, 17895 year = {2010} 17896} 17897 17898@Article{ xu2004energy, 17899 title = {On an energy minimizing basis for algebraic multigrid methods}, 17900 author = {Xu, J. and Zikatanov, L.}, 17901 journal = {Computing and Visualization in Science}, 17902 volume = {7}, 17903 number = {3}, 17904 pages = {121--127}, 17905 year = {2004}, 17906 publisher = {Springer} 17907} 17908 17909@Article{ dblp:journals/toms/bakerhlt09, 17910 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 17911 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 17912 journal = {ACM Trans. Math. Softw.}, 17913 volume = {36}, 17914 number = {3}, 17915 year = {2009}, 17916 doi = {10.1145/1527286.1527287}, 17917 bibsource = {DBLP, http://dblp.uni-trier.de} 17918} 17919 17920@Article{ dblp:journals/siamsc/yanggbllhn05, 17921 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 17922 Parry Husbands and Esmond G. Ng}, 17923 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 17924 journal = {SIAM J. Scientific Computing}, 17925 volume = {27}, 17926 number = {3}, 17927 year = {2005}, 17928 pages = {873-892}, 17929 doi = {10.1137/040613767}, 17930 bibsource = {DBLP, http://dblp.uni-trier.de} 17931} 17932 17933@TechReport{ ml-guide, 17934 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 17935 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 17936 institution = {Sandia National Laboratories}, 17937 year = {2006}, 17938 number = {SAND2006-2649} 17939} 17940 17941@Article{ brannick06, 17942 title = {An energy-based AMG coarsening strategy}, 17943 volume = {13}, 17944 doi = {10.1002/nla.480}, 17945 number = {2-3}, 17946 journal = {Numerical Linear Algebra with Applications}, 17947 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 17948 and Ruge, J}, 17949 year = {2006}, 17950 pages = {133--148} 17951} 17952 17953@Article{ olson10, 17954 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 17955 title = {A new perspective on strength measures in algebraic multigrid}, 17956 journal = {Numerical Linear Algebra with Applications}, 17957 volume = {17}, 17958 number = {4}, 17959 pages = {713--733}, 17960 year = {2010}, 17961 publisher = {John Wiley \& Sons, Ltd.}, 17962 issn = {1099-1506}, 17963 doi = {10.1002/nla.669} 17964} 17965 17966@Article{ olson11, 17967 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 17968 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 17969 Minimization}, 17970 journal = {SIAM J. Sci. Comput.}, 17971 issue_date = {April 2011}, 17972 volume = {33}, 17973 issue = {2}, 17974 month = apr, 17975 year = {2011}, 17976 issn = {1064-8275}, 17977 pages = {966--991}, 17978 numpages = {26}, 17979 doi = {10.1137/100803031}, 17980 acmid = {2078825}, 17981 publisher = {Society for Industrial and Applied Mathematics}, 17982 address = {Philadelphia, PA}, 17983 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 17984 aggregation} 17985} 17986 17987@Article{ dorit2011, 17988 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 17989 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 17990 journal = {Multiscale Modeling {\&} Simulation}, 17991 volume = {9}, 17992 number = {1}, 17993 year = {2011}, 17994 pages = {407-423}, 17995 doi = {10.1137/100791142} 17996} 17997 17998@Article{ chen2011algebraic, 17999 title = {Algebraic distance on graphs}, 18000 author = {Chen, Jie and Safro, Ilya}, 18001 journal = {SIAM Journal on Scientific Computing}, 18002 volume = {33}, 18003 number = {6}, 18004 pages = {3468--3490}, 18005 year = {2011}, 18006 publisher = {SIAM} 18007} 18008 18009@InProceedings{ adams04, 18010 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 18011 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 18012 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 18013 half a billion degrees of freedom}, 18014 note = {Gordon Bell Award}, 18015 year = {2004} 18016} 18017 18018@Article{ adams03a, 18019 author = {Adams, M.~F.}, 18020 journal = {Numerical Linear Algebra with Applications}, 18021 number = {2-3}, 18022 pages = {141-153}, 18023 title = {Algebraic multigrid methods for constrained linear systems with applications to 18024 contact problems in solid mechanics}, 18025 volume = {11}, 18026 year = {2004} 18027} 18028 18029@Article{ adams-10a, 18030 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 18031 doi = {10.1016/j.jcp.2010.04.024}, 18032 issn = {0021-9991}, 18033 journal = {Journal of Computational Physics}, 18034 keywords = {Implicit magnetohydrodynamics}, 18035 number = {18}, 18036 pages = {6208 - 6219}, 18037 title = {Toward textbook multigrid efficiency for fully implicit resistive 18038 magnetohydrodynamics}, 18039 volume = {229}, 18040 year = {2010} 18041} 18042 18043@InProceedings{ adams98, 18044 address = {Copper Mountain, CO}, 18045 author = {Adams, M.~F.}, 18046 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 18047 title = {A Parallel Maximal Independent Set Algorithm}, 18048 year = {1998} 18049} 18050 18051@InProceedings{ madaypatera89, 18052 author = {Y. Maday and A. T. Patera}, 18053 title = {Spectral element methods for the {Navier-Stokes} equations}, 18054 editor = {A. K. Noor and J. T. Oden}, 18055 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 18056 pages = {71-–143}, 18057 publisher = {ASME}, 18058 address = {New York, NY}, 18059 year = {1989} 18060} 18061 18062@Article{ mishra2012mlmcfvm, 18063 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 18064 conservation laws in multi-dimensions}, 18065 journal = {Journal of Computational Physics}, 18066 volume = {231}, 18067 number = {8}, 18068 pages = {3365--3388}, 18069 year = {2012}, 18070 issn = {0021-9991}, 18071 doi = {10.1016/j.jcp.2012.01.011}, 18072 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 18073 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 18074 Carlo, Parallelization} 18075} 18076 18077@Article{ barth2011mlmcfe, 18078 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 18079 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 18080 Switzerland}, 18081 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 18082 stochastic coefficients}, 18083 journal = {Numerische Mathematik}, 18084 publisher = {Springer Berlin / Heidelberg}, 18085 issn = {0029-599X}, 18086 keyword = {Mathematics and Statistics}, 18087 pages = {123-161}, 18088 volume = {119}, 18089 issue = {1}, 18090 doi = {10.1007/s00211-011-0377-0}, 18091 year = {2011} 18092} 18093 18094@Article{ nguyen2011hybridizable, 18095 title = {Hybridizable discontinuous {G}alerkin methods}, 18096 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 18097 journal = {Spectral and High Order Methods for Partial Differential Equations}, 18098 pages = {63--84}, 18099 year = {2011}, 18100 publisher = {Springer} 18101} 18102 18103@Misc{ snyder-scidac3:proposal, 18104 author = {Philip {Snyder (PI)}}, 18105 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 18106 note = {proposal to DOE SciDAC3}, 18107 month = oct, 18108 year = {2011} 18109} 18110 18111@Misc{ wirth-scidac3:proposal, 18112 author = {Brian {Wirth (PI)}}, 18113 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 18114 through Leadership Class Computing}}, 18115 note = {proposal to DOE SciDAC3}, 18116 month = oct, 18117 year = {2011} 18118} 18119 18120@Misc{ cary-scidac3:proposal, 18121 author = {John {Cary (PI)}}, 18122 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 18123 Stability (IMMPACTS)}}, 18124 note = {proposal to DOE SciDAC3}, 18125 month = oct, 18126 year = {2011} 18127} 18128 18129@Misc{ vashista-scidac3:proposal, 18130 author = {Priya {Vashista (PI)}}, 18131 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 18132 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 18133 Multi-Petaflops Simulations}}, 18134 note = {proposal to DOE SciDAC3}, 18135 month = mar, 18136 year = {2012} 18137} 18138 18139@Article{ elemental2012, 18140 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 18141 Robert {v}an~{d}e~{G}eijn}, 18142 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 18143 journal = {{ACM} Transactions on Mathematical Software}, 18144 volume = {39}, 18145 number = {2}, 18146 year = {2013} 18147} 18148 18149@Misc{ elemental-web-page, 18150 author = {Jack Poulson}, 18151 title = {Elemental: Distributed memory dense linear algebra}, 18152 howpublished = {\url{http://libelemental.org}}, 18153 url = {http://libelemental.org/}, 18154 year = {2015} 18155} 18156 18157@Book{ scalesreport, 18158 title = {A Science-based Case for Large-scale Simulation}, 18159 editor = {D. E. Keyes}, 18160 publisher = {U.S. Department of Energy}, 18161 year = {2004}, 18162 url = {http://www.pnl.gov/scales} 18163} 18164 18165@InProceedings{ cilk95, 18166 address = {Santa Barbara, California}, 18167 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 18168 Leiserson and Keith H. Randall and Yuli Zhou}, 18169 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 18170 Parallel Programming (PPoPP)}, 18171 day = {19--21}, 18172 month = jul, 18173 pages = {207--216}, 18174 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 18175 year = {1995} 18176} 18177 18178@Misc{ valgrind-web-page, 18179 author = {Julian Seward}, 18180 title = {Valgrind}, 18181 url = {http://valgrind.org/}, 18182 howpublished = {\url{http://valgrind.org/}}, 18183 year = {2012} 18184} 18185 18186@Article{ blas79, 18187 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 18188 title = {Basic linear algebra subprograms for Fortran usage}, 18189 journal = {ACM Transactions on Mathematical Software}, 18190 volume = {5}, 18191 pages = {308--323}, 18192 year = {1979} 18193} 18194 18195@TechReport{ lapack90, 18196 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 18197 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 18198 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 18199 institution = {Computer Science Dept., University of Tennessee}, 18200 number = {CS-90-105}, 18201 month = may, 18202 year = {1990} 18203} 18204 18205@TechReport{ nvidiafermi, 18206 author = {NVIDIA}, 18207 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 18208 institution = {NVIDIA}, 18209 year = {2009} 18210} 18211 18212@Misc{ intelmic, 18213 author = {Many Core Group, Cambridge University}, 18214 title = {Intel Many Integrated Core Architecture}, 18215 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 18216 month = dec, 18217 year = {2010} 18218} 18219 18220@Article{ abusufahkucklawrie81, 18221 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 18222 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 18223 Transformations}, 18224 journal = {IEEE Trans. Comput.}, 18225 volume = {30}, 18226 number = {5}, 18227 pages = {341--356}, 18228 year = {1981} 18229} 18230 18231@InProceedings{ guobikshandifraguelagarzaranpadua08, 18232 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 18233 and Padua, David}, 18234 title = {Programming with tiles}, 18235 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 18236 parallel programming}, 18237 series = {PPoPP '08}, 18238 year = {2008}, 18239 isbn = {978-1-59593-795-7}, 18240 location = {Salt Lake City, UT}, 18241 pages = {111--122}, 18242 numpages = {12}, 18243 doi = {10.1145/1345206.1345225}, 18244 acmid = {1345225}, 18245 publisher = {ACM}, 18246 address = {New York, NY} 18247} 18248 18249@Article{ strout04, 18250 journal = {International Journal of High Performance Computing Applications}, 18251 year = {2004}, 18252 title = {Sparse Tiling for Stationary Iterative Methods}, 18253 month = feb, 18254 publisher = {Sage Publications}, 18255 pages = {95-114}, 18256 volume = {18}, 18257 number = {1}, 18258 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 18259} 18260 18261@Misc{ openclstandard, 18262 author = {Khronos Group}, 18263 title = {{OpenCL} 1.2 Specification}, 18264 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 18265 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 18266 year = {2011} 18267} 18268 18269@Misc{ stlguide, 18270 author = {SGI}, 18271 title = {Standard Template Library Programmer's Guide}, 18272 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 18273 url = {http://www.sgi.com/tech/stl/}, 18274 year = {2011} 18275} 18276 18277@Book{ stepanov09, 18278 author = {Alexander Stepanov and Paul McJones}, 18279 title = {Elements of Programming}, 18280 publisher = {Addison-Wesley}, 18281 isbn = {978-0-321-63537-2}, 18282 year = {2009} 18283} 18284 18285@Article{ bangerthhartmannkanschat2007, 18286 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18287 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 18288 journal = {ACM Trans. Math. Softw.}, 18289 year = {2007}, 18290 volume = {33}, 18291 number = {4}, 18292 pages = {24/1--24/27} 18293} 18294 18295@Misc{ dealii-web-page, 18296 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18297 title = {{deal.II}}, 18298 howpublished = {\url{http://www.dealii.org/}}, 18299 url = {http://www.dealii.org/}, 18300 year = {2012} 18301} 18302 18303@InBook{ siek2012, 18304 title = {The C++0x ``Concepts'' Effort}, 18305 author = {Jeremy G. Siek}, 18306 editor = {Jeremy Gibbons}, 18307 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 18308 UK, March 22-26, 2010, Revised Lectures}, 18309 pages = {175--216}, 18310 isbn = {978-3-642-32202-0}, 18311 doi = {10.1007/978-3-642-32202-0_4}, 18312 url = {http://arxiv.org/abs/1201.0027}, 18313 note = {\url{http://arxiv.org/abs/1201.0027}}, 18314 publisher = {Springer Berlin Heidelberg}, 18315 year = {2012} 18316} 18317 18318@Misc{ sharpclaw, 18319 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 18320 author = {Ketcheson, D. I. and Parsani, M.}, 18321 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18322 PDEs,sharpclaw,software}, 18323 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18324 PDEs,sharpclaw,software}, 18325 title = {{SharpClaw software}}, 18326 year = {2011} 18327} 18328 18329@Book{ leveque2002, 18330 title = {Finite volume methods for hyperbolic problems}, 18331 author = {Randall J LeVeque}, 18332 volume = {31}, 18333 year = {2002} 18334} 18335 18336@Misc{ clawpack45, 18337 note = {\url{http://www.clawpack.org}}, 18338 author = {LeVeque, R. J. and Berger, M. J.}, 18339 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 18340 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 18341 title = {{Clawpack Software version 4.5}}, 18342 url = {www.clawpack.org}, 18343 year = {2011} 18344} 18345 18346@Article{ nilsen2010, 18347 archiveprefix = {arXiv}, 18348 arxivid = {arXiv:1002.0705v1}, 18349 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 18350 eprint = {arXiv:1002.0705v1}, 18351 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 18352 parallelization of scientific codes by a function-centric approach in 18353 Python.pdf:pdf}, 18354 journal = {Computational Science \& Discovery}, 18355 keywords = {parallel,programming,python,software}, 18356 mendeley-tags = {parallel,programming,python,software}, 18357 pages = {015003}, 18358 publisher = {IOP Publishing}, 18359 title = {{Simplifying the parallelization of scientific codes by a function-centric 18360 approach in Python}}, 18361 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 18362 volume = {3}, 18363 year = {2010} 18364} 18365 18366@Book{ langtangen09, 18367 author = {Hans Petter Langtangen}, 18368 title = {Python Scripting for Computational Science}, 18369 publisher = {Springer}, 18370 series = {Texts in Computational Science and Engineering}, 18371 pages = {784}, 18372 isbn = {3540739157}, 18373 year = {2009} 18374} 18375 18376@Book{ numpyguide, 18377 author = {Travis E. Oliphant}, 18378 title = {Guide to {N}umpy}, 18379 publisher = {Trelgol}, 18380 year = {2008} 18381} 18382 18383@Misc{ pycuda, 18384 author = {Andreas Kl\"ockner}, 18385 title = {{PyCUDA}}, 18386 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 18387 year = {2011} 18388} 18389 18390@Misc{ pyopencl, 18391 author = {Andreas Kl\"ockner}, 18392 title = {{PyOpenCL}}, 18393 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 18394 year = {2011} 18395} 18396 18397@Article{ klockner2012, 18398 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 18399 Paul Ivanov and Ahmed Fasih}, 18400 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 18401 generation}, 18402 journal = {Parallel Computing}, 18403 volume = {38}, 18404 number = {3}, 18405 pages = {157--174}, 18406 year = {2012}, 18407 issn = {0167-8191}, 18408 doi = {10.1016/j.parco.2011.09.001} 18409} 18410 18411%%%%%% Matt Stuff %%%%%% 18412@Article{ morrabozdagknepleyrassvesselinov, 18413 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 18414 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 18415 Velimir Vesselinov}, 18416 journal = {Eos}, 18417 volume = {102}, 18418 doi = {10.1029/2021EO159258}, 18419 month = {Jun}, 18420 year = {2021} 18421} 18422 18423@Misc{ knepley:icerm-workshop:2012, 18424 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 18425 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 18426 Models for Large-scale Simulations}, 18427 note = {Workshop sponsored by the Institute for Computational and Experimental Research 18428 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 18429 \url{http://icerm.brown.edu/tw12-1-exascale}}, 18430 year = {2012} 18431} 18432 18433@TechReport{ kirbyknepleyscott04, 18434 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18435 title = {Optimal Evaluation of Finite Element Matrices}, 18436 type = {Technical Report}, 18437 number = {TR-2004-04}, 18438 institution = {University of Chicago}, 18439 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 18440 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 18441 pages = {14}, 18442 month = may, 18443 year = {2004} 18444} 18445 18446@TechReport{ kirbyknepleyscott10, 18447 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18448 title = {Languages and Compilers for Variational Forms}, 18449 type = {Technical Report}, 18450 number = {TR-2010-09}, 18451 institution = {University of Chicago}, 18452 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 18453 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 18454 month = oct, 18455 year = {2010} 18456} 18457 18458@TechReport{ kirbyknepleyscott10b, 18459 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18460 title = {Evaluation of the Action of Finite Element Operators}, 18461 type = {Technical Report}, 18462 number = {TR-2010-08}, 18463 institution = {University of Chicago}, 18464 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 18465 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 18466 month = oct, 18467 year = {2010} 18468} 18469 18470@TechReport{ bruneknepleyscott11, 18471 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18472 title = {Exponential grids in high-dimensional space}, 18473 type = {Technical Report}, 18474 number = {TR-2011-07}, 18475 institution = {University of Chicago}, 18476 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 18477 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 18478 month = dec, 18479 year = {2011} 18480} 18481 18482@TechReport{ zheng11, 18483 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 18484 Zhang and Yaolin Shi}, 18485 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 18486 strongly variable viscosity based on {Matlab} and {CUDA}}, 18487 type = {Research Report}, 18488 number = {UMSI 2011/33}, 18489 institution = {University of Minnesota Supercomputing Institute}, 18490 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 18491 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 18492 month = mar, 18493 year = {2011} 18494} 18495 18496@InProceedings{ zheng2010, 18497 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 18498 Zhang and Yaolin Shi}, 18499 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 18500 booktitle = {Eos Transactions of the AGU}, 18501 organization = {American Geophysical Union}, 18502 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 18503 year = {2010} 18504} 18505 18506@InCollection{ terrelkirbyknepleyscott12, 18507 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 18508 and Garth N. Wells}, 18509 title = {Finite elements for incompressible fluids}, 18510 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18511 booktitle = {Automated solutions of differential equations by the finite element method}, 18512 series = {Lecture Notes in Computational Science and Engineering}, 18513 volume = {84}, 18514 pages = {163--169}, 18515 publisher = {Springer-Verlag}, 18516 year = {2012} 18517} 18518 18519@InCollection{ mardalhaga12, 18520 author = {Kent-Andre Mardal and Joachim Berdal Haga}, 18521 title = {Block preconditioning of systems of PDEs}, 18522 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18523 booktitle = {Automated solutions of differential equations by the finite element method}, 18524 series = {Lecture Notes in Computational Science and Engineering}, 18525 volume = {84}, 18526 pages = {643--655}, 18527 publisher = {Springer-Verlag}, 18528 year = {2012} 18529} 18530 18531@InCollection{ kirbyknepleyloggscottterrel12, 18532 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 18533 Andy R. Terrel}, 18534 title = {Discrete optimization of finite element matrix evaluation}, 18535 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18536 booktitle = {Automated solutions of differential equations by the finite element method}, 18537 series = {Lecture Notes in Computational Science and Engineering}, 18538 volume = {84}, 18539 pages = {385--397}, 18540 publisher = {Springer-Verlag}, 18541 year = {2012} 18542} 18543 18544@InCollection{ kirby12, 18545 author = {Robert C. Kirby}, 18546 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 18547 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18548 booktitle = {Automated solutions of differential equations by the finite element method}, 18549 series = {Lecture Notes in Computational Science and Engineering}, 18550 volume = {84}, 18551 publisher = {Springer-Verlag}, 18552 year = {2012} 18553} 18554 18555@Article{ brownconveryhotesknepleypetropolous1993, 18556 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 18557 Labros Petropolous}, 18558 title = {Closed strings with low harmonics and kinks}, 18559 journal = {Physical Review D}, 18560 volume = {48}, 18561 number = {6}, 18562 year = {1993} 18563} 18564 18565@Article{ minimax1996, 18566 title = {MiniMax: What has been learned thus far}, 18567 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 18568 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 18569 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 18570 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 18571 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 18572 journal = {Nuovo Cimento}, 18573 volume = {19}, 18574 number = {1}, 18575 pages = {1045--1049}, 18576 year = {1996} 18577} 18578 18579@Article{ minimax1997, 18580 author = {Minimax Collaboration}, 18581 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 18582 Production}, 18583 journal = {Physical Review D}, 18584 volume = {55}, 18585 number = {9}, 18586 year = {1997} 18587} 18588 18589@Article{ minimax2000, 18590 author = {Minimax Collaboration}, 18591 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 18592 journal = {Physical Review D}, 18593 volume = {61}, 18594 number = {3}, 18595 year = {2000} 18596} 18597 18598@Article{ kirbyknepleyloggscott05, 18599 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 18600 title = {Optimizing the evaluation of finite element matrices}, 18601 journal = {SIAM Journal on Scientific Computing}, 18602 volume = {27}, 18603 number = {3}, 18604 pages = {741--758}, 18605 year = {2005} 18606} 18607 18608@Article{ bardhanknepleyanitescu2008, 18609 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 18610 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 18611 of Molecular Solvation}, 18612 journal = {Journal of Chemical Physics}, 18613 volume = {130}, 18614 number = {10}, 18615 pages = {104108}, 18616 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 18617 Research}, 18618 doi = {10.1063/1.3081148}, 18619 year = {2008} 18620} 18621 18622%Poster at Biophysical Society Fall Meeting 18623@Article{ bardhanknepley2017, 18624 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18625 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 18626 Hydration-Shell {Poisson}-{Boltzmann} Model}, 18627 journal = {Biophysical Journal}, 18628 volume = {110}, 18629 number = {3}, 18630 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 18631 doi = {10.1016/j.bpj.2015.11.1766}, 18632 year = {2017} 18633} 18634 18635@Article{ tabrizirahimigoossensknepleybardhan2018, 18636 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 18637 Interface Condition (SLIC) Continuum Dielectric Model}, 18638 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 18639 Matthew G. Knepley and Jaydeep P. Bardhan}, 18640 journal = {International Journal of Quantum Chemistry}, 18641 note = {Accepted}, 18642 year = {2018} 18643} 18644 18645@Article{ knepley2010, 18646 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 18647 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 18648 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 18649 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 18650 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 18651 title = {{Reproducible Research: addressing the need for data and code sharing in 18652 computational science}}, 18653 journal = {Computing in Science and Engineering}, 18654 volume = {12}, 18655 number = {5}, 18656 pages = {8--13}, 18657 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 18658 year = {2010} 18659} 18660 18661@Article{ ketchesonahmadiaknepley2011, 18662 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 18663 Hyperbolic PDE Codes}, 18664 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 18665 journal = {SIAM News}, 18666 volume = {44}, 18667 number = {7}, 18668 month = sep, 18669 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 18670 year = {2011} 18671} 18672 18673@Article{ yokotabardhanknepleybarbahamada2011, 18674 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 18675 Tsuyoshi Hamada}, 18676 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 18677 a billion unknowns}, 18678 journal = {Computer Physics Communications}, 18679 volume = {182}, 18680 number = {6}, 18681 pages = {1272--1283}, 18682 year = {2011}, 18683 issn = {0010-4655}, 18684 doi = {10.1016/j.cpc.2011.02.013}, 18685 url = {http://arxiv.org/abs/1007.4591} 18686} 18687 18688@Article{ bardhanknepley2011, 18689 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18690 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 18691 Results for Spherical Inclusions}, 18692 journal = {Journal of Chemical Physics}, 18693 volume = {135}, 18694 number = {12}, 18695 pages = {124107--124117}, 18696 url = {http://arxiv.org/abs/1109.0651}, 18697 note = {\url{http://arxiv.org/abs/1109.0651}}, 18698 year = {2011} 18699} 18700 18701@Article{ bruneknepleyscott2013, 18702 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18703 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 18704 Graded Meshes}, 18705 journal = {SIAM Journal on Scientific Computing}, 18706 url = {http://arxiv.org/abs/1104.0261}, 18707 note = {\url{http://arxiv.org/abs/1104.0261}}, 18708 volume = {35}, 18709 number = {1}, 18710 pages = {A173--A191}, 18711 year = {2013} 18712} 18713 18714@Article{ bardhanknepley2012a, 18715 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18716 title = {Computational science and re-discovery: open-source implementations of 18717 ellipsoidal harmonics for problems in potential theory}, 18718 journal = {Computational Science \& Discovery}, 18719 volume = {5}, 18720 pages = {014006}, 18721 note = {\url{http://arxiv.org/abs/1204.0267}}, 18722 doi = {10.1088/1749-4699/5/1/014006}, 18723 year = {2012} 18724} 18725 18726@Article{ kreienkampetal2013, 18727 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 18728 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 18729 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 18730 contributions of molecular binding}, 18731 journal = {Molecular Based Mathematical Biology}, 18732 volume = {1}, 18733 pages = {124--150}, 18734 doi = {10.2478/mlbmb-2013-0007}, 18735 issn = {2299-3266}, 18736 month = jun, 18737 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 18738 year = {2013} 18739} 18740 18741@Article{ bardhanknepleybrune2015, 18742 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 18743 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 18744 Boundary-Integral Operators}, 18745 journal = {Molecular Based Mathematical Biology}, 18746 volume = {3}, 18747 number = {1}, 18748 pages = {1--22}, 18749 doi = {10.1515/mlbmb-2015-0001}, 18750 year = {2015} 18751} 18752 18753@Article{ bardhanknepley14, 18754 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18755 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 18756 Conditions}, 18757 journal = {Journal of Chemical Physics}, 18758 volume = {141}, 18759 number = {13}, 18760 pages = {131103}, 18761 doi = {10.1063/1.4897324}, 18762 year = {2014} 18763} 18764 18765@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 18766 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 18767 Electrostatics}, 18768 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 18769 Matthew G. Knepley}, 18770 booktitle = {Proceedings of PIERS}, 18771 pages = {1215--1221}, 18772 month = jul, 18773 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 18774 year = {2015} 18775} 18776 18777@Article{ tabriziknepleybardhan2016, 18778 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 18779 condition at the solute-solvent interface}, 18780 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 18781 journal = {Molecular Physics}, 18782 volume = {114}, 18783 number = {16-17}, 18784 pages = {2558--2567}, 18785 doi = {10.1080/00268976.2016.1198503}, 18786 year = {2016} 18787} 18788 18789% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 18790@Article{ tabrizigoossensrahimiknepleybardhan2017, 18791 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 18792 Mixtures Using a Solvation-Layer Interface Condition}, 18793 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 18794 Matthew G. Knepley and Jaydeep P. Bardhan}, 18795 journal = {Journal of Chemical Physics}, 18796 volume = {146}, 18797 number = {9}, 18798 pages = {094103}, 18799 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 18800 eprint = {https://arxiv.org/abs/1611.02150}, 18801 doi = {10.1063/1.4977037}, 18802 note = {PMCID: PMC5336475}, 18803 year = {2017} 18804} 18805 18806@Article{ tabrizigoossenscooperknepleybardhan2017, 18807 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 18808 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 18809 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 18810 Matthew G. Knepley and Jaydeep P. Bardhan}, 18811 number = {6}, 18812 pages = {2897--2914}, 18813 journal = {Journal of Chemical Theory and Computation}, 18814 year = {2017} 18815} 18816 18817@InProceedings{ mcclanahan2011, 18818 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 18819 K and Vuduc, Richard}, 18820 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 18821 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 18822 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 18823 year = {2011} 18824} 18825 18826@Article{ ghyselsashbymeerbergenvanroose2013, 18827 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 18828 title = {Hiding global communication latency in the {GMRES} algorithm on massively 18829 parallel machines}, 18830 journal = {SIAM Journal on Scientific Computing}, 18831 volume = {35}, 18832 number = {1}, 18833 pages = {C48--C71}, 18834 year = {2013} 18835} 18836 18837@Article{ ghyselsvanroose2014, 18838 author = {P. Ghysels and W. Vanroose}, 18839 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 18840 Algorithm}, 18841 journal = {Parallel Computing}, 18842 volume = {40}, 18843 number = {7}, 18844 pages = {224--238}, 18845 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 18846 doi = {10.1016/j.parco.2013.06.001}, 18847 year = {2014} 18848} 18849 18850@InProceedings{ strzodkagoddeke06, 18851 author = {R. Strzodka and D. G\"oddeke}, 18852 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 18853 from Low Precision Components}, 18854 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 18855 Computing Machines}, 18856 note = {FCCM ’06}, 18857 pages = {259--270}, 18858 year = {2006}, 18859 organization = {IEEE Computer Society} 18860} 18861 18862@InCollection{ jacquesnicolasvollaire12, 18863 author = {T. Jacques and L. Nicolas and C. Vollaire}, 18864 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 18865 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 18866 booktitle = {High-Performance Computing and Networking}, 18867 series = {Lecture Notes in Computer Science}, 18868 volume = {1593}, 18869 pages = {1025--1031}, 18870 publisher = {Springer}, 18871 year = {1999} 18872} 18873 18874@InProceedings{ hoeflerlumsdainerehm07, 18875 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 18876 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 18877 for MPI}}, 18878 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 18879 Networking, Storage and Analysis, SC07}, 18880 location = {Reno, NV}, 18881 publisher = {IEEE Computer Society/ACM}, 18882 source = {http://www.unixer.de/~htor/publications/}, 18883 month = nov, 18884 year = {2007} 18885} 18886 18887@InProceedings{ hoeflersiebretlumsdaine10, 18888 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 18889 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 18890 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 18891 Parallel Programming (PPoPP'10)}, 18892 month = jan, 18893 location = {Bangalore, India}, 18894 publisher = {ACM}, 18895 isbn = {978-1-60558-708-0}, 18896 source = {http://www.unixer.de/~htor/publications/}, 18897 pages = {159--168}, 18898 year = {2010} 18899} 18900 18901@Article{ ruppweinbubjungelgrasser15, 18902 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 18903 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 18904 journal = {ACM Transactions on Mathematical Software (TOMS)}, 18905 volume = {43}, 18906 number = {2}, 18907 pages = {11}, 18908 year = {2016}, 18909 publisher = {ACM} 18910} 18911 18912@Article{ bai_hu_reichel_1994, 18913 title = {A {Newton} basis {GMRES} implementation}, 18914 volume = {14}, 18915 url = {}, 18916 number = {}, 18917 journal = {IMA Journal of Numerical Analysis}, 18918 author = {Z. Bai and D. Hu and L. Reichel}, 18919 year = {1994}, 18920 pages = {563--581} 18921} 18922 18923@Article{ chronopoulos_gear_1989, 18924 title = {{S-step} iterative methods for symmetric linear systems}, 18925 volume = {25}, 18926 url = {}, 18927 number = {}, 18928 journal = {Journal of Computational and Applied Mathematics}, 18929 author = {A. T. Chronopoulos and C. W. Gear}, 18930 year = {1989}, 18931 pages = {153--168} 18932} 18933 18934@Article{ chronopoulos_1996, 18935 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 18936 author = {A. T. Chronopoulos and C. D. Swanson}, 18937 journal = {Parallel Computing}, 18938 volume = {22}, 18939 number = {5}, 18940 year = {1996}, 18941 pages = {623--641} 18942} 18943 18944@Article{ chronopoulos_2010, 18945 author = {A. T. Chronopoulos and A. Kucherov}, 18946 title = {Block {S-step} {Krylov} Iterative Methods}, 18947 journal = {Numerical Linear Algebra with Applications}, 18948 volume = {17}, 18949 number = {1}, 18950 pages = {3--15}, 18951 year = {2010} 18952} 18953 18954@Article{ sturler_vorst_1995, 18955 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 18956 distributed memory computers}, 18957 volume = {18}, 18958 url = {}, 18959 number = {}, 18960 journal = {Applied Numerical Mathematics}, 18961 author = {E. De Sturler and H. A. van der Vorst}, 18962 year = {1995}, 18963 pages = {441--459} 18964} 18965 18966@Article{ joubert_carey_1992, 18967 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 18968 I: Theory}, 18969 volume = {44}, 18970 url = {}, 18971 number = {}, 18972 journal = {International journal of computer mathematics}, 18973 author = {W. D. Joubert and G. F. Carey}, 18974 year = {1992}, 18975 pages = {243--267} 18976} 18977 18978@Article{ elman_saadsaylor_1986, 18979 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 18980 of linear equations}, 18981 volume = {7}, 18982 url = {}, 18983 number = {3}, 18984 journal = {SIAM Journal on Scientific and Statistical Computing}, 18985 author = {Howard Elman and Y. Saad and P. E. Saylor}, 18986 year = {1986}, 18987 pages = {840--855} 18988} 18989 18990@Article{ golub95innerand, 18991 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 18992 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 18993 journal = {SIAM J. Numer. Anal}, 18994 year = {1995}, 18995 volume = {35}, 18996 pages = {300--319} 18997} 18998 18999@Article{ golub_varga_1961, 19000 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 19001 and second-order {Richardson} iterative methods, parts {I} and {II}}, 19002 volume = {3}, 19003 url = {}, 19004 number = {}, 19005 journal = {Numer. Math.}, 19006 author = {Gene Golub and R.S. Varga}, 19007 year = {1961}, 19008 pages = {147--168} 19009} 19010 19011@Article{ el_maliki_guenette_fortin_2011, 19012 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 19013 element problems}, 19014 volume = {18}, 19015 doi = {10.1002/nla.757}, 19016 number = {5}, 19017 journal = {Numerical Linear Algebra with Applications}, 19018 author = {A. {El maliki} and R. Guenette and M. Fortin}, 19019 year = {2011}, 19020 pages = {789-803} 19021} 19022 19023@Article{ adavani2008multigrid, 19024 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 19025 Constraints}, 19026 author = {Adavani, S.S. and Biros, G.}, 19027 journal = {SIAM Journal on Scientific Computing}, 19028 volume = {31}, 19029 number = {1}, 19030 pages = {369--397}, 19031 year = {2008}, 19032 publisher = {Society for Industrial and Applied Mathematics} 19033} 19034 19035@Article{ horton1995space, 19036 title = {A space-time multigrid method for parabolic {PDE}s}, 19037 author = {Horton, G. and Vandewalle, S.}, 19038 journal = {SIAM Journal on Scientific Computing}, 19039 volume = {16}, 19040 number = {4}, 19041 pages = {848--864}, 19042 year = {1995} 19043} 19044 19045@Article{ lewis2005model, 19046 title = {Model problems for the multigrid optimization of systems governed by differential 19047 equations}, 19048 author = {Lewis, R.M. and Nash, S.G.}, 19049 journal = {SIAM Journal on Scientific Computing}, 19050 volume = {26}, 19051 number = {6}, 19052 pages = {1811--1837}, 19053 year = {2005}, 19054 publisher = {Philadelphia, PA: SIAM, c1993-} 19055} 19056 19057@Article{ nash2000mgopt, 19058 title = {A multigrid approach to discretized optimization problems}, 19059 author = {Nash, S.G.}, 19060 journal = {Optimization Methods and Software}, 19061 volume = {14}, 19062 number = {1-2}, 19063 pages = {99--116}, 19064 year = {2000}, 19065 publisher = {Taylor \& Francis} 19066} 19067 19068@Article{ borzi2009multigrid, 19069 title = {Multigrid Methods for {PDE} Optimization}, 19070 author = {Borz{\`i}, A. and Schulz, V.}, 19071 journal = {SIAM Review}, 19072 volume = {51}, 19073 pages = {361}, 19074 year = {2009} 19075} 19076 19077@Article{ borzi2005multigrid, 19078 title = {A multigrid scheme for elliptic constrained optimal control problems}, 19079 author = {Borz{\`i}, A. and Kunisch, K.}, 19080 journal = {Computational Optimization and Applications}, 19081 volume = {31}, 19082 number = {3}, 19083 pages = {309--333}, 19084 year = {2005}, 19085 publisher = {Springer} 19086} 19087 19088@Article{ borzi2003multigrid, 19089 title = {Multigrid methods for parabolic distributed optimal control problems}, 19090 author = {Borz{\`i}, A.}, 19091 journal = {Journal of Computational and Applied Mathematics}, 19092 volume = {157}, 19093 number = {2}, 19094 pages = {365--382}, 19095 year = {2003}, 19096 publisher = {Elsevier} 19097} 19098 19099@Article{ ito2002receding, 19100 title = {Receding horizon optimal control for infinite dimensional systems}, 19101 author = {Ito, K. and Kunisch, K.}, 19102 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 19103 volume = {8}, 19104 number = {1}, 19105 pages = {741--760}, 19106 year = {2002}, 19107 publisher = {Cambridge University Press} 19108} 19109 19110@Article{ schulz1998solving, 19111 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 19112 author = {Schulz, V.H.}, 19113 journal = {Computing and Visualization in Science}, 19114 volume = {1}, 19115 number = {2}, 19116 pages = {83--96}, 19117 year = {1998}, 19118 publisher = {Springer} 19119} 19120 19121@Article{ hazra2005aerodynamic, 19122 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 19123 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 19124 journal = {Journal of Computational Physics}, 19125 volume = {204}, 19126 number = {1}, 19127 pages = {46--64}, 19128 year = {2005}, 19129 publisher = {Elsevier} 19130} 19131 19132@Article{ mandel1985multilevel, 19133 title = {On multilevel iterative methods for integral equations of the second kind and 19134 related problems}, 19135 author = {Mandel, J.}, 19136 journal = {Numerische Mathematik}, 19137 volume = {46}, 19138 number = {1}, 19139 pages = {147--157}, 19140 year = {1985}, 19141 publisher = {Springer} 19142} 19143 19144@Article{ king1992multilevel, 19145 title = {Multilevel algorithms for ill-posed problems}, 19146 author = {King, J.T.}, 19147 journal = {Numerische Mathematik}, 19148 volume = {61}, 19149 number = {1}, 19150 pages = {311--334}, 19151 year = {1992}, 19152 publisher = {Springer} 19153} 19154 19155@Article{ kaltenbacher2001regularizing, 19156 title = {On the regularizing properties of a full multigrid method for ill-posed 19157 problems}, 19158 author = {Kaltenbacher, B.}, 19159 journal = {Inverse Problems}, 19160 volume = {17}, 19161 pages = {767}, 19162 year = {2001}, 19163 publisher = {IOP Publishing} 19164} 19165 19166@Article{ kaltenbacher2002multi, 19167 title = {A multi-grid method with a priori and a posteriori level choice for the 19168 regularization of nonlinear ill-posed problems}, 19169 author = {Kaltenbacher, B. and Schicho, J.}, 19170 journal = {Numerische Mathematik}, 19171 volume = {93}, 19172 number = {1}, 19173 pages = {77--107}, 19174 year = {2002}, 19175 publisher = {Springer} 19176} 19177 19178@Article{ burger2006regularizing, 19179 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 19180 author = {Burger, M. and Kaltenbacher, B.}, 19181 journal = {SIAM Journal on Numerical Analysis}, 19182 volume = {44}, 19183 pages = {153}, 19184 year = {2006} 19185} 19186 19187@Article{ draganescu2008optimal, 19188 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 19189 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 19190 journal = {Mathematics of Computation}, 19191 volume = {77}, 19192 number = {264}, 19193 pages = {2001--2038}, 19194 year = {2008} 19195} 19196 19197@Article{ bastian1998additive, 19198 title = {Additive and multiplicative multi-grid---a comparison}, 19199 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 19200 journal = {Computing}, 19201 volume = {60}, 19202 number = {4}, 19203 pages = {345--364}, 19204 year = {1998}, 19205 publisher = {Springer} 19206} 19207 19208@Article{ fournier2001multiplicative, 19209 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 19210 compressible flow computations on unstructured meshes}, 19211 author = {Fournier, L. and Lanteri, S.}, 19212 journal = {Applied Numerical Mathematics}, 19213 volume = {36}, 19214 number = {4}, 19215 pages = {401--426}, 19216 year = {2001}, 19217 publisher = {Elsevier} 19218} 19219 19220@Article{ chow2006survey, 19221 title = {A survey of parallelization techniques for multigrid solvers}, 19222 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 19223 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 19224 Simon, eds}, 19225 volume = {20}, 19226 pages = {179--201}, 19227 year = {2006} 19228} 19229 19230@InBook{ brandt2001multiscale, 19231 title = {Multiscale scientific computation: {R}eview 2001}, 19232 author = {Brandt, A.}, 19233 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 19234 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 19235 series = {Lecture Notes in Computational Science and Engineering}, 19236 year = {2001}, 19237 volume = {20}, 19238 pages = {3--96}, 19239 publisher = {Springer Verlag} 19240} 19241 19242@InCollection{ brandt2003multigrid, 19243 title = {Multigrid solvers and multilevel optimization strategies}, 19244 author = {Brandt, A. and Ron, D.}, 19245 booktitle = {Multilevel Optimization and VLSICAD}, 19246 editors = {J. Cong and J.R. Shinnerl}, 19247 pages = {1--69}, 19248 publisher = {Kluwer Academic Publishers}, 19249 year = {2003} 19250} 19251 19252@InBook{ brandt2009principles, 19253 title = {Principles of systematic upscaling}, 19254 author = {Brandt, A.}, 19255 booktitle = {Bridging the Scales in Science and Engineering}, 19256 editors = {J. Fish}, 19257 publisher = {Oxford University Press}, 19258 pages = {193--215}, 19259 year = {2009} 19260} 19261 19262@Article{ livne2004coarsening, 19263 title = {Coarsening by compatible relaxation}, 19264 author = {Livne, O.E.}, 19265 journal = {Numerical Linear Algebra with Applications}, 19266 volume = {11}, 19267 number = {2-3}, 19268 pages = {205--227}, 19269 year = {2004}, 19270 publisher = {Wiley Online Library} 19271} 19272 19273@InProceedings{ brandt1986stochastic, 19274 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 19275 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 19276 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 19277 Methods, held at Cologne, October 1-4, 1985}, 19278 volume = {1228}, 19279 pages = {65--98}, 19280 year = {1986}, 19281 organization = {Springer} 19282} 19283 19284@Article{ halko2011finding, 19285 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 19286 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 19287 Approximate Matrix Decompositions}, 19288 journal = {SIAM Review}, 19289 volume = {53}, 19290 number = {2}, 19291 year = {2011}, 19292 pages = {217-288}, 19293 doi = {10.1137/090771806} 19294} 19295 19296@InProceedings{ mhdy09, 19297 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 19298 booktitle = {Proceedings of SC09}, 19299 organization = {ACM}, 19300 title = {Minimizing communication in sparse matrix solvers}, 19301 doi = {10.1145/1654059.1654096}, 19302 year = {2009} 19303} 19304 19305@InProceedings{ vanrosendale83, 19306 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 19307 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 19308 author = {J. van Rosendale}, 19309 year = {1983}, 19310 publisher = {IEEE Computer Society} 19311} 19312 19313@PhDThesis{ vuduc95, 19314 title = {Quantitative performance modeling of scientific computations and creating 19315 locality in numerical algorithms}, 19316 author = {R. Vuduc}, 19317 journal = {Massachusetts Institute of Technology}, 19318 school = {Massachusetts Institute of Technology}, 19319 year = {1995} 19320} 19321 19322@Article{ simoncini2003flexible, 19323 title = {Flexible inner-outer {Krylov} subspace methods}, 19324 author = {Simoncini, V. and Szyld, D.B.}, 19325 journal = {SIAM Journal on Numerical Analysis}, 19326 pages = {2219--2239}, 19327 year = {2003}, 19328 publisher = {JSTOR} 19329} 19330 19331@Article{ parks2006recycling, 19332 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 19333 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 19334 journal = {SIAM Journal on Scientific Computing}, 19335 volume = {28}, 19336 number = {5}, 19337 pages = {1651--1674}, 19338 year = {2006}, 19339 publisher = {Society for Industrial and Applied Mathematics} 19340} 19341 19342@Article{ freund2003model, 19343 title = {Model reduction methods based on Krylov subspaces}, 19344 author = {Freund, R.W.}, 19345 journal = {Acta Numerica}, 19346 volume = {12}, 19347 number = {1}, 19348 pages = {267--319}, 19349 year = {2003}, 19350 publisher = {Cambridge Univ Press} 19351} 19352 19353@InBook{ gutknecht2006block, 19354 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 19355 an introduction}, 19356 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 19357 author = {Gutknecht, M.H.}, 19358 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 19359 publisher = {Anamaya Publishers}, 19360 location = {New Delhi}, 19361 pages = {420-447}, 19362 year = {2006} 19363} 19364 19365@Article{ moulton1998black, 19366 title = {The black box multigrid numerical homogenization algorithm}, 19367 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 19368 journal = {Journal of Computational Physics}, 19369 volume = {142}, 19370 number = {1}, 19371 pages = {80--108}, 19372 year = {1998}, 19373 publisher = {Elsevier} 19374} 19375 19376@Article{ neuss2001homogenization, 19377 title = {Homogenization and multigrid}, 19378 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 19379 journal = {Computing}, 19380 volume = {66}, 19381 number = {1}, 19382 pages = {1--26}, 19383 year = {2001}, 19384 publisher = {Springer} 19385} 19386 19387@Article{ bai2002krylov, 19388 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 19389 systems}, 19390 author = {Bai, Z.}, 19391 journal = {Applied Numerical Mathematics}, 19392 volume = {43}, 19393 number = {1}, 19394 pages = {9--44}, 19395 year = {2002}, 19396 publisher = {Elsevier} 19397} 19398 19399@InProceedings{ dong2003piecewise, 19400 title = {Piecewise polynomial nonlinear model reduction}, 19401 author = {Dong, N. and Roychowdhury, J.}, 19402 booktitle = {Design Automation Conference, 2003. Proceedings}, 19403 pages = {484--489}, 19404 year = {2003}, 19405 organization = {IEEE} 19406} 19407 19408@Article{ bond2009stable, 19409 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 19410 approximation and projection}, 19411 author = {Bond, B.N. and Daniel, L.}, 19412 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 19413 volume = {28}, 19414 number = {10}, 19415 pages = {1467--1480}, 19416 year = {2009}, 19417 publisher = {IEEE} 19418} 19419 19420@Article{ xin2000front, 19421 title = {Front Propagation in Heterogeneous Media}, 19422 author = {Xin, J.}, 19423 journal = {SIAM Review}, 19424 volume = {42}, 19425 number = {2}, 19426 pages = {161--230}, 19427 year = {2000}, 19428 publisher = {Society for Industrial and Applied Mathematics} 19429} 19430 19431@Article{ owhadi2011localized, 19432 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 19433 Nonseparated Scales and High Contrast}, 19434 author = {Owhadi, H. and Zhang, L.}, 19435 journal = {Multiscale Modeling and Simulation}, 19436 volume = {9}, 19437 pages = {1373}, 19438 year = {2011} 19439} 19440 19441@Article{ berlyand2010flux, 19442 title = {Flux norm approach to finite dimensional homogenization approximations with 19443 non-separated scales and high contrast}, 19444 author = {Berlyand, L. and Owhadi, H.}, 19445 journal = {Archive for rational mechanics and analysis}, 19446 volume = {198}, 19447 number = {2}, 19448 pages = {677--721}, 19449 year = {2010}, 19450 publisher = {Springer} 19451} 19452 19453@Article{ babuska2011optimal, 19454 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 19455 Application to Multiscale Problems}, 19456 author = {Babuska, I. and Lipton, R.}, 19457 journal = {Multiscale Modeling \& Simulation}, 19458 volume = {9}, 19459 pages = {373}, 19460 year = {2011} 19461} 19462 19463@Article{ boettinger2002phase, 19464 title = {Phase-Field Simulation of Solidification}, 19465 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 19466 journal = {Annual review of materials research}, 19467 volume = {32}, 19468 number = {1}, 19469 pages = {163--194}, 19470 year = {2002}, 19471 publisher = {Annual Reviews} 19472} 19473 19474@Article{ karma1998quantitative, 19475 title = {Quantitative phase-field modeling of dendritic growth in two and three 19476 dimensions}, 19477 author = {Karma, A. and Rappel, W.J.}, 19478 journal = {Physical Review E}, 19479 volume = {57}, 19480 number = {4}, 19481 pages = {4323}, 19482 year = {1998}, 19483 publisher = {APS} 19484} 19485 19486@Article{ chen2002phase, 19487 title = {Phase-field models for microstructure evolution}, 19488 author = {Chen, L.Q.}, 19489 journal = {Annual review of materials research}, 19490 volume = {32}, 19491 number = {1}, 19492 pages = {113--140}, 19493 year = {2002}, 19494 publisher = {Annual Reviews} 19495} 19496 19497@Article{ galbally2010reductionuq, 19498 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 19499 problems}, 19500 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 19501 journal = {International journal for numerical methods in engineering}, 19502 volume = {81}, 19503 number = {12}, 19504 pages = {1581--1608}, 19505 year = {2010}, 19506 publisher = {Wiley Online Library} 19507} 19508 19509@Article{ griebel1995abstract, 19510 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 19511 author = {Griebel, M. and Oswald, P.}, 19512 journal = {Numerische Mathematik}, 19513 volume = {70}, 19514 number = {2}, 19515 pages = {163--180}, 19516 year = {1995}, 19517 publisher = {Springer} 19518} 19519 19520@InProceedings{ voutchkov2006multiobjective, 19521 title = {Multiobjective optimization using surrogates}, 19522 author = {Voutchkov, I. and Keane, A.J.}, 19523 booktitle = {Adaptive Computing in Design and Manufacture}, 19524 pages = {167--175}, 19525 year = {2006}, 19526 publisher = {The MC Escher Company} 19527} 19528 19529@Article{ leary2001constraint, 19530 title = {A constraint mapping approach to the structural optimization of an expensive 19531 model using surrogates}, 19532 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 19533 journal = {Optimization and Engineering}, 19534 volume = {2}, 19535 number = {4}, 19536 pages = {385--398}, 19537 year = {2001}, 19538 publisher = {Springer} 19539} 19540 19541@InProceedings{ legresley2000airfoil, 19542 title = {Airfoil design optimization using reduced order models based on proper orthogonal 19543 decomposition}, 19544 author = {LeGresley, P.A. and Alonso, J.J.}, 19545 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 19546 year = {2000} 19547} 19548 19549@Book{ myers2009response, 19550 title = {Response surface methodology: process and product optimization using designed 19551 experiments}, 19552 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 19553 volume = {705}, 19554 year = {2009}, 19555 publisher = {John Wiley \& Sons} 19556} 19557 19558@Article{ carlberg2012gnat, 19559 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 19560 application to computational fluid dynamics and turbulent flows}, 19561 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 19562 journal = {arXiv}, 19563 volume = {1207.1349}, 19564 year = {2012} 19565} 19566 19567@Article{ biros2008multilevel, 19568 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 19569 author = {Biros, G. and Dogan, G.}, 19570 journal = {Inverse Problems}, 19571 volume = {24}, 19572 pages = {034010}, 19573 year = {2008}, 19574 publisher = {IOP Publishing} 19575} 19576 19577@Article{ rees2010optimal, 19578 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 19579 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 19580 journal = {SIAM Journal on Scientific Computing}, 19581 volume = {32}, 19582 pages = {271}, 19583 year = {2010} 19584} 19585 19586@Article{ rees2010block, 19587 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 19588 author = {Rees, T. and Stoll, M.}, 19589 journal = {Numerical Linear Algebra with Applications}, 19590 volume = {17}, 19591 number = {6}, 19592 pages = {977--996}, 19593 year = {2010}, 19594 publisher = {Wiley Online Library} 19595} 19596 19597@Article{ rees2011preconditioning, 19598 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 19599 Equations}, 19600 author = {Rees, T. and Wathen, A.J.}, 19601 journal = {SIAM Journal on Scientific Computing}, 19602 volume = {33}, 19603 number = {5}, 19604 pages = {2903--2926}, 19605 year = {2011}, 19606 publisher = {Society for Industrial and Applied Mathematics} 19607} 19608 19609@Article{ vogel2007fbicg, 19610 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19611 author = {Vogel,J.A.}, 19612 journal = {Applied Mathematics and Computation}, 19613 volume = {188}, 19614 number = {1}, 19615 pages = {226–-233}, 19616 year = {2007}, 19617 publisher = {Elsevier} 19618} 19619 19620@Unpublished{ leehammond2010, 19621 author = {B. Lee and G.E. Hammond}, 19622 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 19623 Equation}, 19624 key = {multigrid}, 19625 note = {manuscript, 2010} 19626} 19627 19628@Article{ vandeneshop2004inexact, 19629 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 19630 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 19631 journal = {SIAM Journal on Matrix Analysis and Applications}, 19632 volume = {26}, 19633 number = {1}, 19634 pages = {125--153}, 19635 year = {2004} 19636} 19637 19638@Article{ fbicg.fbcgs, 19639 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19640 author = {Judith A. Vogel}, 19641 journal = {Applied Mathematics and Computation}, 19642 volume = {188}, 19643 number = {1}, 19644 pages = {226--233}, 19645 year = {2007} 19646} 19647 19648@Article{ simoncini2003inexact, 19649 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 19650 Computing}, 19651 author = {Valeria Simoncini and Daniel B. Szyld}, 19652 journal = {SIAM Journal on Scientific Computing}, 19653 volume = {25}, 19654 number = {2}, 19655 pages = {454--477}, 19656 year = {2003} 19657} 19658 19659@Article{ fqmr, 19660 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 19661 author = {Daniel B. Szyld and Judith A. Vogel}, 19662 journal = {SIAM Journal on Scientific Computing}, 19663 volume = {23}, 19664 number = {2}, 19665 pages = {363--380}, 19666 year = {2001} 19667} 19668 19669@Article{ ipcg, 19670 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 19671 author = {Gene H. Golub and Qiang Ye}, 19672 journal = {SIAM Journal on Scientific Computing}, 19673 volume = {21}, 19674 number = {4}, 19675 pages = {1305--1320}, 19676 year = {1999} 19677} 19678 19679@Article{ idr.sonneveld, 19680 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 19681 Systems of Linear Equations}, 19682 author = {Peter Sonneveld and Martin B. van Gijzen}, 19683 journal = {SIAM Journal on Scientific Computing}, 19684 volume = {31}, 19685 number = {2}, 19686 pages = {1035--1062}, 19687 year = {2008} 19688} 19689 19690@Article{ flexiblecg, 19691 title = {Flexible Conjugate Gradients}, 19692 author = {Yvan Notay}, 19693 journal = {SIAM Journal on Scientific Computing}, 19694 volume = {22}, 19695 number = {4}, 19696 pages = {1444--1460}, 19697 year = {2000} 19698} 19699 19700@Article{ generalizedcg, 19701 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 19702 Variable-Step Preconditioning}, 19703 author = {O. Axelsson and P. S. Vassilevski}, 19704 journal = {SIAM Journal on Matrix Analysis and Applications}, 19705 volume = {12}, 19706 number = {4}, 19707 pages = {625--644}, 19708 year = {1991} 19709} 19710 19711@Article{ bicg, 19712 title = {{Conjugate Gradient} methods for indefinite systems}, 19713 author = {R. Fletcher}, 19714 journal = {Lecture Notes in Mathematics}, 19715 volume = {506}, 19716 pages = {73--89}, 19717 year = {1976} 19718} 19719 19720@Article{ idr.bcgs, 19721 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 19722 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 19723 journal = {Applied Numerical Mathematics}, 19724 volume = {60}, 19725 pages = {1100--1114}, 19726 year = {2010} 19727} 19728 19729@Article{ idr.bcgsl, 19730 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 19731 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 19732 journal = {SIAM J. Sci. Comput.}, 19733 volume = {32}, 19734 number = {5}, 19735 pages = {2687--2709}, 19736 year = {2010} 19737} 19738 19739@Article{ idr.min.sync, 19740 title = {Minimizing synchronization in {IDR(s)}}, 19741 author = {T.P. Collignon and M.B. van Gijzen}, 19742 journal = {Numerical Linear Algebra with Applications}, 19743 volume = {18}, 19744 number = {5}, 19745 pages = {805--825}, 19746 year = {2011} 19747} 19748 19749@TechReport{ flexible.idr, 19750 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 19751 Sparse Linear Systems}, 19752 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 19753 institution = {Delft University of Technology}, 19754 number = {11-06}, 19755 year = {2011} 19756} 19757 19758@Article{ vangenuchten1980, 19759 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 19760 Soils}, 19761 author = {M. Th. van Genuchten}, 19762 journal = {Soil Science Society of America Journal}, 19763 volume = {44}, 19764 pages = {892--898}, 19765 year = {1980} 19766} 19767 19768@Article{ gmresr94, 19769 title = {{GMRESR}: a family of nested {GMRES} methods}, 19770 author = {H. A. Van der Vorst and C. Vuik}, 19771 journal = {Numerical Linear Algebra with Applications}, 19772 volume = {1}, 19773 number = {4}, 19774 pages = {369--386}, 19775 year = {1994} 19776} 19777 19778@Article{ knepley10, 19779 author = {Matthew G. Knepley}, 19780 title = {Removing the Barrier to Scalability in Parallel FMM}, 19781 journal = {CoRR}, 19782 volume = {abs/1008.2410}, 19783 note = {\url{http://arxiv.org/abs/1008.2410}}, 19784 year = {2010} 19785} 19786 19787@Article{ teng1998, 19788 author = {Shang-Hua Teng}, 19789 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 19790 N-Body Simulation}, 19791 journal = {SIAM J. Sci. Comput.}, 19792 volume = {19}, 19793 number = {2}, 19794 month = mar, 19795 pages = {635--656}, 19796 year = {1998}, 19797 issn = {1064-8275}, 19798 numpages = {22}, 19799 doi = {10.1137/S1064827595288942}, 19800 acmid = {289842}, 19801 issue_date = {March 1998}, 19802 publisher = {Society for Industrial and Applied Mathematics}, 19803 address = {Philadelphia, PA}, 19804 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 19805 parallel processing, partitioning, scientific computing, the fast multipole 19806 method, tree-codes} 19807} 19808 19809@InProceedings{ skinnerkramer05, 19810 author = {David Skinner and William Kramer}, 19811 title = {Understanding the causes of performance variability in HPC workloads}, 19812 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 19813 International}, 19814 organization = {IEEE}, 19815 pages = {137--149}, 19816 year = {2005} 19817} 19818 19819@Article{ notay_2000, 19820 author = {Yvan Notay}, 19821 title = {Flexible {Conjugate Gradients}}, 19822 journal = {SIAM Journal on Scientific Computing}, 19823 volume = {22}, 19824 number = {4}, 19825 year = {2000}, 19826 pages = {1444--1460} 19827} 19828 19829@Article{ bereux1996, 19830 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 19831 computations}, 19832 author = {Fran{\c{c}}ois B{\'e}reux}, 19833 journal = {Computer Methods in Applied Mechanics and Engineering}, 19834 volume = {133}, 19835 number = {1-2}, 19836 pages = {93--124}, 19837 year = {1996} 19838} 19839 19840@Article{ pawlowski2006globalization, 19841 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 19842 fully coupled solution of the {N}avier-{S}tokes equations}, 19843 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 19844 journal = {SIAM Review}, 19845 volume = {48}, 19846 number = {4}, 19847 pages = {700--721}, 19848 year = {2006}, 19849 publisher = {SIAM} 19850} 19851 19852@Article{ roppshadid2009, 19853 title = {Stability of operator splitting methods for systems with indefinite operators: 19854 Advection--diffusion--reaction systems}, 19855 author = {David L Ropp and John N Shadid}, 19856 journal = {Journal of Computational Physics}, 19857 volume = {228}, 19858 number = {9}, 19859 pages = {3508--3516}, 19860 year = {2009} 19861} 19862 19863@Article{ brown1985experiments, 19864 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 19865 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 19866 journal = {SIAM Journal on Scientific and Statistical Computing}, 19867 volume = {6}, 19868 number = {2}, 19869 pages = {297--313}, 19870 year = {1985}, 19871 publisher = {SIAM} 19872} 19873 19874@Article{ bicgsl_1993, 19875 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 19876 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 19877 Spectrum}, 19878 journal = {Electronic Transactions on Numerical Analysis}, 19879 volume = {1}, 19880 year = {1993}, 19881 pages = {11--32} 19882} 19883 19884@Book{ brandt2011revised, 19885 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 19886 Edition}, 19887 author = {Achi Brandt and Oren Livne}, 19888 year = {2011}, 19889 publisher = {SIAM} 19890} 19891 19892@Article{ axelsson1990algebraic, 19893 title = {Algebraic multilevel preconditioning methods, {II}}, 19894 author = {Axelsson, O. and Vassilevski, P.S.}, 19895 journal = {SIAM Journal on Numerical Analysis}, 19896 volume = {27}, 19897 number = {6}, 19898 pages = {1569--1590}, 19899 year = {1990}, 19900 publisher = {SIAM} 19901} 19902 19903@Article{ zulehner2002analysis, 19904 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 19905 author = {Zulehner, W.}, 19906 journal = {Mathematics of computation}, 19907 volume = {71}, 19908 number = {238}, 19909 pages = {479--506}, 19910 year = {2002} 19911} 19912 19913@Article{ pralet2010, 19914 author = {L. Giraud and A. Haidar and S. Pralet}, 19915 title = {Using multiple levels of parallelism to enhance the performance of domain 19916 decomposition solvers}, 19917 journal = {Parallel Computing}, 19918 volume = {36}, 19919 number = {5-6}, 19920 pages = {285--296}, 19921 year = {2010} 19922} 19923 19924@Book{ brennerscottfem, 19925 title = {The Mathematical Theory of Finite Element Methods}, 19926 author = {Susanne C. Brenner and L. Ridgway Scott}, 19927 edition = {3rd Edition}, 19928 series = {Texts in Applied Mathematics}, 19929 year = {2008}, 19930 publisher = {Springer-Verlag} 19931} 19932 19933@Book{ ortega1987iterative, 19934 title = {Iterative solution of nonlinear equations in several variables}, 19935 author = {Ortega, James M and Rheinboldt, Werner C}, 19936 volume = {30}, 19937 publisher = {Society for Industrial and Applied Mathematics}, 19938 year = {1987} 19939} 19940 19941@InBook{ rheinboldtch6, 19942 author = {Werner C. Rheinboldt}, 19943 title = {6. Combinations of Processes}, 19944 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 19945 chapter = {6}, 19946 pages = {59--74}, 19947 doi = {10.1137/1.9781611970012.ch6}, 19948 year = {1998} 19949} 19950 19951@Article{ allgowerbohmerpotrarheinboldt86, 19952 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 19953 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 19954 journal = {SIAM Journal on Numerical Analysis}, 19955 volume = {23}, 19956 number = {1}, 19957 pages = {160-169}, 19958 year = {1986}, 19959 doi = {10.1137/0723011} 19960} 19961 19962@Article{ rheinboldt76, 19963 author = {Werner C. Rheinboldt}, 19964 title = {On measures of ill-conditioning for nonlinear equations}, 19965 journal = {Mathematics of Computation}, 19966 volume = {30}, 19967 number = {133}, 19968 pages = {104--111}, 19969 year = {1976} 19970} 19971 19972@Article{ little61, 19973 author = {John D. C. Little}, 19974 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 19975 journal = {Operations Research}, 19976 volume = {9}, 19977 number = {3}, 19978 pages = {383--387}, 19979 note = {\url{http://www.jstor.org/stable/167570}}, 19980 year = {1961} 19981} 19982 19983@Misc{ top500, 19984 author = {{TOP500 Supercomputer Sites}}, 19985 url = {http://www.top500.org}, 19986 year = {2013} 19987} 19988 19989@Misc{ hassediagram, 19990 author = {Wikipedia}, 19991 title = {Hasse Diagram}, 19992 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 19993 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 19994 year = {2015} 19995} 19996 19997@Misc{ groupoid, 19998 author = {Wikipedia}, 19999 title = {Groupoid}, 20000 url = {https://en.wikipedia.org/wiki/Groupoid}, 20001 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 20002 year = {2015} 20003} 20004 20005@Misc{ cwcomplex, 20006 author = {Wikipedia}, 20007 title = {{CW} complex}, 20008 url = {http://en.wikipedia.org/wiki/CW_complex}, 20009 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 20010 year = {2015} 20011} 20012 20013@Misc{ linearalgebra, 20014 author = {Wikipedia}, 20015 title = {Linear Algebra}, 20016 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 20017 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 20018 year = {2015} 20019} 20020 20021@Misc{ amdahlslaw, 20022 author = {Wikipedia}, 20023 title = {Amdahl's Law}, 20024 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 20025 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 20026 year = {2015} 20027} 20028 20029@Misc{ gustafsonslaw, 20030 author = {Wikipedia}, 20031 title = {Gustafson's Law}, 20032 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 20033 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 20034 year = {2015} 20035} 20036 20037@InProceedings{ amdahl1967, 20038 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 20039 Capabilities}, 20040 author = {Gene M. Amdahl}, 20041 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 20042 series = {AFIPS '67 (Spring)}, 20043 location = {Atlantic City, New Jersey}, 20044 pages = {483--485}, 20045 numpages = {3}, 20046 doi = {10.1145/1465482.1465560}, 20047 acmid = {1465560}, 20048 publisher = {ACM}, 20049 address = {New York, NY, USA}, 20050 year = {1967} 20051} 20052 20053@Article{ gustafson1988, 20054 title = {Reevaluating {Amdahl}'s Law}, 20055 author = {Gustafson, John L.}, 20056 journal = {Communications of the ACM}, 20057 volume = {31}, 20058 number = {5}, 20059 month = may, 20060 issn = {0001-0782}, 20061 pages = {532--533}, 20062 doi = {10.1145/42411.42415}, 20063 acmid = {42415}, 20064 year = {1988} 20065} 20066 20067@Book{ eijkhout2014, 20068 title = {Introduction to High Performance Scientific Computing}, 20069 author = {Victor Eijkhout}, 20070 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 20071 publisher = {TACC}, 20072 year = {2014} 20073} 20074 20075@Article{ korelc2002multilanguage, 20076 title = {Multi-language and multi-environment generation of nonlinear finite element 20077 codes}, 20078 author = {Korelc, J.}, 20079 journal = {Engineering with Computers}, 20080 volume = {18}, 20081 number = {4}, 20082 pages = {312--327}, 20083 year = {2002}, 20084 publisher = {Springer} 20085} 20086 20087@TechReport{ taylor2011feap, 20088 title = {{FEAP}: A Finite Element Analysis Program}, 20089 subtitle = {Version 8.3 User Manual}, 20090 author = {R. L. Taylor}, 20091 year = {2011}, 20092 institution = {University of California, Berkeley} 20093} 20094 20095@Article{ bergeraftosmismurman2005, 20096 title = {Analysis of slope limiters on irregular grids}, 20097 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 20098 journal = {AIAA paper}, 20099 volume = {490}, 20100 pages = {2005}, 20101 year = {2005} 20102} 20103 20104@InProceedings{ ferreirabridgesbrightwell08, 20105 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 20106 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 20107 Noise Injection}, 20108 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 20109 series = {SC '08}, 20110 year = {2008}, 20111 isbn = {978-1-4244-2835-9}, 20112 location = {Austin, Texas}, 20113 pages = {19:1--19:12}, 20114 articleno = {19}, 20115 numpages = {12}, 20116 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 20117 acmid = {1413390}, 20118 publisher = {IEEE Press}, 20119 address = {Piscataway, NJ} 20120} 20121 20122@Article{ banach22, 20123 author = {Stefan Banach}, 20124 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 20125 \'equations int\'egrales}, 20126 journal = {Fund. Math.}, 20127 volume = {3}, 20128 pages = {133--181}, 20129 year = {1922} 20130} 20131 20132@Article{ bangerthbursteddeheisterkronbichler2012, 20133 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 20134 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 20135 Element Codes}, 20136 journal = {ACM Trans. Math. Softw.}, 20137 issue_date = {December 2011}, 20138 volume = {38}, 20139 number = {2}, 20140 month = jan, 20141 year = {2012}, 20142 issn = {0098-3500}, 20143 pages = {14:1--14:28}, 20144 articleno = {14}, 20145 numpages = {28}, 20146 doi = {10.1145/2049673.2049678}, 20147 acmid = {2049678}, 20148 publisher = {ACM}, 20149 address = {New York, NY, USA}, 20150 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 20151 design} 20152} 20153 20154@Article{ eisenstatwalker1994, 20155 author = {Stanley Eisenstat and Homer Walker}, 20156 title = {Globally Convergent Inexact {N}ewton Methods}, 20157 journal = {SIAM Journal on Optimization}, 20158 volume = {4}, 20159 number = {2}, 20160 pages = {393--422}, 20161 year = {1994}, 20162 doi = {10.1137/0804022} 20163} 20164 20165@Book{ blumcuckershubsmale98, 20166 title = {Complexity and Real Computation}, 20167 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 20168 year = {1998}, 20169 publisher = {Springer} 20170} 20171 20172@Article{ caili2011, 20173 author = {Cai, X.-C. and Li, X.}, 20174 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 20175 Elimination for Problems with High Local Nonlinearity}, 20176 journal = {SIAM Journal on Scientific Computing}, 20177 volume = {33}, 20178 number = {2}, 20179 pages = {746-762}, 20180 year = {2011}, 20181 doi = {10.1137/080736272} 20182} 20183 20184@Article{ cai2009, 20185 author = {X.-C. Cai}, 20186 title = { Nonlinear overlapping domain decomposition methods}, 20187 journal = {Lecture Notes in Computational Science}, 20188 volume = {70}, 20189 pages = {217-224}, 20190 year = {2009} 20191} 20192 20193@Article{ lanzkronrosewilkes1996, 20194 title = {An analysis of approximate nonlinear elimination}, 20195 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 20196 journal = {SIAM Journal on Scientific Computing}, 20197 volume = {17}, 20198 number = {2}, 20199 pages = {538--559}, 20200 year = {1996}, 20201 publisher = {SIAM} 20202} 20203 20204@TechReport{ gropp1993sowing, 20205 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 20206 author = {Gropp, W}, 20207 year = {1995}, 20208 number = {ANL/MCS-TM-208}, 20209 institution = {Argonne National Laboratory} 20210} 20211 20212@TechReport{ gropp1993sowing2, 20213 title = {Users Manual for doctext: Producing Documentation from Source Code}, 20214 author = {Gropp, W}, 20215 year = {1995}, 20216 number = {ANL/MCS-TM-206}, 20217 institution = {Argonne National Laboratory} 20218} 20219 20220@TechReport{ gropp1993simplified, 20221 title = {Simplified Linear Equation Solvers users manual}, 20222 author = {Gropp, W and Smith, B}, 20223 year = {1993}, 20224 number = {ANL--93/8}, 20225 institution = {Argonne National Laboratory} 20226} 20227 20228@Misc{ simplifiedbsd, 20229 author = {{University of California, Berkeley}}, 20230 title = {Simplified {Berkeley} Software Distribution License}, 20231 note = {see 20232 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 20233} 20234 20235@Book{ chaconstraub14, 20236 author = {Scott Chacon and Ben Straub}, 20237 title = {Pro Git}, 20238 publisher = {Apress}, 20239 year = {2014}, 20240 pages = {456}, 20241 note = {Available online at \url{http://git-scm.com/book/}} 20242} 20243 20244@Misc{ bitbucket, 20245 author = {Atlassian}, 20246 title = {Bitbucket}, 20247 note = {Platform available from \url{http://bitbucket.org}} 20248} 20249 20250@Misc{ gitworkflows, 20251 author = {GitWorkflows}, 20252 note = {Available at 20253 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 20254} 20255 20256@Misc{ figshare, 20257 author = {FigShare}, 20258 note = {Available at \url{http://palgrave.figshare.com/}} 20259} 20260 20261@InProceedings{ beazley1996swig, 20262 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 20263 {C++}}, 20264 author = {Beazley, David M}, 20265 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 20266 pages = {129--139}, 20267 year = {1996} 20268} 20269 20270@Misc{ softwareproductivityworkshopreport14, 20271 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 20272 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 20273 title = {Software Productivity for Extreme-Scale Science}, 20274 note = {Report on DOE Workshop, January 13-14, 2014}, 20275 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 20276 year = {2014} 20277} 20278 20279@Misc{ softwareproductivitywhitepaper13, 20280 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 20281 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 20282 Tang}, 20283 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 20284 Capability of Extreme-Scale Computing}, 20285 note = {whitepaper submitted to DOE, available via 20286 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 20287 year = {2013} 20288} 20289 20290@Misc{ ideas:project, 20291 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 20292 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 20293 howpublished = {\url{http://ideas-productivity.org}}, 20294 year = {2015} 20295} 20296 20297@TechReport{ keyesmcinneswoodwardetal2012, 20298 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 20299 and B. Sheehan}, 20300 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 20301 institution = {Argonne National Laboratory}, 20302 number = {ANL/MCS-TM-330}, 20303 month = oct, 20304 year = {2012} 20305} 20306 20307@Misc{ sawsfs-web-page, 20308 author = {Surtai Han and Barry Smith and Hong Zhang}, 20309 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 20310 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 20311 year = {2015} 20312} 20313 20314@Misc{ sawshk-web-page, 20315 author = {Surtai Han and Barry Smith and Hong Zhang}, 20316 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 20317 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 20318 year = {2015} 20319} 20320 20321@Misc{ sawsnestk-web-page, 20322 author = {Surtai Han and Barry Smith and Hong Zhang}, 20323 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 20324 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 20325 year = {2015} 20326} 20327 20328@Misc{ m2acs:project, 20329 author = {M. {Anitescu et al.}}, 20330 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 20331 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 20332 year = {2015} 20333} 20334 20335@Misc{ hssmn13, 20336 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 20337 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 20338 Developing Mathematical Libraries and Simulation Codes}, 20339 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 20340 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 20341 year = {2013} 20342} 20343 20344@Misc{ atpesc:website, 20345 key = {{Argonne Training Program for Extreme-Scale Computing}}, 20346 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 20347 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 20348 year = {2018} 20349} 20350 20351@Article{ barraultmadaynguyenpatera2004, 20352 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 20353 title = {An empirical interpolation method: application to efficient reduced-basis 20354 discretization of partial differential equations}, 20355 journal = {Comptes Rendus Mathematique}, 20356 volume = {339}, 20357 number = {9}, 20358 pages = {667--672}, 20359 year = {2004}, 20360 issn = {1631-073X}, 20361 doi = {10.1016/j.crma.2004.08.006} 20362} 20363 20364@Article{ simongogotsi08, 20365 title = {Materials for electrochemical capacitors}, 20366 author = {Patrice Simon and Yury Gogotsi}, 20367 journal = {Nature Materials}, 20368 volume = {7}, 20369 number = {11}, 20370 pages = {845--854}, 20371 year = {2008}, 20372 doi = {10.1038/nmat2297} 20373} 20374 20375@Article{ vladsinghrollandmelinteajayangohy14, 20376 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 20377 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 20378 Gohy}, 20379 journal = {Scientific Reports}, 20380 volume = {4}, 20381 year = {2014}, 20382 doi = {10.1038/srep04315} 20383} 20384 20385@Article{ lichengshashurinkeidar12, 20386 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 20387 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 20388 journal = {Graphene}, 20389 volume = {1}, 20390 number = {1}, 20391 pages = {1--13}, 20392 year = {2012}, 20393 doi = {10.4236/graphene.2012.11001} 20394} 20395 20396@Article{ miller07, 20397 title = {A Brief History of Supercapacitors}, 20398 author = {John R. Miller}, 20399 journal = {Battery and Energy Storage Technology}, 20400 pages = {61--78}, 20401 year = {2007} 20402} 20403 20404@Book{ deshpande14, 20405 title = {Ultracapacitors: Future of Energy Storage}, 20406 author = {R. P. Deshpande}, 20407 publisher = {McGraw Hill Education}, 20408 isbn = {978-9339214050}, 20409 pages = {452}, 20410 year = {2014} 20411} 20412 20413@Article{ hojowboggs10, 20414 title = {Historical introduction to capacitor technology}, 20415 author = {J. Ho and T.R. Jow and S. Boggs}, 20416 journal = {IEEE Electrical Insulation Magazine}, 20417 month = jan, 20418 volume = {26}, 20419 number = {1}, 20420 pages = {20--25}, 20421 year = {2010}, 20422 doi = {10.1109/MEI.2010.5383924}, 20423 issn = {0883-7554} 20424} 20425 20426@Article{ gillespie14, 20427 title = {A review of steric interactions of ions: Why some theories succeed and others 20428 fail to acount for ion size}, 20429 author = {Dirk Gillespie}, 20430 journal = {Microfluidics and Nanofluidics}, 20431 volume = {18}, 20432 number = {5-6}, 20433 pages = {717--738}, 20434 year = {2015} 20435} 20436 20437@Article{ gillespievaliskoboda05, 20438 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 20439 title = {Density functional theory of the electrical double layer: the RFD functional}, 20440 journal = {J. Phys.: Condens. Matter}, 20441 volume = {17}, 20442 pages = {6609--6626}, 20443 year = {2005} 20444} 20445 20446@Article{ valiskobodagillespie07, 20447 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 20448 title = {Selective adsorption of ions with different diameter and valence at 20449 highly-charged interfaces}, 20450 journal = {J. Phys. Chem. C}, 20451 volume = {111}, 20452 pages = {15575--15585}, 20453 year = {2007} 20454} 20455 20456@Article{ gillespie08, 20457 author = {Dirk Gillespie}, 20458 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 20459 case study}, 20460 journal = {Biophys. J.}, 20461 volume = {94}, 20462 pages = {1169--1184}, 20463 year = {2008} 20464} 20465 20466@Article{ liwuwang15, 20467 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 20468 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 20469 journal = {Biophysical Journal}, 20470 volume = {94}, 20471 number = {3}, 20472 pages = {737--746}, 20473 doi = {10.1529/biophysj.107.112508}, 20474 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 20475 year = {2015} 20476} 20477 20478@Article{ gillespie12, 20479 title = {High energy conversion efficiency in nanofluidic channels}, 20480 author = {Dirk Gillespie}, 20481 journal = {Nano Letters}, 20482 volume = {12}, 20483 pages = {1410--1416}, 20484 year = {2012} 20485} 20486 20487@Article{ dieterich79, 20488 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 20489 author = {James H. Dieterich}, 20490 journal = {Journal of Geophysical Research: Solid Earth}, 20491 volume = {84}, 20492 number = {B5}, 20493 pages = {2161--2168}, 20494 year = {1979}, 20495 publisher = {Wiley Online Library} 20496} 20497 20498@Article{ bodakovacsgillespiekristof14, 20499 title = {Selective transport through a model calcium channel studied by Local Equilibrium 20500 Monte Carlo simulations coupled to the Nernst--Planck equation}, 20501 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 20502 Krist{\'o}f}, 20503 journal = {Journal of Molecular Liquids}, 20504 volume = {189}, 20505 pages = {100--112}, 20506 year = {2014}, 20507 publisher = {Elsevier} 20508} 20509 20510@Article{ brandt05, 20511 title = {Multiscale solvers and systematic upscaling in computational physics}, 20512 author = {Brandt, A}, 20513 journal = {Computer Physics Communications}, 20514 volume = {169}, 20515 number = {1}, 20516 pages = {438--441}, 20517 year = {2005}, 20518 publisher = {Elsevier} 20519} 20520 20521@Article{ rosenfeld89, 20522 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 20523 density-functional theory of freezing}, 20524 author = {Yaakov Rosenfeld}, 20525 journal = {Physical review letters}, 20526 volume = {63}, 20527 number = {9}, 20528 pages = {980}, 20529 year = {1989}, 20530 publisher = {APS} 20531} 20532 20533@Article{ schindlermitchellmccabecummingslevan13, 20534 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 20535 Approach}, 20536 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 20537 M Douglas LeVan}, 20538 journal = {The Journal of Physical Chemistry C}, 20539 volume = {117}, 20540 number = {41}, 20541 pages = {21337--21350}, 20542 year = {2013}, 20543 publisher = {ACS Publications} 20544} 20545 20546@Misc{ tramonto, 20547 author = {Laura Frink and et. al.}, 20548 title = {TRAMONTO 3.0 web site}, 20549 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 20550 year = {2014} 20551} 20552 20553@InCollection{ zhongyuenmoresiknepley15, 20554 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 20555 title = {Numerical Methods for Mantle Convection}, 20556 booktitle = {Treatise on Geophysics}, 20557 publisher = {Elsevier}, 20558 volume = {7}, 20559 editor = {Gerald Schubert}, 20560 edition = {second}, 20561 year = {2015} 20562} 20563 20564@Article{ richarson1911, 20565 author = {Lewis Fry Richardson}, 20566 title = {The approximate arithmetical solution by finite differences of physical problems 20567 including differential equations, with an application to the stresses in a masonry 20568 dam}, 20569 journal = {Philosophical Transactions of the Royal Society A}, 20570 volume = {210}, 20571 number = {459--470}, 20572 pages = {307--357}, 20573 doi = {10.1098/rsta.1911.0009}, 20574 year = {1911} 20575} 20576 20577@Article{ kirkwood34, 20578 author = {John G. Kirkwood}, 20579 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 20580 Application to Zwitterions}, 20581 journal = {The Journal of Chemical Physics}, 20582 volume = {2}, 20583 number = {7}, 20584 year = {1934} 20585} 20586 20587@TechReport{ schoof1994exodus, 20588 title = {{EXODUS II}: a finite element data model}, 20589 author = {Larry A Schoof and Victor R Yarberry}, 20590 institution = {Sandia National Laboratories}, 20591 number = {SAND92-2137}, 20592 address = {Albuquerque, NM}, 20593 year = {1994} 20594} 20595 20596@Misc{ poirier1998cgns, 20597 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 20598 and Fancis Y Enomoto}, 20599 title = {The CGNS system}, 20600 note = {AIAA Paper 98-3007}, 20601 year = {1998} 20602} 20603 20604@Article{ deyobarashephard2001, 20605 title = {Towards curvilinear meshing in 3D: the case of quadratic simplices}, 20606 author = {Saikat Dey and Robert M O'Bara and Mark S Shephard}, 20607 journal = {Computer-Aided Design}, 20608 volume = {33}, 20609 number = {3}, 20610 pages = {199--209}, 20611 year = {2001}, 20612} 20613 20614@InProceedings{ gomezhaimesgalbraith2022, 20615 title = {On Analysis Driven Shape Design Using B-Splines}, 20616 author = {Marlena Gomez and Robert Haimes and Marshall C Galbraith}, 20617 booktitle = {AIAA SciTech 2022 Forum}, 20618 pages = {1736}, 20619 year = {2022} 20620} 20621 20622@InProceedings{ cloughoberaizakrajsek2019, 20623 title = {Automated Wing Internal Structure Placement Guided by Finite Element Analysis}, 20624 author = {Justin L Clough and Assad A Oberai and Andrew J Zakrajsek}, 20625 booktitle = {AIAA Aviation 2019 Forum}, 20626 pages = {3369}, 20627 year = {2019} 20628} 20629 20630@InProceedings{ joegandhidannenhofferdalir2019, 20631 title = {Rapid generation of parametric aircraft structural models}, 20632 author = {John Joe and Viraj Gandhi and John Dannenhoffer and Hamid Dalir}, 20633 booktitle = {AIAA SciTech 2019 Forum}, 20634 pages = {2229}, 20635 year = {2019} 20636} 20637 20638@InProceedings{ haimesdannenhoffer2013, 20639 title = {The engineering sketch pad: A solid-modeling, feature-based, web-enabled system for building parametric geometry}, 20640 author = {Robert Haimes and John Dannenhoffer}, 20641 booktitle = {21st AIAA Computational Fluid Dynamics Conference}, 20642 pages = {3073}, 20643 year = {2013} 20644} 20645 20646@Article{ geuzaine2009gmsh, 20647 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 20648 facilities}, 20649 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 20650 journal = {International Journal for Numerical Methods in Engineering}, 20651 volume = {79}, 20652 number = {11}, 20653 pages = {1309--1331}, 20654 year = {2009}, 20655 publisher = {Wiley Online Library} 20656} 20657 20658@Article{ si2015, 20659 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 20660 author = {Hang Si}, 20661 journal = {ACM Trans. on Mathematical Software}, 20662 volume = {41}, 20663 number = {2}, 20664 month = feb, 20665 doi = {10.1145/2629697}, 20666 year = {2015} 20667} 20668 20669@TechReport{ blackerbohnhoffedwards1994, 20670 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 20671 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 20672 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 20673 year = {1994} 20674} 20675 20676@Article{ bjorck1994, 20677 title = {Numerics of Gram-Schmidt orthogonalization}, 20678 author = {{\AA}ke Bj{\"o}rck}, 20679 journal = {Linear Algebra and Its Applications}, 20680 volume = {197}, 20681 pages = {297--316}, 20682 year = {1994}, 20683 publisher = {Elsevier} 20684} 20685 20686@PhDThesis{ yood05, 20687 author = {Charles Nelson Yood}, 20688 title = {Argonne National Laboratory and the Emergence of Computer and Computational 20689 Science, 1946--1992}, 20690 school = {The Pennsylvania State University}, 20691 month = aug, 20692 year = {2005} 20693} 20694 20695@Article{ fearnleysander79, 20696 title = {Hermann Grassmann and the Creation of Linear Algebra}, 20697 author = {Desmond Fearnley-Sander}, 20698 journal = {The American Mathematical Monthly}, 20699 volume = {86}, 20700 pages = {809--817}, 20701 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 20702 year = {1979} 20703} 20704 20705@InCollection{ knepley2012, 20706 author = {Matthew G. Knepley}, 20707 title = {Programming Languages for Scientific Computing}, 20708 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20709 publisher = {Springer}, 20710 year = {2012}, 20711 editor = {Bj\"orn Engquist}, 20712 doi = {10.1007/978-3-540-70529-1}, 20713 url = {http://arxiv.org/abs/1209.1711} 20714} 20715 20716@InBook{ knepley2015, 20717 title = {Programming Languages for Scientific Computing}, 20718 author = {Matthew G. Knepley}, 20719 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20720 editor = {Bj{\"o}rn Engquist}, 20721 publisher = {Springer Berlin Heidelberg}, 20722 address = {Berlin, Heidelberg}, 20723 pages = {1173--1181}, 20724 isbn = {978-3-540-70529-1}, 20725 doi = {10.1007/978-3-540-70529-1_250}, 20726 year = {2015} 20727} 20728 20729@Book{ hughes2000, 20730 author = {Thomas J. R. Hughes}, 20731 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 20732 series = {Dover Civil and Mechanical Engineering}, 20733 pages = {704}, 20734 year = {2000}, 20735 isbn = {978-0486411811}, 20736 publisher = {Dover} 20737} 20738 20739@Article{ roache2002, 20740 title = {Code verification by the method of manufactured solutions}, 20741 author = {Patrick J. Roache}, 20742 journal = {Journal of Fluids Engineering}, 20743 volume = {124}, 20744 number = {1}, 20745 pages = {4--10}, 20746 year = {2002}, 20747 publisher = {American Society of Mechanical Engineers} 20748} 20749 20750@InCollection{ rokosgorman13, 20751 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 20752 author = {Georgios Rokos and Gerard Gorman}, 20753 booktitle = {Facing the Multicore-Challenge III}, 20754 series = {Lecture Notes in Computer Science}, 20755 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 20756 publisher = {Springer Berlin Heidelberg}, 20757 volume = {7686}, 20758 pages = {143-144}, 20759 doi = {10.1007/978-3-642-35893-7_22}, 20760 isbn = {978-3-642-35892-0}, 20761 year = {2013} 20762} 20763 20764@Misc{ hdf5:homepage, 20765 author = {{The HDF Group}}, 20766 title = {The {HDF5} Homepage}, 20767 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 20768 year = {2015} 20769} 20770 20771@Misc{ paraview:homepage, 20772 author = {Kitware}, 20773 title = {The {ParaView} Homepage}, 20774 howpublished = {\url{http://www.paraview.org/}}, 20775 year = {2015} 20776} 20777 20778@Misc{ xdmf:homepage, 20779 author = {Kitware}, 20780 title = {The Extensible Data Model and Format ({XDMF})}, 20781 howpublished = {\url{http://www.xdmf.org/}}, 20782 year = {2015} 20783} 20784 20785@Article{ cullerkarp1993, 20786 title = {LogP: Towards a realistic model of parallel computation}, 20787 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 20788 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 20789 journal = {SIGPLAN Notices}, 20790 volume = {28}, 20791 number = {7}, 20792 pages = {1--12}, 20793 year = {1993}, 20794 publisher = {ACM} 20795} 20796 20797@Article{ aggarwalvitter1988, 20798 title = {The input/output complexity of sorting and related problems}, 20799 author = {Alok Aggarwal and Jeffrey Vitter}, 20800 journal = {Communications of the ACM}, 20801 volume = {31}, 20802 number = {9}, 20803 pages = {1116--1127}, 20804 year = {1988}, 20805 publisher = {ACM} 20806} 20807 20808@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 20809 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 20810 Chandramowlishwaran and Richard Vuduc}, 20811 title = {Balance principles for algorithm-architecture co-design}, 20812 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 20813 month = may, 20814 address = {Berkeley, CA, USA}, 20815 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 20816 year = {2011} 20817} 20818 20819@Article{ williamswatermanpatterson2009, 20820 title = {Roofline: an insightful visual performance model for multicore architectures}, 20821 author = {Samuel Williams and Andrew Waterman and David Patterson}, 20822 journal = {Communications of the ACM}, 20823 volume = {52}, 20824 number = {4}, 20825 pages = {65--76}, 20826 year = {2009}, 20827 publisher = {ACM} 20828} 20829 20830@Misc{ roofline-web-page, 20831 author = {Samuel Williams and {et. al.}}, 20832 title = {{R}oofline {P}erformance {M}odel}, 20833 key = {Roofline}, 20834 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 20835 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 20836} 20837 20838@Misc{ roofline-talk2008, 20839 author = {Samuel Williams and David Patterson}, 20840 title = {{R}oofline {P}erformance {M}odel}, 20841 key = {Roofline}, 20842 year = {2008}, 20843 note = {ParLab Summer Retreat}, 20844 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 20845 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 20846} 20847 20848@Article{ lee2006, 20849 title = {The problem with threads}, 20850 author = {Edward A Lee}, 20851 journal = {Computer}, 20852 volume = {39}, 20853 number = {5}, 20854 pages = {33--42}, 20855 year = {2006}, 20856 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 20857 publisher = {IEEE Computer Society Press} 20858} 20859 20860@Article{ hoefler2012, 20861 title = {{Optimization principles for collective neighborhood communications}}, 20862 author = {Torsten Hoefler and Timo Schneider}, 20863 journal = {International Conference for High Performance Computing, Networking, Storage and 20864 Analysis, SC}, 20865 doi = {10.1109/SC.2012.86}, 20866 isbn = {9781467308069}, 20867 issn = {21674329}, 20868 year = {2012} 20869} 20870 20871@Book{ grahamknuthpatashnik1989, 20872 title = {Concrete Mathematics}, 20873 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 20874 publisher = {Addison-Wesley}, 20875 year = {1989} 20876} 20877 20878@Book{ jackson1962, 20879 title = {Classical Electrodynamics}, 20880 author = {John David Jackson}, 20881 publisher = {John Wiley \& Sons}, 20882 year = {1962} 20883} 20884 20885@Article{ leveque2013, 20886 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 20887 author = {Randall J. LeVeque}, 20888 journal = {SIAM News}, 20889 volume = {46}, 20890 number = {3}, 20891 month = apr, 20892 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 20893 year = {2013} 20894} 20895 20896@InProceedings{ wang2014, 20897 title = {Fjos: Practical, predictable, and efficient system support for fork/join 20898 parallelism}, 20899 author = {Qi Wang and Gabriel Parmer}, 20900 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 20901 20th}, 20902 pages = {25--36}, 20903 year = {2014}, 20904 organization = {IEEE} 20905} 20906 20907@Article{ fangsaad2009, 20908 author = {Haw-ren Fang and Yousef Saad}, 20909 title = {Two classes of multisecant methods for nonlinear acceleration}, 20910 journal = {Numerical Linear Algebra with Applications}, 20911 volume = {16}, 20912 number = {3}, 20913 pages = {197--221}, 20914 year = {2009}, 20915 doi = {10.1002/nla.617} 20916} 20917 20918@Misc{ hpcchallenge, 20919 title = {HPC Challenge}, 20920 author = {Jack Dongarra and Piotr Luszczek and others}, 20921 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 20922 year = {2015} 20923} 20924 20925@InProceedings{ hoeflerschneiderlumsdaine2008, 20926 title = {Accurately measuring collective operations at massive scale}, 20927 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 20928 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 20929 Processing (IPDPS)}, 20930 pages = {1--8}, 20931 year = {2008}, 20932 doi = {10.1109/IPDPS.2008.4536494}, 20933 organization = {IEEE} 20934} 20935 20936@Book{ potraptak1984, 20937 title = {Nondiscrete Induction and Iterative Processes}, 20938 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 20939 series = {Research Notes in Mathematics}, 20940 year = {1984}, 20941 publisher = {Pitman} 20942} 20943 20944@Book{ pilz1977, 20945 title = {Near-rings: the theory and its applications}, 20946 author = {G{\"u}nter Pilz}, 20947 year = {1977}, 20948 publisher = {New York} 20949} 20950 20951@Article{ birkenjameson2009, 20952 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 20953 author = {Philipp Birken and Antony Jameson}, 20954 journal = {International Journal for Numerical Methods in Fluids}, 20955 volume = {62}, 20956 number = {5}, 20957 pages = {565--573}, 20958 publisher = {John Wiley \& Sons, Ltd.}, 20959 doi = {10.1002/fld.2030}, 20960 issn = {1097-0363}, 20961 year = {2010} 20962} 20963 20964@Article{ anderson1965, 20965 title = {Iterative procedures for nonlinear integral equations}, 20966 author = {Donald G Anderson}, 20967 journal = {Journal of the ACM (JACM)}, 20968 volume = {12}, 20969 number = {4}, 20970 pages = {547--560}, 20971 year = {1965}, 20972 publisher = {ACM} 20973} 20974 20975@Article{ ptak1966, 20976 title = {Some metric aspects of the open mapping and closed graph theorems}, 20977 author = {Vlastimil Pt{\'a}k}, 20978 journal = {Mathematische Annalen}, 20979 volume = {163}, 20980 number = {2}, 20981 pages = {95--104}, 20982 year = {1966}, 20983 publisher = {Springer} 20984} 20985 20986@Article{ ptak1974, 20987 title = {A quantitative refinement of the closed graph theorem}, 20988 author = {Vlastimil Pt{\'a}k}, 20989 journal = {Czechoslovak Mathematical Journal}, 20990 volume = {24}, 20991 number = {3}, 20992 pages = {503--506}, 20993 year = {1974}, 20994 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 20995} 20996 20997@Article{ ptak1975, 20998 title = {The rate of convergence of {Newton's} process}, 20999 author = {Vlastimil Pt{\'a}k}, 21000 journal = {Numerische Mathematik}, 21001 volume = {25}, 21002 number = {3}, 21003 pages = {279--285}, 21004 year = {1975}, 21005 publisher = {Springer} 21006} 21007 21008@Article{ ptak1976, 21009 title = {Nondiscrete mathematical induction and iterative existence proofs}, 21010 author = {Vlastimil Pt{\'a}k}, 21011 journal = {Linear algebra and its applications}, 21012 volume = {13}, 21013 number = {3}, 21014 pages = {223--238}, 21015 year = {1976}, 21016 publisher = {Elsevier} 21017} 21018 21019@Article{ ptak1977, 21020 title = {What should be a rate of convergence?}, 21021 author = {Vlastimil Pt{\'a}k}, 21022 journal = {RAIRO-Analyse num{\'e}rique}, 21023 volume = {11}, 21024 number = {3}, 21025 pages = {279--286}, 21026 year = {1977} 21027} 21028 21029@Article{ potraptak1980, 21030 title = {Sharp error bounds for {Newton's} process}, 21031 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 21032 journal = {Numerische Mathematik}, 21033 volume = {34}, 21034 number = {1}, 21035 pages = {63--72}, 21036 year = {1980}, 21037 publisher = {Springer} 21038} 21039 21040@Article{ liesen2014, 21041 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 21042 author = {J{\"o}rg Liesen}, 21043 journal = {IMA Journal of Numerical Analysis}, 21044 doi = {10.1093/imanum/drv037}, 21045 archiveprefix = {arXiv}, 21046 eprint = {1405.2683}, 21047 primaryclass = {math-na}, 21048 year = {2015} 21049} 21050 21051@Book{ traub1964, 21052 title = {Iterative Methods for the Solution of Equations}, 21053 author = {Joseph F Traub}, 21054 year = {1964}, 21055 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 21056} 21057 21058@InProceedings{ shalfvecpar2010, 21059 title = {Exascale Computing Technology Challenges}, 21060 author = {John Shalf and Sudip Dosanjh and John Morrison}, 21061 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 21062 pages = {1–-25}, 21063 year = {2010} 21064} 21065 21066@Article{ frechet1907, 21067 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 21068 author = {Maurice Ren\'e Fr\'echet}, 21069 journal = {C. R. Acad. Sci. Paris}, 21070 volume = {144}, 21071 pages = {1414--1416}, 21072 year = {1907} 21073} 21074 21075@Article{ riesz1907, 21076 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 21077 author = {Frigyes Riesz}, 21078 journal = {C. R. Acad. Sci. Paris}, 21079 volume = {144}, 21080 pages = {1409--1411}, 21081 year = {1907} 21082} 21083 21084@Article{ riesz1909, 21085 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 21086 author = {Frigyes Riesz}, 21087 journal = {C. R. Acad. Sci. Paris}, 21088 volume = {149}, 21089 pages = {974--977}, 21090 year = {1909} 21091} 21092 21093@Misc{ rieszmarkovkakutanirepresentationtheorem, 21094 author = {Wikipedia}, 21095 title = {Riesz-Markov-Kakutani Representation Theorem}, 21096 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 21097 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 21098 year = {2015} 21099} 21100 21101@Article{ markov1938, 21102 title = {On mean values and exterior densities}, 21103 author = {Andrey Markov}, 21104 journal = {Rec. Math. Moscou}, 21105 volume = {4}, 21106 pages = {165--190}, 21107 year = {1938} 21108} 21109 21110@Article{ kakutani1941, 21111 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 21112 space of continuous functions.)}, 21113 author = {Shizuo Kakutani}, 21114 journal = {Ann. of Math.}, 21115 volume = {2}, 21116 number = {42}, 21117 pages = {994--1024}, 21118 doi = {10.2307/1968778}, 21119 year = {1941} 21120} 21121 21122@Article{ michoskimeyersonisaacwaelbroeck2014, 21123 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 21124 tokamaks}, 21125 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 21126 journal = {Journal of Computational Physics}, 21127 volume = {274}, 21128 pages = {898--919}, 21129 year = {2014}, 21130 publisher = {Elsevier} 21131} 21132 21133@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 21134 title = {Extreme-scale AMR}, 21135 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 21136 Stadler and Tim Warburton and Lucas Wilcox}, 21137 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 21138 Computing, Networking, Storage and Analysis}, 21139 pages = {1--12}, 21140 year = {2010}, 21141 organization = {IEEE Computer Society}, 21142 doi = {10.1109/SC.2010.25} 21143} 21144 21145@InProceedings{ isaacbursteddeghattas2012, 21146 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 21147 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 21148 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 21149 International}, 21150 pages = {426--437}, 21151 year = {2012}, 21152 organization = {IEEE}, 21153 doi = {10.1109/IPDPS.2012.47} 21154} 21155 21156@Article{ isaacpetrastadlerghattas2015, 21157 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 21158 through inference to prediction for large-scale problems, with application to flow 21159 of the {Antarctic} ice sheet}, 21160 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 21161 journal = {Journal of Computational Physics}, 21162 volume = {296}, 21163 pages = {348--368}, 21164 year = {2015}, 21165 publisher = {Elsevier}, 21166 doi = {10.1016/j.jcp.2015.04.047} 21167} 21168 21169@Article{ isaacbursteddewilcoxghattas2015, 21170 title = {Recursive Algorithms for Distributed Forests of Octrees}, 21171 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 21172 journal = {SIAM Journal on Scientific Computing}, 21173 volume = {37}, 21174 number = {5}, 21175 pages = {C497-C531}, 21176 eprint = {1406.0089}, 21177 eprinttype = {arXiv}, 21178 year = {2015}, 21179 doi = {10.1137/140970963} 21180} 21181 21182@Article{ isaacstadlerghattas2015, 21183 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 21184 elements on nonconforming and anisotropic meshes, with application to ice sheet 21185 dynamics}, 21186 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 21187 journal = {SIAM Journal on Scientific Computing}, 21188 number = {6}, 21189 pages = {804--833}, 21190 volume = {37}, 21191 year = {2015}, 21192 doi = {10.1137/140974407} 21193} 21194 21195@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 21196 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 21197 earth's mantle}, 21198 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 21199 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 21200 Alessandro Curioni and Omar Ghattas}, 21201 booktitle = {Proceedings of the International Conference for High Performance Computing, 21202 Networking, Storage and Analysis}, 21203 pages = {5}, 21204 year = {2015}, 21205 organization = {ACM}, 21206 doi = {10.1145/2807591.2807675} 21207} 21208 21209@Article{ bunchhopcroft1974, 21210 title = {Triangular factorization and inversion by fast matrix multiplication}, 21211 author = {James R Bunch and John E Hopcroft}, 21212 journal = {Mathematics of Computation}, 21213 volume = {28}, 21214 number = {125}, 21215 pages = {231--236}, 21216 doi = {10.2307/2005828}, 21217 year = {1974} 21218} 21219 21220@Article{ nemirovsky1991, 21221 title = {On optimality of Krylov's information when solving linear operator equations}, 21222 author = {A.S Nemirovsky}, 21223 journal = {Journal of Complexity}, 21224 volume = {7}, 21225 number = {2}, 21226 pages = {121--130}, 21227 doi = {10.1016/0885-064X(91)90001-E}, 21228 year = {1991} 21229} 21230 21231@Misc{siamcseprize, 21232 author = {{PETSc Team}}, 21233 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21234 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21235 url = {https://www.siam.org/prizes/sponsored/cse.php}, 21236 year = {2015} 21237} 21238 21239@Article{ rathgeber2017, 21240 title = {Firedrake: automating the finite element method by composing abstractions}, 21241 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 21242 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 21243 Graham R and Kelly, Paul HJ}, 21244 archiveprefix = {arXiv}, 21245 journal = {ACM Transaction on Mathematical Software}, 21246 eprint = {1501.01809}, 21247 volume = {43}, 21248 issue = {3}, 21249 number = {24}, 21250 year = {2017}, 21251 url = {http://arxiv.org/abs/1501.01809} 21252} 21253 21254@Article{ kirby2006b, 21255 title = {Topological optimization of the evaluation of finite element matrices}, 21256 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 21257 journal = {SIAM Journal on Scientific Computing}, 21258 volume = {28}, 21259 number = {1}, 21260 pages = {224--240}, 21261 year = {2006}, 21262 publisher = {SIAM} 21263} 21264 21265@Article{ luporini2015, 21266 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 21267 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 21268 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 21269 Assembly}, 21270 journal = {ACM Trans. Archit. Code Optim.}, 21271 issue_date = {January 2015}, 21272 volume = {11}, 21273 number = {4}, 21274 month = jan, 21275 year = {2015}, 21276 issn = {1544-3566}, 21277 pages = {57:1--57:25}, 21278 articleno = {57}, 21279 numpages = {25}, 21280 doi = {10.1145/2687415}, 21281 acmid = {2687415}, 21282 publisher = {ACM}, 21283 address = {New York, NY, USA}, 21284 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 21285 optimizations} 21286} 21287 21288@Article{ markall2012, 21289 title = {Finite element assembly strategies on multi- and many-core architectures}, 21290 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 21291 C. D. and Sherwin, S. J.}, 21292 journal = {International Journal for Numerical Methods in Fluids}, 21293 year = {2013}, 21294 volume = {71}, 21295 pages = {80--97}, 21296 doi = {10.1002/fld.3648} 21297} 21298 21299@Article{ markall2010, 21300 title = {Towards generating optimised finite element solvers for GPUs from high-level 21301 specifications}, 21302 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 21303 journal = {Procedia Computer Science}, 21304 volume = {1}, 21305 number = {1}, 21306 pages = {1815--1823}, 21307 year = {2010}, 21308 note = {{ICCS} 2010}, 21309 doi = {10.1016/j.procs.2010.04.203} 21310} 21311 21312@Article{ longkirbywaanders2010, 21313 title = {Unified embedded parallel finite element computations via software-based 21314 Fr{\'e}chet differentiation}, 21315 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 21316 journal = {SIAM Journal on Scientific Computing}, 21317 volume = {32}, 21318 number = {6}, 21319 pages = {3323--3351}, 21320 year = {2010}, 21321 publisher = {SIAM} 21322} 21323 21324@Article{ kirby2010, 21325 title = {From functional analysis to iterative methods}, 21326 author = {Robert C Kirby}, 21327 journal = {SIAM review}, 21328 volume = {52}, 21329 number = {2}, 21330 pages = {269--293}, 21331 year = {2010}, 21332 publisher = {SIAM} 21333} 21334 21335@Article{ kirby2014, 21336 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 21337 author = {Robert C Kirby}, 21338 journal = {SIAM Journal on Scientific Computing}, 21339 volume = {36}, 21340 number = {2}, 21341 pages = {A846--A868}, 21342 year = {2014}, 21343 publisher = {SIAM} 21344} 21345 21346@Article{ kirby2011, 21347 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 21348 author = {Robert C Kirby}, 21349 journal = {Numerische Mathematik}, 21350 volume = {117}, 21351 number = {4}, 21352 pages = {631--652}, 21353 year = {2011}, 21354 publisher = {Springer} 21355} 21356 21357@Article{ arnoldfalkwinther2006, 21358 title = {Finite element exterior calculus, homological techniques, and applications}, 21359 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 21360 journal = {Acta numerica}, 21361 volume = {15}, 21362 pages = {1--155}, 21363 year = {2006}, 21364 publisher = {Cambridge Univ Press} 21365} 21366 21367@Article{ arnoldlogg2014, 21368 title = {Periodic table of the finite elements}, 21369 author = {Douglas Arnold and Anders Logg}, 21370 month = nov, 21371 journal = {SIAM News}, 21372 year = {2014} 21373} 21374 21375@Article{ janssonhoffmanjansson2012, 21376 title = {Framework for massively parallel adaptive finite element computational fluid 21377 dynamics on tetrahedral meshes}, 21378 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 21379 journal = {SIAM Journal on Scientific Computing}, 21380 volume = {34}, 21381 number = {1}, 21382 pages = {C24--C41}, 21383 year = {2012}, 21384 publisher = {SIAM} 21385} 21386 21387@Article{ rogneshamcottermcrae2013, 21388 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 21389 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 21390 journal = {Geoscientific Model Development}, 21391 volume = {6}, 21392 number = {6}, 21393 pages = {2099--2119}, 21394 year = {2013}, 21395 publisher = {Copernicus GmbH} 21396} 21397 21398@Book{ loggmardalwells2012, 21399 title = {Automated solution of differential equations by the finite element method: The 21400 {FEniCS} book}, 21401 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 21402 volume = {84}, 21403 year = {2012}, 21404 publisher = {Springer Science \& Business Media} 21405} 21406 21407@Article{ cotterkirby2014, 21408 title = {Mixed finite elements for global tide models}, 21409 author = {Colin J Cotter and Robert C Kirby}, 21410 archiveprefix = {arXiv}, 21411 journal = {Submitted}, 21412 eprint = {1410.0045}, 21413 year = {2014}, 21414 url = {http://arxiv.org/abs/1410.0045} 21415} 21416 21417@Article{ kirbykieu2015, 21418 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 21419 author = {Robert C Kirby and Thinh Tri Kieu}, 21420 journal = {Numerische Mathematik}, 21421 volume = {130}, 21422 number = {2}, 21423 pages = {257--291}, 21424 year = {2015}, 21425 publisher = {Springer} 21426} 21427 21428@Article{ brennankirby2015, 21429 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 21430 model}, 21431 author = {Brian Brennan and Robert C Kirby}, 21432 journal = {Submitted to Computers and Mathematics with Applications}, 21433 year = {2015} 21434} 21435 21436@Article{ howlekirbydillon2013, 21437 title = {Block preconditioners for coupled physics problems}, 21438 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 21439 journal = {SIAM Journal on Scientific Computing}, 21440 volume = {35}, 21441 number = {5}, 21442 pages = {S368--S385}, 21443 year = {2013}, 21444 publisher = {SIAM} 21445} 21446 21447@Book{ malekstrakos2014, 21448 title = {Preconditioning and the conjugate gradient method in the context of solving 21449 PDEs}, 21450 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 21451 volume = {1}, 21452 year = {2014}, 21453 publisher = {SIAM} 21454} 21455 21456@Article{ desturler1995, 21457 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 21458 distributed memory computers}, 21459 author = {E. de Sturler and H.A. van der Vorst}, 21460 journal = {Applied Numerical Mathematics}, 21461 volume = {18}, 21462 number = {4}, 21463 pages = {441--459}, 21464 year = {1995}, 21465 doi = {10.1016/0168-9274(95)00079-A} 21466} 21467 21468@Article{ velicmaymoresi2009, 21469 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 21470 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 21471 journal = {Journal of Mathematical Modelling and Algorithms}, 21472 volume = {8}, 21473 number = {3}, 21474 pages = {343--355}, 21475 year = {2009}, 21476 publisher = {Springer} 21477} 21478 21479@Article{ may2012, 21480 title = {Volume reconstruction of point cloud data sets derived from computational 21481 geodynamic simulations}, 21482 author = {May, DA}, 21483 journal = {Geochemistry, Geophysics, Geosystems}, 21484 volume = {13}, 21485 number = {5}, 21486 year = {2012}, 21487 publisher = {Wiley Online Library} 21488} 21489 21490@Article{ quenettehodkinson2010, 21491 title = {StgDomain--scalable parallel domain software components for particle-in-cell 21492 finite element methods}, 21493 author = {Quenette, Steve and Hodkinson, Luke}, 21494 journal = {Concurrency and Computation: Practice and Experience}, 21495 volume = {22}, 21496 number = {12}, 21497 pages = {1593--1603}, 21498 year = {2010}, 21499 publisher = {Wiley Online Library} 21500} 21501 21502@Book{ velic2005, 21503 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 21504 author = {Velic, Mirko}, 21505 year = {2005}, 21506 publisher = {Monash University} 21507} 21508 21509@Article{ velicknepleymay2016, 21510 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 21511 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 21512 note = {in preparation}, 21513 year = {2016} 21514} 21515 21516@Article{ traubwozniakowski1979, 21517 title = {Convergence and complexity of Newton iteration for operator equations}, 21518 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 21519 journal = {Journal of the ACM (JACM)}, 21520 volume = {26}, 21521 number = {2}, 21522 pages = {250--258}, 21523 year = {1979}, 21524 publisher = {ACM} 21525} 21526 21527@Article{ sterck2013, 21528 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 21529 author = {Hans De Sterck}, 21530 journal = {Numerical Linear Algebra with Applications}, 21531 volume = {20}, 21532 number = {3}, 21533 pages = {453--471}, 21534 year = {2013} 21535} 21536 21537@Article{ sterckwinlaw2015, 21538 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 21539 tensor approximation}, 21540 author = {Hans De Sterck and Manda Winlaw}, 21541 journal = {Numerical Linear Algebra with Applications}, 21542 volume = {22}, 21543 number = {3}, 21544 pages = {410--432}, 21545 year = {2015} 21546} 21547 21548@Article{ sterckhowse2015, 21549 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 21550 approximate {Tucker} tensor decompositions}, 21551 author = {Hans De Sterck and Alexander Howse}, 21552 journal = {SIAM Journal on Scientific Computing}, 21553 note = {submitted}, 21554 year = {2015} 21555} 21556 21557@Book{ ladevezesimmonds1999, 21558 title = {Nonlinear computational structural mechanics: {N}ew approaches and 21559 non-incremental methods of calculation}, 21560 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 21561 series = {{M}echanical {E}ngineering {S}eries}, 21562 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 21563 isbn = {9780387985947}, 21564 lccn = {98029990}, 21565 year = {1999}, 21566 publisher = {Springer} 21567} 21568 21569@InProceedings{ walkerwoodwardyang2010, 21570 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 21571 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 21572 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 21573 year = {2010} 21574} 21575 21576@Article{ lottwalkerwoodwardyang2012, 21577 title = {An accelerated {P}icard method for nonlinear systems related to variably 21578 saturated flow}, 21579 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 21580 journal = {Advances in Water Resources}, 21581 volume = {38}, 21582 number = {0}, 21583 pages = {92--101}, 21584 doi = {10.1016/j.advwatres.2011.12.013}, 21585 year = {2012} 21586} 21587 21588@TechReport{ mohrrude1998, 21589 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 21590 author = {Marcus Mohr and Ulrich R\"ude}, 21591 type = {Technical Report}, 21592 number = {394}, 21593 institution = {University of Augsburg}, 21594 year = {1998} 21595} 21596 21597@InProceedings{ mohr2000, 21598 title = {Low Communication Parallel Multigrid}, 21599 author = {Mohr, Marcus}, 21600 booktitle = {Euro-Par 2000 Parallel Processing}, 21601 pages = {806--814}, 21602 year = {2000}, 21603 organization = {Springer} 21604} 21605 21606@Article{ brandtdiskin1994, 21607 title = {Multigrid solvers on decomposed domains}, 21608 author = {Achi Brandt and Boris Diskin}, 21609 journal = {Contemporary Mathematics}, 21610 volume = {157}, 21611 year = {1994}, 21612 publisher = {AMERICAN MATHEMATICAL SOCIETY} 21613} 21614 21615@InProceedings{ prabhuetal2011, 21616 title = {A Survey of the Practice of Computational Science}, 21617 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 21618 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 21619 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 21620 David I.}, 21621 booktitle = {State of the Practice Reports}, 21622 series = {SC '11}, 21623 year = {2011}, 21624 isbn = {978-1-4503-1139-7}, 21625 location = {Seattle, Washington}, 21626 pages = {19:1--19:12}, 21627 articleno = {19}, 21628 numpages = {12}, 21629 doi = {10.1145/2063348.2063374}, 21630 acmid = {2063374}, 21631 publisher = {ACM}, 21632 address = {New York, NY, USA} 21633} 21634 21635@PhDThesis{ dinarthesis1979, 21636 title = {Fast methods for the numerical solution of boundary value problems}, 21637 author = {N. Dinar}, 21638 school = {Weizmann Institute of Science}, 21639 year = {1979} 21640} 21641 21642@Article{ thomasdiskinbrandt2001, 21643 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 21644 high Reynolds number wakes and boundary layers}, 21645 author = {James L Thomas and Boris Diskin and Achi Brandt}, 21646 journal = {Computers \& fluids}, 21647 volume = {30}, 21648 number = {7}, 21649 pages = {853--874}, 21650 year = {2001}, 21651 publisher = {Elsevier} 21652} 21653 21654@Article{ greenbaumptakstrakos1996, 21655 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 21656 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 21657 journal = {SIAM Journal on Matrix Analysis and Applications}, 21658 volume = {17}, 21659 number = {3}, 21660 pages = {465--469}, 21661 year = {1996}, 21662 publisher = {SIAM} 21663} 21664 21665@Article{ nangiapatankarbhalla2019, 21666 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 21667 density ratio multiphase flows}, 21668 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 21669 journal = {Journal of Computational Physics}, 21670 volume = {398}, 21671 pages = {108804}, 21672 year = {2019} 21673} 21674 21675@Article{ bhallanangiadafnakisbraccomattiazzo2019, 21676 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 21677 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 21678 library}, 21679 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 21680 Bracco and Giuliana Mattiazzo}, 21681 journal = {Applied Ocean Research}, 21682 note = {In press}, 21683 year = {2019} 21684} 21685 21686@Article{ bhallagriffithpatankardonev2013, 21687 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 21688 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 21689 Alexander Donev}, 21690 journal = {Journal of Chemical Physics}, 21691 volume = {139}, 21692 number = {21}, 21693 pages = {214112}, 21694 year = {2013} 21695} 21696 21697@Article{ bhallabalegriffithpatankar2014, 21698 title = {Fully resolved immersed electrohydrodynamics for particle motion, 21699 electrolocation, and self-propulsion}, 21700 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 21701 Patankar}, 21702 journal = {Journal of Computational Physics}, 21703 volume = {256}, 21704 pages = {88--108}, 21705 year = {2014} 21706} 21707 21708@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 21709 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 21710 multiblob approach}, 21711 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 21712 and Boyce E. Griffith and Alexander Donev}, 21713 journal = {Communications in Applied Mathematics and Computational Science}, 21714 volume = {11}, 21715 number = {2}, 21716 pages = {217--296}, 21717 year = {2016} 21718} 21719 21720@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 21721 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 21722 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 21723 P.J. Kahrilas and Neelesh A. Patankar}, 21724 journal = {Journal of Computational Physics}, 21725 volume = {298}, 21726 pages = {446--465}, 21727 year = {2015} 21728} 21729 21730@Article{ balenevelnbhallamaciverpatankar2015, 21731 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 21732 and vertebrates}, 21733 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 21734 A. Patankar}, 21735 journal = {PLoS Biology}, 21736 volume = {13}, 21737 number = {4}, 21738 pages = {1--22}, 21739 year = {2015} 21740} 21741 21742@Article{ balehaobhallapatankar2014, 21743 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 21744 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 21745 journal = {Proceedings of the National Academy of Sciences}, 21746 volume = {111}, 21747 number = {21}, 21748 pages = {7517--7521}, 21749 year = {2014} 21750} 21751 21752@Article{ bhallabalegriffithpatankar2013, 21753 title = {A unified mathematical framework and an adaptive numerical method for 21754 fluid--structure interaction with rigid, deforming, and elastic bodies}, 21755 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 21756 Patankar}, 21757 journal = {Journal of Computational Physics}, 21758 volume = {250}, 21759 pages = {446--476}, 21760 year = {2013}, 21761 publisher = {Elsevier} 21762} 21763 21764@Article{ takeikatz2013, 21765 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 21766 Governing equations and linearized analysis}, 21767 author = {Yasuko Takei and Richard F. Katz}, 21768 journal = {Journal of Fluid Mechanics}, 21769 volume = {734}, 21770 issn = {1469-7645}, 21771 pages = {424--455}, 21772 numpages = {32}, 21773 doi = {10.1017/jfm.2013.482}, 21774 month = nov, 21775 year = {2013} 21776} 21777 21778@Misc{ stewart2011, 21779 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 21780 author = {G. W. Stewart}, 21781 note = {Translated with commentary by G. W. Stewart}, 21782 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 21783 year = {2011} 21784} 21785 21786@Article{ douglisnirenberg1955, 21787 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 21788 author = {Avron Douglis and Louis Nirenberg}, 21789 journal = {Communications on Pure and Applied Mathematics}, 21790 volume = {8}, 21791 pages = {503--538}, 21792 year = {1955} 21793} 21794 21795@Article{ gorelickgalunsharonbasribrandt2006, 21796 title = {Shape Representation and Classification Using the Poisson Equation}, 21797 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 21798 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 21799 volume = {28}, 21800 number = {12}, 21801 pages = {1991--2005}, 21802 year = {2006} 21803} 21804 21805@Article{ salsbury2006, 21806 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 21807 solvation energies}, 21808 author = {Freddie R. Salsbury Jr.}, 21809 journal = {Molecular Physics}, 21810 volume = {104}, 21811 number = {08}, 21812 pages = {1299--1309}, 21813 year = {2006} 21814} 21815 21816@Article{ sigalov2006, 21817 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 21818 approximation}, 21819 author = {G. Sigalov and A. Fenley and A. Onufriev}, 21820 journal = {Journal of Chemical Physics}, 21821 volume = {124}, 21822 number = {124902}, 21823 year = {2006} 21824} 21825 21826@Article{ dennard1974, 21827 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 21828 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 21829 Andre R LeBlanc}, 21830 journal = {IEEE Journal of Solid-State Circuits}, 21831 volume = {9}, 21832 number = {5}, 21833 pages = {256--268}, 21834 year = {1974} 21835} 21836 21837@Article{ zeegeijn2015, 21838 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 21839 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 21840 journal = {ACM Transactions on Mathematical Software}, 21841 volume = {41}, 21842 number = {3}, 21843 pages = {14:1--14:33}, 21844 month = jun, 21845 year = {2015}, 21846 issue_date = {jun}, 21847 doi = {10.1145/2764454} 21848} 21849 21850@Article{ campbell1976, 21851 title = {Assessing the Impact of Planned Social Change}, 21852 author = {Donald T. Campbell}, 21853 journal = {Occasional Paper Series, The Public Affairs Center}, 21854 number = {8}, 21855 publisher = {Dartmouth College}, 21856 year = {1976} 21857} 21858 21859@Article{ smaldinomcelreath2016, 21860 title = {The natural selection of bad science}, 21861 author = {Paul E. Smaldino and Richard McElreath}, 21862 journal = {Royal Society Open Science}, 21863 volume = {3}, 21864 number = {9}, 21865 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 21866 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 21867 doi = {10.1098/rsos.160384}, 21868 year = {2016}, 21869 publisher = {The Royal Society} 21870} 21871 21872@Article{ harlowwelch1965, 21873 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 21874 free surface}, 21875 author = {Francis H Harlow and J Eddie Welch}, 21876 journal = {Physics of fluids}, 21877 volume = {8}, 21878 number = {12}, 21879 pages = {2182--2189}, 21880 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 21881 year = {1965} 21882} 21883 21884@Article{ diskinthomasmineck2005, 21885 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 21886 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 21887 journal = {SIAM Journal on Scientific Computing}, 21888 volume = {27}, 21889 number = {1}, 21890 pages = {108--129}, 21891 doi = {10.1137/030601521}, 21892 issn = {1064-8275}, 21893 year = {2005} 21894} 21895 21896@TechReport{ scott2012, 21897 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 21898 Computer Science}, 21899 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 21900 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 21901 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 21902 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 21903 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 21904 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 21905 Yuen}, 21906 institution = {University of Chicago}, 21907 number = {2012-02}, 21908 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 21909 year = {2012} 21910} 21911 21912@Article{ roth2010, 21913 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 21914 author = {Roland Roth}, 21915 journal = {J. Phys. Cond. Mat.}, 21916 volume = {22}, 21917 pages = {063102}, 21918 year = {2010} 21919} 21920 21921@Article{ wu2008, 21922 title = {Density functional theory for liquid structure and thermodynamics}, 21923 author = {J. Z. Wu}, 21924 journal = {Struct. Bond.}, 21925 doi = {10.1007/430_2008_3}, 21926 year = {2008} 21927} 21928 21929@Article{ goel2008, 21930 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 21931 by {Monte Carlo} simulations and density functional theory}, 21932 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 21933 journal = {J. Chem. Phys.}, 21934 volume = {129}, 21935 pages = {154707}, 21936 year = {2008} 21937} 21938 21939@Article{ marchxiaoyubiros2015, 21940 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 21941 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 21942 journal = {SIAM Journal on Scientific Computing (to appear)}, 21943 year = {2015} 21944} 21945 21946@InProceedings{ yangduraiswamigumerovdavis2003, 21947 title = {Improved fast gauss transform and efficient kernel density estimation}, 21948 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 21949 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 21950 pages = {664--671}, 21951 year = {2003}, 21952 organization = {IEEE} 21953} 21954 21955@Article{ fornberglarssonflyer2011, 21956 title = {Stable computations with Gaussian radial basis functions}, 21957 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 21958 journal = {SIAM Journal on Scientific Computing}, 21959 volume = {33}, 21960 number = {2}, 21961 pages = {869--892}, 21962 year = {2011}, 21963 publisher = {SIAM} 21964} 21965 21966@InProceedings{ srinivasanqiduraiswami2010, 21967 title = {GPUML: Graphical processors for speeding up kernel machines}, 21968 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 21969 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 21970 Implementations, and Applications}, 21971 year = {2010} 21972} 21973 21974@Article{ jadamecbillen2010, 21975 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 21976 a slab edge}, 21977 author = {Margarete A Jadamec and Magali I Billen}, 21978 journal = {Nature}, 21979 volume = {465}, 21980 number = {7296}, 21981 pages = {338--341}, 21982 year = {2010} 21983} 21984 21985@Article{ jadamecbillen2012, 21986 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 21987 numerical models of the Alaska slab edge}, 21988 author = {Margarete A Jadamec and Magali I Billen}, 21989 journal = {Journal of Geophysical Research: Solid Earth}, 21990 volume = {117}, 21991 number = {B2}, 21992 year = {2012} 21993} 21994 21995@Article{ jadamec2015, 21996 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 21997 author = {Margarete A Jadamec}, 21998 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 21999 volume = {211}, 22000 pages = {135}, 22001 year = {2015} 22002} 22003 22004@Article{ durancejadamecfalloonnicholls2012, 22005 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 22006 olivine-hosted melt inclusions and geochemical modelling with insights from 22007 geodynamic models}, 22008 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 22009 journal = {Australian Journal of Earth Sciences}, 22010 volume = {59}, 22011 number = {6}, 22012 pages = {913--931}, 22013 year = {2012} 22014} 22015 22016@Article{ sharplesmoresijadamecrevote2015, 22017 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 22018 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 22019 journal = {Journal of Geophysical Research: Solid Earth}, 22020 volume = {120}, 22021 number = {6}, 22022 pages = {4379--4404}, 22023 year = {2015} 22024} 22025 22026@Article{ hayniejadamec2017, 22027 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 22028 geodynamic models}, 22029 author = {Kirstie L Haynie and Margarete A Jadamec}, 22030 journal = {Tectonics}, 22031 note = {in review}, 22032 year = {2017} 22033} 22034 22035@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 22036 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 22037 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 22038 Lithgow-Bertelloni and Wenbo Xu}, 22039 journal = {Geophysical Journal International}, 22040 volume = {179}, 22041 number = {2}, 22042 pages = {1169--1185}, 22043 year = {2009} 22044} 22045 22046@Article{ zhong2006, 22047 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 22048 plume excess temperature, and upper mantle temperature}, 22049 author = {Shijie Zhong}, 22050 journal = {Journal of Geophysical Research: Solid Earth}, 22051 volume = {111}, 22052 number = {B4}, 22053 year = {2006} 22054} 22055 22056@Article{ billenhirth2007, 22057 title = {Rheologic controls on slab dynamics}, 22058 author = {Magali I Billen and Greg Hirth}, 22059 journal = {Geochemistry, Geophysics, Geosystems}, 22060 volume = {8}, 22061 number = {8}, 22062 year = {2007} 22063} 22064 22065@Article{ hirthkohlstedt2003, 22066 title = {Rheology of the upper mantle and the mantle wedge: A view from the 22067 experimentalists}, 22068 author = {Greg Hirth and David Kohlstedt}, 22069 journal = {Inside the subduction Factory}, 22070 pages = {83--105}, 22071 year = {2003} 22072} 22073 22074@Article{ longsilver2008, 22075 title = {The subduction zone flow field from seismic anisotropy: A global view}, 22076 author = {Maureen D Long and Paul G Silver}, 22077 journal = {science}, 22078 volume = {319}, 22079 number = {5861}, 22080 pages = {315--318}, 22081 year = {2008} 22082} 22083 22084@Article{ karatowu1993, 22085 title = {Rheology of the upper mantle: A synthesis}, 22086 author = {Shun-ichiro Karato and Patrick Wu}, 22087 journal = {Science}, 22088 volume = {260}, 22089 number = {5109}, 22090 pages = {771--778}, 22091 year = {1993} 22092} 22093 22094@Article{ long2013mantle, 22095 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 22096 for wedge processes}, 22097 author = {Long, Maureen D and Wirth, Erin A}, 22098 journal = {Journal of Geophysical Research: Solid Earth}, 22099 volume = {118}, 22100 number = {2}, 22101 pages = {583--606}, 22102 year = {2013}, 22103 publisher = {Wiley Online Library} 22104} 22105 22106@Article{ hoernle2008arc, 22107 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 22108 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 22109 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 22110 Alvarado, Guillermo and Protti, Marino and others}, 22111 journal = {Nature}, 22112 volume = {451}, 22113 number = {7182}, 22114 pages = {1094--1097}, 22115 year = {2008}, 22116 publisher = {Nature Publishing Group} 22117} 22118 22119@Article{ savage1999, 22120 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 22121 splitting?}, 22122 author = {MK Savage}, 22123 journal = {Reviews of Geophysics}, 22124 volume = {37}, 22125 number = {1}, 22126 pages = {65--106}, 22127 year = {1999} 22128} 22129 22130@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 22131 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 22132 of airborne contaminants}, 22133 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 22134 Omar Ghattas and Bart Van Bloemen Waanders}, 22135 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 22136 pages = {43}, 22137 year = {2005}, 22138 organization = {IEEE Computer Society} 22139} 22140 22141@Article{ draganescusoane2013, 22142 title = {Multigrid solution of a distributed optimal control problem constrained by the 22143 {Stokes} equations}, 22144 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 22145 journal = {Applied Mathematics and Computation}, 22146 volume = {219}, 22147 number = {10}, 22148 pages = {5622--5634}, 22149 year = {2013} 22150} 22151 22152@Article{ zhonggurnis1995, 22153 title = {Mantle convection with plates and mobile, faulted plate margins}, 22154 author = {Shijie Zhong and Michael Gurnis}, 22155 journal = {Science}, 22156 volume = {267}, 22157 number = {5199}, 22158 pages = {838}, 22159 year = {1995} 22160} 22161 22162@Article{ studerbobinchahidmousavicandesdahan2012, 22163 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 22164 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 22165 and Emmanuel Candes and Maxime Dahan}, 22166 journal = {Proceedings of the National Academy of Sciences}, 22167 volume = {109}, 22168 number = {26}, 22169 pages = {E1679--E1687}, 22170 year = {2012} 22171} 22172 22173@Article{ borsukhigdonstowreckhow2001, 22174 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 22175 matter loading in estuaries and coastal zones}, 22176 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 22177 journal = {Ecological Modelling}, 22178 volume = {143}, 22179 number = {3}, 22180 pages = {165--181}, 22181 year = {2001} 22182} 22183 22184@Article{ liebermanwillcox2012, 22185 title = {Goal-oriented inference: Approach, linear theory, and application to advection 22186 diffusion}, 22187 author = {Chad Lieberman and Karen Willcox}, 22188 journal = {SIAM Journal on Scientific Computing}, 22189 volume = {34}, 22190 number = {4}, 22191 pages = {A1880--A1904}, 22192 year = {2012} 22193} 22194 22195@Article{ chaillatbiros2012, 22196 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 22197 frequencies and multiple sources for the scalar {Helmholtz} equation}, 22198 author = {St{\'e}phanie Chaillat and George Biros}, 22199 journal = {Journal of Computational Physics}, 22200 volume = {231}, 22201 number = {12}, 22202 pages = {4403--4421}, 22203 year = {2012} 22204} 22205 22206@Article{ farhattezaurdjellouli2002, 22207 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 22208 problems by a regularized {Newton} method}, 22209 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 22210 journal = {Inverse problems}, 22211 volume = {18}, 22212 number = {5}, 22213 pages = {1229}, 22214 year = {2002} 22215} 22216 22217@Article{ orozcoghattas1992, 22218 title = {Massively parallel aerodynamic shape optimization}, 22219 author = {Orozco, Carlos E and Ghattas, ON}, 22220 journal = {Computing Systems in Engineering}, 22221 volume = {3}, 22222 number = {1-4}, 22223 pages = {311--320}, 22224 year = {1992} 22225} 22226 22227@Article{ reutheralonsorimlingerjameson1999, 22228 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 22229 adjoint formulation on distributed memory parallel computers}, 22230 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 22231 journal = {Computers \& fluids}, 22232 volume = {28}, 22233 number = {4}, 22234 pages = {675--700}, 22235 year = {1999} 22236} 22237 22238@Article{ rudistadlerghattas2016, 22239 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 22240 Heterogeneous Viscosity}, 22241 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 22242 journal = {ArXiv e-prints}, 22243 archiveprefix = {arXiv}, 22244 primaryclass = {math.NA}, 22245 eprint = {1607.03936}, 22246 month = jul, 22247 year = {2016} 22248} 22249 22250@Article{ borzikunisch2006, 22251 title = {A globalization strategy for the multigrid solution of elliptic optimal control 22252 problems}, 22253 author = {Borzi, A and Kunisch, K}, 22254 journal = {Optimisation Methods and Software}, 22255 volume = {21}, 22256 number = {3}, 22257 pages = {445--459}, 22258 year = {2006} 22259} 22260 22261@Article{ nash2000, 22262 title = {A multigrid approach to discretized optimization problems}, 22263 author = {Stephen G Nash}, 22264 journal = {Optimization Methods and Software}, 22265 volume = {14}, 22266 number = {1-2}, 22267 pages = {99--116}, 22268 year = {2000} 22269} 22270 22271@Article{ jameson1983, 22272 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 22273 method}, 22274 author = {Antony Jameson}, 22275 journal = {Applied mathematics and computation}, 22276 volume = {13}, 22277 number = {3-4}, 22278 pages = {327--355}, 22279 year = {1983} 22280} 22281 22282@Article{ billen2008, 22283 title = {Modeling the dynamics of subducting slabs}, 22284 author = {Magali I Billen}, 22285 journal = {Annu. Rev. Earth Planet. Sci.}, 22286 volume = {36}, 22287 pages = {325--356}, 22288 year = {2008} 22289} 22290 22291@Article{ gerya2011, 22292 title = {Future directions in subduction modeling}, 22293 author = {Taras Gerya}, 22294 journal = {Journal of Geodynamics}, 22295 volume = {52}, 22296 number = {5}, 22297 pages = {344--378}, 22298 year = {2011} 22299} 22300 22301@Article{ tackley2000, 22302 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 22303 theory}, 22304 author = {Paul J Tackley}, 22305 journal = {Science}, 22306 volume = {288}, 22307 number = {5473}, 22308 pages = {2002--2007}, 22309 year = {2000} 22310} 22311 22312@Article{ caseydewey1984, 22313 title = {Initiation of subduction zones along transform and accreting plate boundaries, 22314 triple-junction evolution, and forearc spreading centres—implications for 22315 ophiolitic geology and obduction}, 22316 author = {JF Casey and JF Dewey}, 22317 journal = {Geological Society, London, Special Publications}, 22318 volume = {13}, 22319 number = {1}, 22320 pages = {269--290}, 22321 year = {1984} 22322} 22323 22324@Article{ doughertyclayton2014, 22325 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 22326 in the {South Cocos} plate}, 22327 author = {Sara L Dougherty and Robert W Clayton}, 22328 journal = {Journal of Geophysical Research: Solid Earth}, 22329 volume = {119}, 22330 number = {4}, 22331 pages = {3424--3447}, 22332 year = {2014} 22333} 22334 22335@Article{ syracusemaceiraprietozhangammon2016, 22336 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 22337 velocity from the joint inversion of seismic and gravity data}, 22338 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 22339 Charles J Ammon}, 22340 journal = {Earth and Planetary Science Letters}, 22341 volume = {444}, 22342 pages = {139--149}, 22343 year = {2016} 22344} 22345 22346@Article{ bowergurnisflament2015, 22347 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 22348 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 22349 journal = {Physics of the Earth and Planetary Interiors}, 22350 volume = {238}, 22351 pages = {8--22}, 22352 year = {2015} 22353} 22354 22355@Book{ ciarlet1976, 22356 title = {Numerical analysis of the finite element method}, 22357 author = {Philippe G Ciarlet}, 22358 volume = {59}, 22359 year = {1976}, 22360 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 22361} 22362 22363@InProceedings{ liumellorcrummey2013, 22364 title = {A data-centric profiler for parallel programs}, 22365 author = {Xu Liu and John Mellor-Crummey}, 22366 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 22367 Storage and Analysis (SC)}, 22368 pages = {1--12}, 22369 year = {2013}, 22370 organization = {IEEE} 22371} 22372 22373@InCollection{ ernstgander2012, 22374 title = {Why it is difficult to solve Helmholtz problems with classical iterative 22375 methods}, 22376 author = {Oliver G Ernst and Martin J Gander}, 22377 booktitle = {Numerical analysis of multiscale problems}, 22378 pages = {325--363}, 22379 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 22380 year = {2012} 22381} 22382 22383@Article{ warburtonkarniadakis1999, 22384 title = {A discontinuous {G}alerkin method for the viscous {MHD} equations}, 22385 author = {Timothy C Warburton and George E Karniadakis}, 22386 journal = {Journal of Computational Physics}, 22387 volume = {152}, 22388 number = {2}, 22389 pages = {608--641}, 22390 year = {1999} 22391} 22392 22393@Article{ salahsoulaimanihabashi2001, 22394 title = {A finite element method for magnetohydrodynamics}, 22395 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 22396 journal = {Computer Methods in Applied Mechanics and Engineering}, 22397 volume = {43}, 22398 number = {190}, 22399 pages = {5867--5892}, 22400 year = {2001} 22401} 22402 22403@Article{ nesliturktezersezgin2005, 22404 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 22405 author = {Ali I Nesliturk and M Tezer-Sezgin}, 22406 journal = {Computer methods in applied mechanics and engineering}, 22407 volume = {194}, 22408 number = {9}, 22409 pages = {1201--1224}, 22410 year = {2005} 22411} 22412 22413@Article{ strakschellart2016, 22414 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 22415 Upwellings: Insights from Analog Models}, 22416 author = {Vincent Strak and Wouter P Schellart}, 22417 journal = {Journal of Geophysical Research: Solid Earth}, 22418 year = {2016} 22419} 22420 22421@InBook{ kirbyloggrognesterrel2012, 22422 title = {Common and unusual finite elements}, 22423 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 22424 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22425 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22426 {FEniCS} Book}, 22427 publisher = {Springer Berlin Heidelberg}, 22428 address = {Berlin, Heidelberg}, 22429 pages = {95--119}, 22430 isbn = {978-3-642-23099-8}, 22431 doi = {10.1007/978-3-642-23099-8_3}, 22432 year = {2012} 22433} 22434 22435@InBook{ kirbymardal2012, 22436 author = {Robert C. Kirby and Kent-Andre Mardal}, 22437 title = {Constructing general reference finite elements}, 22438 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22439 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22440 {FEniCS} Book}, 22441 publisher = {Springer Berlin Heidelberg}, 22442 address = {Berlin, Heidelberg}, 22443 pages = {121--132}, 22444 isbn = {978-3-642-23099-8}, 22445 doi = {10.1007/978-3-642-23099-8_4}, 22446 year = {2012} 22447} 22448 22449@Book{ wriggers2008, 22450 title = {Nonlinear finite element methods}, 22451 author = {Peter Wriggers}, 22452 publisher = {Springer Science \& Business Media}, 22453 year = {2008} 22454} 22455 22456@Book{ zienkiewicztaylor1977, 22457 title = {The finite element method}, 22458 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 22459 publisher = {McGraw-hill London}, 22460 volume = {3}, 22461 year = {1977} 22462} 22463 22464@Article{ rogneskirbylogg2009, 22465 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 22466 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 22467 journal = {SIAM Journal on Scientific Computing}, 22468 volume = {31}, 22469 number = {6}, 22470 pages = {4130--4151}, 22471 year = {2009} 22472} 22473 22474@Book{ kelley03, 22475 title = {Solving nonlinear equations with Newton's method}, 22476 author = {Carl T. Kelley}, 22477 publisher = {SIAM}, 22478 year = {2003} 22479} 22480 22481@Article{ turing1937, 22482 title = {The Chemical Basis of Morphogenesis}, 22483 author = {A. M. Turing}, 22484 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 22485 volume = {237}, 22486 number = {641}, 22487 pages = {37--72}, 22488 doi = {10.1098/rstb.1952.0012}, 22489 issn = {0080-4622}, 22490 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 22491 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 22492 year = {1952} 22493} 22494 22495@Article{ fabienknepleymillsriviere2017, 22496 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 22497 multigrid method}, 22498 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 22499 Rivi\`ere}, 22500 journal = {SIAM Journal on Scientific Computing}, 22501 url = {https://arxiv.org/abs/1705.09907}, 22502 volume = {41}, 22503 number = {2}, 22504 pages = {C73--C96}, 22505 doi = {10.1137/17M1128903}, 22506 year = {2018} 22507} 22508 22509@Article{ fabienknepleyriviere2018, 22510 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 22511 porous media}, 22512 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 22513 journal = {International Journal for Numerical Methods in Engineering}, 22514 volume = {116}, 22515 number = {3}, 22516 pages = {161--177}, 22517 doi = {10.1002/nme.5919}, 22518 year = {2018} 22519} 22520 22521@Article{ fabienknepleyriviere2020, 22522 title = {A high order hybridizable discontinuous Galerkin method for incompressible 22523 miscible displacement in heterogeneous media}, 22524 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22525 journal = {Results in Applied Mathematics}, 22526 url = {https://arxiv.org/abs/1809.00747}, 22527 volume = {8}, 22528 pages = {100089}, 22529 doi = {10.1016/j.rinam.2019.100089}, 22530 year = {2020} 22531} 22532 22533@Article{ fabienknepleyriviere2019b, 22534 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 22535 second order elliptic problems}, 22536 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22537 journal = {Journal of Numerical Mathematics}, 22538 volume = {28}, 22539 number = {3}, 22540 pages = {161--174}, 22541 doi = {10.1515/jnma-2019-0027}, 22542 year = {2019} 22543} 22544 22545@Article{ fabien2019, 22546 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 22547 Elasticity}, 22548 author = {Maurice S. Fabien}, 22549 journal = {Communications in Computational Physics}, 22550 volume = {27}, 22551 number = {2}, 22552 pages = {513--545}, 22553 issn = {1991-7120}, 22554 doi = {10.4208/cicp.OA-2018-0235}, 22555 year = {2019} 22556} 22557 22558@Unpublished{ awanoufabienguzmanstern2020, 22559 title = {Hybridization and postprocessing in finite element exterior calculus}, 22560 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 22561 eprint = {2008.00149}, 22562 note = {preprint}, 22563 primaryclass = {math.NA}, 22564 year = {2020} 22565} 22566 22567@Article{ chaabanegiraultrivierethompson2018, 22568 title = {A stable enriched {G}alerkin element for the {S}tokes problem}, 22569 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 22570 journal = {Applied Numerical Mathematics}, 22571 volume = {132}, 22572 pages = {1--21}, 22573 issn = {0168-9274}, 22574 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 22575 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 22576 year = {2018} 22577} 22578 22579@Article{ thompsonriviereknepley2018, 22580 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 22581 Resuscitation In The Small Intestine}, 22582 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 22583 journal = {Mathematical Medicine and Biology}, 22584 volume = {36}, 22585 number = {4}, 22586 pages = {513--548}, 22587 doi = {10.1093/imammb/dqz00}, 22588 year = {2019} 22589} 22590 22591@Article{ kevrekidisthompsongoriely2020, 22592 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 22593 Diseases}, 22594 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 22595 journal = {Physics Letters A}, 22596 volume = {384}, 22597 number = {36}, 22598 pages = {126935}, 22599 year = {2020} 22600} 22601 22602@Article{ mardalrognesthompson2021, 22603 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 22604 {Stokes-Biot} Stability Revisited}, 22605 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 22606 journal = {BIT Numerical Mathematics}, 22607 pages = {1--36}, 22608 year = {2021} 22609} 22610 22611@Article{ piersantileethompsonmardalrognes2021, 22612 title = {Parameter robust preconditioning by congruence for multiple-network 22613 poroelasticity}, 22614 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 22615 Rognes, Marie E}, 22616 journal = {SIAM Journal on Scientific Computing}, 22617 volume = {43}, 22618 number = {4}, 22619 pages = {B984--B1007}, 22620 year = {2021}, 22621 publisher = {SIAM} 22622} 22623 22624@Article{ walkerknepleyaagaardwilliams2023, 22625 title = {Multiphysics Modeling in {PyLith}: Poroelasticity}, 22626 author = {Robert L. Walker and Matthew G. Knepley and Brad T. Aagaard and Charles A. Williams}, 22627 journal = {Geophysical Journal International}, 22628 volume = {235}, 22629 number = {3}, 22630 pages = {2442--2475}, 22631 doi = {10.1093/gji/ggad370}, 22632 year = {2023} 22633} 22634 22635@InProceedings{ actorfuentesriviere2020b, 22636 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 22637 Level Set Equation and Deep Learning for Image Segmentation}, 22638 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22639 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 22640 year = {2020} 22641} 22642 22643@Article{ actorfuentesriviere2020, 22644 title = {Robust Regularized Networks in the Presence of Noise}, 22645 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22646 journal = {Medical Image Analysis}, 22647 note = {In revision}, 22648 year = {2020} 22649} 22650 22651@Book{ byerly1893, 22652 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 22653 ellipsoidal harmonics, with applications to problems in mathematical physics}, 22654 author = {William Elwood Byerly}, 22655 publisher = {Dover}, 22656 year = {1893} 22657} 22658 22659@Book{ hobson1931, 22660 title = {The theory of spherical and ellipsoidal harmonics}, 22661 author = {Ernest William Hobson}, 22662 year = {1931}, 22663 publisher = {CUP Archive} 22664} 22665 22666@Book{ dassios2012, 22667 title = {Ellipsoidal harmonics: theory and applications}, 22668 author = {George Dassios}, 22669 volume = {146}, 22670 year = {2012}, 22671 publisher = {Cambridge University Press} 22672} 22673 22674@Book{ miller1977, 22675 title = {Symmetry and separation of variables}, 22676 author = {Miller, Jr, Willard}, 22677 year = {1977}, 22678 address = {Reading, MA}, 22679 publisher = {Addison-Wesley Publishing Co., Inc.} 22680} 22681 22682@TechReport{ epanet-users-manual, 22683 author = {Lewis A. Rossman}, 22684 title = {{EPANET 2} Users Manual}, 22685 institution = {Water Supply and Water Resources Division, National Risk Management Research 22686 Laboratory, Cincinnati, OH 45268}, 22687 year = {2000} 22688} 22689 22690@Article{ klocknerbarnettgreengardoneil2013, 22691 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 22692 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 22693 O'Neil}, 22694 journal = {Journal of Computational Physics}, 22695 volume = {252}, 22696 pages = {332--349}, 22697 year = {2013} 22698} 22699 22700@Article{ turcksinkronbichlerbangerth2016, 22701 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 22702 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 22703 journal = {ACM Transactions on Mathematical Software)}, 22704 volume = {43}, 22705 number = {1}, 22706 pages = {2}, 22707 year = {2016} 22708} 22709 22710@Article{ vitushkin1954, 22711 title = {On {Hilbert's} thirteenth problem}, 22712 author = {A. G. Vitushkin}, 22713 journal = {Dokl. Akad. Nauk SSSR}, 22714 volume = {95}, 22715 pages = {701--704}, 22716 year = {1954} 22717} 22718 22719@Article{ kolmogorov1957, 22720 title = {On the representation of continuous functions of several variables as 22721 superpositions of continuous functions of one variable and addition}, 22722 author = {Andrei N. Kolmogorov}, 22723 journal = {Dokl. Akad. Nauk SSSR}, 22724 pages = {953--956}, 22725 volume = {114:5}, 22726 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 22727 year = {1957} 22728} 22729 22730@Article{ fridman1967, 22731 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 22732 Theorem}}, 22733 author = {B. L. Fridman}, 22734 journal = {Dokl. Akad. Nauk SSR}, 22735 volume = {177:5}, 22736 pages = {1019--1022}, 22737 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 22738 year = {1967} 22739} 22740 22741@Article{ sprecher1972, 22742 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 22743 author = {David Sprecher}, 22744 journal = {Journal of Mathematical Analysis and Applications}, 22745 volume = {38}, 22746 pages = {208--213}, 22747 year = {1972} 22748} 22749 22750@Article{ diaconisshahshahani1984, 22751 title = {On nonlinear functions of linear combinations}, 22752 author = {Persi Diaconis and Mehrdad Shahshahani}, 22753 journal = {SIAM Journal on Scientific and Statistical Computing}, 22754 volume = {5}, 22755 number = {1}, 22756 pages = {175--191}, 22757 year = {1984}, 22758 publisher = {SIAM} 22759} 22760 22761@InProceedings{ hechtnielsen1987, 22762 title = {Kolmogorov's mapping neural network existence theorem}, 22763 author = {R. Hecht-Nielsen}, 22764 booktitle = {Proceedings of the International Conference on Neural Networks}, 22765 volume = {III}, 22766 pages = {11--14}, 22767 publisher = {IEEE Press}, 22768 year = {1987} 22769} 22770 22771@InProceedings{ hechtnielsen1989, 22772 title = {Theory of the back-propagation neural network}, 22773 author = {R. Hecht-Nielsen}, 22774 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 22775 volume = {I}, 22776 pages = {593--608}, 22777 publisher = {IEEE Press}, 22778 year = {1989} 22779} 22780 22781@Article{ girosipoggio1989, 22782 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 22783 author = {Federico Girosi and Tomaso Poggio}, 22784 journal = {Neural Computation}, 22785 volume = {1}, 22786 number = {4}, 22787 pages = {465--469}, 22788 year = {1989}, 22789 publisher = {MIT Press} 22790} 22791 22792@InBook{ koppen2002, 22793 title = {On the Training of a Kolmogorov Network}, 22794 author = {Mario K\"oppen}, 22795 pages = {474--9}, 22796 publisher = {ICANN 2002, LNCS 2415}, 22797 year = {2002} 22798} 22799 22800@PhDThesis{ bryant2008, 22801 title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in 22802 applications with low and high dimensional data}, 22803 author = {Donald W Bryant}, 22804 school = {University of Central Florida}, 22805 year = {2008} 22806} 22807 22808@InCollection{ griebel2006, 22809 title = {Sparse Grids for Higher Dimensional Problems}, 22810 author = {Michael Griebel}, 22811 booktitle = {Foundations of Computational Mathematics}, 22812 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 22813 publisher = {Cambridge University Press}, 22814 pages = {106--161}, 22815 doi = {10.1017/CBO9780511721571.004}, 22816 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 22817 month = jun, 22818 day = {29}, 22819 year = {2006} 22820} 22821 22822@Article{ braungriebel2009, 22823 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 22824 author = {Jurgen Bra\"un and Michael Griebel}, 22825 journal = {Constructive Approximation}, 22826 pages = {653--675}, 22827 volume = {30}, 22828 year = {2009} 22829} 22830 22831@InProceedings{ lenifougerolletruchetet2009, 22832 title = {Kolmogorov superposition theorem and its application to wavelet image 22833 decompositions}, 22834 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 22835 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 22836 of the SPIE}, 22837 pages = {724804--724804}, 22838 doi = {10.1117/12.805916}, 22839 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 22840 year = {2009} 22841} 22842 22843@Article{ oseledets2011, 22844 title = {Tensor-train decomposition}, 22845 author = {Ivan V Oseledets}, 22846 journal = {SIAM Journal on Scientific Computing}, 22847 volume = {33}, 22848 number = {5}, 22849 pages = {2295--2317}, 22850 year = {2011} 22851} 22852 22853@PhDThesis{ liu2015, 22854 title = {Kolmogorov superposition theorem and its applications}, 22855 author = {Xing Liu}, 22856 school = {Imperial College London}, 22857 year = {2015} 22858} 22859 22860@Article{ lecunbengiohinton2015, 22861 title = {Deep learning}, 22862 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 22863 journal = {Nature}, 22864 volume = {521}, 22865 number = {7553}, 22866 pages = {436--444}, 22867 year = {2015} 22868} 22869 22870@Book{ trefethen2013, 22871 title = {Approximation theory and approximation practice}, 22872 author = {Lloyd N Trefethen}, 22873 publisher = {SIAM}, 22874 year = {2013} 22875} 22876 22877@Article{ butlergrahammattiswalsh2017, 22878 title = {A measure-theoretic interpretation of sample based numerical integration with 22879 applications to inverse and prediction problems under uncertainty}, 22880 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 22881 journal = {SIAM Journal on Scientific Computing}, 22882 volume = {39}, 22883 number = {5}, 22884 pages = {A2072--A2098}, 22885 year = {2017} 22886} 22887 22888@Article{ logg2009, 22889 title = {Efficient representation of computational meshes}, 22890 author = {Anders Logg}, 22891 journal = {International Journal of Computational Science and Engineering}, 22892 volume = {4}, 22893 number = {4}, 22894 pages = {283--295}, 22895 year = {2009} 22896} 22897 22898@Article{ agelekandersonbangerthbarth2017, 22899 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 22900 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 22901 journal = {ACM Transactions on Mathematical Software (TOMS)}, 22902 volume = {44}, 22903 number = {1}, 22904 pages = {5}, 22905 year = {2017} 22906} 22907 22908@Article{ actorknepley2018, 22909 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 22910 Superposition Theorem}}, 22911 author = {Jonas Actor and Matthew G. Knepley}, 22912 eprint = {1712.08286}, 22913 archiveprefix = {arXiv}, 22914 primaryclass = {math.na}, 22915 note = {\url{http://arxiv.org/abs/1712.08286}}, 22916 year = {2018} 22917} 22918 22919@Book{ driscollhaletrefethen2014, 22920 title = {Chebfun guide}, 22921 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 22922 publisher = {Pafnuty Publications, Oxford}, 22923 year = {2014} 22924} 22925 22926@Article{ johntobiska2000, 22927 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 22928 solution of the incompressible Navier-Stokes equations}, 22929 author = {Volker John and Lutz Tobiska}, 22930 journal = {International Journal for Numerical Methods in Fluids}, 22931 volume = {33}, 22932 number = {4}, 22933 pages = {453--473}, 22934 year = {2000} 22935} 22936 22937@Article{ vanka1986, 22938 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 22939 author = {S. P. Vanka}, 22940 journal = {Computer Methods in Applied Mechanics and Engineering}, 22941 volume = {59}, 22942 number = {1}, 22943 pages = {29--48}, 22944 year = {1986} 22945} 22946 22947@Article{ bartelgunther2018, 22948 author = {Andreas Bartel and Michael G\"unther}, 22949 title = {{PDAEs} in refined electrical network modeling}, 22950 journal = {SIAM Review}, 22951 volume = {60}, 22952 number = {1}, 22953 pages = {56--91}, 22954 doi = {10.1137/17M1113643}, 22955 year = {2018} 22956} 22957 22958@Article{ matpower, 22959 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 22960 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 22961 systems research and education}, 22962 journal = {IEEE Transactions on Power Systems}, 22963 volume = {26}, 22964 number = {1}, 22965 pages = {12--19}, 22966 year = {2011}, 22967 doi = {10.1109/TPWRS.2010.2051168} 22968} 22969 22970@Article{ betrieyan2018, 22971 author = {G. Betrie and E. Yan}, 22972 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 22973 Energy and Water Nexus}, 22974 journal = {Applied Energy, Submitted}, 22975 volume = {}, 22976 number = {}, 22977 pages = {}, 22978 doi = {}, 22979 year = {2018} 22980} 22981 22982@Article{ faeth2012, 22983 author = {P. Faeth}, 22984 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 22985 journal = {Environment: Science and Policy for Sustainable Development}, 22986 volume = {54(1)}, 22987 number = {1}, 22988 pages = {4--19}, 22989 year = {2012}, 22990 doi = {10.1080/00139157.2012.639595} 22991} 22992 22993@InProceedings{ hagberg2008, 22994 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 22995 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 22996 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 22997 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 22998 year = {2008}, 22999 pages = {11--15} 23000} 23001 23002@Misc{ simulink-web-page, 23003 author = {Mathworks}, 23004 title = {{SIMULINK} web page}, 23005 note = {\url{https://www.mathworks.com/products/simulink.html}}, 23006 year = {2017} 23007} 23008 23009@Misc{ labview-web-page, 23010 author = {National Instruments}, 23011 title = {{LabVIEW} web page}, 23012 note = {\url{http://www.ni.com/labview/}}, 23013 key = {labview}, 23014 year = {2017} 23015} 23016 23017@Misc{ modelica-web-page, 23018 author = {Modelica Association}, 23019 title = {Modelica web page}, 23020 note = {\url{https://www.modelica.org/}}, 23021 year = {2017} 23022} 23023 23024@InProceedings{ yangsc16, 23025 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 23026 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 23027 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 23028 Computing, Networking, Storage and Analysis}, 23029 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 23030 Dynamics}, 23031 note = {Gordon Bell Award}, 23032 year = {2016} 23033} 23034 23035@InProceedings{ bekassc15, 23036 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 23037 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 23038 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 23039 Computing, Networking, Storage and Analysis}, 23040 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 23041 Earth's Mantle}, 23042 note = {Gordon Bell Award}, 23043 year = {2015} 23044} 23045 23046@Misc{ improving-software-whitepaper2017, 23047 author = {M. Heroux and L.C. McInnes}, 23048 title = {Improving and accelerating scientific discovery through better software}, 23049 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 23050 doi = {10.6084/m9.figshare.5339692}, 23051 year = {2017} 23052} 23053 23054@Misc{ doe:40thanniversarycollection, 23055 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 23056 changed the face of science}, 23057 key = {Department of Energy, Office of Science}, 23058 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 23059 year = {2017} 23060} 23061 23062@Misc{ siam:fellowsprogram, 23063 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 23064 key = {SIAM}, 23065 howpublished = {\url{http://www.siam.org/prizes/fellows}} 23066} 23067 23068@Misc{ r-and-d100:awards2009, 23069 title = {{R\&D100 Award Winners 2009}}, 23070 key = {{R\&D100 Award Winners 2009}}, 23071 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 23072} 23073 23074@Misc{ xsdk:website, 23075 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 23076 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 23077 howpublished = {\url{https://xsdk.info}} 23078} 23079 23080@Misc{ xsdk-community-installation-policies2017, 23081 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 23082 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 23083 note = {version 0.3, November 7, 2017}, 23084 doi = {10.6084/m9.figshare.4495133}, 23085 year = {2017} 23086} 23087 23088@Misc{ xsdk-community-package-policies2017, 23089 title = {{xSDK} Community Package Policies}, 23090 author = {B. Smith and R. Bartlett and {xSDK developers}}, 23091 note = {version 0.3, November 7, 2017}, 23092 doi = {10.6084/m9.figshare.4495136}, 23093 year = {2017} 23094} 23095 23096@Misc{ ideas-what-are-interoperable-libraries, 23097 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 23098 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 23099 Ulrike Yang and {all xSDK developers}}, 23100 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 23101 \url{https://ideas-productivity.org/resources/howtos/}}, 23102 year = {2016} 23103} 23104 23105@Misc{ ideas-productivity:website, 23106 title = {{IDEAS Scientific Software Productivity Project}}, 23107 key = {IDEAS Scientific Software Productivity Project}, 23108 howpublished = {\url{https://ideas-productivity.org}} 23109} 23110 23111@Misc{ ecp:website, 23112 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 23113 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 23114 note = {\url{https://exascaleproject.org}}, 23115 year = {2018} 23116} 23117 23118@Misc{ siam-cse-jan2018, 23119 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 23120 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 23121 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 23122 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 23123 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 23124 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 23125 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 23126 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 23127 title = {Research and Education in Computational Science and Engineering}, 23128 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 23129 Review}}, 23130 year = {2018} 23131} 23132 23133@Misc{ doe-appliedmathpimeeting2017, 23134 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 23135 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 23136 Willcox and Steven Lee}, 23137 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 23138 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 23139 year = {2017} 23140} 23141 23142@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 23143 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 23144 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 23145 Sciences}}, 23146 note = {available via 23147 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 23148 year = {2015} 23149} 23150 23151@Misc{ sisc-specialissueintro, 23152 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 23153 Software'} and {'Big Data in CSE'}}, 23154 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 23155 month = nov, 23156 year = {2016}, 23157 journal = {SIAM J. Sci. Comput.}, 23158 doi = {10.1137/16N974188} 23159} 23160 23161@Article{ xsdk-foundations2017, 23162 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 23163 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 23164 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 23165 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 23166 journal = {Supercomputing Frontiers and Innovations}, 23167 month = feb, 23168 year = {2017}, 23169 note = {available via \url{https://arxiv.org/abs/1702.08425}} 23170} 23171 23172@Misc{ openfoam:website, 23173 title = {{OpenFOAM}}, 23174 author = {OpenFOAM Team}, 23175 key = {OpenFOAM}, 23176 howpublished = {\url{https://openfoam.com}} 23177} 23178 23179@Misc{ mfem:website, 23180 title = {{MFEM}}, 23181 author = {Tzanio Kolev and MFEM Team}, 23182 key = {MFEM}, 23183 howpublished = {\url{https://mfem.org}} 23184} 23185 23186@Misc{ deal.ii:website, 23187 title = {{{deal.II}: An open-source finite element library}}, 23188 author = {Wolfgang Bangerth and Deal.II Team}, 23189 howpublished = {\url{http://www.dealii.org}}, 23190 year = {2018} 23191} 23192 23193@Misc{ ibamr:website, 23194 title = {{{IBAMR}: Immersed Boundary Method Adaptive Mesh Refinement Software Infrastructure}}, 23195 author = {Boyce Griffith and IBAMR Team}, 23196 howpublished = {\url{https://ibamr.github.io/}}, 23197 year = {2023} 23198} 23199 23200@Misc{ fission-gas-scidac:website, 23201 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 23202 author = {A. David {Andersson (PI)}}, 23203 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 23204 year = {2018} 23205} 23206 23207@Misc{ tokamak-disruption-scidac:project, 23208 title = {{Tokamak Disruption Simulation}}, 23209 author = {Xianzhu {Tang (PI)}}, 23210 howpublished = {SciDAC project}, 23211 year = {2018} 23212} 23213 23214@InProceedings{ duplyakin2018memory, 23215 title = {Evaluating Active Learning with Cost and Memory Awareness}, 23216 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 23217 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 23218 pages = {214--223}, 23219 year = {2018}, 23220 organization = {IEEE}, 23221 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 23222} 23223 23224@InProceedings{ duplyakin2016active, 23225 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 23226 title = {Active Learning in Performance Analysis}, 23227 booktitle = {Proceedings of the IEEE Cluster Conference}, 23228 year = {2016}, 23229 month = sep, 23230 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 23231 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 23232} 23233 23234@Misc{ xgc1:website, 23235 title = {{XGC1 project website}}, 23236 author = {C. S. Chang and others}, 23237 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 23238 year = {2018} 23239} 23240 23241@Misc{ wdmapp-bhattacharjee-ecp:website, 23242 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 23243 Plasmas}}, 23244 author = {A. Bhattacharjee and others}, 23245 note = {ECP application project}, 23246 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 23247 year = {2018} 23248} 23249 23250@Misc{ subsurface-steefel-ecp:website, 23251 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 23252 and Mechanics}}, 23253 note = {ECP application project}, 23254 author = {C. Steefel and others}, 23255 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 23256 year = {2018} 23257} 23258 23259@Article{ chombo-crunch:2014, 23260 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 23261 with Carbon Sequestration}, 23262 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 23263 journal = {Computing in Science and Engineering}, 23264 volume = {16}, 23265 issue = {6}, 23266 year = {2014}, 23267 pages = {22--31}, 23268 doi = {10.1109/MCSE.2014.77} 23269} 23270 23271@Article{ courantfriedrichslewy1967, 23272 title = {On the partial difference equations of mathematical physics}, 23273 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 23274 journal = {IBM journal of Research and Development}, 23275 volume = {11}, 23276 number = {2}, 23277 pages = {215--234}, 23278 year = {1967}, 23279 publisher = {IBM} 23280} 23281 23282@Article{ erway2017solving, 23283 title = {On solving large-scale limited-memory quasi-Newton equations}, 23284 author = {Erway, Jennifer B and Marcia, Roummel F}, 23285 journal = {Linear Algebra and its Applications}, 23286 volume = {515}, 23287 pages = {196--225}, 23288 year = {2017}, 23289 publisher = {Elsevier} 23290} 23291 23292@Article{ griewank2012broyden, 23293 title = {Broyden updating, the good and the bad!}, 23294 author = {Griewank, Andreas}, 23295 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 23296 pages = {301--315}, 23297 year = {2012} 23298} 23299 23300@Book{ tarantola2005, 23301 title = {Inverse problem theory and methods for model parameter estimation}, 23302 author = {Albert Tarantola}, 23303 volume = {89}, 23304 year = {2005}, 23305 publisher = {SIAM} 23306} 23307 23308@Article{ rutkaikristof2010, 23309 title = {Dynamic Monte Carlo simulation in mixtures}, 23310 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 23311 journal = {The Journal of Chemical Physics}, 23312 volume = {132}, 23313 number = {10}, 23314 pages = {104107}, 23315 year = {2010}, 23316 publisher = {AIP} 23317} 23318 23319@Book{ vogel2002, 23320 title = {Computational methods for inverse problems}, 23321 author = {Curtis R Vogel}, 23322 volume = {23}, 23323 year = {2002}, 23324 publisher = {SIAM} 23325} 23326 23327@Article{ malqvistpeterseim2014, 23328 title = {Localization of elliptic multiscale problems}, 23329 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 23330 journal = {Mathematics of Computation}, 23331 volume = {83}, 23332 number = {290}, 23333 pages = {2583--2603}, 23334 year = {2014} 23335} 23336 23337@Article{ brandtbrannickkahllivshits2011, 23338 title = {Bootstrap {AMG}}, 23339 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 23340 journal = {SIAM Journal on Scientific Computing}, 23341 volume = {33}, 23342 number = {2}, 23343 pages = {612--632}, 23344 year = {2011} 23345} 23346 23347@InProceedings{ barralalauzet2014, 23348 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 23349 moving mesh strategy}, 23350 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 23351 booktitle = {44th AIAA Fluid Dynamics Conference}, 23352 pages = {2773}, 23353 year = {2014} 23354} 23355 23356@InProceedings{ barralalauzetloseille2015, 23357 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 23358 problems involving moving geometries}, 23359 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 23360 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 23361 pages = {2039}, 23362 year = {2015} 23363} 23364 23365@Article{ barralolivieralauzet2017, 23366 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 23367 problems with body-fitted moving geometries}, 23368 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 23369 journal = {Journal of Computational Physics}, 23370 volume = {331}, 23371 pages = {157--187}, 23372 year = {2017} 23373} 23374 23375@Article{ ibanezbarralkrakosloseillemichalpark2017, 23376 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 23377 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 23378 Michal and Mike Park}, 23379 journal = {Procedia engineering}, 23380 volume = {203}, 23381 pages = {154--166}, 23382 year = {2017} 23383} 23384 23385@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 23386 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 23387 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 23388 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 23389 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 23390 pages = {1103}, 23391 year = {2018} 23392} 23393 23394@InProceedings{ barralangeloudiskramergormanpiggott2018, 23395 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 23396 modelling}, 23397 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 23398 and Matthew D Piggott}, 23399 booktitle = {EGU General Assembly Conference Abstracts}, 23400 volume = {20}, 23401 pages = {19168}, 23402 year = {2018} 23403} 23404 23405@Article{ principe2009, 23406 title = {{Mathematical models for thermally coupled low speed flows}}, 23407 author = {Javier Principe and Ramon Codina}, 23408 journal = {Advances in Theoretical and Applied Mechanics}, 23409 volume = {2}, 23410 number = {1-4}, 23411 pages = {93--112}, 23412 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 23413 year = {2009} 23414} 23415 23416@Book{ vandervorst2003, 23417 title = {Iterative {K}rylov Methods for Large Linear Systems}, 23418 author = {van der Vorst, H.}, 23419 isbn = {9780521818285}, 23420 publisher = {Cambridge University Press}, 23421 year = {2003} 23422} 23423 23424@Book{ peres2006, 23425 author = {Asher Peres}, 23426 title = {Quantum theory: concepts and methods}, 23427 volume = {57}, 23428 publisher = {Springer Science \& Business Media}, 23429 year = {2006} 23430} 23431 23432@Book{ kuttler2012, 23433 title = {Linear algebra: theory and applications}, 23434 author = {Kenneth Kuttler}, 23435 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 23436 year = {2012} 23437} 23438 23439@Book{ elman_silvester_wathen_2014, 23440 place = {Oxford}, 23441 title = {Finite elements and fast iterative solvers: with applications in incompressible 23442 fluid dynamics}, 23443 publisher = {Oxford University Press}, 23444 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 23445 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 23446 year = {2014} 23447} 23448 23449@Article{ alametal2007, 23450 title = {An evaluation of the ORNL Cray XT3}, 23451 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 23452 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 23453 journal = {International Journal of High Performance Computing Applications}, 23454 volume = {22}, 23455 number = {1}, 23456 pages = {52--80}, 23457 doi = {10.1177/1094342007085019}, 23458 year = {2007} 23459} 23460 23461@Article{ plazacarey2000, 23462 title = {Local refinement of simplicial grids based on the skeleton}, 23463 author = {Plaza, A. and Carey, Graham F.}, 23464 journal = {Applied Numerical Mathematics}, 23465 doi = {10.1016/S0168-9274(99)00022-7}, 23466 issn = {01689274}, 23467 volume = {32}, 23468 number = {2}, 23469 pages = {195--218}, 23470 year = {2000} 23471} 23472 23473@Article{ carsonstrakos2020, 23474 title = {On the cost of iterative computations}, 23475 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 23476 journal = {Phil. Trans. R. Soc. A}, 23477 volume = {378}, 23478 number = {20190050}, 23479 doi = {10.1098/rsta.2019.0050}, 23480 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 23481 year = {2020} 23482} 23483 23484@Article{ schoberl1999, 23485 title = {Multigrid methods for a parameter dependent problem in primal variables}, 23486 author = {Joachim Sch{\"o}berl}, 23487 journal = {Numerische Mathematik}, 23488 volume = {84}, 23489 number = {1}, 23490 pages = {97--119}, 23491 year = {1999} 23492} 23493 23494@Article{ wuleexuzikatanov2008, 23495 title = {Convergence analysis on iterative methods for semidefinite systems}, 23496 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 23497 journal = {Journal of Computational Mathematics}, 23498 pages = {797--815}, 23499 year = {2008} 23500} 23501 23502@Article{ maierrannacher2016, 23503 title = {Duality-based adaptivity in finite element discretization of heterogeneous 23504 multiscale problems}, 23505 author = {Maier, Matthias and Rannacher, Rolf}, 23506 journal = {Journal of Numerical Mathematics}, 23507 volume = {24}, 23508 number = {3}, 23509 pages = {167--187}, 23510 year = {2016} 23511} 23512 23513@Article{ maierrannacher2018, 23514 title = {A duality-based optimization approach for model adaptivity in heterogeneous 23515 multiscale problems}, 23516 author = {Maier, Matthias and Rannacher, Rolf}, 23517 journal = {Multiscale Modeling \& Simulation}, 23518 volume = {16}, 23519 number = {1}, 23520 pages = {412--428}, 23521 year = {2018} 23522} 23523 23524@Article{ margetismaierluskin2017, 23525 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 23526 metamaterial sheet}, 23527 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 23528 journal = {Studies in Applied Mathematics}, 23529 volume = {139}, 23530 number = {4}, 23531 pages = {599--625}, 23532 year = {2017} 23533} 23534 23535@Article{ maiermargetisluskin2017b, 23536 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 23537 approximation and validation}, 23538 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 23539 journal = {Journal of Computational Physics}, 23540 volume = {339}, 23541 pages = {126--145}, 23542 year = {2017} 23543} 23544 23545@Article{ maiermargetisluskin2018, 23546 title = {Generation of surface plasmon-polaritons by edge effects}, 23547 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 23548 journal = {Communications in Mathematical Sciences}, 23549 volume = {16}, 23550 number = {1}, 23551 pages = {77--95}, 23552 url = {http://arxiv.org/abs/1702.00848}, 23553 year = {2018} 23554} 23555 23556@Article{ maiermattheakiskaxirasluskinmargetis2018, 23557 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 23558 metamaterials}, 23559 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23560 Mitchell and Margetis, Dionisios}, 23561 journal = {Physical Review B}, 23562 volume = {97}, 23563 number = {3}, 23564 pages = {035307}, 23565 year = {2018} 23566} 23567 23568@Article{ maiermattheakiskaxirasluskinmargetis2019, 23569 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 23570 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23571 Mitchell and Margetis, Dionisios}, 23572 journal = {Proceedings of the Royal Society A}, 23573 volume = {475}, 23574 number = {2230}, 23575 pages = {20190220}, 23576 year = {2019} 23577} 23578 23579@Article{ maiermargetisluskin2020, 23580 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 23581 two scales}, 23582 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 23583 journal = {Physical Review B}, 23584 volume = {102}, 23585 number = {7}, 23586 pages = {075308}, 23587 year = {2020} 23588} 23589 23590@Article{ margetismaierstauberlowluskin2020, 23591 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 23592 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 23593 Luskin, Mitchell}, 23594 journal = {Journal of Physics A: Mathematical and Theoretical}, 23595 volume = {53}, 23596 number = {5}, 23597 pages = {055201}, 23598 year = {2020} 23599} 23600 23601@Article{ maiermargetismellet2020, 23602 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 23603 structures}, 23604 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 23605 journal = {Journal of Computational and Applied Mathematics}, 23606 volume = {377}, 23607 pages = {112909}, 23608 year = {2020} 23609} 23610 23611@Article{ maierkronbichler2021, 23612 title = {Efficient parallel 3D computation of the compressible Euler equations with an 23613 invariant-domain preserving second-order finite-element scheme}, 23614 author = {Maier, Matthias and Kronbichler, Martin}, 23615 journal = {ACM Transactions on Parallel Computing}, 23616 volume = {8}, 23617 number = {3}, 23618 pages = {1--30}, 23619 year = {2021} 23620} 23621 23622@Article{ guermondmaierpopovtomas2021, 23623 title = {Second-order invariant domain preserving approximation of the compressible 23624 Navier--Stokes equations}, 23625 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 23626 journal = {Computer Methods in Applied Mechanics and Engineering}, 23627 volume = {375}, 23628 pages = {113608}, 23629 year = {2021} 23630} 23631 23632@Article{ liliptonmaier2021, 23633 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 23634 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 23635 eprint = {2009.12166}, 23636 archiveprefix = {arXiv}, 23637 primaryclass = {phys.optics}, 23638 year = {2021} 23639} 23640 23641@Article{ songmaierluskin2020, 23642 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 23643 gradient-index graphene waveguides}, 23644 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23645 journal = {Journal of Computational Physics}, 23646 volume = {423}, 23647 pages = {109871}, 23648 year = {2020} 23649} 23650 23651@Article{ songmaierluskin2019, 23652 title = {Adaptive finite element simulations of waveguide configurations involving 23653 parallel 2D material sheets}, 23654 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23655 journal = {Computer Methods in Applied Mechanics and Engineering}, 23656 volume = {351}, 23657 pages = {20--34}, 23658 year = {2019} 23659} 23660 23661% 23662% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 23663% 23664% 23665@Unpublished{ rob1, 23666 author = {Rob Kunz}, 23667 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 23668 State University}, 23669 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 23670 sponsors = {U.S. Navy, NRC}, 23671 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 23672 simulations, including lake warming by power plants}, 23673 dates = {Oct 3 and 4, 2002}, 23674 email = {rfk@wt.arl.psu.edu} 23675} 23676 23677@Unpublished{ au1, 23678 author = {Feng Wang and William Appelbe}, 23679 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 23680 url = {http://www.vpac.org}, 23681 sponsors = { }, 23682 note = {Using PETSc for a Variety of Geophysical Simulations}, 23683 dates = {Nov 22, 2002} 23684} 23685 23686@Unpublished{ carl1, 23687 author = {Carl Sovinec}, 23688 institution = {Applied Physics, University of Wisconsin}, 23689 url = {http://nimrodteam.org}, 23690 sponsors = {DOE Office of Fusion Research}, 23691 note = {Investigating using PETSc for NIMROD}, 23692 dates = {Nov 21, 2002}, 23693 email = {sovinec@engr.wisc.edu} 23694} 23695 23696@Unpublished{ au1b, 23697 author = {Pablo Carrica and Robert Wilson}, 23698 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 23699 url = {http://}, 23700 sponsors = {Office of Naval Research}, 23701 note = {Using PETSc for a hydrodynamics of ships and submarines}, 23702 dates = {Sept, 2002}, 23703 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 23704} 23705 23706% ------------------- TAO References ---------------------- 23707@Article{ benson:2001:csp, 23708 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 23709 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 23710 journal = {{ACM} Transactions on Mathematical Software}, 23711 volume = {27}, 23712 number = {3}, 23713 month = sep, 23714 year = {2001}, 23715 pages = {361--376} 23716} 23717 23718@TechReport{ tao-user-ref-2000, 23719 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 23720 title = {{TAO} Users Manual}, 23721 year = {2000}, 23722 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23723 number = {ANL/MCS-TM-242}, 23724 note = {See \url{http://www.mcs.anl.gov/tao}} 23725} 23726 23727% ------------------- Optimization References ---------------------- 23728@Book{ optguide93, 23729 title = {Optimization Software Guide}, 23730 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 23731 publisher = {SIAM Publications}, 23732 address = {Philadelphia}, 23733 year = {1993} 23734} 23735 23736@InProceedings{ more84, 23737 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 23738 Hillstrom}, 23739 title = {The {MINPACK} Project}, 23740 booktitle = {Sources and Development of Mathematical Software}, 23741 editor = {Wayne R. Cowell}, 23742 year = {1984}, 23743 pages = {88--111} 23744} 23745 23746@Article{ steihaug:83, 23747 author = {Trond Steihaug}, 23748 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 23749 journal = {SIAM J. Numer. Anal.}, 23750 volume = {20}, 23751 year = {1983}, 23752 pages = {626--637}, 23753 key = {steihaug92 ! trust_region} 23754} 23755 23756@TechReport{ minpack2test, 23757 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 23758 title = {The {MINPACK-2} Test Problem Collection}, 23759 institution = {Argonne National Laboratory}, 23760 year = {1991}, 23761 number = {ANL/MCS-TM-150}, 23762 key = {more91 ! MINPACK-2} 23763} 23764 23765@TechReport{ hohmann:94, 23766 author = {Andreas Hohmann}, 23767 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 23768 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 23769 year = {1994}, 23770 number = {SC-94-4}, 23771 key = {Hohmann94} 23772} 23773 23774@TechReport{ meza:94, 23775 author = {Juan C. Meza}, 23776 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 23777 institution = {Sandia National Laboratory}, 23778 year = {1994}, 23779 number = {SAND94-8225}, 23780 key = {Meza94} 23781} 23782 23783@Book{ dennis:83, 23784 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 23785 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 23786 publisher = {Prentice-Hall, Inc.}, 23787 address = {Englewood Cliffs, NJ}, 23788 year = {1983} 23789} 23790 23791@TechReport{ more:92, 23792 author = {Jorge J. Mor\'{e} and David Thuente}, 23793 title = {Line search algorithms with guaranteed sufficient decrease}, 23794 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23795 year = {1992}, 23796 number = {MCS-P330-1092} 23797} 23798 23799@Article{ more-toraldo, 23800 author = {Jorge J. Mor\'e and G. Toraldo}, 23801 journal = {SIOPT}, 23802 pages = {93--113}, 23803 title = {On the solution of large quadratic programming problems with bound constraints}, 23804 volume = {1}, 23805 year = {1991} 23806} 23807 23808@Article{ byrd:1995:lma, 23809 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 23810 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 23811 journal = {SIAM Journal on Scientific Computing}, 23812 volume = {16}, 23813 number = {5}, 23814 pages = {1190--1208}, 23815 month = sep, 23816 year = {1995}, 23817 coden = {SJOCE3}, 23818 issn = {1064-8275 (print), 1095-7197 (electronic)}, 23819 mrclass = {90C30 (65K05)}, 23820 mrnumber = {96e:90039}, 23821 mrreviewer = {Henry Wolkowicz}, 23822 bibdate = {Fri Dec 4 16:17:35 MST 1998} 23823} 23824 23825@Article{ lin_c3, 23826 author = {C.-J. Lin and J. J. Mor\'e}, 23827 title = {Newton's method for large bound-constrained optimization problems}, 23828 year = {1999}, 23829 journal = {SIOPT}, 23830 volume = {9(4)}, 23831 pages = {1100--1127}, 23832 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 23833} 23834 23835@TechReport{ dolan2, 23836 author = {E. Dolan and J. J. Mor\'{e}}, 23837 title = {Benchmarking Optimization Software with Performance Profiles}, 23838 year = {2001}, 23839 month = jan, 23840 number = {ANL/MCS-P861-1200}, 23841 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23842 address = {Argonne, IL}, 23843 url = {http://www.mcs.anl.gov/~more/cops/} 23844} 23845 23846@InProceedings{ owlqn, 23847 author = {Galen Andrew and Jianfeng Gao}, 23848 title = {Scalable training of L1-regularized log-linear models}, 23849 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 23850 pages = {33--40}, 23851 year = {2007} 23852} 23853 23854@Article{ bmrm, 23855 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 23856 title = {Bundle methods for regularized risk minimization}, 23857 year = {2010}, 23858 journal = {Journal of Machine Learning Research}, 23859 volume = {11}, 23860 pages = {311--365} 23861} 23862 23863% ------------------- Component Software References ---------------------- 23864@InProceedings{ cca99, 23865 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 23866 McInnes and S. Parker and B. Smolinski}, 23867 title = {Toward a Common Component Architecture for High-Performance Scientific 23868 Computing}, 23869 booktitle = {Proceedings of {High Performance Distributed Computing}}, 23870 pages = {115--124}, 23871 year = {1999}, 23872 note = {See \url{http://cca-forum.org}} 23873} 23874 23875@Book{ szyperski98, 23876 author = {Clemens Szyperski}, 23877 title = {Component Software: Beyond Object-Oriented Programming}, 23878 publisher = {ACM Press}, 23879 address = {New York}, 23880 year = {1998} 23881} 23882 23883@Article{ broy98, 23884 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 23885 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 23886 Stal and Clemens Szyperski}, 23887 title = {What Characterizes a (Software) Component?}, 23888 journal = {Software -- Concepts and Tools}, 23889 publisher = {Springer-Verlag}, 23890 year = {1998}, 23891 volume = {19}, 23892 pages = {49--56} 23893} 23894 23895@Article{ componentware:94, 23896 author = {Jon Udell}, 23897 title = {Componentware}, 23898 journal = {Byte}, 23899 volume = {may}, 23900 pages = {46--56}, 23901 year = {1994}, 23902 key = {Udell94 ! componentware} 23903} 23904 23905@Misc{ cca-web-page, 23906 author = {{Common Component Architecture Forum}}, 23907 note = {See \url{http://cca-forum.org}} 23908} 23909 23910% --------------- References for Tools Used by TAO Developers ----------------- 23911 23912% 23913% tohtml: Used to generate on-line TAO users manual and manual pages 23914% 23915@TechReport{ tohtml, 23916 author = {William Gropp}, 23917 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 23918 institution = {Argonne National Laboratory}, 23919 number = {ANL/MCS-TM-00}, 23920 month = jan, 23921 year = {1995}, 23922 key = {tohtml} 23923} 23924 23925% 23926% doctext: Used to generate tex version of TAO manual pages 23927% 23928@TechReport{ doctext, 23929 author = {William Gropp}, 23930 title = {Users Manual for doctext: Producing documentation from {C} source code}, 23931 institution = {Argonne National Laboratory}, 23932 number = {ANL/MCS-TM-00}, 23933 month = jan, 23934 year = {1995}, 23935 key = {doctext} 23936} 23937 23938% 23939% bfort: Used to generate TAO Fortran interface 23940% 23941@TechReport{ bfort, 23942 author = {William Gropp}, 23943 title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, 23944 institution = {Argonne National Laboratory}, 23945 number = {ANL/MCS-TM-208}, 23946 month = mar, 23947 year = {1995}, 23948 key = {doctext} 23949} 23950 23951% ------------------------- PETSc References ------------------------------ 23952@InProceedings{ petsc, 23953 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 23954 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 23955 Libraries}, 23956 booktitle = {Modern Software Tools in Scientific Computing}, 23957 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 23958 publisher = {Birkhauser Press}, 23959 pages = {163--202}, 23960 year = {1997} 23961} 23962 23963% ------------------------- Misc Other References ------------------------------ 23964@Misc{ indeps-web-page, 23965 title = {{InDEPS} {W}eb page}, 23966 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 23967 author = {et al. Robert Armstrong}, 23968 institution = {Sandia National Laboratory}, 23969 key = {{InDEPS} {W}eb page} 23970} 23971 23972@Misc{ pooma, 23973 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 23974 chitectures}, 23975 year = {1996}, 23976 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 23977 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 23978} 23979 23980@Misc{ isis++-web-page, 23981 title = {{ISIS++} {W}eb Page}, 23982 note = {See \url{http://ca.sandia.gov/isis}}, 23983 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 23984 institution = {Sandia National Laboratories} 23985} 23986 23987@Misc{ trilinos-web-page, 23988 title = {{Trilinos} {W}eb Page}, 23989 note = {See 23990 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 23991 author = {Mike Heroux et al.}, 23992 institution = {Sandia National Laboratories} 23993} 23994 23995@Misc{ alice-web-page, 23996 title = {{ALICE} {W}eb page}, 23997 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 23998 Argonne National Laboratory}, 23999 key = {{ALICE} {W}eb page} 24000} 24001 24002@Misc{ autodiff-webpage, 24003 author = {{Computational Differentiation Project}}, 24004 note = {See \url{http://www.mcs.anl.gov/autodiff}} 24005} 24006 24007@Misc{ coool-home-page, 24008 author = {Lydia Deng and Wences Gouveia and John Scales}, 24009 title = {{The CWP Object-Oriented Optimization Library}}, 24010 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 24011} 24012 24013@Misc{ rice-inversion-home-page, 24014 author = {Mark S. Gokenbach and William W. Symes}, 24015 title = {{The Hilbert Class Library}}, 24016 note = {See \url{http://www.trip.caam.rice.edu/}} 24017} 24018 24019@Misc{ opt++-home-page, 24020 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 24021 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 24022} 24023 24024@Article{ gockenbach:1999:ccl, 24025 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 24026 title = {C++ Classes for Linking Optimization with Complex Simulations}, 24027 journal = {{ACM} Transactions on Mathematical Software}, 24028 volume = {25}, 24029 number = {2}, 24030 month = jun, 24031 year = {1999}, 24032 pages = {191-212}, 24033 abstract = {The object-oriented programming paradigm can be used to overcome the 24034 incompatibilities between off-the-shelf optimization software and application 24035 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 24036 objects arising in optimization problems, such as vectors, linear operators, and 24037 so forth, as C++ classes, making it possible to write optimization code in a 24038 natural fashion, while allowing application software such as simulators to use the 24039 most convenient data structures and programming style. In spite of the poor 24040 reputation C++ has for runtime performance, the use of mixed-language programming 24041 allows performance equal to that achieved by standard Fortran packages, as 24042 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 24043 accepted = {April 1999}, 24044 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 24045} 24046 24047@Misc{ neos-guide, 24048 author = {{The Optimization Software Guide}}, 24049 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 24050} 24051 24052@Article{ boyd, 24053 title = {Distributed optimization and statistical learning via the alternating direction 24054 method of multipliers}, 24055 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 24056 Jonathan and others}, 24057 journal = {Foundations and Trends{\textregistered} in Machine learning}, 24058 volume = {3}, 24059 number = {1}, 24060 pages = {1-122}, 24061 year = {2011}, 24062 publisher = {Now Publishers, Inc.} 24063} 24064 24065@Misc{ :alertsys, 24066 title = {page{ALERT}}, 24067 organization = {Alert Systems, Inc}, 24068 address = {Madison, Wisconsin}, 24069 note = {http://www.alertsys.com/} 24070} 24071 24072@Manual{ :cmfortran, 24073 title = {{CM} {F}ortran Language Reference Manual}, 24074 organization = {Thinking Machines Corporation}, 24075 year = {1994}, 24076 address = {Cambridge, MA} 24077} 24078 24079@Manual{ :cmmd, 24080 title = {{CMMD} Reference Manual, Version 3.0}, 24081 organization = {Thinking Machines Corporation}, 24082 year = {1993}, 24083 address = {Cambridge, MA} 24084} 24085 24086@Manual{ :cmssl, 24087 title = {{CMSSL} for {CM} {F}ortran}, 24088 volume = {I}, 24089 organization = {Thinking Machines Corporation}, 24090 year = {1994}, 24091 address = {Cambridge, MA} 24092} 24093 24094@Misc{ :condor, 24095 author = {M. Livny}, 24096 title = {{PI}, The {Condor} Project, High Throughput Computing}, 24097 howpublished = {www.cs.wisc.edu/condor} 24098} 24099 24100@Manual{ :connection, 24101 title = {Connection Machine {CM}--5 Technical Summary}, 24102 organization = {Thinking Machines Corporation}, 24103 year = {1993}, 24104 address = {Cambridge, MA} 24105} 24106 24107@Manual{ :cplex, 24108 title = {{CPLEX} Optimizer}, 24109 organization = {ILOG CPLEX Division}, 24110 address = {889 Alder Avenue, Incline Village, Nevada}, 24111 note = {http://www.cplex.com/} 24112} 24113 24114@Manual{ :cplextm, 24115 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 24116 (Version 2.0)}, 24117 organization = {CPLEX Optimization Inc.}, 24118 year = {1992}, 24119 address = {Incline Village, Nevada} 24120} 24121 24122@Misc{ :fatcop, 24123 author = {M. C. Ferris}, 24124 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 24125 Solver}, 24126 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 24127} 24128 24129@Misc{ :metaneos, 24130 author = {S. J. Wright}, 24131 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 24132 howpublished = {www-unix.mcs.anl.gov/metaneos} 24133} 24134 24135@InCollection{ gropp.more:optimization, 24136 author = {W. Gropp and J. J. Mor\'e}, 24137 title = {Optimization environments and the {NEOS} Server}, 24138 booktitle = {Approximation Theory and Optimization}, 24139 pages = {167--182}, 24140 publisher = {Cambridge University Press}, 24141 year = {1997}, 24142 editor = {M. D. Buhmann and A. Iserles} 24143} 24144 24145@Article{ czyzyk.mesnier.ea:neos, 24146 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 24147 title = {The {NEOS} Server}, 24148 journal = {IEEE Journal on Computational Science and Engineering}, 24149 volume = {5}, 24150 year = {1998}, 24151 pages = {68--75} 24152} 24153 24154@Book{ :osl, 24155 title = {Handbook for {IBM OSL}}, 24156 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 24157 year = {1994}, 24158 publisher = {Boyd and Fraser}, 24159 address = {Danvers, Massachusetts} 24160} 24161 24162@Manual{ :pro-matlab, 24163 title = {{PRO}--{MATLAB} User's Guide}, 24164 organization = {The MathWorks, Inc.}, 24165 year = {1989}, 24166 address = {21 Eliot Street, South Natick, MA 01760} 24167} 24168 24169@Misc{ :prostate, 24170 key = {Biomedical}, 24171 title = {Biomedical Business International Newsletter}, 24172 howpublished = {pp. 72--75}, 24173 year = {1996} 24174} 24175 24176@Misc{ :sipcase, 24177 key = {Natural}, 24178 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 24179 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 24180} 24181 24182@Book{ aarts.korst:simulated, 24183 author = {E. Aarts and J. Korst}, 24184 title = {Simulated Annealing and Boltzman Machines}, 24185 year = {1990}, 24186 publisher = {John Wiley \& Sons}, 24187 address = {Chichester} 24188} 24189 24190@TechReport{ aarts.laarhoven.ea:local-search-based, 24191 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 24192 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 24193 institution = {Centre for Quantitative Methods}, 24194 year = {1991}, 24195 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 24196 number = {106}, 24197 type = {CQM-Not} 24198} 24199 24200@Article{ aashtiani.magnanti:equilibria, 24201 author = {H. Z. Aashtiani and T. L. Magnanti}, 24202 title = {Equilibria on a congested transportation network}, 24203 journal = {SIAM Journal on Algebraic and Discrete Methods}, 24204 volume = {2}, 24205 year = {1981}, 24206 pages = {213--226} 24207} 24208 24209@Article{ ablow.brigham:analog, 24210 author = {C. M. Ablow and G. Brigham}, 24211 title = {An Analog Solution of Programming Problems}, 24212 journal = {Operations Research}, 24213 year = {1955}, 24214 volume = {3}, 24215 pages = {388--394} 24216} 24217 24218@Article{ achuthan.grabowski.ea:optimal, 24219 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 24220 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 24221 journal = {Opsearch}, 24222 year = {1981}, 24223 volume = {18}, 24224 pages = {117--138} 24225} 24226 24227@Book{ adelman.robinson:income, 24228 author = {I. Adelman and S. Robinson}, 24229 title = {Income Distribution Policy in Developing Countries}, 24230 publisher = {Stanford University Press}, 24231 year = {1978}, 24232 address = {Stanford, California} 24233} 24234 24235@Article{ adler.resende.ea:implementation, 24236 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 24237 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 24238 journal = {Mathematical Programming}, 24239 year = {1989}, 24240 volume = {44}, 24241 pages = {297--336} 24242} 24243 24244@TechReport{ aeberhard.coomans.ea:comparison, 24245 author = {S. Aeberhard and D. Coomans and O. de Vel}, 24246 title = {Comparison of Classifiers in High Dimensional Settings}, 24247 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 24248 University of North Queensland}, 24249 year = {1992}, 24250 number = {92-02}, 24251 type = {Technical Report} 24252} 24253 24254@Article{ aganagic.cottle:constructive, 24255 author = {M. Aganagi\'{c} and R. W. Cottle}, 24256 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 24257 Minors}, 24258 journal = {Mathematical Programming}, 24259 year = {1987}, 24260 volume = {37}, 24261 pages = {223--231} 24262} 24263 24264@TechReport{ aganagic:iterative, 24265 author = {M. Aganagi\'{c}}, 24266 title = {Iterative Methods for the Linear Complementarity Problem}, 24267 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 24268 University}, 24269 year = {1978}, 24270 type = {SOL}, 24271 number = {78-10}, 24272 address = {Stanford, California} 24273} 24274 24275@Book{ ahlfors:complex, 24276 author = {L. V. Ahlfors}, 24277 title = {Complex Analysis}, 24278 publisher = {McGraw--Hill Book Company}, 24279 address = {New York}, 24280 series = {International Series in Pure and Applied Mathematics}, 24281 edition = {Second}, 24282 year = {1966} 24283} 24284 24285@Article{ ahn:solution, 24286 author = {B--H. Ahn}, 24287 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 24288 journal = {Journal of Optimization Theory and Applications}, 24289 year = {1981}, 24290 volume = {33}, 24291 pages = {175--185} 24292} 24293 24294@Article{ al-fahed.stavroulakis.ea:hard, 24295 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24296 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 24297 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 24298 volume = {71}, 24299 year = {1991}, 24300 pages = {257--265} 24301} 24302 24303@Article{ al-fahed.stavroulakis.ea:linear, 24304 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24305 title = {A linear complementarity approach to the frictionless gripper}, 24306 journal = {International Journal of Robotic Research}, 24307 volume = {11}, 24308 year = {1992}, 24309 pages = {112--122} 24310} 24311 24312@Article{ al-khayyal.falk:jointly, 24313 author = {F. A. Al--Khayyal and J. E. Falk}, 24314 title = {Jointly Constrained Biconvex Programming}, 24315 journal = {Mathematics of Operations Research}, 24316 year = {1983}, 24317 volume = {8}, 24318 pages = {273--286} 24319} 24320 24321@Article{ al-khayyal.kyparisis:finite, 24322 author = {F. A. Al--Khayyal and J. Kyparisis}, 24323 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 24324 Inequalities}, 24325 journal = {Journal of Optimization Theory and Applications}, 24326 year = {1991}, 24327 volume = {70}, 24328 pages = {319--332} 24329} 24330 24331@PhDThesis{ al-khayyal:biconvex, 24332 author = {F. A. Al--Khayyal}, 24333 title = {Biconvex Programming and Biconcave Minimization}, 24334 year = {1977}, 24335 school = {The George Washington University} 24336} 24337 24338@Article{ alart.curnier:mixed, 24339 author = {P. Alart and A. Curnier}, 24340 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 24341 solution methods}, 24342 journal = {Computer Methods in Applied Mechanics and Engineering}, 24343 volume = {92}, 24344 year = {1991}, 24345 pages = {353--375} 24346} 24347 24348@Misc{ alexander.kellog.ea:piecewise, 24349 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 24350 title = {Piecewise smooth continuation}, 24351 howpublished = {Manuscript}, 24352 year = {1979} 24353} 24354 24355@InCollection{ alexander.li.ea:piecewise, 24356 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 24357 title = {Piecewise smooth homotopies}, 24358 booktitle = {Homotopy Methods and Global Convergence}, 24359 pages = {1--14}, 24360 publisher = {Plenum Press}, 24361 year = {1983}, 24362 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 24363 address = {New York} 24364} 24365 24366@InCollection{ alexander:topological, 24367 author = {J.~C. Alexander}, 24368 title = {The topological theory of an embedding method}, 24369 booktitle = {Continuation Methods}, 24370 pages = {37--68}, 24371 publisher = {Academic Press}, 24372 year = {1978}, 24373 editor = {H. Wacker}, 24374 address = {New York} 24375} 24376 24377@Book{ allen:probability, 24378 author = {A. O. Allen}, 24379 title = {Probability, Statistics and Queueing Theory}, 24380 publisher = {Academic Press}, 24381 year = {1990}, 24382 address = {London}, 24383 edition = {Second} 24384} 24385 24386@Book{ allgower.georg:numerical, 24387 author = {E. L. Allgower and K. Georg}, 24388 title = {Numerical Continuation Methods, An Introduction}, 24389 publisher = {Springer-Verlag}, 24390 year = {1990}, 24391 address = {Berlin} 24392} 24393 24394@InProceedings{ allgower.georg:predictor-corrector, 24395 crossref = {bachem.grotschel.ea:mathematical}, 24396 author = {E. L. Allgower and K. Georg}, 24397 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 24398 Zero Points of Nonlinear Mappings}, 24399 pages = {15--56} 24400} 24401 24402@Article{ aluffi-pentini.parisi.ea:algorithm, 24403 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 24404 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 24405 Algorithm}, 24406 journal = {ACM Transactions on Mathematical Software}, 24407 year = {1988}, 24408 volume = {14}, 24409 pages = {366--380} 24410} 24411 24412@Article{ anandalingam.friesz:hierarchical, 24413 author = {G. Anandalingam and T. L. Friesz}, 24414 title = {Hierarchical Optimization: An Introduction}, 24415 journal = {Annals of Operations Research}, 24416 year = {1992}, 24417 volume = {34}, 24418 pages = {1--11} 24419} 24420 24421@Article{ anandalingam.white:solution, 24422 author = {G. Anandalingam and D. J. White}, 24423 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 24424 Functions}, 24425 journal = {IEEE Transactions on Automatic Control}, 24426 year = {1990}, 24427 volume = {35}, 24428 number = {10}, 24429 pages = {1170--1173} 24430} 24431 24432@Article{ andersen.andersen:presolving, 24433 author = {E. Andersen and K. Andersen}, 24434 title = {Presolving in Linear Programming}, 24435 year = {1995}, 24436 journal = {Mathematical Programming}, 24437 volume = {71}, 24438 pages = {221--245} 24439} 24440 24441@InProceedings{ andersen.ye:homogeneous, 24442 author = {E. Andersen and Y. Ye}, 24443 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 24444 Equality Constraints}, 24445 crossref = {ferris.pang:complementarity}, 24446 pages = {1--11} 24447} 24448 24449@Book{ anderson.bai.ea:lapack, 24450 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 24451 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 24452 Sorensen}, 24453 title = {{LAPACK} User's Guide}, 24454 publisher = {SIAM}, 24455 year = {1995}, 24456 address = {Philadelphia, Pennsylvania}, 24457 edition = {Second} 24458} 24459 24460@Article{ anderson.ferris:direct, 24461 author = {E. J. Anderson and M. C. Ferris}, 24462 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 24463 year = {2001}, 24464 journal = {SIAM Journal on Optimization, forthcoming}, 24465 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 24466 key = {55} 24467} 24468 24469@InProceedings{ anderson.ferris:genetic, 24470 author = {E. J. Anderson and M. C. Ferris}, 24471 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 24472 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 24473 Waterloo, Ontario, Canada, May 28--30}, 24474 publisher = {University of Waterloo Press}, 24475 key = {14}, 24476 year = {1990} 24477} 24478 24479@Article{ anderson.ferris:genetic*1, 24480 author = {E. J. Anderson and M. C. Ferris}, 24481 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 24482 Problem}, 24483 journal = {ORSA Journal on Computing}, 24484 year = {1994}, 24485 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 24486 volume = {6}, 24487 pages = {161--173}, 24488 key = {22} 24489} 24490 24491@InProceedings{ anderson.ferris:parallel, 24492 author = {E. J. Anderson and M. C. Ferris}, 24493 title = {Parallel Genetic Algorithms in Optimization}, 24494 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 24495 Computing, Chicago, Illinois, December 11-13}, 24496 year = {1989}, 24497 key = {12} 24498} 24499 24500@Unpublished{ anderson.lewis:primal, 24501 author = {E. J. Anderson and A. S. Lewis}, 24502 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24503 note = {In preparation} 24504} 24505 24506@Book{ anderson.nash:linear, 24507 author = {E. J. Anderson and P. Nash}, 24508 title = {Linear Programming in Infinite--Dimensional Spaces}, 24509 year = {1987}, 24510 publisher = {John Wiley \& Sons}, 24511 address = {Chichester} 24512} 24513 24514@InProceedings{ anderson:primal, 24515 author = {E. J. Anderson}, 24516 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24517 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 24518 Programming, Cambridge, September 1984}, 24519 year = {1985}, 24520 editor = {E. J. Anderson and A. B. Philpott}, 24521 publisher = {Springer-Verlag}, 24522 address = {Berlin} 24523} 24524 24525@Article{ andradottir:method, 24526 author = {S. Andrad\'{o}ttir}, 24527 title = {A Method of Discrete Stochastic Optimization}, 24528 journal = {Management Science}, 24529 year = {1995}, 24530 volume = {41}, 24531 pages = {1946--1961} 24532} 24533 24534@Article{ andradottir:global, 24535 author = {S. Andrad\'{o}ttir}, 24536 title = {A Global Search Method for Discrete Stochastic Optimization}, 24537 journal = {SIAM Journal on Optimization}, 24538 year = {1996}, 24539 volume = {6}, 24540 pages = {513--530} 24541} 24542 24543@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 24544 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 24545 title = {An infeasible--interior--point predictor--corrector algorithm for the 24546 {P}$_x$--geometric {LCP}}, 24547 institution = {Department of Mathematics, The University of Iowa}, 24548 address = {Iowa City, Iowa}, 24549 year = {1994}, 24550 number = {62}, 24551 type = {Reports on Computational Mathematics} 24552} 24553 24554@TechReport{ anitescu.potra:formulating, 24555 author = {M. Anitescu and F. A. Potra}, 24556 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 24557 Linear Complementarity Problems}, 24558 institution = {Department of Mathematics, The University of Iowa}, 24559 year = {1996}, 24560 type = {Report}, 24561 number = {93}, 24562 address = {Iowa City, Iowa} 24563} 24564 24565@Article{ anstreicher.lee.ea:crashing, 24566 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 24567 title = {Crashing a Maximum-Weight Complementarity Basis}, 24568 journal = {Mathematical Programming}, 24569 year = {1992}, 24570 volume = {54}, 24571 pages = {281--294} 24572} 24573 24574@Article{ anstreicher:combined, 24575 author = {K. M. Anstreicher}, 24576 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 24577 programming}, 24578 journal = {Mathematical Programming}, 24579 year = {1991}, 24580 volume = {52}, 24581 pages = {429--440} 24582} 24583 24584@Article{ anstreicher:combined*1, 24585 author = {K. M. Anstreicher}, 24586 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 24587 journal = {Mathematical Programming}, 24588 year = {1989}, 24589 volume = {43}, 24590 pages = {209--223} 24591} 24592 24593@InCollection{ arbenz.gander.ea:remote, 24594 author = {P. Arbenz and W. Gander and M. Oettli}, 24595 title = {The Remote Computational System}, 24596 booktitle = {High-Performance Computation and Networks}, 24597 publisher = {Springer-Verlag}, 24598 year = {1996}, 24599 volume = {1067}, 24600 series = {Lecture Notes in Computer Science}, 24601 pages = {662--667} 24602} 24603 24604@InCollection{ arcus:comsoal, 24605 author = {A. L. Arcus}, 24606 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 24607 booktitle = {Readings in Production and Operations Management}, 24608 year = {1966}, 24609 editor = {E. S. Buffa}, 24610 publisher = {John Wiley \& Sons}, 24611 address = {New York} 24612} 24613 24614@TechReport{ arioli.chan.ea:computing, 24615 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 24616 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 24617 Optimization Calculations}, 24618 institution = {CERFACS}, 24619 year = {1993}, 24620 number = {TR/PA/93/34} 24621} 24622 24623@Article{ armijo:minimization, 24624 author = {L. Armijo}, 24625 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 24626 Derivatives}, 24627 journal = {Pacific Journal of Mathematics}, 24628 year = {1966}, 24629 volume = {16}, 24630 pages = {1--3} 24631} 24632 24633@Article{ arrow.debreu:existence, 24634 author = {K. Arrow and G. Debreu}, 24635 title = {Existence of Equilibrium for a Competitive Economy}, 24636 journal = {Econometrica}, 24637 year = {1954}, 24638 volume = {22}, 24639 pages = {265--290} 24640} 24641 24642@InCollection{ arrow.solow:gradient, 24643 author = {K. J. Arrow and R. M. Solow}, 24644 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 24645 booktitle = {Studies in Linear and Nonlinear Programming}, 24646 year = {1958}, 24647 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 24648 publisher = {Stanford University Press}, 24649 address = {Stanford, California}, 24650 pages = {166--176} 24651} 24652 24653@Book{ aubin.ekeland:nonlinear, 24654 author = {J.-P. Aubin and I. Ekeland}, 24655 title = {Applied nonlinear analysis}, 24656 publisher = {John Wiley \& Sons}, 24657 address = {New York}, 24658 year = {1984} 24659} 24660 24661@Article{ auchmuty:variational, 24662 author = {G. Auchmuty}, 24663 title = {Variational Principles for Variational Inequalities}, 24664 journal = {Numerical Functional Analysis and Optimization}, 24665 year = {1989}, 24666 volume = {10}, 24667 pages = {863--874} 24668} 24669 24670@Book{ auerbach.kotlikoff:dynamic, 24671 author = {A. J. Auerbach and L. J. Kotlikoff}, 24672 title = {Dynamic Fiscal Policy}, 24673 publisher = {Cambridge University Press}, 24674 address = {Cambridge, England}, 24675 year = {1987} 24676} 24677 24678@InProceedings{ ault.deutsch.ea:interpolating, 24679 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 24680 title = {Interpolating Subspaces in Approximation Theory}, 24681 booktitle = {Approximation Theory}, 24682 year = {1970}, 24683 editor = {A. Talbot}, 24684 publisher = {Academic Press}, 24685 address = {London} 24686} 24687 24688@Article{ auslender.crouzeix:global, 24689 author = {A. A. Auslender and J.--P. Crouzeix}, 24690 title = {Global Regularity Theorems}, 24691 journal = {Mathematics of Operations Research}, 24692 year = {1988}, 24693 volume = {13}, 24694 pages = {243--253} 24695} 24696 24697@Article{ auslender.haddou:interior-proximal, 24698 author = {A. Auslender and M. Haddou}, 24699 title = {An interior-proximal method for convex linearly constrained problems and its 24700 extension to variational inequalities}, 24701 year = {1995}, 24702 journal = {Mathematical Programming}, 24703 pages = {77--100}, 24704 volume = {71} 24705} 24706 24707@Article{ auslender:convergence, 24708 author = {A. Auslender}, 24709 title = {Convergence of stationary sequences for variational inequalities with maximal 24710 monotone operators}, 24711 journal = {Applied Mathematics and Optimization}, 24712 volume = {28}, 24713 year = {1993}, 24714 pages = {161--172} 24715} 24716 24717@Book{ auslender:optimization, 24718 author = {A. Auslender}, 24719 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 24720 year = {1976}, 24721 publisher = {Masson}, 24722 address = {Paris} 24723} 24724 24725@TechReport{ averick.carter.ea:minpack-2, 24726 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 24727 title = {The {MINPACK-2} Test Problem Collection}, 24728 institution = {Argonne National Laboratory}, 24729 year = {1992}, 24730 address = {Argonne, Illinois}, 24731 number = {MCS-P153-0692} 24732} 24733 24734@TechReport{ axline.billups.ea:guidelines, 24735 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 24736 title = {Guidelines for Software Security ({U})}, 24737 institution = {SNL}, 24738 year = {1989}, 24739 month = oct, 24740 address = {Albuquerque, New Mexico}, 24741 number = {SAND88-2955} 24742} 24743 24744@Article{ ayres.walter:greenhouse, 24745 author = {R. U. Ayres and J. Walter}, 24746 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 24747 journal = {Environmental and Resource Economics}, 24748 year = {1991}, 24749 volume = {1}, 24750 pages = {237--270} 24751} 24752 24753@PhDThesis{ bagley:behaviour, 24754 author = {J. D. Bagley}, 24755 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 24756 Algorithms}, 24757 year = {1967}, 24758 school = {University of Michigan} 24759} 24760 24761@Article{ bain.stewart:application, 24762 author = {R. S. Bain and W. E. Stewart}, 24763 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 24764 Algebraic Equation Systems}, 24765 journal = {Computers in Chemical Engineering}, 24766 year = {1991}, 24767 volume = {15}, 24768 pages = {203--208} 24769} 24770 24771@Article{ baker.lasdon:successive, 24772 author = {T. E. Baker and L. S. Lasdon}, 24773 title = {Successive Linear Programming at {E}xxon}, 24774 journal = {Management Science}, 24775 year = {1985}, 24776 volume = {31}, 24777 pages = {264--274} 24778} 24779 24780@InProceedings{ baker:reducing, 24781 crossref = {grefenstette:genetic}, 24782 author = {J. E. Baker}, 24783 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 24784 pages = {14--21} 24785} 24786 24787@Article{ balas.zemel:algorithm, 24788 author = {E. Balas and E. Zemel}, 24789 title = {An Algorithm for Large Zero--One Knapsack Problems}, 24790 journal = {Operations Research}, 24791 year = {1980}, 24792 volume = {28}, 24793 pages = {1132--1154} 24794} 24795 24796@Book{ ballard.fullerton.ea:general, 24797 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 24798 title = {A General Equilibrium Model for Tax Policy Evaluation}, 24799 publisher = {The University of Chicago Press}, 24800 year = {1985}, 24801 series = {National Bureau of Economic Research Monograph} 24802} 24803 24804@InProceedings{ balog.angelos.ea:dose, 24805 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 24806 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 24807 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 24808 Radiation Therapy, Salt Lake City}, 24809 year = {1997}, 24810 editor = {D. D. Leavitt and G. Starkshall}, 24811 publisher = {Medical Physics Publishing}, 24812 address = {St. Louis, Missouri}, 24813 pages = {323--326} 24814} 24815 24816@Article{ baraff:fast, 24817 author = {D. Baraff}, 24818 title = {Fast contact force computation for nonpenetrating rigid bodies}, 24819 journal = {Computer Graphics (Proceedings SIGRAPH)}, 24820 year = {1994}, 24821 pages = {23--34}, 24822 volume = {28} 24823} 24824 24825@Article{ baraff:issues, 24826 author = {D. Baraff}, 24827 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 24828 journal = {Algorithmica}, 24829 volume = {10}, 24830 year = {1993}, 24831 pages = {292--352} 24832} 24833 24834@Book{ barrett.berry.ea:templates, 24835 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 24836 Methods}, 24837 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 24838 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 24839 year = {1994}, 24840 publisher = {SIAM}, 24841 address = {Philadelphia, Pennsylvania} 24842} 24843 24844@Article{ bard:algorithm, 24845 author = {J. F. Bard}, 24846 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 24847 journal = {Mathematics of Operations Research}, 24848 year = {1983}, 24849 volume = {8}, 24850 pages = {260--272} 24851} 24852 24853@Article{ bard:convex, 24854 author = {J. F. Bard}, 24855 title = {Convex Two-Level Optimization}, 24856 journal = {Mathematical Programming}, 24857 year = {1988}, 24858 volume = {40}, 24859 pages = {15--27} 24860} 24861 24862@InCollection{ bard:eclectic, 24863 author = {Y. Bard}, 24864 title = {An Eclectic Approach to Nonlinear Programming}, 24865 booktitle = {Optimization}, 24866 publisher = {University of Queensland Press}, 24867 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 24868 year = {1972}, 24869 address = {St. Lucia, Queensland, Australia}, 24870 pages = {116--128} 24871} 24872 24873@Article{ barnes:variation, 24874 author = {E. R. Barnes}, 24875 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 24876 journal = {Mathematical Programming}, 24877 year = {1986}, 24878 volume = {36}, 24879 pages = {174--182} 24880} 24881 24882@Article{ bartels.golub:simplex, 24883 author = {R. H. Bartels and G. H. Golub}, 24884 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 24885 journal = {Communications of the Asociation for Computing Machinery}, 24886 year = {1969}, 24887 volume = {12}, 24888 pages = {266--268} 24889} 24890 24891@Article{ barton.ivey:nelder, 24892 author = {R. Barton and J. S. Ivey}, 24893 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 24894 journal = {Management Science}, 24895 year = {1996}, 24896 volume = {42}, 24897 number = {7}, 24898 pages = {954--973} 24899} 24900 24901@Article{ battiti:first-, 24902 author = {R. Battiti}, 24903 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 24904 {N}ewton's Method}, 24905 journal = {Neural Computation}, 24906 year = {1992}, 24907 volume = {4}, 24908 pages = {141--166} 24909} 24910 24911@Article{ baudet:asynchronous, 24912 author = {G. M. Baudet}, 24913 title = {Asynchronous iterative methods for multiprocesors}, 24914 journal = {Journal of the Association for Computing Machinery}, 24915 year = {1978}, 24916 volume = {25}, 24917 pages = {226--244} 24918} 24919 24920@InProceedings{ baum.haussler:what, 24921 author = {E. B. Baum and D. Haussler}, 24922 title = {What Size Net Gives Valid Generalization}, 24923 booktitle = {Advances in Neural Information Processing Systems I}, 24924 year = {1989}, 24925 editor = {D. S. Touretzky}, 24926 publisher = {Morgan Kaufmann}, 24927 address = {San Mateo, California}, 24928 pages = {81--90} 24929} 24930 24931@Misc{ baum:private, 24932 author = {E. B. Baum}, 24933 title = {Private Communication}, 24934 year = {1992}, 24935 address = {NEC Research Institute, Princeton, New Jersey} 24936} 24937 24938@Book{ bazaraa.sherali.ea:nonlinear, 24939 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 24940 title = {Nonlinear Programming}, 24941 edition = {Second}, 24942 publisher = {John Wiley and Sons}, 24943 address = {New York}, 24944 year = {1993} 24945} 24946 24947@Book{ bazaraa.shetty:nonlinear, 24948 author = {M. S. Bazaraa and C. M. Shetty}, 24949 title = {Nonlinear Programming: Theory and Algorithms}, 24950 publisher = {John Wiley \& Sons}, 24951 year = {1979}, 24952 address = {New York, New York} 24953} 24954 24955@Article{ beale:cycling, 24956 author = {E. M. L. Beale}, 24957 title = {Cycling in the Dual Simplex Method}, 24958 journal = {Naval Research Logistics Quarterly}, 24959 year = {1955}, 24960 volume = {2}, 24961 pages = {103--107} 24962} 24963 24964@InProceedings{ becker.cun:improving, 24965 author = {S. Becker and Y. le Cun}, 24966 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 24967 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 24968 year = {1988}, 24969 editor = {D. S. Touretzky}, 24970 publisher = {Morgan Kaufmann}, 24971 address = {San Mateo, California}, 24972 pages = {29--37} 24973} 24974 24975@Book{ ben-israel.ben-tal.ea:optimality, 24976 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 24977 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 24978 year = {1981}, 24979 publisher = {John Wiley \& Sons}, 24980 address = {New York} 24981} 24982 24983@Article{ ben-israel:newton-raphson, 24984 author = {A. Ben--Israel}, 24985 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 24986 journal = {Journal of Mathematical Analysis and its Applications}, 24987 year = {1966}, 24988 volume = {15}, 24989 pages = {243--252} 24990} 24991 24992@Article{ ben-tal.melman.ea:curved, 24993 author = {A. Ben--Tal and A. Melman and J. Zowe}, 24994 title = {Curved Search Methods for Unconstrained Optimization}, 24995 journal = {Optimization}, 24996 year = {1990}, 24997 volume = {21}, 24998 pages = {669--695}, 24999 publisher = {John Wiley \& Sons}, 25000 address = {New York} 25001} 25002 25003@InProceedings{ bennett.ferris.ea:genetic, 25004 crossref = {belew.booker:fourth}, 25005 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 25006 title = {A Genetic Algorithm for Database Query Optimization}, 25007 pages = {400--407}, 25008 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 25009 key = {19} 25010} 25011 25012@Article{ bennett.mangasarian:bilinear, 25013 author = {K. P. Bennett and O. L. Mangasarian}, 25014 title = {Bilinear Separation of Two Sets in n-Space}, 25015 journal = {Computational Optimization and Applications}, 25016 year = {1993}, 25017 volume = {2}, 25018 pages = {207--227} 25019} 25020 25021@Article{ bennett.mangasarian:multicategory, 25022 author = {K. P. Bennett and O. L. Mangasarian}, 25023 title = {Multicategory Separation via Linear Programming}, 25024 journal = {Optimization Methods and Software}, 25025 year = {1993}, 25026 volume = {3}, 25027 pages = {27--39} 25028} 25029 25030@InProceedings{ bennett.mangasarian:neural, 25031 author = {K. P. Bennett and O. L. Mangasarian}, 25032 title = {Neural Network Training via Linear Programming}, 25033 booktitle = {Advances in Optimization and Parallel Computing}, 25034 year = {1992}, 25035 editor = {P. M. Pardalos}, 25036 publisher = {North Holland}, 25037 address = {Amsterdam}, 25038 pages = {56--67} 25039} 25040 25041@Article{ bennett.mangasarian:robust, 25042 author = {K. P. Bennett and O. L. Mangasarian}, 25043 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 25044 journal = {Optimization Methods and Software}, 25045 year = {1992}, 25046 volume = {1}, 25047 pages = {23--34} 25048} 25049 25050@Article{ bennett.mangasarian:serial, 25051 author = {K. P. Bennett and O. L. Mangasarian}, 25052 title = {Serial and Parallel Multicategory Separation}, 25053 journal = {SIAM Journal on Optimization}, 25054 year = {1994}, 25055 volume = {4}, 25056 pages = {722--734} 25057} 25058 25059@TechReport{ bennett.wu.ea:support, 25060 author = {K. P. Bennett and D. Wu and L. Auslender}, 25061 title = {On Support Vector Decision Trees for Database Marketing}, 25062 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 25063 year = {1998}, 25064 optkey = {}, 25065 opttype = {RPI Math Report}, 25066 optnumber = {98-100}, 25067 optaddress = {Troy, New York}, 25068 optmonth = {}, 25069 optnote = {}, 25070 optannote = {} 25071} 25072 25073@InProceedings{ bennett:decision, 25074 author = {K. P. Bennett}, 25075 title = {Decision Tree Construction Via Linear Programming}, 25076 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 25077 Society Conference}, 25078 year = {1992}, 25079 editor = {M. Evans}, 25080 address = {Utica, Illinois}, 25081 pages = {97--101} 25082} 25083 25084@Book{ berge.ghouila-houri:programming, 25085 author = {C. Berge and A. Ghouila-Houri}, 25086 title = {Programming, Games and Transportation Networks}, 25087 year = {1965}, 25088 publisher = {John Wiley \& Sons}, 25089 address = {New York} 25090} 25091 25092@Book{ berge:topological, 25093 author = {C. Berge}, 25094 title = {Topological Spaces}, 25095 year = {1963}, 25096 publisher = {McMillan}, 25097 address = {New York} 25098} 25099 25100@TechReport{ berkelaar.jansen.ea:basis, 25101 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 25102 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 25103 Complementarity Problems}, 25104 institution = {Department of Econometrics and Operations Research}, 25105 year = {1996}, 25106 address = {Erasmus University, Rotterdam, The Netherlands} 25107} 25108 25109@Article{ bertsekas.baz:distributed, 25110 author = {D. P. Bertsekas and D. El Baz}, 25111 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 25112 journal = {SIAM Journal on Control and Optimization}, 25113 year = {1987}, 25114 volume = {25}, 25115 pages = {74--85} 25116} 25117 25118@Article{ bertsekas.gafni:projection, 25119 author = {D. P. Bertsekas and E. M. Gafni}, 25120 title = {Projection Methods for Variational Inequalities with Application to the Traffic 25121 Assignment Problem}, 25122 journal = {Mathematical Programming Study}, 25123 year = {1982}, 25124 volume = {17}, 25125 pages = {139--159} 25126} 25127 25128@Article{ bertsekas.hossein.ea:relaxation, 25129 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 25130 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 25131 journal = {SIAM Journal on Control and Optimization}, 25132 year = {1987}, 25133 volume = {25}, 25134 pages = {1219--1243} 25135} 25136 25137@Unpublished{ bertsekas.tseng:partial, 25138 author = {D. P. Bertsekas and P. Tseng}, 25139 title = {Partial Proximal Minimization for Convex Programming}, 25140 year = {1991}, 25141 note = {Manuscript} 25142} 25143 25144@Article{ bertsekas.tsitsiklis:analysis, 25145 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25146 title = {An Analysis of Stochastic Shortest Path Problems}, 25147 journal = {Mathematics of Operations Research}, 25148 year = {1991}, 25149 volume = {16}, 25150 pages = {580--595} 25151} 25152 25153@Book{ bertsekas.tsitsiklis:parallel, 25154 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25155 title = {Parallel and Distributed Computation: Numerical Methods}, 25156 publisher = {Prentice-Hall, Inc}, 25157 year = {1989}, 25158 address = {Englewood Cliffs, New Jersey} 25159} 25160 25161@Book{ bertsekas:constrained, 25162 author = {D. P. Bertsekas}, 25163 title = {Constrained Optimization and Lagrange Multiplier Methods}, 25164 year = {1982}, 25165 publisher = {Academic Press}, 25166 address = {New York} 25167} 25168 25169@Book{ bertsekas:dynamic, 25170 author = {D. P. Bertsekas}, 25171 title = {Dynamic Programming and Optimal Control}, 25172 publisher = {Athena Scientific}, 25173 year = {1995}, 25174 address = {Belmont MA} 25175} 25176 25177@Article{ bertsekas:enlarging, 25178 author = {D. P. Bertsekas}, 25179 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 25180 Optimization}, 25181 journal = {Journal of Optimization Theory and Applications}, 25182 year = {1982}, 25183 volume = {36}, 25184 pages = {221--252} 25185} 25186 25187@Article{ bertsekas:goldstein-levitin-poljak, 25188 author = {D. P. Bertsekas}, 25189 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 25190 journal = {IEEE Transactions on Automatic Control}, 25191 year = {1976}, 25192 volume = {AC-21}, 25193 pages = {174--184} 25194} 25195 25196@Article{ bertsekas:multiplier, 25197 author = {D. P. Bertsekas}, 25198 title = {Multiplier Methods: {A} Survey}, 25199 journal = {Automatica}, 25200 year = {1976}, 25201 volume = {12}, 25202 pages = {133--145} 25203} 25204 25205@Article{ bertsekas:necessary, 25206 author = {D. P. Bertsekas}, 25207 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 25208 journal = {Mathematical Programming}, 25209 year = {1975}, 25210 volume = {9}, 25211 pages = {87--99} 25212} 25213 25214@Book{ bertsekas:nonlinear, 25215 author = {D. P. Bertsekas}, 25216 title = {Nonlinear Programming}, 25217 publisher = {Athena Scientific}, 25218 year = {1995}, 25219 address = {Belmont, Massachusetts} 25220} 25221 25222@Article{ bertsekas:projected, 25223 author = {Dimitri P. Bertsekas}, 25224 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 25225 journal = {SIAM Journal on Control and Optimization}, 25226 year = {1982}, 25227 volume = {20}, 25228 pages = {221--246} 25229} 25230 25231@Article{ billups.dirkse.ea:comparison, 25232 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 25233 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 25234 journal = {Computational Optimization and Applications}, 25235 year = {1997}, 25236 pages = {3--25}, 25237 volume = {7}, 25238 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 25239 key = {51} 25240} 25241 25242@Article{ billups.ferris:convergence, 25243 author = {S. C. Billups and M. C. Ferris}, 25244 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 25245 Starting Points}, 25246 journal = {SIAM Journal on Optimization}, 25247 year = {1996}, 25248 volume = {6}, 25249 pages = {316--325}, 25250 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 25251 key = {34} 25252} 25253 25254@TechReport{ billups.ferris:convergence*1, 25255 author = {S. C. Billups and M. C. Ferris}, 25256 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 25257 Points}, 25258 institution = {Computer Sciences Department, University of Wisconsin}, 25259 year = {1993}, 25260 address = {Madison, Wisconsin}, 25261 number = {1180}, 25262 note = {Revised version in SIAM Journal on Optimization.} 25263} 25264 25265@Article{ billups.ferris:qpcomp, 25266 author = {S. C. Billups and M. C. Ferris}, 25267 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 25268 year = {1997}, 25269 journal = {Mathematical Programming}, 25270 pages = {533--562}, 25271 volume = {76}, 25272 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 25273 key = {47} 25274} 25275 25276@Article{ billups.ferris:solutions, 25277 author = {S. C. Billups and M. C. Ferris}, 25278 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 25279 journal = {Mathematics of Operations Research}, 25280 volume = {24}, 25281 pages = {219--236}, 25282 year = {1999}, 25283 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 25284 key = {42}, 25285 institution = {Computer Sciences Department, University of Wisconsin}, 25286 address = {Madison, Wisconsin}, 25287 type = {Mathematical Programming Technical Report}, 25288 number = {94--15} 25289} 25290 25291@TechReport{ billups.murata.ea:users, 25292 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 25293 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 25294 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 25295 institution = {SNL}, 25296 year = {1994}, 25297 month = jan, 25298 address = {Albuquerque, New Mexico}, 25299 number = {SAND91--1482} 25300} 25301 25302@TechReport{ billups.speight.ea:nonmonotone, 25303 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 25304 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 25305 Problems}, 25306 institution = {Department of Mathematics, University of Colorado}, 25307 year = {1999}, 25308 address = {Denver, Colorado} 25309} 25310 25311@PhDThesis{ billups:algorithms, 25312 author = {S. C. Billups}, 25313 title = {Algorithms for Complementarity Problems and Generalized Equations}, 25314 school = {University of Wisconsin--Madison}, 25315 year = {1995}, 25316 address = {Madison, Wisconsin}, 25317 month = aug 25318} 25319 25320@MastersThesis{ billups:augmented, 25321 author = {S. C. Billups}, 25322 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 25323 school = {Virginia Tech}, 25324 year = {1985}, 25325 address = {Blacksburg, Virginia} 25326} 25327 25328@TechReport{ billups:homotopy, 25329 author = {S. C. Billups}, 25330 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 25331 institution = {Department of Mathematics, University of Colorado}, 25332 year = {1998}, 25333 address = {Denver, Colorado} 25334} 25335 25336@Article{ billups:improving, 25337 author = {S. C. Billups}, 25338 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 25339 Proximal Perturbations}, 25340 year = {2000}, 25341 journal = {Mathematical Programming}, 25342 volume = {87}, 25343 pages = {153--176} 25344} 25345 25346@Book{ birge.louveaux:introduction, 25347 author = {J. R. Birge and R. Louveaux}, 25348 title = {Introduction to Stochastic Programming}, 25349 publisher = {Springer}, 25350 address = {New York}, 25351 year = {1997} 25352} 25353 25354@TechReport{ bischof.carle.ea:adifor, 25355 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 25356 title = {{ADIFOR} 2.0 User's Guide}, 25357 institution = {Argonne National Laboratory}, 25358 year = {1995}, 25359 address = {Argonne, Illinois}, 25360 number = {ANL/MCS--TM--192}, 25361 type = {Mathematics and Computer Science Division Report} 25362} 25363 25364@Book{ bisschop.entriken:aimms, 25365 author = {J. Bisschop and R. Entriken}, 25366 title = {{AIMMS} -- The Modeling System}, 25367 year = {1993}, 25368 publisher = {Paragon Decision Technology}, 25369 address = {Haarlem, The Netherlands} 25370} 25371 25372@Article{ bisschop.meeraus:development, 25373 author = {J. Bisschop and A. Meeraus}, 25374 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 25375 Environment}, 25376 journal = {Mathematical Programming Study}, 25377 year = {1982}, 25378 volume = {20}, 25379 pages = {1--29} 25380} 25381 25382@Misc{ bixby.ceria.ea:miplib, 25383 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 25384 title = {{MIPLIB} 3.0}, 25385 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 25386} 25387 25388@InProceedings{ bjorkman.klarbring.ea:sequential, 25389 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 25390 Sj{\"{o}}din}, 25391 title = {Sequential quadratic programming for non-linear elastic contact problems}, 25392 editor = {J. Herskovits}, 25393 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 25394 Systems}, 25395 volume = {2}, 25396 year = {1993}, 25397 pages = {301--308} 25398} 25399 25400@Article{ bjorkman:path, 25401 author = {G. Bj{\"o}rkman}, 25402 title = {Path Following and Critical Points for Contact Problems}, 25403 journal = {Computational Mechanics}, 25404 volume = {10}, 25405 pages = {231--246}, 25406 year = {1992} 25407} 25408 25409@Article{ bjorkman:solution, 25410 author = {G. Bj{\"o}rkman}, 25411 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 25412 of Linear Complementarity Problems}, 25413 journal = {International Journal for Numerical Methods in Engineering}, 25414 volume = {31}, 25415 pages = {1553--1566}, 25416 year = {1991} 25417} 25418 25419@Article{ bland:pivot, 25420 author = {R. G. Bland}, 25421 title = {New Pivot Rules for the Simplex Method}, 25422 journal = {Mathematics of Operations Research}, 25423 year = {1977}, 25424 volume = {2}, 25425 pages = {103--107} 25426} 25427 25428@Article{ block.levin:boundedness, 25429 author = {H. D. Block and S. A. Levin}, 25430 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 25431 Inequalities}, 25432 journal = {Proceedings of the American Mathematical Society}, 25433 year = {1970}, 25434 volume = {26}, 25435 pages = {229--235} 25436} 25437 25438@Book{ bloomer:power, 25439 author = {J. Bloomer}, 25440 title = {Power Programming with {RPC}}, 25441 publisher = {O'Reilly and Associates, Inc.}, 25442 address = {Sebastopol, CA}, 25443 year = {1992} 25444} 25445 25446@InProceedings{ blum.rivest:training, 25447 author = {A. Blum and R. L. Rivest}, 25448 title = {Training a 3-Node Neural Network is {NP}-Complete}, 25449 booktitle = {Advances in Neural Information Processing Systems I}, 25450 year = {1989}, 25451 editor = {D. S. Touretzky}, 25452 publisher = {Morgan Kaufmann}, 25453 address = {San Mateo, California}, 25454 pages = {494--501} 25455} 25456 25457@InProceedings{ boehringer.ferris.ea:exemptions, 25458 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 25459 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 25460 from a General Equilibrium Model for Six {EU} Countries}, 25461 key = {49}, 25462 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 25463 year = {1995} 25464} 25465 25466@Article{ boender.kan:bayesian, 25467 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 25468 title = {Bayesian Stopping Rules for Global Optimization}, 25469 journal = {Mathematical Programming}, 25470 year = {1987}, 25471 volume = {37}, 25472 pages = {59--80} 25473} 25474 25475@Article{ boggs:convergence, 25476 author = {P. T. Boggs}, 25477 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 25478 Problems}, 25479 journal = {Mathematics of Computation}, 25480 year = {1976}, 25481 volume = {30}, 25482 pages = {512--522} 25483} 25484 25485@InProceedings{ bolzon.cochetti.ea:computing, 25486 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 25487 title = {On computing all solutions in decohesion}, 25488 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 25489 International Congress of Theoretical and Applied Mechanics}, 25490 year = {1996}, 25491 address = {Kyoto} 25492} 25493 25494@InProceedings{ bolzon.maier.ea:holonomic, 25495 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25496 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 25497 study of mathematical programming approaches}, 25498 booktitle = {Fracture Mechanics of Concrete Structures}, 25499 editor = {F. H. Wittmann}, 25500 series = {Second International Conference on Fracture Mechanics of Concrete Structures 25501 (FRAMCOS 2)}, 25502 year = {1995}, 25503 publisher = {Aedificatio Publishers}, 25504 pages = {885--898} 25505} 25506 25507@InProceedings{ bolzon.maier.ea:holonomic*1, 25508 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25509 title = {On holonomic structural analysis as a complementarity problem}, 25510 booktitle = {APCOM96, Seoul}, 25511 year = {1996} 25512} 25513 25514@Article{ bolzon.maier.ea:multiplicity, 25515 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25516 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 25517 journal = {Computational Mechanics}, 25518 year = {1997}, 25519 volume = {19}, 25520 pages = {511--516} 25521} 25522 25523@Article{ bongartz.conn.ea:cute, 25524 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 25525 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 25526 year = {1995}, 25527 journal = {{ACM} Transactions on Mathematical Software}, 25528 volume = {21}, 25529 pages = {123--160} 25530} 25531 25532@Article{ boppana:eigenvalues, 25533 author = {R. Boppana}, 25534 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 25535 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 25536 pages = {280--285}, 25537 year = {1987} 25538} 25539 25540@Article{ bortfeld.kahler.ea:x-ray, 25541 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 25542 title = {{X}-ray field compensation with multileaf collimators}, 25543 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25544 year = {1994}, 25545 volume = {28}, 25546 number = {3}, 25547 pages = {723--730} 25548} 25549 25550@Article{ bortfeld.schlegel:optimization, 25551 author = {T. Bortfeld and W. Schlegel}, 25552 title = {Optimization of beam orientations in radiation therapy: some theoretical 25553 considerations}, 25554 journal = {Physics in Medicine and Biology}, 25555 year = {1993}, 25556 volume = {38}, 25557 number = {2}, 25558 pages = {291--304} 25559} 25560 25561@Article{ borwein:stability, 25562 author = {J. M. Borwein}, 25563 title = {Stability and regular points of inequality systems}, 25564 journal = {Journal of Optimization Theory and Applications}, 25565 year = {1986}, 25566 volume = {48}, 25567 pages = {9--52} 25568} 25569 25570@Article{ boyer:present, 25571 author = {A. L. Boyer}, 25572 title = {Present and Future Developments in Radiotherapy Treatment Units}, 25573 journal = {Seminars in Radiation Oncology}, 25574 year = {1995}, 25575 volume = {5}, 25576 number = {2}, 25577 pages = {146--155} 25578} 25579 25580@Article{ bracken.mcgill:mathematical, 25581 author = {J. Bracken and J. T. McGill}, 25582 title = {Mathematical programs with optimization problems in the constraints}, 25583 journal = {Operations Research}, 25584 volume = {21}, 25585 year = {1973}, 25586 pages = {37--44} 25587} 25588 25589@Article{ bradley.fayyad.ea:mathematical, 25590 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 25591 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 25592 journal = {INFORMS Journal on Computing}, 25593 year = {1999}, 25594 volume = {11}, 25595 pages = {217--238} 25596} 25597 25598@TechReport{ bradley.mangasarian.ea:clustering, 25599 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25600 title = {Clustering via Concave Minimization}, 25601 institution = {Computer Sciences Department, University of Wisconsin}, 25602 year = {1996}, 25603 type = {Mathematical Programming Technical Report}, 25604 number = {96-03}, 25605 address = {Madison, Wisconsin} 25606} 25607 25608@TechReport{ bradley.mangasarian.ea:feature, 25609 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25610 title = {Feature Selection via Mathematical Programming}, 25611 institution = {Computer Sciences Department, University of Wisconsin}, 25612 year = {1995}, 25613 type = {Mathematical Programming Technical Report}, 25614 number = {95-21}, 25615 address = {Madison, Wisconsin} 25616} 25617 25618@Article{ bradley.mangasarian:massive, 25619 author = {P. S. Bradley and O. L. Mangasarian}, 25620 title = {Massive Data Discrimination via Linear Support Vector Machines}, 25621 year = {2000}, 25622 journal = {Optimization Methods and Software}, 25623 volume = {13}, 25624 pages = {1-10} 25625} 25626 25627@PhDThesis{ brady:condition, 25628 author = {L. Brady}, 25629 title = {Condition Constants for Solutions of Convex Inequalities}, 25630 year = {1988}, 25631 address = {Madison, Wisconsin}, 25632 school = {Computer Sciences Department, University of Wisconsin} 25633} 25634 25635@Article{ braess:uber, 25636 author = {D. Braess}, 25637 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 25638 journal = {Unternehmensforschung}, 25639 year = {1968}, 25640 volume = {12}, 25641 pages = {258--268} 25642} 25643 25644@Article{ brahme:optimization, 25645 author = {A. Brahme}, 25646 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 25647 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25648 year = {1993}, 25649 volume = {25}, 25650 pages = {373--375} 25651} 25652 25653@Article{ brahme:stationary, 25654 author = {A. Brahme}, 25655 title = {Optimization of stationary and moving beam radiation therapy techniques}, 25656 journal = {Radiother. Oncol.}, 25657 year = {1988}, 25658 volume = {12}, 25659 pages = {129--140} 25660} 25661 25662@InCollection{ brahme:treatment, 25663 author = {A. Brahme}, 25664 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 25665 booktitle = {Radiation Therapy Physics}, 25666 publisher = {Springer-Verlag}, 25667 year = {1995}, 25668 editor = {A. R. Smith}, 25669 address = {Berlin}, 25670 pages = {209--246} 25671} 25672 25673@TechReport{ branch:getting, 25674 author = {M. A. Branch}, 25675 title = {Getting {CUTE} with {M}atlab}, 25676 institution = {Cornell University}, 25677 year = {1994}, 25678 type = {Cornell Theory Center Report}, 25679 number = {CTC94TR194}, 25680 address = {Ithaca, New York} 25681} 25682 25683@Article{ brearley.mitra.ea:analysis, 25684 author = {A. Brearley and G. Mitra and H. Williams}, 25685 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 25686 Algorithm}, 25687 journal = {Mathematical Programming}, 25688 year = {1975}, 25689 volume = {8}, 25690 pages = {54--83} 25691} 25692 25693@Article{ bredensteiner.bennett:feature, 25694 author = {E. Bredensteiner and K. Bennett}, 25695 title = {Feature Minimization within Decision Trees}, 25696 journal = {Computational Optimization and Applications}, 25697 year = {1998}, 25698 volume = {10}, 25699 pages = {111--126} 25700} 25701 25702@Article{ bregman:relaxation, 25703 author = {L. M. Bregman}, 25704 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 25705 Application to the Solution of Problems in Convex Programming}, 25706 journal = {USSR Computational Mathematics and Mathematical Physics}, 25707 year = {1967}, 25708 volume = {7}, 25709 pages = {200--217} 25710} 25711 25712@Book{ brenner.hall:making, 25713 author = {D. J. Brenner and E. J. Hall}, 25714 title = {Making the Radiation Therapy Decision}, 25715 publisher = {Contemporary Books}, 25716 year = {1996}, 25717 address = {Chicago, IL} 25718} 25719 25720@Book{ brent:algorithms, 25721 author = {R. P. Brent}, 25722 title = {Algorithms for Minimization without Derivatives}, 25723 publisher = {Prentice-Hall, Inc}, 25724 year = {1973}, 25725 address = {Englewood Cliffs, New Jersey} 25726} 25727 25728@Article{ brewster.mohan.ea:three, 25729 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 25730 title = {Three dimensional conformal treatment planning with multileaf collimators}, 25731 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25732 year = {1995}, 25733 volume = {33}, 25734 number = {5}, 25735 pages = {1081--1089} 25736} 25737 25738@Article{ brezis.lions:produits, 25739 author = {H. Br\'{e}zis and P.--L. Lions}, 25740 title = {Produits Infinis de Resolvantes}, 25741 journal = {Israel Journal of Mathematics}, 25742 year = {1978}, 25743 volume = {29}, 25744 pages = {329--345} 25745} 25746 25747@Book{ brezis:operateurs, 25748 author = {H. Br\'{e}zis}, 25749 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 25750 Espaces de Hilbert}, 25751 publisher = {North-Holland}, 25752 address = {Amsterdam}, 25753 year = {1973} 25754} 25755 25756@Book{ brooke.kendrick.ea:gams, 25757 author = {A. Brooke and D. Kendrick and A. Meeraus}, 25758 title = {{GAMS}: {A} User's Guide}, 25759 year = {1988}, 25760 publisher = {The Scientific Press}, 25761 address = {South San Francisco, CA} 25762} 25763 25764@Article{ brown.demarzo.ea:computing, 25765 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 25766 title = {Computing Equilibria when Asset Markets Are Incomplete}, 25767 journal = {Econometrica}, 25768 year = {1996}, 25769 volume = {64}, 25770 pages = {1--28} 25771} 25772 25773@Article{ bruck:iterative, 25774 author = {R. E. Bruck}, 25775 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 25776 in {H}ilbert Space}, 25777 journal = {Bulletin of the American Mathematical Society}, 25778 year = {1975}, 25779 volume = {81}, 25780 pages = {890--892} 25781} 25782 25783@Article{ bunch.parlett:direct, 25784 author = {J. R. Bunch and B. N. Parlett}, 25785 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 25786 journal = {SIAM Journal on Numerical Analysis}, 25787 year = {1971}, 25788 volume = {8}, 25789 pages = {639--655} 25790} 25791 25792@Article{ burachik.iusem.ea:enlargement, 25793 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 25794 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 25795 year = {1997}, 25796 journal = {Set-Valued Analysis, forthcoming} 25797} 25798 25799@TechReport{ burachik.iusem:generalized, 25800 author = {R. S. Burachik and A. N. Iusem}, 25801 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 25802 Problem}, 25803 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 25804 year = {1995}, 25805 type = {Working Paper}, 25806 address = {Rio de Janeiro} 25807} 25808 25809@Article{ burachik.iusem:generalized*1, 25810 author = {R. S. Burachik and A. N. Iusem}, 25811 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 25812 {A} {H}ilbert Space}, 25813 year = {1998}, 25814 journal = {SIAM Journal on Optimization}, 25815 volume = {8}, 25816 pages = {197--216} 25817} 25818 25819@Article{ burdakov:globally, 25820 author = {O. P. Burdakov}, 25821 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 25822 of Nonlinear Equations}, 25823 journal = {Soviet Mathematics Doklady}, 25824 year = {1980}, 25825 volume = {22}, 25826 pages = {376--379} 25827} 25828 25829@Article{ burges:tutorial, 25830 author = {C. J. C. Burges}, 25831 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 25832 journal = {Data Mining and Knowledge Discovery}, 25833 volume = {2}, 25834 number = {2}, 25835 pages = {121-167}, 25836 year = {1998} 25837} 25838 25839@Article{ burke.ferris.ea:clarke, 25840 author = {J. V. Burke and M. C. Ferris and M. Qian}, 25841 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 25842 journal = {Journal of Mathematical Analysis and its Applications}, 25843 year = {1992}, 25844 volume = {166}, 25845 pages = {199--213}, 25846 key = {16} 25847} 25848 25849@Unpublished{ burke.ferris.ea:least, 25850 author = {J. V. Burke and M. C. Ferris and L. Qi}, 25851 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 25852 year = {1994}, 25853 month = mar, 25854 note = {Manuscript}, 25855 key = {999} 25856} 25857 25858@Article{ burke.ferris:characterization, 25859 author = {J. V. Burke and M. C. Ferris}, 25860 title = {Characterization of Solution Sets of Convex Programs}, 25861 journal = {Operations Research Letters}, 25862 year = {1991}, 25863 volume = {10}, 25864 pages = {57--60}, 25865 key = {10} 25866} 25867 25868@Article{ burke.ferris:gauss-newton, 25869 author = {J. V. Burke and M. C. Ferris}, 25870 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 25871 journal = {Mathematical Programming}, 25872 year = {1995}, 25873 volume = {71}, 25874 pages = {179--194}, 25875 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 25876 key = {32} 25877} 25878 25879@Article{ burke.ferris:weak, 25880 author = {J. V. Burke and M. C. Ferris}, 25881 title = {Weak Sharp Minima in Mathematical Programming}, 25882 journal = {SIAM Journal on Control and Optimization}, 25883 year = {1993}, 25884 volume = {31}, 25885 pages = {1340--1359}, 25886 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 25887 key = {23} 25888} 25889 25890@Article{ burke.more.ea:convergence, 25891 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 25892 title = {Convergence Properties of Trust Region Methods for Linear and Convex 25893 Constraints}, 25894 journal = {Mathematical Programming}, 25895 year = {1990}, 25896 volume = {47}, 25897 pages = {305--336} 25898} 25899 25900@Article{ burke.more:exposing, 25901 author = {J. V. Burke and J. J. Mor\'{e}}, 25902 title = {Exposing Constraints}, 25903 journal = {SIAM Journal on Optimization}, 25904 year = {1994}, 25905 volume = {4}, 25906 pages = {573--595} 25907} 25908 25909@Article{ burke.more:identification, 25910 author = {J. V. Burke and J. J. Mor\'{e}}, 25911 title = {On the Identification of Active Constraints}, 25912 journal = {SIAM Journal on Numerical Analysis}, 25913 year = {1988}, 25914 volume = {25}, 25915 pages = {1197--1211} 25916} 25917 25918@Article{ burke.poliquin:optimality, 25919 author = {J. V. Burke and R. A. Poliquin}, 25920 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 25921 journal = {Mathematical Programming}, 25922 year = {1992}, 25923 volume = {57}, 25924 pages = {103--120} 25925} 25926 25927@Article{ burke.tseng:unified, 25928 author = {J. V. Burke and P. Tseng}, 25929 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 25930 journal = {SIAM Journal on Optimization}, 25931 year = {1996}, 25932 volume = {6}, 25933 pages = {265--282} 25934} 25935 25936@Article{ burke.xu:global, 25937 author = {J. V. Burke and S. Xu}, 25938 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 25939 Linear Complementarity Problems}, 25940 year = {1998}, 25941 journal = {Mathematics of Operations Research}, 25942 volume = {23}, 25943 pages = {719--735} 25944} 25945 25946@TechReport{ burke:algorithms, 25947 author = {J. V. Burke}, 25948 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 25949 Inequalities that have both Global and Quadratic Convergence Properties}, 25950 institution = {Argonne National Laboratory}, 25951 year = {1985}, 25952 address = {Argonne, Illinois}, 25953 number = {ANL/MCS--TM--54}, 25954 type = {Mathematics and Computer Science Division Report} 25955} 25956 25957@Article{ burke:descent, 25958 author = {J. V. Burke}, 25959 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 25960 journal = {Mathematical Programming}, 25961 year = {1985}, 25962 volume = {33}, 25963 pages = {260--279} 25964} 25965 25966@Article{ burke:exact, 25967 author = {J. V. Burke}, 25968 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 25969 journal = {SIAM Journal on Control and Optimization}, 25970 year = {1991}, 25971 volume = {29}, 25972 pages = {968--998} 25973} 25974 25975@Article{ burke:identification, 25976 author = {J. V. Burke}, 25977 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 25978 journal = {SIAM Journal on Numerical Analysis}, 25979 year = {1990}, 25980 volume = {27}, 25981 pages = {1081--1102} 25982} 25983 25984@Article{ burke:robust, 25985 author = {J. V. Burke}, 25986 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 25987 journal = {SIAM Journal on Optimization}, 25988 year = {1992}, 25989 volume = {2}, 25990 pages = {325--347} 25991} 25992 25993@Article{ burke:second, 25994 author = {J. V. Burke}, 25995 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 25996 journal = {Mathematical Programming}, 25997 year = {1987}, 25998 volume = {38}, 25999 pages = {287--302} 26000} 26001 26002@Article{ burke:sequential, 26003 author = {J. V. Burke}, 26004 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 26005 Programs}, 26006 journal = {Journal of Mathematical Analysis and its Applications}, 26007 year = {1989}, 26008 volume = {139}, 26009 pages = {319--351} 26010} 26011 26012@Article{ burman.kutcher.ea:fitting, 26013 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 26014 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 26015 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26016 year = {1991}, 26017 optvolume = {21}, 26018 optpages = {123-135} 26019} 26020 26021@TechReport{ busovaca:handling, 26022 author = {S. Busovaca}, 26023 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 26024 institution = {University of Waterloo}, 26025 year = {1985}, 26026 address = {Ontario}, 26027 number = {CS85 34}, 26028 type = {Technical Report} 26029} 26030 26031@Article{ butler.martin:method, 26032 author = {T. Butler and A. V. Martin}, 26033 title = {On a Method of {C}ourant for Minimizing Functionals}, 26034 journal = {Journal of Mathematical Physics}, 26035 year = {1962}, 26036 volume = {41}, 26037 pages = {291--299} 26038} 26039 26040@Article{ calamai.more:projected, 26041 author = {P. H. Calamai and J. J. Mor\'{e}}, 26042 title = {Projected Gradient Methods for Linearly Constrained Problems}, 26043 journal = {Mathematical Programming}, 26044 year = {1987}, 26045 volume = {39}, 26046 pages = {93--116} 26047} 26048 26049@Article{ cao.ferris:genetic, 26050 author = {M. Cao and M. C. Ferris}, 26051 title = {Genetic Algorithms in Optimization}, 26052 journal = {Journal of Undergraduate Mathematics and its Applications}, 26053 year = {1991}, 26054 volume = {12}, 26055 pages = {81--90}, 26056 key = {17} 26057} 26058 26059@Article{ cao.ferris:interior, 26060 author = {M. Cao and M. C. Ferris}, 26061 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 26062 journal = {Journal of Optimization Theory and Applications}, 26063 year = {1994}, 26064 volume = {83}, 26065 pages = {269--283}, 26066 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 26067 key = {28} 26068} 26069 26070@Article{ cao.ferris:lineality, 26071 author = {M. Cao and M. C. Ferris}, 26072 title = {Lineality Removal for Copositive--Plus Normal Maps}, 26073 year = {1995}, 26074 volume = {2}, 26075 pages = {1--10}, 26076 journal = {Communications on Applied Nonlinear Analysis}, 26077 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 26078 key = {38} 26079} 26080 26081@Article{ cao.ferris:pc, 26082 author = {M. Cao and M. C. Ferris}, 26083 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 26084 journal = {Linear Algebra and Its Applications}, 26085 year = {1996}, 26086 volume = {246}, 26087 pages = {299--312}, 26088 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 26089 key = {37} 26090} 26091 26092@Article{ cao.ferris:pivotal, 26093 author = {M. Cao and M. C. Ferris}, 26094 title = {A Pivotal Method for Affine Variational Inequalities}, 26095 journal = {Mathematics of Operations Research}, 26096 year = {1996}, 26097 volume = {21}, 26098 pages = {44--64}, 26099 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 26100 key = {29} 26101} 26102 26103@PhDThesis{ cao:piecewise, 26104 author = {M. Cao}, 26105 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 26106 school = {Computer Sciences Department, University of Wisconsin}, 26107 year = {1994}, 26108 address = {Madison, Wisconsin}, 26109 note = {Technical Report 1210} 26110} 26111 26112@Article{ caroe.schultz:dual, 26113 author = {C. C. Car{\o}e and R. Schultz}, 26114 title = {Dual Decomposition in Stochastic Integer Programming}, 26115 journal = {Operations Research Letters}, 26116 volume = {24}, 26117 pages = {37-45}, 26118 year = {1999} 26119} 26120 26121@Article{ carol.targovnik.ea:initial, 26122 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 26123 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 26124 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 26125 conformal radiation therapy system}, 26126 journal = {Stereotactic and Functional Neurosurgery}, 26127 year = {1996}, 26128 volume = {66}, 26129 pages = {30--34} 26130} 26131 26132@Article{ carolan.hill.ea:empirical, 26133 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 26134 Wichmann}, 26135 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 26136 Applications}, 26137 journal = {Operations Research}, 26138 year = {1990}, 26139 volume = {38}, 26140 pages = {240--248} 26141} 26142 26143@Article{ carroll:created, 26144 author = {C. W. Carroll}, 26145 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 26146 Systems}, 26147 journal = {Operations Research}, 26148 year = {1961}, 26149 volume = {9}, 26150 pages = {169--184} 26151} 26152 26153@PhDThesis{ carroll:operations, 26154 author = {C. W. Carroll}, 26155 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 26156 Process}, 26157 year = {1959}, 26158 address = {Appleton, Wisconsin}, 26159 school = {Institute of Paper Chemistry} 26160} 26161 26162@TechReport{ casanova.dongarra:netsolve, 26163 author = {H. Casanova and J. Dongarra}, 26164 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 26165 institution = {University of Tennessee}, 26166 year = {1996}, 26167 type = {Technical Report} 26168} 26169 26170@TechReport{ cavalier.soyster:computational, 26171 author = {T. M. Cavalier and A. L. Soyster}, 26172 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 26173 institution = {Pennsylvania State University}, 26174 year = {1985}, 26175 address = {Pennsylvania}, 26176 number = {85-105}, 26177 type = {ISME Working Paper} 26178} 26179 26180@TechReport{ censor.iusem.ea:interior-point, 26181 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 26182 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 26183 Problem with Paramonotone Operators}, 26184 institution = {University of Haifa}, 26185 year = {1994}, 26186 type = {Working Paper} 26187} 26188 26189@Article{ censor.lent:iterative, 26190 author = {Y. Censor and A. Lent}, 26191 title = {An Iterative Row-Action Method for Interval Convex Programming}, 26192 journal = {Journal of Optimization Theory and Applications}, 26193 year = {1981}, 26194 volume = {34}, 26195 pages = {275--291} 26196} 26197 26198@InCollection{ censor.pierro.ea:iterative, 26199 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 26200 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 26201 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 26202 XXIV}, 26203 publisher = {Banach Center}, 26204 year = {1987}, 26205 editor = {A. J. Wakulicz}, 26206 address = {Warsaw, Poland} 26207} 26208 26209@Article{ censor.segman:block-iterative, 26210 author = {Y. Censor and J. Segman}, 26211 title = {On Block-Iterative Entropy Maximization}, 26212 journal = {Journal of Information and Optimization Science}, 26213 year = {1987}, 26214 volume = {8}, 26215 pages = {275--291} 26216} 26217 26218@Article{ censor.zenios:proximal, 26219 author = {Y. Censor and S. A. Zenios}, 26220 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 26221 journal = {Journal of Optimization Theory and Applications}, 26222 year = {1992}, 26223 volume = {73}, 26224 pages = {451--464} 26225} 26226 26227@Article{ censor:parallel, 26228 author = {Yair Censor}, 26229 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 26230 Therapy}, 26231 journal = {Mathematical Programming}, 26232 year = {1988}, 26233 volume = {42}, 26234 pages = {307--325} 26235} 26236 26237@Article{ censor:row-action, 26238 author = {Yair Censor}, 26239 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 26240 journal = {SIAM Review}, 26241 year = {1981}, 26242 volume = {23}, 26243 pages = {444--466} 26244} 26245 26246@Article{ chajakis.zenios:synchronous, 26247 author = {E. D. Chajakis and S. A. Zenios}, 26248 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 26249 Nonlinear Network Optimization}, 26250 journal = {Parallel Computing}, 26251 year = {1990}, 26252 note = {To appear} 26253} 26254 26255@Article{ chamberlain.powell.ea:watchdog, 26256 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 26257 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 26258 Optimization}, 26259 journal = {Mathematical Programming Study}, 26260 year = {1982}, 26261 volume = {16}, 26262 pages = {1--17} 26263} 26264 26265@Article{ chan.pang:generalized, 26266 author = {D. Chan and J. S. Pang}, 26267 title = {The Generalized Quasi-Variational Inequality Problem}, 26268 journal = {Mathematics of Operations Research}, 26269 volume = {7}, 26270 pages = {211--222}, 26271 year = {1982} 26272} 26273 26274@Article{ charalambous:nonlinear, 26275 author = {C. Charalambous}, 26276 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 26277 journal = {Mathematical Programming}, 26278 year = {1977}, 26279 volume = {12}, 26280 pages = {195--225} 26281} 26282 26283@Article{ charnes.cooper.ea:duality, 26284 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 26285 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 26286 journal = {Proceedings of the National Academy of Sciences of the United States}, 26287 year = {1962}, 26288 pages = {783--786} 26289} 26290 26291@Book{ charnes.cooper.ea:introduction, 26292 author = {A. Charnes and W. W. Cooper and A. Henderson}, 26293 title = {An Introduction to Linear Programming}, 26294 year = {1953}, 26295 publisher = {John Wiley \& Sons}, 26296 address = {New York} 26297} 26298 26299@TechReport{ charnes.semple:practical, 26300 author = {A. Charnes and J. Semple}, 26301 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 26302 institution = {CCS}, 26303 year = {1991}, 26304 address = {Austin, Texas}, 26305 number = {663}, 26306 type = {Research Report} 26307} 26308 26309@InProceedings{ charnes:fundamental, 26310 author = {A. Charnes}, 26311 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 26312 booktitle = {Computer and Information Sciences}, 26313 year = {1964}, 26314 editor = {J. T. Lou and R. H. Wilcox}, 26315 publisher = {Spartan Books}, 26316 address = {Washington, D.C.}, 26317 pages = {67--74} 26318} 26319 26320@TechReport{ chen.chen.ea:penalized, 26321 author = {B. Chen and X. Chen and C. Kanzow}, 26322 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 26323 Numerical Results}, 26324 institution = {Institute of Applied Mathematics, University of Hamburg}, 26325 year = {1997}, 26326 type = {Preprint}, 26327 number = {126}, 26328 address = {Hamburg, Germany} 26329} 26330 26331@Article{ chen.chen:global, 26332 author = {B. Chen and X. Chen}, 26333 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 26334 ${R}_0$ {NCP} or Monotone {NCP}}, 26335 journal = {SIAM Journal on Optimization}, 26336 year = {1999}, 26337 volume = {9}, 26338 pages = {624--645} 26339} 26340 26341@Article{ chen.ferris.ea:fatcop, 26342 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 26343 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 26344 Solver}, 26345 journal = {Annals of Operations Research, forthcoming}, 26346 year = {2000}, 26347 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 26348 key = {89}, 26349 type = {Data Mining Institute Technical Report}, 26350 institution = {Computer Sciences Department, University of Wisconsin}, 26351 address = {Madison, Wisconsin}, 26352 number = {99-11} 26353} 26354 26355@TechReport{ chen.ferris:fatcop, 26356 author = {Q. Chen and M. C. Ferris}, 26357 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 26358 type = {Mathematical Programming Technical Report}, 26359 institution = {Computer Sciences Department, University of Wisconsin}, 26360 address = {Madison, Wisconsin}, 26361 year = {1999}, 26362 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 26363 number = {99-05}, 26364 key = {81}, 26365 annote = {Submitted to {\em SIOPT}} 26366} 26367 26368@Article{ chen.florian:nonlinear, 26369 author = {Y. Chen and M. Florian}, 26370 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 26371 Optimality Conditions}, 26372 journal = {Optimization}, 26373 year = {1995}, 26374 volume = {32}, 26375 pages = {193--209} 26376} 26377 26378@TechReport{ chen.florian:o-d, 26379 author = {Y. Chen and M. Florian}, 26380 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 26381 optimality conditions}, 26382 type = {Publication}, 26383 number = {CRT-94-56}, 26384 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 26385 address = {Montr\'eal, Canada}, 26386 year = {1994} 26387} 26388 26389@Article{ chen.harker:continuation, 26390 author = {B. Chen and P. T. Harker}, 26391 title = {A Continuation Method for Monotone Variational Inequalities}, 26392 journal = {Mathematical Programming}, 26393 volume = {69}, 26394 pages = {237--253}, 26395 year = {1995} 26396} 26397 26398@Article{ chen.harker:non-interior, 26399 author = {B. Chen and P. T. Harker}, 26400 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 26401 journal = {SIAM Journal on Matrix Analysis and Applications}, 26402 year = {1993}, 26403 volume = {14}, 26404 pages = {1168--1190} 26405} 26406 26407@Article{ chen.harker:smooth, 26408 author = {B. Chen and P. T. Harker}, 26409 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 26410 journal = {SIAM Journal on Optimization}, 26411 year = {1997}, 26412 volume = {7}, 26413 pages = {403--420} 26414} 26415 26416@Article{ chen.mangasarian:class, 26417 author = {Chunhui Chen and O. L. Mangasarian}, 26418 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 26419 journal = {Computational Optimization and Applications}, 26420 year = {1996}, 26421 volume = {5}, 26422 pages = {97--138} 26423} 26424 26425@Article{ chen.mangasarian:smoothing, 26426 author = {Chunhui Chen and O. L. Mangasarian}, 26427 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 26428 journal = {Mathematical Programming}, 26429 year = {1995}, 26430 volume = {78}, 26431 pages = {51--70} 26432} 26433 26434@Article{ chen.nashed.ea:convergence, 26435 author = {X. Chen and Z. Nashed and L. Qi}, 26436 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 26437 using Adaptive Outer Inverses}, 26438 year = {1997}, 26439 journal = {SIAM Journal on Optimization}, 26440 volume = {7}, 26441 pages = {445--462} 26442} 26443 26444@Article{ chen.qi.ea:global, 26445 author = {X. Chen and L. Qi and D. Sun}, 26446 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 26447 Application to General Box Constrained Variational Inequalities}, 26448 year = {1998}, 26449 journal = {Mathematics of Computation}, 26450 volume = {67}, 26451 pages = {519--540} 26452} 26453 26454@Article{ chen.teboulle:convergence, 26455 author = {G. Chen and M. Teboulle}, 26456 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 26457 Functions}, 26458 journal = {SIAM Journal on Optimization}, 26459 year = {1993}, 26460 volume = {3}, 26461 pages = {538--543} 26462} 26463 26464@Article{ chen.ye:homotopy-smoothing, 26465 author = {X.~Chen and Y.~Ye}, 26466 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 26467 year = {1999}, 26468 journal = {SIAM Journal on Control and Optimization}, 26469 volume = {37}, 26470 pages = {589--616} 26471} 26472 26473@PhDThesis{ chen:forward-backward, 26474 author = {G. H.--G. Chen}, 26475 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 26476 school = {University of Washington}, 26477 year = {1994} 26478} 26479 26480@PhDThesis{ chen:smoothing, 26481 author = {Chunhui Chen}, 26482 title = {Smoothing Methods in Mathematical Programming}, 26483 school = {Computer Sciences Department, University of Wisconsin}, 26484 year = {1995}, 26485 address = {Madison, Wisconsin}, 26486 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26487 annote = {Mathematical Programming Technical Report 95-12} 26488} 26489 26490@Book{ cheney:introduction, 26491 author = {E. W. Cheney}, 26492 title = {Introduction to Approximation Theory}, 26493 year = {1966}, 26494 publisher = {McGraw--Hill}, 26495 address = {New York} 26496} 26497 26498@Article{ cho.kuterdem.ea:spherical, 26499 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 26500 title = {A spherical dose model for radiosurgery treatment planning}, 26501 journal = {Physics in Medicine and Biology}, 26502 year = {1998}, 26503 volume = {43}, 26504 pages = {3145--3148} 26505} 26506 26507@Article{ cho.lee.ea:optimization, 26508 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 26509 title = {Optimization of intensity modulated beams with volume constraints using two 26510 methods: cost function minimization and projection onto convex sets}, 26511 journal = {Medical Physics}, 26512 year = {1998}, 26513 volume = {25}, 26514 number = {4}, 26515 pages = {435--443} 26516} 26517 26518@Article{ choi.desarbo.ea:product, 26519 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 26520 title = {Product Positioning Under Price Competition}, 26521 journal = {Management Science}, 26522 year = {1990}, 26523 volume = {36}, 26524 pages = {175--199} 26525} 26526 26527@Article{ chow.mallet-parret.ea:finding, 26528 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 26529 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 26530 One}, 26531 journal = {Mathematics of Computing}, 26532 year = {1978}, 26533 volume = {32}, 26534 pages = {887--899} 26535} 26536 26537@Article{ christopherson:mathematical, 26538 author = {D. G. Christopherson}, 26539 title = {A new mathematical method for the solution of film lubrication problems}, 26540 journal = {Proceedings of the Institute of Mechanical Engineers}, 26541 volume = {146}, 26542 year = {1941}, 26543 pages = {126--135} 26544} 26545 26546@TechReport{ chun.lee.ea:implementation, 26547 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 26548 title = {An Implementation of the Bundle Decomposition Algorithm}, 26549 institution = {Department of Industrial Engineering, University of Wisconsin}, 26550 year = {1991}, 26551 address = {Madison, Wisconsin}, 26552 number = {91-6} 26553} 26554 26555@Article{ chung:np-completeness, 26556 author = {S.--J. Chung}, 26557 title = {{NP}-Completeness of the Linear Complementarity Problem}, 26558 journal = {Journal of Optimization Theory and Applications}, 26559 volume = {60}, 26560 year = {1989}, 26561 pages = {393--399} 26562} 26563 26564@Book{ chvatal:linear, 26565 author = {V. Chv\'atal}, 26566 title = {Linear Programming}, 26567 year = {1983}, 26568 publisher = {W. H. Freeman and Company}, 26569 address = {New York} 26570} 26571 26572@Book{ ciarlet:finite, 26573 author = {P. G. Ciarlet}, 26574 title = {The Finite Element Method for Elliptic Problems}, 26575 year = {1978}, 26576 publisher = {North-Holland}, 26577 address = {New York} 26578} 26579 26580@Article{ cinquini.contro:optimal, 26581 author = {C. Cinquini and R. Contro}, 26582 title = {Optimal design of beams discretized by elastic plastic finite element}, 26583 journal = {Computers \& Structures}, 26584 volume = {20}, 26585 year = {1985}, 26586 pages = {475--585} 26587} 26588 26589@Book{ clarke:optimization, 26590 author = {F. H. Clarke}, 26591 title = {Optimization and Nonsmooth Analysis}, 26592 year = {1983}, 26593 publisher = {John Wiley \& Sons}, 26594 address = {New York} 26595} 26596 26597@InProceedings{ cleveland.smith:genetic, 26598 crossref = {schaeffer:third}, 26599 author = {G. A. Cleveland and S. F. Smith}, 26600 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 26601 pages = {160--169} 26602} 26603 26604@Book{ cochran:sampling, 26605 author = {W. Cochran}, 26606 title = {Sampling Techniques}, 26607 publisher = {Wiley}, 26608 year = {1977}, 26609 address = {New York}, 26610 edition = {Third} 26611} 26612 26613@Article{ coleman.conn:nonlinear, 26614 author = {T. F. Coleman and A. R. Conn}, 26615 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 26616 journal = {Mathematical Programming}, 26617 year = {1982}, 26618 volume = {24}, 26619 pages = {123--136} 26620} 26621 26622@Article{ coleman.conn:nonlinear*1, 26623 author = {T. F. Coleman and A. R. Conn}, 26624 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 26625 journal = {Mathematical Programming}, 26626 year = {1982}, 26627 volume = {24}, 26628 pages = {137--161} 26629} 26630 26631@TechReport{ coleman.liu:interior, 26632 author = {T. F. Coleman and J. Liu}, 26633 title = {An interior newton method for quadratic programming}, 26634 institution = {Dept. of Computer Science, Cornell University}, 26635 year = {1993}, 26636 number = {TR 93-1388}, 26637 address = {Ithaca, NY}, 26638 month = oct 26639} 26640 26641@Article{ coleman.more:estimation, 26642 author = {T. F. Coleman and J. J. Mor\'{e}}, 26643 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 26644 journal = {SIAM Journal on Numerical Analysis}, 26645 year = {1983}, 26646 volume = {20}, 26647 pages = {187--209} 26648} 26649 26650@Manual{ coleman.verma:admat, 26651 author = {T. F. Coleman and A. Verma}, 26652 title = {{ADMAT} User Guide}, 26653 year = {2000} 26654} 26655 26656@TechReport{ colville:comparative, 26657 author = {A. R. Colville}, 26658 title = {A Comparative Study on Nonlinear Programming Codes}, 26659 institution = {IBM New York Scientific Center}, 26660 year = {1968}, 26661 month = jun, 26662 number = {320--2949}, 26663 type = {Technical Report} 26664} 26665 26666@Article{ comi.maier:extremum, 26667 author = {C. Comi and G. Maier}, 26668 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 26669 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 26670 journal = {European Journal Mechanics A/Solids}, 26671 volume = {9}, 26672 year = {1990}, 26673 pages = {563--585} 26674} 26675 26676@Misc{ condon.dahl.ea:implementing, 26677 author = {T. Condon and H. Dahl and S. Devarajan}, 26678 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 26679 Model}, 26680 year = {1987}, 26681 howpublished = {{DRD} Discussion Paper 290}, 26682 note = {The World Bank, Washington DC} 26683} 26684 26685@Book{ conn.gould.ea:lancelot, 26686 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26687 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 26688 (Release {A})}, 26689 year = {1992}, 26690 publisher = {Springer Verlag}, 26691 address = {Heidelberg, Berlin}, 26692 series = {Springer Series in Computational Mathematics}, 26693 number = {17} 26694} 26695 26696@Article{ conn.gould.ea:numerical, 26697 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26698 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 26699 Nonlinear Optimization}, 26700 journal = {Mathematical Programming}, 26701 year = {1996}, 26702 volume = {75}, 26703 pages = {73--110} 26704} 26705 26706@Book{ cgt, 26707 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26708 title = {Trust-Region Methods}, 26709 year = {2000}, 26710 publisher = {SIAM}, 26711 address = {Philadelphia, Pennsylvania} 26712} 26713 26714@InCollection{ conn.toint:algorithm, 26715 author = {A. R. Conn and Ph. L. Toint}, 26716 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 26717 Optimization}, 26718 booktitle = {Nonlinear Optimization and Applications}, 26719 editor = {G. Di Pillo and F. Giannessi}, 26720 year = {1996}, 26721 publisher = {Plenum Press}, 26722 address = {New York} 26723} 26724 26725@Article{ conry.seireg:mathematical, 26726 author = {T. F. Conry and A. Seireg}, 26727 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 26728 journal = {{ASME} Transactions Journal of Applied Mechanics}, 26729 volume = {93}, 26730 year = {1971}, 26731 pages = {387--392} 26732} 26733 26734@Article{ cook.gerards.ea:sensitivity, 26735 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 26736 title = {Sensitivity Results in Integer Linear Programming}, 26737 journal = {Mathematical Programming}, 26738 year = {1986}, 26739 volume = {34}, 26740 pages = {251--264} 26741} 26742 26743@Article{ cook:taxonomy, 26744 author = {S. A. Cook}, 26745 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 26746 journal = {Information and Control}, 26747 year = {1985}, 26748 volume = {64}, 26749 pages = {2--22} 26750} 26751 26752@Article{ cooper:gradient, 26753 author = {R. E. M. Cooper}, 26754 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 26755 journal = {Radiology}, 26756 year = {1978}, 26757 volume = {128}, 26758 pages = {235--243} 26759} 26760 26761@Article{ cormack:problem, 26762 author = {A. M. Cormack}, 26763 title = {A problem in roatation therapy with x-rays}, 26764 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26765 year = {1987}, 26766 volume = {13}, 26767 pages = {623--630} 26768} 26769 26770@Article{ cormack:problem*1, 26771 author = {A. M. Cormack}, 26772 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 26773 symmetry}, 26774 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26775 year = {1987}, 26776 volume = {13}, 26777 pages = {1921--1925} 26778} 26779 26780@Article{ cottle.dantzig:complementary, 26781 author = {R. W. Cottle and G. B. Dantzig}, 26782 title = {Complementary Pivot Theory of Mathematical Programming}, 26783 journal = {Linear Algebra and Its Applications}, 26784 year = {1968}, 26785 volume = {1}, 26786 pages = {103--125} 26787} 26788 26789@Article{ cottle.dantzig:generalization, 26790 author = {R. W. Cottle and G. B. Dantzig}, 26791 title = {A Generalization of the Linear Complementarity Problem}, 26792 journal = {Journal of Combinatorial Theory}, 26793 year = {1970}, 26794 volume = {8}, 26795 pages = {79--90} 26796} 26797 26798@Book{ cottle.giannessi.ea:variational, 26799 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 26800 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 26801 year = {1980}, 26802 publisher = {John Wiley \& Sons}, 26803 address = {New York} 26804} 26805 26806@InCollection{ cottle.goheen:special, 26807 author = {R. W. Cottle and M. S. Goheen}, 26808 title = {A Special Class of Large Quadratic Programs}, 26809 pages = {361--390}, 26810 crossref = {mangasarian.meyer.ea:nonlinear*3} 26811} 26812 26813@Article{ cottle.golub.ea:solution, 26814 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 26815 title = {On the Solution of Large Structured Complementarity Problems: The Block 26816 Partitioned Case}, 26817 journal = {Applied Mathematics and Optimization}, 26818 year = {1978}, 26819 volume = {4}, 26820 pages = {347--363} 26821} 26822 26823@Book{ cottle.pang.ea:linear, 26824 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 26825 title = {The Linear Complementarity Problem}, 26826 year = {1992}, 26827 publisher = {Academic Press}, 26828 address = {Boston} 26829} 26830 26831@Article{ cottle.pang.ea:sufficient, 26832 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 26833 title = {Sufficient Matrices and the Linear Complementarity Problem}, 26834 journal = {Linear Algebra and Its Applications}, 26835 year = {1989}, 26836 volume = {114/115}, 26837 pages = {231--249} 26838} 26839 26840@PhDThesis{ cottle:nonlinear, 26841 author = {R. W. Cottle}, 26842 title = {Nonlinear programs with positively bounded {J}acobians}, 26843 school = {Department of Mathematics, University of California}, 26844 year = {1964}, 26845 address = {Berkeley, California} 26846} 26847 26848@Article{ cottle:nonlinear*1, 26849 author = {R. W. Cottle}, 26850 title = {Nonlinear programs with positively bounded {J}acobians}, 26851 journal = {Journal of the Society for Industrial and Applied Mathematics}, 26852 volume = {14}, 26853 year = {1966}, 26854 pages = {147--158} 26855} 26856 26857@InCollection{ cottle:principal, 26858 author = {R. W. Cottle}, 26859 title = {The principal pivoting method of quadratic programming}, 26860 booktitle = {Mathematics of the Decision Sciences, Part 1}, 26861 publisher = {American Mathematical Society}, 26862 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 26863 address = {Providence, Rhode Island}, 26864 year = {1968}, 26865 pages = {144--162} 26866} 26867 26868@Unpublished{ courant:calculus, 26869 author = {R. Courant}, 26870 title = {Calculus of Variations and Supplementary Notes and Exercises}, 26871 year = {1956}, 26872 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 26873 New York University} 26874} 26875 26876@Article{ courant:variational, 26877 author = {R. Courant}, 26878 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 26879 journal = {Bulletin of the American Mathematical Society}, 26880 year = {1943}, 26881 volume = {49}, 26882 pages = {1--23} 26883} 26884 26885@Book{ cristianini.shawe-taylor:introduction, 26886 author = {N. Cristianini and J. Shawe-Taylor}, 26887 title = {An Introduction to Support Vector Machines}, 26888 publisher = {Cambridge University Press}, 26889 address = {Cambridge}, 26890 year = {2000} 26891} 26892 26893@Article{ cromme:strong, 26894 author = {L. Cromme}, 26895 title = {Strong Uniqueness}, 26896 journal = {Numerische Mathematik}, 26897 year = {1978}, 26898 volume = {29}, 26899 pages = {179--193} 26900} 26901 26902@Article{ crowder.johnson.ea:solving, 26903 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 26904 title = {Solving Large Scale Zero-One Linear Programming Problems}, 26905 journal = {Operations Research}, 26906 year = {1983}, 26907 volume = {31}, 26908 pages = {803--834} 26909} 26910 26911@Article{ cryer.dempster:equivalence, 26912 author = {C. W. Cryer and M. A. H. Dempster}, 26913 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 26914 Lattice {H}ilbert Spaces}, 26915 journal = {SIAM Journal on Control and Optimization}, 26916 year = {1980}, 26917 volume = {18}, 26918 pages = {76--89} 26919} 26920 26921@Article{ cryer:method, 26922 author = {C. W. Cryer}, 26923 title = {The method of {C}hristopherson for solving free boundary problems for infinite 26924 journal bearings by means of finite differences}, 26925 journal = {Mathematics of Computation}, 26926 volume = {25}, 26927 year = {1971}, 26928 pages = {435--553} 26929} 26930 26931@Article{ cryer:solution, 26932 author = {C. W. Cryer}, 26933 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 26934 journal = {SIAM Journal on Control and Optimization}, 26935 year = {1971}, 26936 volume = {9}, 26937 pages = {385--392} 26938} 26939 26940@Article{ cryer:solution*1, 26941 author = {C. W. Cryer}, 26942 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 26943 journal = {SIAM Journal on Control}, 26944 year = {1971}, 26945 volume = {9}, 26946 pages = {385--392} 26947} 26948 26949@Manual{ culler:split-c, 26950 author = {D. Culler}, 26951 title = {The Split--{C} Programming Language}, 26952 organization = {Computer Science Department, University of California, Berkeley} 26953} 26954 26955@InProceedings{ cun.denker.ea:optimal, 26956 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 26957 title = {Optimal Brain Damage}, 26958 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 26959 year = {1990}, 26960 editor = {D. S. Touretzky}, 26961 publisher = {Morgan Kaufmann}, 26962 address = {San Mateo, California}, 26963 pages = {598--605} 26964} 26965 26966@TechReport{ czyzyk.mehrotra.ea:pcx, 26967 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 26968 title = {{PCx} Users Guide}, 26969 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 26970 University}, 26971 year = {1996}, 26972 type = {Technical Report}, 26973 number = {OTC 96/01} 26974} 26975 26976@TechReport{ czyzyk.mesnier.ea:network-enabled, 26977 address = {Argonne, Illinois}, 26978 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 26979 institution = {Argonne National Laboratory}, 26980 number = {MCS-P615-0996}, 26981 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 26982 type = {Preprint}, 26983 year = {1996} 26984} 26985 26986@Article{ czyzyk.wisniewski.ea:optimization, 26987 title = {Optimization Case Studies in the {NEOS} Guide}, 26988 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 26989 journal = {SIAM Review}, 26990 volume = {41}, 26991 pages = {148--163}, 26992 year = {1999} 26993} 26994 26995@Article{ dai.laan.ea:simplicial, 26996 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 26997 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 26998 Polyhedron}, 26999 journal = {SIAM Journal on Optimization}, 27000 year = {1991}, 27001 volume = {1}, 27002 pages = {151--165} 27003} 27004 27005@Article{ dai.talman:linear, 27006 author = {Y. Dai and D. Talman}, 27007 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 27008 journal = {Mathematics of Operations Research}, 27009 year = {1993}, 27010 pages = {635--644} 27011} 27012 27013@Book{ daniel:approximate, 27014 author = {J. W. Daniel}, 27015 title = {The approximate minimization of functionals}, 27016 year = {1971}, 27017 publisher = {Prentice-Hall, Inc}, 27018 address = {Englewood Cliffs, New Jersey} 27019} 27020 27021@Article{ danskin:theory, 27022 author = {J. M. Danskin}, 27023 title = {The Theory of Min--Max, with Applications}, 27024 journal = {SIAM Journal on Applied Mathematics}, 27025 year = {1964}, 27026 volume = {14}, 27027 pages = {641--664} 27028} 27029 27030@Book{ danskin:theory*1, 27031 author = {J. M. Danskin}, 27032 title = {The Theory of Min--Max}, 27033 year = {1967}, 27034 publisher = {Springer-Verlag}, 27035 address = {New York} 27036} 27037 27038@InCollection{ dantzig.cottle:positive, 27039 author = {G. B. Dantzig and R. W. Cottle}, 27040 title = {Positive (semi-)definite programming}, 27041 booktitle = {Nonlinear Programming}, 27042 publisher = {North-Holland}, 27043 editor = {J. Abadie}, 27044 address = {Amsterdam}, 27045 year = {1967}, 27046 pages = {55--73} 27047} 27048 27049@Article{ dantzig.manne:complementarity, 27050 author = {G. B. Dantzig and A. S. Manne}, 27051 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 27052 Proportions}, 27053 journal = {Journal of Economic Theory}, 27054 year = {1974}, 27055 volume = {9}, 27056 pages = {312--323} 27057} 27058 27059@Article{ dantzig.wolfe:decomposition, 27060 author = {G. B. Dantzig and P. Wolfe}, 27061 title = {Decomposition Principle for Linear Programs}, 27062 journal = {Operations Research}, 27063 year = {1960}, 27064 volume = {8}, 27065 pages = {101--111} 27066} 27067 27068@Book{ dantzig:linear, 27069 author = {G. B. Dantzig}, 27070 title = {Linear Programming and Extensions}, 27071 year = {1963}, 27072 publisher = {Princeton University Press}, 27073 address = {Princeton, New Jersey} 27074} 27075 27076@Manual{ dash:xpress-mp, 27077 title = {{XPRESS-MP} User Guide}, 27078 organization = {Dash Associates}, 27079 address = {Blisworth House, Blisworth, Northants, UK}, 27080 note = {http://www.dashopt.com/} 27081} 27082 27083@Book{ davis:handbook, 27084 author = {L. D. Davis}, 27085 title = {The Handbook of Genetic Algorithms}, 27086 year = {1990}, 27087 publisher = {Van Nostrand Reinhold} 27088} 27089 27090@TechReport{ davis:users, 27091 author = {T. A. Davis}, 27092 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 27093 type = {{Technical Report}}, 27094 year = {1993}, 27095 institution = {Computer and Information Sciences Department, University of Florida}, 27096 address = {Gainesville, Florida} 27097} 27098 27099@TechReport{ dax:computation, 27100 author = {A. Dax}, 27101 title = {The Computation of Descent Directions at Degenerate Points}, 27102 institution = {Hydrological Service of Israel}, 27103 year = {1985}, 27104 type = {Technical Report} 27105} 27106 27107@Article{ dax:note, 27108 author = {A. Dax}, 27109 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 27110 Problem}, 27111 journal = {Mathematical Programming}, 27112 year = {1986}, 27113 volume = {36}, 27114 pages = {72--80} 27115} 27116 27117@Article{ deasy:multiple, 27118 author = {J. O. Deasy}, 27119 title = {Multiple local minima in radiotherapy optimization problems with dose volume 27120 constraints}, 27121 journal = {Medical Physics}, 27122 year = {1997}, 27123 optvolume = {24}, 27124 optnumber = {7}, 27125 optpages = {1157-1161} 27126} 27127 27128@Article{ deboor.ron:computational, 27129 author = {C. {deBoor} and A. Ron}, 27130 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 27131 journal = {Mathematics of Computation}, 27132 year = {1992}, 27133 volume = {58}, 27134 pages = {705--727} 27135} 27136 27137@Article{ debremaecker.ferris.ea:compressional, 27138 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 27139 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 27140 Problems}, 27141 year = {2000}, 27142 key = {82}, 27143 journal = {Engineering Fracture Mechanics}, 27144 volume = {66}, 27145 pages = {287--303} 27146} 27147 27148@Article{ debremaecker.ferris:comparison, 27149 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 27150 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 27151 year = {2000}, 27152 key = {90}, 27153 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 27154 journal = {Engineering Fracture Mechanics}, 27155 volume = {66}, 27156 pages = {601--605}, 27157 institution = {Computer Sciences Department, University of Wisconsin}, 27158 address = {Madison, Wisconsin}, 27159 number = {00-01} 27160} 27161 27162@Article{ dedonato.maier:mathematical, 27163 author = {O. {De~Donato} and G. Maier}, 27164 title = {Mathematical programming methods for the inelastic analysis of reinforced 27165 concrete frames allowing for limited rotation capacity}, 27166 journal = {International Journal for Numerical Methods in Engineering}, 27167 volume = {4}, 27168 year = {1972}, 27169 pages = {307--329} 27170} 27171 27172@Book{ deimling:nonlinear, 27173 author = {K. Deimling}, 27174 title = {Nonlinear Functional Analysis}, 27175 publisher = {Springer-Verlag}, 27176 year = {1985} 27177} 27178 27179@PhDThesis{ dejong:analysis, 27180 author = {K. A. De~Jong}, 27181 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 27182 year = {1975}, 27183 school = {University of Michigan}, 27184 note = {Dissertation Abstracts International 36(10), 5140B} 27185} 27186 27187@Article{ deleone.mangasarian.ea:multi-sweep, 27188 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 27189 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 27190 Linear Complementarity Problem}, 27191 journal = {Annals of Operations Research}, 27192 year = {1990}, 27193 volume = {22}, 27194 pages = {43--54} 27195} 27196 27197@InCollection{ deleone.mangasarian:serial, 27198 author = {R. {De~Leone} and O. L. Mangasarian}, 27199 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 27200 {L}agrangian Successive Overrelaxation}, 27201 booktitle = {Optimization, Parallel Processing and Applications}, 27202 publisher = {Springer-Verlag}, 27203 year = {1988}, 27204 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 27205 volume = {304}, 27206 series = {Lecture Notes in Economics and Mathematical Systems}, 27207 pages = {103--124}, 27208 address = {Berlin} 27209} 27210 27211@TechReport{ deluca.facchinei.ea:combining, 27212 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27213 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 27214 Complementarity Problems: Theory and Numerical Results}, 27215 type = {Preprint}, 27216 institution = {Institute of Applied Mathematics, University of Hamburg}, 27217 year = {1996} 27218} 27219 27220@TechReport{ deluca.facchinei.ea:general, 27221 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27222 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 27223 Numerical Results}, 27224 type = {Preprint}, 27225 institution = {Institute of Applied Mathematics, University of Hamburg}, 27226 year = {1997} 27227} 27228 27229@Article{ deluca.facchinei.ea:semismooth, 27230 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27231 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 27232 Problems}, 27233 journal = {Mathematical Programming}, 27234 volume = {75}, 27235 pages = {407--439}, 27236 year = {1996} 27237} 27238 27239@Article{ deluca.facchinei.ea:theoretical, 27240 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27241 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 27242 Complementarity Problems}, 27243 year = {1999}, 27244 journal = {Computational Optimization and Applications, forthcoming} 27245} 27246 27247@Article{ demarzo.eaves:computing, 27248 author = {P. M. DeMarzo and B. C. Eaves}, 27249 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 27250 journal = {Journal of Mathematical Economics}, 27251 year = {1996}, 27252 volume = {26}, 27253 pages = {479--497} 27254} 27255 27256@Article{ dembo.steihaug:truncated, 27257 author = {R. S. Dembo and T. Steihaug}, 27258 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 27259 Optimization}, 27260 journal = {Mathematical Programming}, 27261 year = {1983}, 27262 volume = {26}, 27263 pages = {190--212} 27264} 27265 27266@Article{ dembo:performance, 27267 author = {R. S. Dembo}, 27268 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 27269 journal = {Mathematical Programming Study}, 27270 year = {1986}, 27271 volume = {26}, 27272 pages = {245--248} 27273} 27274 27275@Article{ demoor.vandenberghe.ea:generalized, 27276 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 27277 title = {The generalized linear complementarity problem and an algorithm to find all its 27278 solutions}, 27279 journal = {Mathematical Programming}, 27280 volume = {57}, 27281 year = {1992}, 27282 pages = {415--426} 27283} 27284 27285@Book{ demyanov.vasilev:nondifferentiable, 27286 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 27287 title = {Nondifferentiable Optimization}, 27288 publisher = {Optimization Software, Inc.}, 27289 year = {1985}, 27290 address = {New York} 27291} 27292 27293@Article{ dennis.torczon:direct, 27294 author = {J. E. Dennis and V. Torczon}, 27295 title = {Direct Search Methods on Parallel Machines}, 27296 journal = {SIAM Journal on Optimization}, 27297 year = {1991}, 27298 volume = {1}, 27299 pages = {448--474} 27300} 27301 27302@TechReport{ depierro.iusem:convergence, 27303 author = {A. R. {De~Pierro} and A. N. Iusem}, 27304 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 27305 Linear Complementarity Problems}, 27306 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 27307 year = {1990}, 27308 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 27309} 27310 27311@Article{ depierro.iusem:relaxed, 27312 author = {A. R. {De~Pierro} and A. N. Iusem}, 27313 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 27314 journal = {Journal of Optimization Theory and Applications}, 27315 year = {1986}, 27316 volume = {51}, 27317 pages = {421--440} 27318} 27319 27320@Book{ dervis.melo.ea:general, 27321 author = {K. Dervis and J. de Melo and S. Robinson}, 27322 title = {General Equilibrium Models of Development Policy}, 27323 publisher = {Cambridge University Press}, 27324 year = {1982}, 27325 address = {Cambridge, England} 27326} 27327 27328@Article{ deschutter.demoor:minimal, 27329 author = {B. {De~Schutter} and B. {De~Moor}}, 27330 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 27331 Problem}, 27332 journal = {Systems \& Control Letters}, 27333 year = {1995}, 27334 pages = {103--111} 27335} 27336 27337@Article{ desilets.golden.ea:predicting, 27338 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 27339 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 27340 journal = {Computers \& Operations Research}, 27341 year = {1992}, 27342 volume = {19}, 27343 pages = {277--285} 27344} 27345 27346@PhDThesis{ desilva:sensitivity, 27347 author = {A. H. DeSilva}, 27348 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 27349 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 27350 Production}, 27351 school = {George Washington University}, 27352 address = {Washington, D.C.}, 27353 year = {1978} 27354} 27355 27356@TechReport{ dijkstra:cooperating, 27357 author = {E. W. Dijkstra}, 27358 title = {Cooperating Sequential Processes}, 27359 institution = {Technological University}, 27360 year = {1965}, 27361 address = {Eindhoven, The Netherlands}, 27362 number = {EWD--123}, 27363 type = {Technical Report} 27364} 27365 27366@Article{ dikin:iterative, 27367 author = {I. I. Dikin}, 27368 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 27369 journal = {Soviet Mathematics Doklady}, 27370 year = {1967}, 27371 volume = {8}, 27372 pages = {674--675} 27373} 27374 27375@InCollection{ dipillo.grippo.ea:class, 27376 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 27377 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 27378 booktitle = {System Modelling and Optimization}, 27379 year = {1981}, 27380 editor = {R. F. Drenick and F. Kozin}, 27381 publisher = {Springer-Verlag}, 27382 address = {Berlin} 27383} 27384 27385@Article{ dipillo.grippo:augmented, 27386 author = {G. Di~Pillo and L. Grippo}, 27387 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 27388 Problems}, 27389 journal = {Journal of Optimization Theory and Applications}, 27390 year = {1982}, 27391 volume = {36}, 27392 pages = {495--519} 27393} 27394 27395@Article{ dipillo.grippo:class, 27396 author = {G. Di~Pillo and L. Grippo}, 27397 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 27398 journal = {SIAM Journal on Control and Optimization}, 27399 year = {1979}, 27400 volume = {17}, 27401 pages = {618--628} 27402} 27403 27404@Article{ dipillo.grippo:continuously, 27405 author = {G. Di~Pillo and L. Grippo}, 27406 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 27407 Problems with Inequality Constraints}, 27408 journal = {SIAM Journal on Control and Optimization}, 27409 year = {1985}, 27410 volume = {23}, 27411 pages = {72--84} 27412} 27413 27414@Article{ dipillo.grippo:exact, 27415 author = {G. Di~Pillo and L. Grippo}, 27416 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 27417 Programming Problems}, 27418 journal = {Mathematical Programming}, 27419 year = {1986}, 27420 volume = {36}, 27421 pages = {1--18} 27422} 27423 27424@TechReport{ dirkse.ferris.ea:gams, 27425 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 27426 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 27427 institution = {Computer Sciences Department, University of Wisconsin}, 27428 year = {1994}, 27429 address = {Madison, Wisconsin}, 27430 number = {94-07}, 27431 type = {Mathematical Programming Technical Report}, 27432 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 27433 key = {25} 27434} 27435 27436@InProceedings{ dirkse.ferris:crash, 27437 crossref = {ferris.pang:complementarity}, 27438 author = {S. P. Dirkse and M. C. Ferris}, 27439 title = {Crash Techniques for Large-Scale Complementarity Problems}, 27440 pages = {40--61}, 27441 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 27442 key = {52} 27443} 27444 27445@Article{ dirkse.ferris:mcplib, 27446 author = {S. P. Dirkse and M. C. Ferris}, 27447 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 27448 journal = {Optimization Methods and Software}, 27449 pages = {319--345}, 27450 volume = {5}, 27451 year = {1995}, 27452 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 27453 key = {36} 27454} 27455 27456@InCollection{ dirkse.ferris:modeling, 27457 author = {S. P. Dirkse and M. C. Ferris}, 27458 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 27459 year = {1999}, 27460 pages = {127--148}, 27461 editor = {M. Fukushima and L. Qi}, 27462 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 27463 publisher = {Kluwer Academic Publishers}, 27464 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 27465 key = {62} 27466} 27467 27468@Article{ dirkse.ferris:path, 27469 author = {S. P. Dirkse and M. C. Ferris}, 27470 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 27471 Complementarity Problems}, 27472 journal = {Optimization Methods and Software}, 27473 pages = {123--156}, 27474 volume = {5}, 27475 year = {1995}, 27476 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 27477 key = {33} 27478} 27479 27480@Article{ dirkse.ferris:pathsearch, 27481 author = {S. P. Dirkse and M. C. Ferris}, 27482 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 27483 journal = {Annals of Operations Research}, 27484 vol = {68}, 27485 year = {1996}, 27486 pages = {211--232}, 27487 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 27488 key = {39} 27489} 27490 27491@InCollection{ dirkse.ferris:traffic, 27492 author = {S. P. Dirkse and M. C. Ferris}, 27493 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 27494 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 27495 Management}, 27496 publisher = {Springer-Verlag}, 27497 year = {1998}, 27498 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 27499 series = {NATO ASI Series F}, 27500 volume = {166}, 27501 pages = {136--163}, 27502 key = {61}, 27503 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 27504} 27505 27506@PhDThesis{ dirkse:robust, 27507 author = {S. P. Dirkse}, 27508 title = {Robust Solution of Mixed Complementarity Problems}, 27509 school = {Computer Sciences Department, University of Wisconsin}, 27510 year = {1994}, 27511 address = {Madison, Wisconsin}, 27512 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 27513 annote = {Mathematical Programming Technical Report 94-12} 27514} 27515 27516@TechReport{ dixon.mills:neural, 27517 author = {L. C. Dixon and D. J. Mills}, 27518 title = {Neural Nets for Massively Parallel Optimisation}, 27519 institution = {Hatfield Polytechnic}, 27520 year = {1992}, 27521 address = {Hatfield, Hertforshire, England}, 27522 number = {Numerical Optimisation Centre Technical Report No. 259} 27523} 27524 27525@Article{ dontchev:local, 27526 author = {A. L. Dontchev}, 27527 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 27528 journal = {C.R. Acad. Sci. Paris Series I}, 27529 year = {1996}, 27530 volume = {332}, 27531 pages = {327--331} 27532} 27533 27534@Article{ douglas.rachford:numerical, 27535 author = {J. Douglas and H. H. Rachford}, 27536 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 27537 Variables}, 27538 journal = {Transactions of the American Mathematical Society}, 27539 year = {1956}, 27540 volume = {82}, 27541 pages = {421--439} 27542} 27543 27544@Article{ drud:conopt, 27545 author = {A. Drud}, 27546 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 27547 Problems}, 27548 journal = {Mathematical Programming}, 27549 year = {1985}, 27550 volume = {31}, 27551 pages = {153--191} 27552} 27553 27554@Article{ dsouza.meyer.ea:mixed, 27555 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27556 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27557 Optimization}, 27558 journal = {Medical Physics}, 27559 year = {1999}, 27560 key = {85}, 27561 volume = {26}, 27562 number = {6}, 27563 pages = {1099} 27564} 27565 27566@TechReport{ dsouza.meyer.ea:mixed*1, 27567 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27568 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27569 Optimization}, 27570 year = {1999}, 27571 key = {87}, 27572 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 27573 institution = {Computer Sciences Department, University of Wisconsin}, 27574 address = {Madison, Wisconsin}, 27575 number = {99-08}, 27576 type = {Mathematical Programming Technical Report}, 27577 annote = {Submitted to } 27578} 27579 27580@Article{ dsouza.meyer.ea:iterative, 27581 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 27582 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 27583 Brachytherapy Treatment Optimization}, 27584 year = {2000}, 27585 key = {96}, 27586 journal = {Physics and Medicine in Biology, forthcoming} 27587} 27588 27589@Article{ du.yu.ea:multileaf, 27590 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 27591 G. Gustafson and A. Martinez and J. W. Wong}, 27592 title = {A multileaf collimator field prescription preparation system for conventional 27593 radiotherapy}, 27594 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27595 year = {1994}, 27596 volume = {30}, 27597 number = {3}, 27598 pages = {707--714} 27599} 27600 27601@Article{ duda.fossum:pattern, 27602 author = {R. O. Duda and H. Fossum}, 27603 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 27604 Discriminant Functions}, 27605 journal = {IEEE Transactions on Electronic Computers}, 27606 year = {1966}, 27607 volume = {15}, 27608 pages = {220--232} 27609} 27610 27611@Book{ duda.hart:pattern, 27612 author = {R. O. Duda and P. E. Hart}, 27613 title = {Pattern Classification and Scene Analysis}, 27614 year = {1973}, 27615 publisher = {John Wiley \& Sons}, 27616 address = {New York} 27617} 27618 27619@Book{ duff.erisman.ea:direct, 27620 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 27621 title = {Direct Methods for Sparse Matrices}, 27622 publisher = {Oxford University Press}, 27623 year = {1986}, 27624 address = {Oxford, England} 27625} 27626 27627@InCollection{ duffin:infinite, 27628 author = {R. J. Duffin}, 27629 title = {Infinite Programs}, 27630 booktitle = {Linear Inequalities and Related Systems}, 27631 year = {1975}, 27632 editor = {H. W. Kuhn and A. W. Tucker}, 27633 publisher = {Princeton University Press}, 27634 address = {Princeton, New Jersey}, 27635 pages = {157--170} 27636} 27637 27638@Article{ dunn.sachs:effect, 27639 author = {J. C. Dunn and E. Sachs}, 27640 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 27641 journal = {Applied Mathematics and Optimization}, 27642 year = {1983}, 27643 volume = {10}, 27644 pages = {143--157} 27645} 27646 27647@Article{ dunn:convergence, 27648 author = {J. C. Dunn}, 27649 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 27650 journal = {Journal of Optimization Theory and Applications}, 27651 year = {1987}, 27652 volume = {55}, 27653 pages = {203--216} 27654} 27655 27656@Article{ dunn:global, 27657 author = {J. C. Dunn}, 27658 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 27659 Gradient Processes}, 27660 journal = {SIAM Journal on Control and Optimization}, 27661 year = {1981}, 27662 volume = {19}, 27663 pages = {368--400} 27664} 27665 27666@Article{ dunn:rates, 27667 author = {J. C. Dunn}, 27668 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 27669 Nonsingular Extremals}, 27670 journal = {SIAM Journal on Control and Optimization}, 27671 year = {1979}, 27672 volume = {17}, 27673 pages = {187--211} 27674} 27675 27676@Article{ dupuis.simha:sampling, 27677 author = {P. Dupuis and R. Simha}, 27678 title = {On Sampling-Controlled Stochastic Approximation}, 27679 journal = {{IEEE} Transactions on Automatic Control}, 27680 year = {1991}, 27681 volume = {36}, 27682 pages = {915--924} 27683} 27684 27685@TechReport{ eager.ferris.ea:models, 27686 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27687 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 27688 institution = {Computer Sciences Department, University of Wisconsin}, 27689 year = {1999}, 27690 type = {Technical Report}, 27691 number = {1402}, 27692 address = {Madison, Wisconsin}, 27693 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 27694 key = {84} 27695} 27696 27697@InProceedings{ eager.ferris.ea:optimized, 27698 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27699 title = {Optimized Regional Caching for On-Demand Data Delivery}, 27700 year = {1999}, 27701 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 27702 volume = {3654}, 27703 address = {Bellingham, Washington}, 27704 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 27705 key = {69}, 27706 pages = {301--316}, 27707 annote = {18 percent acceptance rate} 27708} 27709 27710@Article{ eager.ferris.ea:optimized*1, 27711 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27712 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 27713 journal = {Performance Evaluation}, 27714 year = {2000}, 27715 key = {72}, 27716 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 27717 volume = {42}, 27718 pages = {163--185} 27719} 27720 27721@InProceedings{ eager.vernon:dynamic, 27722 author = {D. L. Eager and M. K. Vernon}, 27723 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 27724 year = {1998}, 27725 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 27726 ({MIS '98})}, 27727 pages = {18--32}, 27728 address = {Istanbul, Turkey} 27729} 27730 27731@Article{ eaves.lemke:equivalence, 27732 author = {B. C. Eaves and C. E. Lemke}, 27733 title = {Equivalence of {LCP} and {PLS}}, 27734 journal = {Mathematics of Operations Research}, 27735 year = {1981}, 27736 volume = {6}, 27737 pages = {475--484} 27738} 27739 27740@Article{ eaves.rothblum:relationships, 27741 author = {B. C. Eaves and U. G. Rothblum}, 27742 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 27743 journal = {Linear Algebra and Its Applications}, 27744 year = {1990}, 27745 volume = {132}, 27746 pages = {1--63} 27747} 27748 27749@Article{ eaves:basic, 27750 author = {B. C. Eaves}, 27751 title = {On the Basic Theorem of Complementarity}, 27752 journal = {Mathematical Programming}, 27753 year = {1971}, 27754 volume = {1}, 27755 pages = {68--87} 27756} 27757 27758@Article{ eaves:computing, 27759 author = {B. C. Eaves}, 27760 title = {Computing Stationary Points}, 27761 journal = {Mathematical Programming Study}, 27762 year = {1978}, 27763 volume = {7}, 27764 pages = {1--14} 27765} 27766 27767@InCollection{ eaves:computing*1, 27768 author = {B. C. Eaves}, 27769 title = {Computing Stationary Points, Again}, 27770 pages = {391--405}, 27771 crossref = {mangasarian.meyer.ea:nonlinear*3} 27772} 27773 27774@Article{ eaves:homotopies, 27775 author = {B. C. Eaves}, 27776 title = {Homotopies for Computation of Fixed Points}, 27777 journal = {Mathematical Programming}, 27778 year = {1972}, 27779 volume = {3}, 27780 pages = {1--22} 27781} 27782 27783@Article{ eaves:linear, 27784 author = {B. C. Eaves}, 27785 title = {The Linear Complementarity Problem}, 27786 journal = {Management Science}, 27787 year = {1971}, 27788 volume = {17}, 27789 pages = {612--634} 27790} 27791 27792@Article{ eaves:quadratic, 27793 author = {B. C. Eaves}, 27794 title = {On Quadratic Programming}, 27795 journal = {Management Science}, 27796 year = {1971}, 27797 volume = {17}, 27798 pages = {698--711} 27799} 27800 27801@InProceedings{ eaves:short, 27802 author = {B. C. Eaves}, 27803 title = {A Short Course in Solving Equations with {PL} Homotopies}, 27804 booktitle = {Nonlinear Programming}, 27805 organization = {American Mathematical Society}, 27806 year = {1976}, 27807 editor = {R. W. Cottle and C. E. Lemke}, 27808 publisher = {SIAM--AMS Proceedings}, 27809 address = {Providence, RI}, 27810 pages = {73--143} 27811} 27812 27813@InCollection{ ebiefung.kostreva:global, 27814 author = {A. A. Ebiefung and M. M. Kostreva}, 27815 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 27816 Class of Polynomial Complementarity Problems}, 27817 editors = {C. Floudas and P. Pardalos}, 27818 booktitle = {Recent Advances in Global Optimization}, 27819 publisher = {Princeton University Press}, 27820 pages = {102--124}, 27821 year = {1991} 27822} 27823 27824@TechReport{ ebiefung.kostreva:z-matrices, 27825 author = {A. A. Ebiefung and M. M. Kostreva}, 27826 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 27827 institution = {Department of Mathematical Sciences, Clemson University}, 27828 year = {1991}, 27829 number = {608}, 27830 address = {Clemson, South Carolina} 27831} 27832 27833@TechReport{ eckstein.bertsekas:alternating, 27834 author = {J. Eckstein and D. P. Bertsekas}, 27835 title = {An Alternating Direction Method for Linear Programming}, 27836 institution = {Harvard Business School}, 27837 year = {1990}, 27838 type = {Working Paper}, 27839 number = {90-063}, 27840 address = {Boston, MA} 27841} 27842 27843@Article{ eckstein.bertsekas:douglas-rachford, 27844 author = {J. Eckstein and D. P. Bertsekas}, 27845 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 27846 Maximal Monotone Operators}, 27847 journal = {Mathematical Programming}, 27848 year = {1992}, 27849 pages = {293--318}, 27850 volume = {55} 27851} 27852 27853@Article{ eckstein.bertsekas:douglas-rachford*1, 27854 author = {J. Eckstein and D. P. Bertsekas}, 27855 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 27856 for Maximal Monotone Operators}, 27857 journal = {Mathematical Programming}, 27858 year = {1991}, 27859 note = {To appear} 27860} 27861 27862@TechReport{ eckstein.ferris:operator, 27863 author = {J. Eckstein and M. C. Ferris}, 27864 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 27865 institution = {Thinking Machines Corporation}, 27866 year = {1992}, 27867 address = {Cambridge, MA 02142}, 27868 number = {239}, 27869 type = {TMC}, 27870 key = {26} 27871} 27872 27873@Article{ eckstein.ferris:operator*1, 27874 author = {J. Eckstein and M. C. Ferris}, 27875 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 27876 Parallel Application to Optimal Control}, 27877 volume = {10}, 27878 pages = {218--235}, 27879 year = {1998}, 27880 journal = {INFORMS Journal on Computing}, 27881 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 27882 key = {44} 27883} 27884 27885@Article{ eckstein.ferris:smooth, 27886 author = {J. Eckstein and M. C. Ferris}, 27887 title = {Smooth Methods of Multipliers for Complementarity Problems}, 27888 key = {58}, 27889 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 27890 year = {1999}, 27891 journal = {Mathematical Programming}, 27892 volume = {86}, 27893 pages = {65--90} 27894} 27895 27896@InProceedings{ eckstein.hart.ea:resource, 27897 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 27898 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 27899 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 27900 year = {1997}, 27901 note = {www.cs.sandia.gov/ISUG97} 27902} 27903 27904@Article{ eckstein:alternating, 27905 author = {J. Eckstein}, 27906 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 27907 CM-2}}, 27908 journal = {ORSA Journal on Computing}, 27909 year = {to appear} 27910} 27911 27912@Article{ eckstein:approximate, 27913 author = {J. Eckstein}, 27914 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 27915 year = {1998}, 27916 journal = {Mathematical Programming}, 27917 volume = {83}, 27918 pages = {113--124} 27919} 27920 27921@Article{ eckstein:communication, 27922 author = {J. Eckstein}, 27923 title = {How Much Communication Does Parallel Branch and Bound Need}, 27924 journal = {{INFORMS} Journal on Computing}, 27925 volume = {9}, 27926 year = {1997}, 27927 pages = {15--29} 27928} 27929 27930@Article{ eckstein:distributed, 27931 author = {J. Eckstein}, 27932 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 27933 Integer Programming on the {CM}-5}, 27934 journal = {Computational Optimization and Applications}, 27935 volume = {7}, 27936 pages = {199--220}, 27937 year = {1997} 27938} 27939 27940@TechReport{ eckstein:lions-mercier, 27941 author = {J. Eckstein}, 27942 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 27943 as instances of the Proximal Point Algorithm}, 27944 institution = {MIT}, 27945 year = {1988}, 27946 address = {Cambridge, Massachusetts}, 27947 number = {LIDS-P-1769} 27948} 27949 27950@Article{ eckstein:nonlinear, 27951 author = {J. Eckstein}, 27952 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 27953 to Convex Programming}, 27954 journal = {Mathematics of Operations Research}, 27955 year = {1993}, 27956 pages = {202--226}, 27957 volume = {18} 27958} 27959 27960@Article{ eckstein:parallel, 27961 author = {J. Eckstein}, 27962 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 27963 {CM}-5}, 27964 journal = {SIAM Journal on Optimization}, 27965 volume = {4}, 27966 pages = {794--814}, 27967 year = {1994} 27968} 27969 27970@TechReport{ eckstein:smooth, 27971 author = {J. Eckstein}, 27972 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 27973 institution = {Rutgers Center for Operations Research, Rutgers University}, 27974 address = {New Brunswick, New Jersey}, 27975 year = {1996}, 27976 type = {Research Report}, 27977 number = {27-96} 27978} 27979 27980@PhDThesis{ eckstein:splitting, 27981 author = {J. Eckstein}, 27982 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 27983 Optimization}, 27984 school = {Massachusetts Institute of Technology}, 27985 year = {1989}, 27986 address = {Cambridge, MA}, 27987 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 27988} 27989 27990@Article{ eglese:simulated, 27991 author = {R. W. Eglese}, 27992 title = {Simulated Annealing: {A} Tool for Operational Research}, 27993 journal = {European Journal of Operations Research}, 27994 year = {1990}, 27995 volume = {46}, 27996 pages = {271--281} 27997} 27998 27999@Book{ ekeland.temam:convex, 28000 author = {I. Ekeland and R. Temam}, 28001 title = {Convex Analysis and Variational Problems}, 28002 year = {1976}, 28003 publisher = {North--Holland}, 28004 address = {Amsterdam} 28005} 28006 28007@Article{ ekeland:variational, 28008 author = {I. Ekeland}, 28009 title = {On the Variational Principle}, 28010 journal = {Journal of Mathematical Analysis and Applications}, 28011 year = {1974}, 28012 volume = {47}, 28013 pages = {324--353} 28014} 28015 28016@TechReport{ el-bakry.tapia.ea:formulation, 28017 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 28018 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 28019 for nonlinear programming}, 28020 type = {{Technical Report TR92-40}}, 28021 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 28022 year = {1992} 28023} 28024 28025@Article{ eldersveld.saunders:block, 28026 author = {S. K. Eldersveld and M. A. Saunders}, 28027 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 28028 journal = {SIAM Journal on Matrix Analysis and Applications}, 28029 year = {1992}, 28030 volume = {13}, 28031 pages = {191--201} 28032} 28033 28034@Article{ elster.neumaier:grid, 28035 author = {C. Elster and A. Neumaier}, 28036 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 28037 journal = {{IMA} Journal of Numerical Analysis}, 28038 year = {1995}, 28039 volume = {15}, 28040 pages = {585--608} 28041} 28042 28043@Article{ epema.livny.ea:worldwide, 28044 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 28045 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 28046 journal = {Journal on Future Generations of Computer Systems}, 28047 year = {1996}, 28048 volume = {12}, 28049 pages = {53--65} 28050} 28051 28052@Book{ ermoliev.editors:numerical, 28053 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 28054 title = {Numerical Techniques for Stochastic Optimization Problems}, 28055 year = {1988}, 28056 publisher = {Springer-Verlag}, 28057 address = {Berlin} 28058} 28059 28060@TechReport{ evett.spiehler:rule, 28061 author = {I. W. Evett and E. J. Spiehler}, 28062 title = {Rule Induction in Forensic Science}, 28063 institution = {Central Research Establishment, Home Office Forensic Science Service}, 28064 year = {1987}, 28065 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 28066 type = {Technical Report} 28067} 28068 28069@Article{ evtushenko.purtov:sufficient, 28070 author = {Y. G. Evtushenko and V. A. Purtov}, 28071 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 28072 journal = {Soviet Mathematics Doklady}, 28073 year = {1984}, 28074 volume = {30}, 28075 pages = {313--316} 28076} 28077 28078@Article{ facchinei.fischer.ea:regularity, 28079 author = {F. Facchinei and A. Fischer and C. Kanzow}, 28080 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 28081 journal = {SIAM Journal on Optimization}, 28082 year = {1998}, 28083 volume = {8}, 28084 pages = {850--869} 28085} 28086 28087@Article{ facchinei.fischer.ea:semismooth, 28088 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 28089 Constraints}, 28090 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 28091 journal = {Complementarity and Variational Problems: State of the Art}, 28092 volume = {92}, 28093 pages = {76}, 28094 year = {1997} 28095} 28096 28097@TechReport{ facchinei.fischer.ea:simply, 28098 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 28099 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 28100 Variational Inequalities}, 28101 institution = {University of Hamburg}, 28102 year = {1996} 28103} 28104 28105@Article{ facchinei.jiang.ea:smoothing, 28106 author = {F. Facchinei and H. Jiang and L. Qi}, 28107 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 28108 year = {1999}, 28109 journal = {Mathematical Programming}, 28110 volume = {85}, 28111 pages = {107--134} 28112} 28113 28114@Article{ facchinei.kanzow:nonsmooth, 28115 author = {F. Facchinei and C. Kanzow}, 28116 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 28117 Complementarity Problems}, 28118 year = {1997}, 28119 journal = {Mathematical Programming}, 28120 volume = {76}, 28121 pages = {493--512} 28122} 28123 28124@Article{ facchinei.kanzow:unconstrained, 28125 author = {F. Facchinei and C. Kanzow}, 28126 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 28127 {L}agrangian}, 28128 year = {1997}, 28129 journal = {Journal of Optimization Theory and Applications}, 28130 volume = {92}, 28131 pages = {99--115} 28132} 28133 28134@TechReport{ facchinei.pang:total, 28135 author = {F. Facchinei and J. S. Pang}, 28136 title = {Total stability of variational inequalities}, 28137 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 28138 year = {1988}, 28139 type = {Manuscript}, 28140 address = {Roma, Italy} 28141} 28142 28143@Article{ facchinei.soares:merit, 28144 author = {F. Facchinei and J. Soares}, 28145 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 28146 Algorithm}, 28147 journal = {SIAM Journal on Optimization}, 28148 year = {1997}, 28149 volume = {7}, 28150 pages = {225--247} 28151} 28152 28153@InCollection{ facchinei.soares:testing, 28154 author = {F. Facchinei and J. Soares}, 28155 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 28156 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 28157 publisher = {Plenum Press}, 28158 address = {New York}, 28159 editor = {F. Giannessi and A. Maugeri}, 28160 year = {1995}, 28161 pages = {69--83} 28162} 28163 28164@InProceedings{ fahlman.lebiere:cascade-correlation, 28165 author = {S. E. Fahlman and C. Lebiere}, 28166 title = {The cascade-correlation learning architecture}, 28167 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 28168 year = {1990}, 28169 editor = {D. S. Touretzky}, 28170 publisher = {Morgan Kaufmann}, 28171 address = {San Mateo, California}, 28172 pages = {524--532} 28173} 28174 28175@InProceedings{ fang.geiser.ea:software, 28176 author = {G. Fang and B. Geiser and T. R. Mackie}, 28177 title = {Software system for {UW}/{GE} tomotherapy prototype}, 28178 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 28179 Radiation Therapy, Salt Lake City}, 28180 year = {1997}, 28181 editor = {D. D. Leavitt and G. Starkshall}, 28182 publisher = {Medical Physics Publishing}, 28183 address = {St. Louis, Missouri}, 28184 pages = {332--334} 28185} 28186 28187@Book{ fang.puthenpura:linear, 28188 author = {S.--C. Fang and S. Puthenpura}, 28189 title = {Linear Optimization and Extensions}, 28190 year = {1993}, 28191 publisher = {Prentice-Hall, Inc}, 28192 address = {Englewood Cliffs, New Jersey} 28193} 28194 28195@Article{ fayard.plateau:algorithm, 28196 author = {D. Fayard and G. Plateau}, 28197 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 28198 journal = {Computing}, 28199 year = {1982}, 28200 volume = {28}, 28201 pages = {269--287} 28202} 28203 28204@Book{ feller:introduction, 28205 author = {W. Feller}, 28206 title = {An Introduction to Probability Theory and its Applications}, 28207 publisher = {John Wiley \& Sons}, 28208 year = {1968}, 28209 address = {New York} 28210} 28211 28212@Article{ ferris.fourer.ea:expressing, 28213 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 28214 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 28215 journal = {SIAM Journal on Optimization}, 28216 volume = {9}, 28217 pages = {991--1009}, 28218 year = {1999}, 28219 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 28220 key = {65}, 28221 institution = {Computer Sciences Department, University of Wisconsin}, 28222 address = {Madison, Wisconsin}, 28223 number = {98-02}, 28224 type = {Mathematical Programming Technical Report} 28225} 28226 28227@TechReport{ ferris.horn:nlp2mcp, 28228 author = {M. C. Ferris and J. D. Horn}, 28229 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 28230 problems}, 28231 year = {1998}, 28232 institution = {Computer Sciences Department, University of Wisconsin}, 28233 note = {In preparation} 28234} 28235 28236@Article{ ferris.horn:partitioning, 28237 author = {M. C. Ferris and J. D. Horn}, 28238 title = {Partitioning Mathematical Programs for Parallel Solution}, 28239 year = {1998}, 28240 volume = {80}, 28241 pages = {35--62}, 28242 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 28243 journal = {Mathematical Programming}, 28244 key = {40} 28245} 28246 28247@Article{ ferris.kanzow.ea:feasible, 28248 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 28249 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 28250 year = {1999}, 28251 journal = {Mathematical Programming}, 28252 volume = {86}, 28253 pages = {475--497}, 28254 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 28255 key = {67} 28256} 28257 28258@InCollection{ ferris.kanzow:complementarity, 28259 author = {M. C. Ferris and C. Kanzow}, 28260 title = {Complementarity and Related Problems: {A} Survey}, 28261 booktitle = {Handbook of Applied Optimization, forthcoming}, 28262 key = {74}, 28263 publisher = {Oxford University Press}, 28264 year = {2000}, 28265 editor = {P. M. Pardalos and M. G. C. Resende}, 28266 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 28267 institution = {Computer Sciences Department, University of Wisconsin}, 28268 address = {Madison, Wisconsin}, 28269 number = {98-17}, 28270 type = {Mathematical Programming Technical Report} 28271} 28272 28273@Article{ ferris.lucidi.ea:nonmonotone, 28274 author = {M. C. Ferris and S. Lucidi and M. Roma}, 28275 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 28276 journal = {Computational Optimization and Applications}, 28277 volume = {6}, 28278 pages = {117--136}, 28279 year = {1996}, 28280 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 28281 key = {43} 28282} 28283 28284@TechReport{ ferris.lucidi:globally, 28285 author = {M. C. Ferris and S. Lucidi}, 28286 title = {Globally Convergent Methods for Nonlinear Equations}, 28287 institution = {Computer Sciences Department, University of Wisconsin}, 28288 year = {1991}, 28289 address = {Madison, Wisconsin}, 28290 number = {1030}, 28291 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 28292 key = {21} 28293} 28294 28295@Article{ ferris.lucidi:nonmonotone, 28296 author = {M. C. Ferris and S. Lucidi}, 28297 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 28298 journal = {Journal of Optimization Theory and Applications}, 28299 year = {1994}, 28300 volume = {81}, 28301 pages = {53--71}, 28302 key = {30} 28303} 28304 28305@Article{ ferris.mangasarian:breast, 28306 author = {M. C. Ferris and O. L. Mangasarian}, 28307 title = {Breast Cancer Diagnosis via Linear Programming}, 28308 key = {50}, 28309 journal = {{IEEE} Computational Science and Engineering}, 28310 year = {1995}, 28311 volume = {2}, 28312 pages = {70--71} 28313} 28314 28315@Article{ ferris.mangasarian:error, 28316 author = {M. C. Ferris and O. L. Mangasarian}, 28317 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 28318 Inequalities}, 28319 journal = {Annals of Operations Research}, 28320 year = {1993}, 28321 volume = {47}, 28322 pages = {293--305}, 28323 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 28324 key = {24} 28325} 28326 28327@Article{ ferris.mangasarian:finite, 28328 author = {M. C. Ferris and O. L. Mangasarian}, 28329 title = {Finite Perturbation of Convex Programs}, 28330 journal = {Applied Mathematics and Optimization}, 28331 year = {1991}, 28332 volume = {23}, 28333 pages = {263--273}, 28334 key = {08} 28335} 28336 28337@Book{ ferris.mangasarian:linear, 28338 author = {M. C. Ferris and O. L. Mangasarian}, 28339 title = {Linear Programming via {MATLAB}}, 28340 publisher = {in preparation}, 28341 year = {1995}, 28342 address = {Madison, Wisconsin} 28343} 28344 28345@Article{ ferris.mangasarian:minimum, 28346 author = {M. C. Ferris and O. L. Mangasarian}, 28347 title = {Minimum Principle Sufficiency}, 28348 journal = {Mathematical Programming}, 28349 year = {1992}, 28350 volume = {57}, 28351 pages = {1--14}, 28352 key = {11} 28353} 28354 28355@Article{ ferris.mangasarian:parallel, 28356 author = {M. C. Ferris and O. L. Mangasarian}, 28357 title = {Parallel Constraint Distribution}, 28358 journal = {SIAM Journal on Optimization}, 28359 year = {1991}, 28360 volume = {1}, 28361 pages = {487--500}, 28362 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 28363 key = {18} 28364} 28365 28366@Article{ ferris.mangasarian:parallel*1, 28367 author = {M. C. Ferris and O. L. Mangasarian}, 28368 title = {Parallel Variable Distribution}, 28369 journal = {SIAM Journal on Optimization}, 28370 year = {1994}, 28371 volume = {4}, 28372 pages = {815--832}, 28373 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 28374 key = {31} 28375} 28376 28377@Article{ ferris.meeraus.ea:computing, 28378 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 28379 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 28380 journal = {Optimization Methods and Software}, 28381 year = {1999}, 28382 volume = {10}, 28383 pages = {669--685}, 28384 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 28385 key = {45} 28386} 28387 28388@Article{ ferris.mesnier.ea:neos, 28389 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 28390 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 28391 {I}nternet}, 28392 year = {2000}, 28393 journal = {{ACM} Transactions on Mathematical Software}, 28394 key = {54}, 28395 volume = {26}, 28396 pages = {1--18}, 28397 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 28398 institution = {Computer Sciences Department, University of Wisconsin}, 28399 address = {Madison, Wisconsin}, 28400 number = {96-08}, 28401 type = {Mathematical Programming Technical Report}, 28402 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 28403 Argonne National Laboratory}, 28404 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 28405 1996} 28406} 28407 28408@InCollection{ ferris.meyer:models, 28409 author = {M. C. Ferris and R. R. Meyer}, 28410 title = {Models and Solution for On-Demand Data Delivery Problems}, 28411 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 28412 key = {80}, 28413 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 28414 Problems}, 28415 editor = {P. M. Pardalos}, 28416 series = {Nonconvex Optimization and its Applications}, 28417 volume = {42}, 28418 address = {Dordrect}, 28419 year = {2000}, 28420 pages = {175--188}, 28421 publisher = {Kluwer}, 28422 type = {Mathematical Programming Technical Report}, 28423 institution = {Computer Sciences Department, University of Wisconsin}, 28424 number = {99-04} 28425} 28426 28427@InProceedings{ ferris.munson.ea:homotopy, 28428 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 28429 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 28430 booktitle = {Numerical Analysis 1999}, 28431 key = {88}, 28432 year = {2000}, 28433 editor = {D. F. Griffiths and G. A. Watson}, 28434 series = {Research Notes in Mathematics}, 28435 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 28436 address = {London}, 28437 pages = {143--167}, 28438 publisher = {Chapman and Hall}, 28439 institution = {Computer Sciences Department, University of Wisconsin}, 28440 number = {99-09}, 28441 type = {Mathematical Programming Technical Report} 28442} 28443 28444@TechReport{ ferris.munson.ea:practical, 28445 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 28446 title = {A Practical Approach to Sample-Path Simulation Optimization}, 28447 type = {Data Mining Institute Technical Report}, 28448 institution = {Computer Sciences Department, University of Wisconsin}, 28449 address = {Madison, Wisconsin}, 28450 year = {2000}, 28451 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 28452 number = {00-03}, 28453 key = {92}, 28454 annote = {To appear in WSC 2000} 28455} 28456 28457@InCollection{ ferris.munson:case, 28458 author = {M. C. Ferris and T. S. Munson}, 28459 title = {Case Studies in Complementarity: Improving Model Formulation}, 28460 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 28461 key = {73}, 28462 pages = {79--98}, 28463 publisher = {Springer Verlag}, 28464 year = {1999}, 28465 editor = {M. Th\'{e}ra and R. Tichatschke}, 28466 number = {477}, 28467 series = {Lecture Notes in Economics and Mathematical Systems}, 28468 address = {Berlin}, 28469 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 28470 type = {Mathematical Programming Technical Report}, 28471 institution = {Computer Sciences Department, University of Wisconsin} 28472} 28473 28474@Article{ ferris.munson:complementarity, 28475 author = {M. C. Ferris and T. S. Munson}, 28476 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 28477 year = {2000}, 28478 volume = {24}, 28479 pages = {165--188}, 28480 journal = {Journal of Economic Dynamics and Control}, 28481 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 28482 key = {70}, 28483 type = {Mathematical Programming Technical Report}, 28484 institution = {Computer Sciences Department, University of Wisconsin}, 28485 address = {Madison, Wisconsin}, 28486 number = {98-12} 28487} 28488 28489@Misc{ ferris.munson:condor, 28490 author = {M. C. Ferris and T. S. Munson}, 28491 title = {Condor Modeling Language Interface}, 28492 organization = {Computer Sciences Department, University of Wisconsin}, 28493 address = {Madison, Wisconsin}, 28494 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 28495} 28496 28497@Manual{ ferris.munson:gams, 28498 author = {M. C. Ferris and T. S. Munson}, 28499 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 28500 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 28501} 28502 28503@Article{ ferris.munson:interfaces, 28504 author = {M. C. Ferris and T. S. Munson}, 28505 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 28506 journal = {Computational Optimization and Applications}, 28507 volume = {12}, 28508 pages = {207--227}, 28509 year = {1999}, 28510 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 28511 key = {63}, 28512 institution = {Computer Sciences Department, University of Wisconsin}, 28513 address = {Madison, Wisconsin}, 28514 number = {97-12}, 28515 type = {Mathematical Programming Technical Report} 28516} 28517 28518@TechReport{ ferris.munson:interior, 28519 author = {M. C. Ferris and T. S. Munson}, 28520 title = {Interior Point Methods for Massive Support Vector Machines}, 28521 institution = {Computer Sciences Department, University of Wisconsin}, 28522 year = {2000}, 28523 key = {94}, 28524 type = {Data Mining Institute Technical Report}, 28525 number = {00-05}, 28526 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 28527 address = {Madison, Wisconsin}, 28528 annote = {Submitted to SIOPT} 28529} 28530 28531@Article{ ferris.munson:linear, 28532 author = {M. C. Ferris and T. S. Munson}, 28533 title = {Linear Programming for Emergency Broadcast Systems}, 28534 year = {1999}, 28535 journal = {{SIAG/OPT} Newsletter}, 28536 volume = {10}, 28537 pages = {6--8}, 28538 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 28539 key = {76}, 28540 type = {Mathematical Programming Technical Report}, 28541 institution = {Computer Sciences Department, University of Wisconsin}, 28542 address = {Madison, Wisconsin}, 28543 number = {98-20} 28544} 28545 28546@Article{ ferris.munson:modeling, 28547 author = {M. C. Ferris and T. S. Munson}, 28548 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 28549 year = {2000}, 28550 journal = {Mathematical Programming}, 28551 volume = {88}, 28552 pages = {487--506}, 28553 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 28554 key = {71}, 28555 type = {Mathematical Programming Technical Report}, 28556 institution = {Computer Sciences Department, University of Wisconsin}, 28557 address = {Madison, Wisconsin}, 28558 number = {98-13} 28559} 28560 28561@TechReport{ ferris.munson:preprocessing, 28562 author = {M. C. Ferris and T. S. Munson}, 28563 title = {Preprocessing Complementarity Problems}, 28564 type = {Mathematical Programming Technical Report}, 28565 institution = {Computer Sciences Department, University of Wisconsin}, 28566 address = {Madison, Wisconsin}, 28567 year = {1999}, 28568 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 28569 number = {99-07}, 28570 key = {86}, 28571 annote = {Submitted to ICCP 99} 28572} 28573 28574@TechReport{ ferris.munson:semismooth, 28575 author = {M. C. Ferris and T. S. Munson}, 28576 title = {Semismooth Support Vector Machines}, 28577 institution = {Computer Sciences Department, University of Wisconsin}, 28578 year = {2000}, 28579 key = {97}, 28580 type = {Data Mining Institute Technical Report}, 28581 number = {00-09}, 28582 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 28583 address = {Madison, Wisconsin}, 28584 annote = {Submitted to Math Prog B} 28585} 28586 28587@Article{ ferris.pang:engineering, 28588 author = {M. C. Ferris and J. S. Pang}, 28589 title = {Engineering and Economic Applications of Complementarity Problems}, 28590 year = {1997}, 28591 journal = {SIAM Review}, 28592 volume = {39}, 28593 pages = {669--713}, 28594 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 28595 key = {46} 28596} 28597 28598@Article{ ferris.pang:nondegenerate, 28599 author = {M. C. Ferris and J. S. Pang}, 28600 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 28601 journal = {SIAM Journal on Control and Optimization}, 28602 year = {1996}, 28603 volume = {34}, 28604 pages = {244--263}, 28605 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 28606 key = {35} 28607} 28608 28609@Article{ ferris.philpott:affine, 28610 author = {M. C. Ferris and A. B. Philpott}, 28611 title = {On Affine Scaling and Semi--Infinite Programming}, 28612 journal = {Mathematical Programming}, 28613 year = {1992}, 28614 volume = {56}, 28615 pages = {361--364}, 28616 key = {15} 28617} 28618 28619@Article{ ferris.philpott:interior, 28620 author = {M. C. Ferris and A. B. Philpott}, 28621 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 28622 journal = {Mathematical Programming}, 28623 year = {1989}, 28624 volume = {43}, 28625 pages = {257--276}, 28626 key = {04} 28627} 28628 28629@Article{ ferris.philpott:performance, 28630 author = {M. C. Ferris and A. B. Philpott}, 28631 title = {On the Performance of {K}armarkar's Algorithm}, 28632 journal = {Journal of the Operational Research Society}, 28633 year = {1988}, 28634 volume = {39}, 28635 pages = {257--270}, 28636 key = {03} 28637} 28638 28639@InCollection{ ferris.ralph:projected, 28640 author = {M. C. Ferris and D. Ralph}, 28641 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 28642 Maps}, 28643 booktitle = {Recent Advances in Nonsmooth Optimization}, 28644 publisher = {World Scientific Publishers}, 28645 year = {1995}, 28646 pages = {57--87}, 28647 editor = {D. Du and L. Qi and R. Womersley}, 28648 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 28649 key = {41} 28650} 28651 28652@Article{ ferris.ruszczynski:robust, 28653 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 28654 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 28655 year = {2000}, 28656 journal = {Networks}, 28657 volume = {35}, 28658 pages = {181--194}, 28659 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 28660 key = {60} 28661} 28662 28663@InCollection{ ferris.rutherford:accessing, 28664 author = {M. C. Ferris and T. F. Rutherford}, 28665 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 28666 booktitle = {Nonlinear Optimization and Applications}, 28667 key = {48}, 28668 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 28669 editor = {G. Di Pillo and F. Giannessi}, 28670 year = {1996}, 28671 pages = {141--153}, 28672 publisher = {Plenum Press}, 28673 address = {New York} 28674} 28675 28676@InCollection{ ferris.shepard:optimizing, 28677 author = {M. C. Ferris and D. M. Shepard}, 28678 title = {Optimization of Gamma Knife Radiosurgery}, 28679 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 28680 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 28681 publisher = {AMS}, 28682 year = {2000}, 28683 optseries = {DIMACS}, 28684 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 28685 key = {91}, 28686 type = {Data Mining Institute Technical Report}, 28687 institution = {Computer Sciences Department, University of Wisconsin}, 28688 address = {Madison, Wisconsin}, 28689 number = {00-01} 28690} 28691 28692@InCollection{ ferris.sinapiromsaran:formulating, 28693 author = {M. C. Ferris and K. Sinapiromsaran}, 28694 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 28695 booktitle = {Optimization}, 28696 key = {77}, 28697 publisher = {Springer-Verlag}, 28698 year = {2000}, 28699 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 28700 volume = {481}, 28701 series = {Lecture Notes in Economics and Mathematical Systems}, 28702 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 28703 type = {Mathematical Programming Technical Report}, 28704 institution = {Computer Sciences Department, University of Wisconsin}, 28705 address = {Madison, Wisconsin}, 28706 number = {98-21} 28707} 28708 28709@Article{ ferris.tin-loi:limit, 28710 author = {M. C. Ferris and F. Tin-Loi}, 28711 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 28712 Complementarity Constraints}, 28713 year = {2001}, 28714 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 28715 key = {78}, 28716 journal = {International Journal of Mechanical Sciences}, 28717 pages = {209--224}, 28718 volume = {43}, 28719 type = {Mathematical Programming Technical Report}, 28720 institution = {Computer Sciences Department, University of Wisconsin}, 28721 address = {Madison, Wisconsin}, 28722 number = {99-01} 28723} 28724 28725@Article{ ferris.tin-loi:nonlinear, 28726 author = {M. C. Ferris and F. Tin-Loi}, 28727 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 28728 Elastoplasticity}, 28729 year = {1998}, 28730 key = {64}, 28731 volume = {6}, 28732 pages = {857--870}, 28733 journal = {Structural Engineering and Mechanics} 28734} 28735 28736@Article{ ferris.tin-loi:solution, 28737 author = {M. C. Ferris and F. Tin-Loi}, 28738 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 28739 and Complementarity Constraints}, 28740 year = {1999}, 28741 journal = {Computer Methods in Applied Mechanics and Engineering}, 28742 volume = {174}, 28743 pages = {107--120}, 28744 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 28745 key = {66} 28746} 28747 28748@Article{ ferris.vlach:scheduling, 28749 author = {M. C. Ferris and M. Vlach}, 28750 title = {Scheduling with Earliness and Tardiness Penalties}, 28751 journal = {Naval Research Logistics Quarterly}, 28752 year = {1992}, 28753 volume = {39}, 28754 pages = {229--245}, 28755 key = {13} 28756} 28757 28758@TechReport{ ferris.zavriev:linear, 28759 author = {M. C. Ferris and S. K Zavriev}, 28760 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 28761 institution = {Computer Sciences Department, University of Wisconsin}, 28762 year = {1996}, 28763 key = {56}, 28764 address = {Madison, Wisconsin}, 28765 type = {Mathematical Programming Technical Report}, 28766 number = {96--12}, 28767 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 28768} 28769 28770@Article{ ferris:finite, 28771 author = {M. C. Ferris}, 28772 title = {Finite Termination of the Proximal Point Algorithm}, 28773 journal = {Mathematical Programming}, 28774 year = {1991}, 28775 volume = {50}, 28776 pages = {359--366}, 28777 key = {06} 28778} 28779 28780@Article{ ferris:iterative, 28781 author = {M. C. Ferris}, 28782 title = {Iterative Linear Programming Solution of Convex Programs}, 28783 journal = {Journal of Optimization Theory and Applications}, 28784 year = {1990}, 28785 volume = {65}, 28786 pages = {53--65}, 28787 key = {07} 28788} 28789 28790@Article{ ferris:linear, 28791 author = {M. C. Ferris}, 28792 title = {The Linear Complementarity Problem}, 28793 journal = {Bulletin of the American Mathematical Society}, 28794 year = {1993}, 28795 volume = {28}, 28796 pages = {169--175}, 28797 key = {27} 28798} 28799 28800@MastersThesis{ ferris:linear*1, 28801 author = {M. C. Ferris}, 28802 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 28803 Solving a Class of Structural Optimization Problems}, 28804 year = {1985}, 28805 school = {University of Cambridge}, 28806 address = {England}, 28807 key = {01} 28808} 28809 28810@TechReport{ ferris:matlab, 28811 author = {M. C. Ferris}, 28812 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 28813 institution = {Computer Sciences Department, University of Wisconsin}, 28814 year = {1998}, 28815 address = {Madison, Wisconsin}, 28816 type = {Mathematical Programming Technical Report}, 28817 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 28818 number = {98-19}, 28819 key = {75} 28820} 28821 28822@Article{ ferris:parallel, 28823 author = {M. C. Ferris}, 28824 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 28825 journal = {Mathematics of Operations Research}, 28826 year = {1994}, 28827 volume = {19}, 28828 pages = {645--658}, 28829 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 28830 key = {20} 28831} 28832 28833@TechReport{ ferris:parallel*1, 28834 author = {M. C. Ferris}, 28835 title = {Parallel Solution of Extremely Large Knapsack Problems}, 28836 institution = {Computer Sciences Department, University of Wisconsin}, 28837 year = {1989}, 28838 address = {Madison, Wisconsin}, 28839 number = {842}, 28840 key = {09} 28841} 28842 28843@PhDThesis{ ferris:weak, 28844 author = {M. C. Ferris}, 28845 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 28846 year = {1988}, 28847 school = {University of Cambridge}, 28848 address = {England}, 28849 key = {02} 28850} 28851 28852@TechReport{ ferris:weak*1, 28853 author = {M. C. Ferris}, 28854 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 28855 institution = {Computer Sciences Department, University of Wisconsin}, 28856 year = {1988}, 28857 address = {Madison, Wisconsin}, 28858 number = {779}, 28859 key = {05} 28860} 28861 28862@Book{ fiacco.mccormick:nonlinear, 28863 author = {A. V. Fiacco and G. P. McCormick}, 28864 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 28865 year = {1968}, 28866 publisher = {John Wiley \& Sons}, 28867 address = {New York}, 28868 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 28869} 28870 28871@Book{ fiacco:introduction, 28872 author = {A. V. Fiacco}, 28873 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 28874 year = {1983}, 28875 publisher = {Academic Press}, 28876 address = {New York} 28877} 28878 28879@Article{ fiedler.ptak:matrices, 28880 author = {M. Fiedler and V. Pt\'{a}k}, 28881 title = {On matrices with nonpositive off-diagonal elements and positive principal 28882 minors}, 28883 journal = {Czechoslovak Mathematics Journal}, 28884 volume = {12}, 28885 pages = {382--400}, 28886 year = {1962} 28887} 28888 28889@Article{ fischer.kanzow:finite, 28890 author = {A. Fischer and C. Kanzow}, 28891 title = {On Finite Termination of an Iterative Method for Linear Complementarity 28892 Problems}, 28893 journal = {Mathematical Programming}, 28894 volume = {74}, 28895 pages = {279--292}, 28896 year = {1996} 28897} 28898 28899@TechReport{ fischer:constrained, 28900 author = {A. Fischer}, 28901 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 28902 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 28903 year = {1995}, 28904 type = {Technical Report}, 28905 number = {MATH-NM-10-1995}, 28906 address = {Dresden} 28907} 28908 28909@Article{ fischer:local, 28910 author = {A. Fischer}, 28911 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 28912 weak conditions}, 28913 journal = {Optimization Methods and Software}, 28914 year = {1995}, 28915 volume = {6}, 28916 pages = {83--107} 28917} 28918 28919@InCollection{ fischer:ncp-function, 28920 author = {A. Fischer}, 28921 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 28922 booktitle = {Recent Advances in Nonsmooth Optimization}, 28923 publisher = {World Scientific Publishers}, 28924 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 28925 year = {1995}, 28926 pages = {88--105} 28927} 28928 28929@Article{ fischer:newton-type, 28930 author = {A. Fischer}, 28931 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 28932 Problems}, 28933 journal = {Journal of Optimization Theory and Applications}, 28934 year = {1995}, 28935 volume = {86}, 28936 pages = {585--608} 28937} 28938 28939@Article{ fischer:solution, 28940 author = {A. Fischer}, 28941 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 28942 Functions}, 28943 year = {1997}, 28944 journal = {Mathematical Programming}, 28945 pages = {513--532} 28946} 28947 28948@Article{ fischer:special, 28949 author = {A. Fischer}, 28950 title = {A Special {N}ewton--Type Optimization Method}, 28951 journal = {Optimization}, 28952 year = {1992}, 28953 volume = {24}, 28954 pages = {269--284} 28955} 28956 28957@Article{ fisher:use, 28958 author = {R. A. Fisher}, 28959 title = {The Use of Multiple Measurements in Taxonomic Problems}, 28960 journal = {Annual Eugenics}, 28961 year = {1936}, 28962 volume = {7}, 28963 number = {Part II}, 28964 pages = {179--188} 28965} 28966 28967@Book{ fishman:principles, 28968 author = {G. Fishman}, 28969 title = {Principles of Discrete Event Simulation}, 28970 publisher = {Wiley}, 28971 address = {New York, NY}, 28972 year = {1978} 28973} 28974 28975@Article{ fitchard.aldridge.ea:registration, 28976 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 28977 title = {Registration of Synthetic Tomographic Projection Data Sets Using 28978 Cross-Correlation}, 28979 journal = {Physics in Medicine and Biology}, 28980 year = {1998}, 28981 volume = {43}, 28982 pages = {1645--1657} 28983} 28984 28985@Article{ fletcher.matthews:stable, 28986 author = {R. Fletcher and S. P. J. Matthews}, 28987 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 28988 journal = {Mathematical Programming}, 28989 year = {1984}, 28990 volume = {30}, 28991 pages = {267--284} 28992} 28993 28994@TechReport{ fletcher.maza:nonlinear, 28995 author = {R. Fletcher and E. Sainz de la Maza}, 28996 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 28997 Programming}, 28998 institution = {Department of Mathematical Sciences}, 28999 year = {1987}, 29000 address = {The University, Dundee, Scotland}, 29001 number = {NA/100}, 29002 type = {Numerical Analysis Report} 29003} 29004 29005@InCollection{ fletcher:class, 29006 author = {R. Fletcher}, 29007 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 29008 Properties}, 29009 booktitle = {Integer and Nonlinear Programming}, 29010 year = {1970}, 29011 editor = {J. Abadie}, 29012 publisher = {North--Holland}, 29013 address = {Amsterdam}, 29014 pages = {157--173} 29015} 29016 29017@Article{ fletcher:exact, 29018 author = {R. Fletcher}, 29019 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 29020 journal = {Mathematical Programming}, 29021 year = {1973}, 29022 volume = {5}, 29023 pages = {129--150} 29024} 29025 29026@Article{ fletcher:generalized, 29027 author = {R. Fletcher}, 29028 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 29029 Equations}, 29030 journal = {The Computer Journal}, 29031 year = {1968}, 29032 volume = {10}, 29033 pages = {392--399} 29034} 29035 29036@InProceedings{ fletcher:penalty, 29037 crossref = {bachem.grotschel.ea:mathematical}, 29038 author = {R. Fletcher}, 29039 title = {Penalty Functions}, 29040 pages = {87--114} 29041} 29042 29043@Book{ fletcher:practical, 29044 author = {R. Fletcher}, 29045 title = {Practical Methods of Optimization}, 29046 year = {1981}, 29047 publisher = {John Wiley \& Sons}, 29048 address = {Chichester}, 29049 volume = {1} 29050} 29051 29052@Book{ fletcher:practical*1, 29053 author = {R. Fletcher}, 29054 title = {Practical Methods of Optimization}, 29055 year = {1981}, 29056 publisher = {John Wiley \& Sons}, 29057 address = {Chichester}, 29058 volume = {2} 29059} 29060 29061@Book{ fletcher:practical*2, 29062 author = {R. Fletcher}, 29063 title = {Practical Methods of Optimization}, 29064 year = {1987}, 29065 publisher = {John Wiley \& Sons}, 29066 address = {New York}, 29067 edition = {second} 29068} 29069 29070@Unpublished{ fletcher:recent, 29071 author = {R. Fletcher}, 29072 title = {Recent Developments in Nonlinear Programming}, 29073 note = {Presentation at SOR 96, Braunchweig, Germany}, 29074 year = {1996} 29075} 29076 29077@InCollection{ fletcher:second, 29078 author = {R. Fletcher}, 29079 title = {Second Order Correction for Nondifferentiable Optimization}, 29080 booktitle = {Numerical Analysis}, 29081 year = {1982}, 29082 editor = {G. A. Watson}, 29083 publisher = {Springer-Verlag}, 29084 address = {Berlin}, 29085 pages = {85--114} 29086} 29087 29088@InCollection{ florian:mathematical, 29089 author = {M. Florian}, 29090 title = {Mathematical programming applications in national, regional, and urban planning}, 29091 editors = {M. Iri and K. Tanabe}, 29092 booktitle = {Mathematical Programming: Recent Developments and Applications}, 29093 publisher = {Kluwer Academic Publishers}, 29094 address = {Tokyo}, 29095 year = {1989} 29096} 29097 29098@Article{ florian:nonlinear, 29099 author = {M. Florian}, 29100 title = {Nonlinear Cost Network Models in Transportation Analysis}, 29101 journal = {Mathematical Programming Study}, 29102 year = {1986}, 29103 volume = {26}, 29104 pages = {167--196} 29105} 29106 29107@Article{ flynn:computer, 29108 author = {M.~J. Flynn}, 29109 title = {Some Computer Organizations and their Effectiveness}, 29110 journal = {IEEE Transactions on Computers}, 29111 year = {1972}, 29112 volume = {C-21}, 29113 pages = {948--960} 29114} 29115 29116@InProceedings{ fogarty:varying, 29117 crossref = {schaeffer:third}, 29118 author = {T. C. Fogarty}, 29119 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 29120 pages = {422--427} 29121} 29122 29123@Article{ forrest.goldfarb:steepest-edge, 29124 author = {J. J. Forrest and D. Goldfarb}, 29125 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 29126 journal = {Mathematical Programming}, 29127 year = {1992}, 29128 volume = {57}, 29129 pages = {341--374} 29130} 29131 29132@Article{ forrest.tomlin:updating, 29133 author = {J. J. H. Forrest and J. A. Tomlin}, 29134 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 29135 Simplex Method}, 29136 journal = {Mathematical Programming}, 29137 year = {1972}, 29138 volume = {2}, 29139 pages = {263--278} 29140} 29141 29142@TechReport{ forsgren.gill.ea:computing, 29143 author = {A. Forsgren and P. E. Gill and W. Murray}, 29144 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 29145 institution = {Department of Mathematics, Royal Institute of Technology}, 29146 year = {1993}, 29147 number = {TRITA-MAT-1993-9}, 29148 address = {Stockholm, Sweden} 29149} 29150 29151@TechReport{ forsgren.gill:primal-dual, 29152 author = {A. Forsgren and P. E. Gill}, 29153 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 29154 institution = {Department of Mathematics, University of California}, 29155 year = {1996}, 29156 type = {Report NA}, 29157 number = {96-3}, 29158 address = {San Diego} 29159} 29160 29161@InCollection{ fortin.glowinski:decomposition-coordination, 29162 author = {M. Fortin and R. Glowinski}, 29163 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 29164 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 29165 Problems}, 29166 publisher = {North-Holland}, 29167 year = {1983}, 29168 editor = {M. Fortin and R. Glowinski}, 29169 address = {Amsterdam} 29170} 29171 29172@Misc{ foster.kesselman:globus, 29173 author = {I. Foster and C. Kesselman}, 29174 title = {The Globus Project}, 29175 howpublished = {www.globus.org} 29176} 29177 29178@Article{ foster.kesselman:globus*1, 29179 author = {I. Foster and C. Kesselman}, 29180 title = {Globus: A Metacomputing Infrastructure Toolkit}, 29181 journal = {International Journal of Supercomputer Applications}, 29182 volume = {11}, 29183 pages = {115--128}, 29184 year = {1997} 29185} 29186 29187@Book{ foster.kesselman:grid, 29188 editor = {I. Foster and C. Kesselman}, 29189 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 29190 publisher = {Morgan Kaufmann Publishers}, 29191 year = {1999} 29192} 29193 29194@Book{ fourer.gay.ea:ampl, 29195 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29196 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 29197 year = {1993}, 29198 publisher = {Duxbury Press} 29199} 29200 29201@Article{ fourer.gay.ea:modeling, 29202 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29203 title = {A Modeling Language for Mathematical Programming}, 29204 journal = {Management Science}, 29205 year = {1990}, 29206 volume = {36}, 29207 pages = {519--554} 29208} 29209 29210@Article{ fraass:development, 29211 author = {A. Fraass}, 29212 title = {The development of conformal radiation therapy}, 29213 journal = {Medical Physics}, 29214 year = {1995}, 29215 volume = {22}, 29216 number = {11}, 29217 pages = {1911--1921} 29218} 29219 29220@TechReport{ fraley:algorithms, 29221 author = {C. Fraley}, 29222 title = {Algorithms for Nonlinear Least Squares}, 29223 institution = {Stanford University}, 29224 year = {1988}, 29225 number = {{SOL} 88.16}, 29226 type = {Technical Report} 29227} 29228 29229@InCollection{ francois.mcdonald.ea:uruguay, 29230 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29231 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 29232 booktitle = {The {U}ruguay Round and the Developing Economies}, 29233 address = {New York}, 29234 editors = {W. Martin and L. A. Winters}, 29235 publisher = {Cambridge University Press} 29236} 29237 29238@InCollection{ francois.mcdonald.ea:uruguay*1, 29239 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29240 title = {The {U}ruguay Round: {A} Global Analysis}, 29241 booktitle = {Challenges and Opportunities for East Asian Trade}, 29242 address = {Cambridge}, 29243 editors = {D. Robertson}, 29244 publisher = {Cambridge University Press} 29245} 29246 29247@Article{ frank.wolfe:algorithm, 29248 author = {M. Frank and P. Wolfe}, 29249 title = {An Algorithm for Quadratic Programming}, 29250 journal = {Naval Research Logistics Quarterly}, 29251 year = {1956}, 29252 volume = {3}, 29253 pages = {95--110} 29254} 29255 29256@Article{ freund.nachtigal:qmrpack, 29257 author = {R. W. Freund and N. M. Nachtigal}, 29258 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 29259 journal = {{ACM} Transactions on Mathematical Software}, 29260 year = {1996}, 29261 volume = {22}, 29262 pages = {46--77} 29263} 29264 29265@InProceedings{ freund.schapire:experiments, 29266 author = {Y. Freund and R. E. Schapire}, 29267 title = {Experiments with a New Boosting Algorithm}, 29268 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 29269 pages = {148--156}, 29270 year = {1996}, 29271 editor = {L. Saitta}, 29272 publisher = {Morgan Kaufmann} 29273} 29274 29275@Unpublished{ freund.todd:barrier, 29276 author = {Robert M. Freund and Michael J. Todd}, 29277 title = {Barrier functions and interior-point algorithms for linear programming with 29278 zero-, one-, or two-sided bounds on the variables}, 29279 year = {1992}, 29280 month = jul 29281} 29282 29283@Article{ friedman.chernina:iterative, 29284 author = {V. M. Friedman and V. S. Chernina}, 29285 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 29286 note = {In Russian}, 29287 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 29288 volume = {1}, 29289 pages = {116--120}, 29290 year = {1967} 29291} 29292 29293@Article{ friesz.bernstein.ea:day-to-day, 29294 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 29295 Ganjalizadeh}, 29296 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 29297 Systems}, 29298 journal = {Operations Research}, 29299 year = {1994}, 29300 volume = {42}, 29301 pages = {1120--1136} 29302} 29303 29304@Article{ friesz.tobin.ea:nonlinear, 29305 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 29306 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 29307 Derived Demand Network Equilibrium Problem}, 29308 journal = {Journal of Regional Science}, 29309 year = {1983}, 29310 volume = {23}, 29311 pages = {337--359} 29312} 29313 29314@Article{ friesz:network, 29315 author = {T. L. Friesz}, 29316 title = {Network Equilibrium, Design and Aggregation}, 29317 journal = {Transportation Research}, 29318 volume = {19A}, 29319 year = {1985}, 29320 pages = {413--427} 29321} 29322 29323@Unpublished{ frisch:logarithmic, 29324 author = {K. R. Frisch}, 29325 title = {The Logarithmic Potential Method of Convex Programming}, 29326 year = {1955}, 29327 note = {Unpublished manuscript, University Institute of Economics, Oslo} 29328} 29329 29330@Book{ fukunaga:statistical, 29331 author = {K. Fukunaga}, 29332 title = {Statistical Pattern Recognition}, 29333 year = {1990}, 29334 publisher = {Academic Press}, 29335 address = {New York} 29336} 29337 29338@Article{ fukushima.luo.ea:globally, 29339 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 29340 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 29341 Programs with Linear Complementarity Constraints}, 29342 journal = {Computational Optimization and Applications}, 29343 year = {1998}, 29344 volume = {10}, 29345 pages = {5--34} 29346} 29347 29348@Article{ fukushima:equivalent, 29349 author = {M. Fukushima}, 29350 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 29351 Asymmetric Variational Inequality Problems}, 29352 journal = {Mathematical Programming}, 29353 year = {1992}, 29354 volume = {53}, 29355 pages = {99--110} 29356} 29357 29358@Article{ fukushima:primal, 29359 author = {M. Fukushima}, 29360 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 29361 Mappings with Application to the Traffic Equilibrium Problem}, 29362 journal = {Mathematical Programming}, 29363 year = {1996}, 29364 volume = {72}, 29365 pages = {1--15} 29366} 29367 29368@Article{ gabay.mercier:dual, 29369 author = {D. Gabay and B. Mercier}, 29370 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 29371 Finite Element Approximations}, 29372 journal = {Computational Mathematics and Applications}, 29373 year = {1976}, 29374 volume = {2}, 29375 pages = {17--48} 29376} 29377 29378@InCollection{ gabay:applications, 29379 author = {D. Gabay}, 29380 title = {Applications of the Method of Multipliers to Variational Inequalities}, 29381 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 29382 Problems}, 29383 publisher = {North-Holland}, 29384 year = {1983}, 29385 editor = {M. Fortin and R. Glowinski}, 29386 address = {Amsterdam} 29387} 29388 29389@Unpublished{ gabriel.bernstein:path, 29390 author = {S. A. Gabriel and D. Berstein}, 29391 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 29392 Equilibrium Problem}, 29393 note = {Draft, 1995} 29394} 29395 29396@TechReport{ gabriel.kydes:nonlinear, 29397 author = {S. A. Gabriel and A. S. Kydes}, 29398 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 29399 System}, 29400 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 29401 year = {1995}, 29402 type = {Preprint}, 29403 number = {MCS-P504-0395}, 29404 address = {Argonne, Illinois}, 29405 month = mar 29406} 29407 29408@InProceedings{ gabriel.more:smoothing, 29409 crossref = {ferris.pang:complementarity}, 29410 author = {S. A. Gabriel and J. J. Mor\'{e}}, 29411 title = {Smoothing of Mixed Complementarity Problems} 29412} 29413 29414@Article{ gabriel.pang:inexact, 29415 author = {S. A. Gabriel and J. S. Pang}, 29416 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 29417 journal = {Computational Optimization and Applications}, 29418 year = {1992}, 29419 volume = {1}, 29420 pages = {67--91} 29421} 29422 29423@InCollection{ gabriel.pang:trust, 29424 author = {S. A. Gabriel and J. S. Pang}, 29425 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 29426 booktitle = {Large--Scale Optimization: State of the Art}, 29427 publisher = {Kluwer Academic Publishers}, 29428 year = {1994}, 29429 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 29430 pages = {159--186} 29431} 29432 29433@PhDThesis{ gabriel:algorithms, 29434 author = {S. A. Gabriel}, 29435 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 29436 Extensions}, 29437 school = {The Johns Hopkins University}, 29438 year = {1992}, 29439 address = {Baltimore, Maryland} 29440} 29441 29442@Article{ gafni.bertsekas:two-metric, 29443 author = {E. M. Gafni and D. P. Bertsekas}, 29444 title = {Two-Metric Projection Methods for Constrained Optimization}, 29445 journal = {SIAM Journal on Control and Optimization}, 29446 year = {1984}, 29447 volume = {22}, 29448 pages = {936--964} 29449} 29450 29451@InProceedings{ gaivoronski:convergence, 29452 author = {A. A. Gaivoronski}, 29453 title = {Convergence of Parallel Backpropagation for Neural Networks}, 29454 booktitle = {SIAM Journal on Optimization}, 29455 year = {1994}, 29456 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 29457 submitted} 29458} 29459 29460@Misc{ gaivoronski:private, 29461 author = {A. A. Gaivoronski}, 29462 title = {Private Communication}, 29463 year = {1992}, 29464 month = nov, 29465 address = {ITALTEL, Milan} 29466} 29467 29468@Book{ gale:theory, 29469 author = {D. Gale}, 29470 title = {The Theory of Linear Economic Models}, 29471 year = {1960}, 29472 publisher = {McGraw-Hill Book Company}, 29473 address = {New York} 29474} 29475 29476@Book{ gallant:neural, 29477 author = {S. I. Gallant}, 29478 title = {Neural Network Learning and Expert Systems}, 29479 year = {1993}, 29480 publisher = {MIT Press}, 29481 address = {Cambridge, Massachusetts} 29482} 29483 29484@InProceedings{ ganti.gehrke.ea:framework, 29485 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 29486 title = {A Framework for Measuring Changes in Data Characteristics}, 29487 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 29488 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 29489 publisher = {ACM Press}, 29490 year = {1999}, 29491 isbn = {1-58113-062-7}, 29492 pages = {126--137} 29493} 29494 29495@Book{ ganz:gamma, 29496 author = {J. C. Ganz}, 29497 title = {Gamma Knife Surgery}, 29498 publisher = {Springer-Verlag Wien}, 29499 year = {1997}, 29500 address = {Austria} 29501} 29502 29503@TechReport{ gao:nonlinear, 29504 author = {Y. Gao}, 29505 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 29506 Conditions}, 29507 type = {Manuscript}, 29508 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 29509 month = oct, 29510 year = {1994} 29511} 29512 29513@Article{ garcia-palomares.mangasarian:superlinearly, 29514 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 29515 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 29516 Optimization Problems}, 29517 journal = {Mathematical Programming}, 29518 year = {1976}, 29519 volume = {11}, 29520 pages = {1--13} 29521} 29522 29523@Article{ garcia-palomares.restuccia:global, 29524 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 29525 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 29526 journal = {Mathematical Programming}, 29527 year = {1981}, 29528 volume = {21}, 29529 pages = {290--300} 29530} 29531 29532@InProceedings{ garcia-palomares:superlinearly, 29533 author = {U. M. {Garcia--Palomares}}, 29534 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 29535 crossref = {mangasarian.meyer.ea:nonlinear*2}, 29536 pages = {101--119} 29537} 29538 29539@Article{ garcia.gould:theorem, 29540 author = {C. B. Garcia and F. J. Gould}, 29541 title = {A Theorem on Homotopy Paths}, 29542 journal = {Mathematics of Operations Research}, 29543 year = {1978}, 29544 volume = {3}, 29545 pages = {282--289} 29546} 29547 29548@Book{ garcia.zangwill:pathways, 29549 author = {C. B. Garcia and W. I. Zangwill}, 29550 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 29551 year = {1981}, 29552 publisher = {Prentice-Hall, Inc}, 29553 address = {Englewood Cliffs, New Jersey} 29554} 29555 29556@Book{ garey.johnson:computers, 29557 author = {M. R. Garey and D. S. Johnson}, 29558 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 29559 year = {1979}, 29560 publisher = {W.H. Freeman and Company}, 29561 address = {San Francisco} 29562} 29563 29564@Article{ garey.tarjan.ea:one-processor, 29565 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 29566 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 29567 journal = {Mathematics of Operations Research}, 29568 year = {1988}, 29569 volume = {13}, 29570 pages = {330--348} 29571} 29572 29573@Book{ garfinkel.nemhauser:integer, 29574 author = {R. S. Garfinkel and G. L. Nemhauser}, 29575 title = {Integer Programming}, 29576 year = {1972}, 29577 publisher = {John Wiley \& Sons}, 29578 address = {New York} 29579} 29580 29581@Book{ gass:linear, 29582 author = {S. Gass}, 29583 title = {Linear Programming Methods and Applications}, 29584 edition = {Fifth}, 29585 publisher = {Boyd and Fraser Publishing Company}, 29586 address = {Danvers, Massachusetts}, 29587 year = {1985} 29588} 29589 29590@InProceedings{ gay:combining, 29591 author = {D. M. Gay}, 29592 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 29593 booktitle = {Sparse Matrix Proceedings 1978}, 29594 editor = {I. S. Duff and G. W. Stewart}, 29595 year = {1978}, 29596 organization = {SIAM}, 29597 address = {Philadelphia, Pennsylvania}, 29598 pages = {313--334} 29599} 29600 29601@Article{ gay:electronic, 29602 author = {D. M. Gay}, 29603 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 29604 journal = {{COAL} Newsletter}, 29605 year = {1985}, 29606 volume = {13}, 29607 pages = {10--12} 29608} 29609 29610@TechReport{ gay:hooking, 29611 author = {D. M. Gay}, 29612 title = {Hooking Your Solver to {AMPL}}, 29613 year = {1997}, 29614 institution = {Bell Laboratories}, 29615 address = {Murray Hill, New Jersey}, 29616 note = {Revised 1994, 1997} 29617} 29618 29619@Article{ gay:variant, 29620 author = {D. Gay}, 29621 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 29622 Form}, 29623 journal = {Mathematical Programming}, 29624 year = {1987}, 29625 volume = {37}, 29626 pages = {81--90} 29627} 29628 29629@Article{ geiger.kanzow:resolution, 29630 author = {C. Geiger and C. Kanzow}, 29631 title = {On the Resolution of Monotone Complementarity Problems}, 29632 journal = {Computational Optimization and Applications}, 29633 volume = {5}, 29634 year = {1996}, 29635 pages = {155--173} 29636} 29637 29638@Book{ geist.beguelin.ea:pvm, 29639 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 29640 V. S. Sunderam}, 29641 title = {{PVM}: Parallel Virtual Machine}, 29642 publisher = {MIT Press}, 29643 address = {Cambridge, Massachusetts}, 29644 year = {1994} 29645} 29646 29647@Article{ gendron.crainic:parallel, 29648 author = {B. Gendron and T. G. Crainic}, 29649 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 29650 journal = {Operations Research}, 29651 year = {1994}, 29652 volume = {42}, 29653 pages = {1042--1060} 29654} 29655 29656@Article{ george:automatic, 29657 author = {A. George}, 29658 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 29659 journal = {SIAM Journal on Numerical Analysis}, 29660 vol = {17}, 29661 pages = {740--751}, 29662 year = {1980} 29663} 29664 29665@InProceedings{ georges-schleuter:asparagos, 29666 crossref = {schaeffer:third}, 29667 author = {M. Georges--Schleuter}, 29668 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 29669 pages = {416--421} 29670} 29671 29672@Article{ georgiou:comments, 29673 author = {G. M. Georgiou}, 29674 title = {Comments On Hidden Nodes in Neural Nets}, 29675 journal = {IEEE Transactions on Circuits and Systems}, 29676 year = {1991}, 29677 volume = {38}, 29678 pages = {1410} 29679} 29680 29681@TechReport{ gertz.linderoth.ea:object-oriented, 29682 author = {M. Gertz and J. Linderoth and S. Wright}, 29683 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 29684 institution = {MCS Division, Argonne National Laboratory}, 29685 year = {in preparation} 29686} 29687 29688@Article{ ghellinck.vial:polynomial, 29689 author = {G. de Ghellinck and J.--Ph. Vial}, 29690 title = {A Polynomial {N}ewton Method for Linear Programming}, 29691 journal = {Algorithmica}, 29692 year = {1986}, 29693 volume = {1}, 29694 pages = {425--453} 29695} 29696 29697@InCollection{ gilbert.ng:predicting, 29698 author = {J. R. Gilbert and E. Ng}, 29699 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 29700 year = {1993}, 29701 booktitle = {Graph Theory and Sparse Matrix Computation}, 29702 editor = {A. George and J. Gilbert and J. Liu}, 29703 publisher = {Springer-Verlag} 29704} 29705 29706@Article{ gilbert-lemarechal, 29707 author = {J. C. Gilbert and C. Lemarechal}, 29708 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 29709 journal = {Mathematical Programming}, 29710 year = {1989}, 29711 volume = {45}, 29712 pages = {407--434} 29713} 29714 29715@Article{ gill.murray.ea:computing, 29716 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29717 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 29718 journal = {SIAM Journal on Scientific and Statistical Computing}, 29719 year = {1983}, 29720 volume = {4}, 29721 pages = {310--321} 29722} 29723 29724@Article{ gill.murray.ea:maintaining, 29725 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29726 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 29727 year = {1987}, 29728 journal = {Linear Algebra and Its Applications}, 29729 volume = {88/89}, 29730 pages = {239--270} 29731} 29732 29733@Book{ gill.murray.ea:practical, 29734 author = {P. E. Gill and W. Murray and M. H. Wright}, 29735 title = {Practical Optimization}, 29736 year = {1981}, 29737 publisher = {Academic Press}, 29738 address = {London} 29739} 29740 29741@Article{ gill.murray.ea:practical*1, 29742 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29743 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 29744 journal = {Mathematical Programming}, 29745 year = {1989}, 29746 volume = {45}, 29747 pages = {437--474} 29748} 29749 29750@Article{ gill.murray.ea:projected, 29751 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 29752 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 29753 to {K}armarkar's Projective Method}, 29754 journal = {Mathematical Programming}, 29755 year = {1986}, 29756 volume = {36}, 29757 pages = {183--209} 29758} 29759 29760@Article{ gill.murray:newton-type, 29761 author = {P. E. Gill and W. Murray}, 29762 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 29763 journal = {Mathematical Programming}, 29764 year = {1974}, 29765 volume = {7}, 29766 pages = {311--350} 29767} 29768 29769@InProceedings{ gill.murray:nonlinear, 29770 author = {P. E. Gill and W. Murray}, 29771 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 29772 booktitle = {Numerical Analysis, Dundee 1975}, 29773 year = {1976}, 29774 editor = {G. A. Watson}, 29775 publisher = {Springer-Verlag}, 29776 address = {Berlin}, 29777 note = {Lecture Notes in Mathematics 506} 29778} 29779 29780@Book{ ginsburgh.waelbroeck:activity, 29781 author = {V. Ginsburgh and J. Waelbroeck}, 29782 title = {Activity Analysis and General Equilibrium Modelling}, 29783 publisher = {North--Holland}, 29784 year = {1981}, 29785 address = {Amsterdam} 29786} 29787 29788@Article{ glad.goldstein:errors, 29789 author = {T. Glad and A. Goldstein}, 29790 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 29791 journal = {BIT}, 29792 year = {1977}, 29793 volume = {17}, 29794 pages = {160--169} 29795} 29796 29797@Article{ glad.polak:multiplier, 29798 author = {T. Glad and E. Polak}, 29799 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 29800 journal = {Mathematical Programming}, 29801 year = {1979}, 29802 volume = {17}, 29803 pages = {140--155} 29804} 29805 29806@Book{ glashoff.gustafson:linear, 29807 author = {K. Glashoff and S.--\AA. Gustafson}, 29808 title = {Linear Optimization and Approximation}, 29809 year = {1983}, 29810 publisher = {Springer-Verlag}, 29811 address = {New York} 29812} 29813 29814@Article{ glover:improved, 29815 author = {F. Glover}, 29816 title = {Improved Linear Programming Models for Discriminant Analysis}, 29817 journal = {Decision Sciences}, 29818 year = {1990}, 29819 volume = {21}, 29820 pages = {771--785} 29821} 29822 29823@Book{ glasserman:gradient, 29824 author = {P. Glasserman}, 29825 title = {Gradient Estimation via Perturbation Analysis}, 29826 publisher = {Kluwer}, 29827 year = {1991}, 29828 address = {Norwell, MA} 29829} 29830 29831@Article{ glover:tabu, 29832 author = {F. Glover}, 29833 title = {Tabu Search -- Part 1}, 29834 journal = {ORSA Journal on Computing}, 29835 year = {1989}, 29836 volume = {1}, 29837 pages = {190--206} 29838} 29839 29840@Article{ glowinski.marroco:sur, 29841 author = {R. Glowinski and A. Marroco}, 29842 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 29843 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 29844 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 29845 year = {1975}, 29846 volume = {9(R-2)}, 29847 pages = {41--76} 29848} 29849 29850@TechReport{ goeleven.nguyen:convergence, 29851 author = {D. Goeleven and V. H. Nguyen}, 29852 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 29853 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 29854 year = {1992}, 29855 address = {B-5000 Namur, Belgium} 29856} 29857 29858@Book{ goldberg:genetic, 29859 author = {D. E. Goldberg}, 29860 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 29861 year = {1989}, 29862 publisher = {Addison-Wesley}, 29863 address = {Reading MA} 29864} 29865 29866@Article{ golden.skiscim:simulated, 29867 author = {B. L. Golden and C. C. Skiscim}, 29868 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 29869 journal = {Naval Research Logistics Quarterly}, 29870 year = {1989}, 29871 volume = {33}, 29872 pages = {261--279} 29873} 29874 29875@Article{ goldfarb.reid:practical, 29876 author = {D. Goldfarb and J. K. Reid}, 29877 title = {A Practical Steepest--Edge Simplex Algorithm}, 29878 journal = {Mathematical Programming}, 29879 year = {1977}, 29880 volume = {12}, 29881 pages = {361--371} 29882} 29883 29884@InProceedings{ goldman.tucker:theory, 29885 author = {A. J. Goldman and A. W. Tucker}, 29886 title = {Theory of Linear Programming}, 29887 booktitle = {Linear Inequalities and Related Systems}, 29888 year = {1956}, 29889 editor = {H. W. Kuhn and A. W. Tucker}, 29890 publisher = {Princeton University Press}, 29891 address = {Princeton, New Jersey}, 29892 pages = {53--97} 29893} 29894 29895@Book{ goldstein:constructive, 29896 author = {A. A. Goldstein}, 29897 title = {Constructive Real Analysis}, 29898 year = {1967}, 29899 publisher = {Harper and Row}, 29900 address = {New York} 29901} 29902 29903@Article{ golshtein:block, 29904 author = {Ye. G. Golshtein}, 29905 title = {The Block Method of Convex Programming}, 29906 journal = {Soviet Mathematics Doklady}, 29907 year = {1986}, 29908 volume = {33}, 29909 pages = {584--587} 29910} 29911 29912@Article{ golshtein:general, 29913 author = {Ye. G. Golshtein}, 29914 title = {A General Approach to Decomposition of Optimization Systems}, 29915 journal = {Soviet Journal of Computer and Systems Sciences}, 29916 year = {1987}, 29917 volume = {3}, 29918 pages = {105--114} 29919} 29920 29921@Article{ golub.kahan:calculating, 29922 author = {G. H. Golub and W. Kahan}, 29923 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 29924 journal = {SIAM Journal on Numerical Analysis}, 29925 year = {1965}, 29926 volume = {2}, 29927 pages = {205--224} 29928} 29929 29930@Book{ golub.vanloan:matrix, 29931 author = {G. H. Golub and C. F. {Van Loan}}, 29932 title = {Matrix Computations}, 29933 year = {1996}, 29934 publisher = {The John Hopkins University Press}, 29935 address = {Baltimore, Maryland}, 29936 edition = {Third} 29937} 29938 29939@TechReport{ gomez.barron:exponential, 29940 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 29941 title = {The Exponential Tunneling Method}, 29942 institution = {Universidad Nacional Autonoma de Mexico}, 29943 year = {1991}, 29944 type = {Serie Reportes de Investigacion}, 29945 number = {3}, 29946 address = {Mexico} 29947} 29948 29949@Article{ gondzio:multiple, 29950 author = {J. Gondzio}, 29951 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 29952 journal = {Computational Optimization and Applications}, 29953 year = {1996}, 29954 volume = {6}, 29955 pages = {137--156} 29956} 29957 29958@TechReport{ gonzaga:algorithm, 29959 author = {C. C. Gonzaga}, 29960 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 29961 operations}, 29962 institution = {Electronics Research Laboratory, University of California}, 29963 year = {1987}, 29964 address = {Berkeley, California}, 29965 number = {UCB/ERL M87/10}, 29966 type = {Memorandum} 29967} 29968 29969@Article{ gould.tolle:necessary, 29970 author = {F. J. Gould and J. W. Tolle}, 29971 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 29972 journal = {SIAM Journal on Applied Mathematics}, 29973 year = {1971}, 29974 volume = {20}, 29975 pages = {164--172} 29976} 29977 29978@InProceedings{ goux.kulkarni.ea:enabling, 29979 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 29980 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 29981 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 29982 Distributed Computing}, 29983 year = {2000} 29984} 29985 29986@Article{ gowda.pang:basic, 29987 author = {M. S. Gowda and J. S. Pang}, 29988 title = {The Basic Theorem of Complementarity Revisited}, 29989 journal = {Mathematical Programming}, 29990 year = {1993}, 29991 volume = {58}, 29992 pages = {161--178} 29993} 29994 29995@Article{ gowda.pang:boundedness, 29996 author = {M. S. Gowda and J. S. Pang}, 29997 title = {On the Boundedness and Stability of Solutions to the Affine Variational 29998 Inequality Problem}, 29999 journal = {SIAM Journal on Control and Optimization}, 30000 year = {1994}, 30001 volume = {32}, 30002 pages = {421--441} 30003} 30004 30005@Article{ gowda.pang:stability, 30006 author = {M. S. Gowda and J. S. Pang}, 30007 title = {Stability analysis of variational inequalities and nonlinear complementarity 30008 problems, via the mixed linear complementarity problem and degree theory}, 30009 journal = {Mathematics of Operations Research}, 30010 year = {1994}, 30011 volume = {19}, 30012 pages = {831--879} 30013} 30014 30015@Article{ gowda.sznajder:generalizations, 30016 author = {M. S. Gowda and R. Sznajder}, 30017 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 30018 Horizontal {LCP}s}, 30019 journal = {Linear Algebra and Its Applications}, 30020 year = {1995}, 30021 volume = {223/224}, 30022 pages = {695--715} 30023} 30024 30025@Article{ gowda.sznajder:generalized, 30026 author = {M. S. Gowda and R. Sznajder}, 30027 title = {The Generalized Order Linear Complementarity Problem}, 30028 journal = {SIAM Journal on Matrix Analysis and Applications}, 30029 year = {1994} 30030} 30031 30032@Article{ gowda:analysis, 30033 author = {M. S. Gowda}, 30034 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 30035 Function via its Recession Function}, 30036 journal = {SIAM Journal on Matrix Analysis and Applications}, 30037 year = {1996}, 30038 volume = {17}, 30039 pages = {594--609} 30040} 30041 30042@Article{ gowda:applications, 30043 author = {M. S. Gowda}, 30044 title = {Applications of Degree Theory to Linear Complementarity Problems}, 30045 journal = {Mathematics of Operations Research}, 30046 year = {1993}, 30047 volume = {18}, 30048 pages = {868--879} 30049} 30050 30051@Article{ grant.woo:clinical, 30052 author = {W. I. Grant and S. Y. Woo}, 30053 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 30054 Delivery}, 30055 journal = {Seminars in Radiation Oncology}, 30056 year = {1999}, 30057 volume = {9}, 30058 pages = {99--107} 30059} 30060 30061@Article{ greenberg.hegerich:branch, 30062 author = {H. Greenberg and R. L. Hegerich}, 30063 title = {A Branch Search Algorithm for the Knapsack Problem}, 30064 journal = {Management Science}, 30065 year = {1970}, 30066 volume = {16}, 30067 pages = {327--332} 30068} 30069 30070@InCollection{ grefenstette:incorporating, 30071 crossref = {davis:genetic}, 30072 author = {J. J. Grefenstette}, 30073 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 30074} 30075 30076@Book{ griewank.corliss:automatic, 30077 editor = {A. Griewank and G. F. Corliss}, 30078 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 30079 publisher = {SIAM}, 30080 year = {1991}, 30081 address = {Philadelphia, Pennsylvania} 30082} 30083 30084@Article{ griewank.juedes.ea:adol-c, 30085 author = {A. Griewank and D. Juedes and J. Utke}, 30086 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 30087 in {C}/{C}++}, 30088 journal = {{ACM} Transactions on Mathematical Software}, 30089 year = {1996}, 30090 volume = {22}, 30091 pages = {131--167} 30092} 30093 30094@Article{ griffith.stewart:nonlinear, 30095 author = {R. E. Griffith and R. A. Stewart}, 30096 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 30097 Systems}, 30098 journal = {Management Science}, 30099 year = {1961}, 30100 volume = {7}, 30101 pages = {379--392} 30102} 30103 30104@Article{ grinold:mathematical, 30105 author = {R. C. Grinold}, 30106 title = {Mathematical Methods for {PA}ttern Classification}, 30107 journal = {Management Science}, 30108 year = {1972}, 30109 volume = {19}, 30110 pages = {272--289} 30111} 30112 30113@Article{ grippo.lampariello.ea:class, 30114 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30115 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 30116 journal = {Numerische Mathematik}, 30117 year = {1991}, 30118 volume = {59}, 30119 pages = {779--805} 30120} 30121 30122@Article{ grippo.lampariello.ea:global, 30123 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30124 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 30125 Without Derivatives}, 30126 journal = {Journal of Optimization Theory and Applications}, 30127 year = {1988}, 30128 volume = {56}, 30129 pages = {385--406} 30130} 30131 30132@Article{ grippo.lampariello.ea:nonmonotone, 30133 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30134 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 30135 journal = {SIAM Journal on Numerical Analysis}, 30136 year = {1986}, 30137 volume = {23}, 30138 pages = {707--716} 30139} 30140 30141@Misc{ grippo:private, 30142 author = {L. Grippo}, 30143 title = {Private Communication}, 30144 year = {1992}, 30145 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 30146} 30147 30148@Article{ grotschel.lovasz.ea:ellipsoid, 30149 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 30150 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 30151 journal = {Combinatorica}, 30152 year = {1981}, 30153 volume = {1}, 30154 pages = {169--197} 30155} 30156 30157@Article{ guignard:generalized, 30158 author = {M. Guignard}, 30159 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 30160 {B}anach Space}, 30161 journal = {SIAM Journal on Control and Optimization}, 30162 year = {1969}, 30163 volume = {7}, 30164 pages = {232--241} 30165} 30166 30167@Article{ guler.ye:convergence, 30168 author = {O. G{\"{u}}ler and Y. Ye}, 30169 title = {Convergence Behavior of Interior--Point Algorithms}, 30170 journal = {Mathematical Programming}, 30171 year = {1993}, 30172 volume = {60}, 30173 pages = {215--228} 30174} 30175 30176@Article{ guler:existence, 30177 author = {O. G{\"{u}}ler}, 30178 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 30179 Complementarity Problems}, 30180 journal = {Mathematics of Operations Research}, 30181 year = {1993}, 30182 volume = {18}, 30183 pages = {128--147} 30184} 30185 30186@Article{ guler:generalized, 30187 author = {O. G{\"{u}}ler}, 30188 title = {Generalized Linear Complementarity Problems}, 30189 journal = {Mathematics of Operations Research}, 30190 year = {1995}, 30191 volume = {20}, 30192 pages = {441--448} 30193} 30194 30195@Article{ gupta.sen:minimizing, 30196 author = {S. Gupta and T. Sen}, 30197 title = {Minimizing the Range of Lateness on a Single Machine}, 30198 journal = {Journal of the Operational Research Society}, 30199 year = {1984}, 30200 volume = {35}, 30201 pages = {853--857} 30202} 30203 30204@InCollection{ gustafson:numerical, 30205 author = {S.-\AA. Gustafson}, 30206 title = {On Numerical Analysis in Semi-Infinite Programming}, 30207 booktitle = {Semi-Infinite Programming}, 30208 year = {1979}, 30209 editor = {R. Hettich}, 30210 publisher = {Springer-Verlag}, 30211 address = {Berlin} 30212} 30213 30214@Article{ gustafsson.lind.ea:simultaneous, 30215 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 30216 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 30217 or compensation filters using a generalized pencil beam algorithm}, 30218 journal = {Medical Physics}, 30219 year = {1995}, 30220 volume = {22}, 30221 number = {7}, 30222 pages = {1141--1156} 30223} 30224 30225@PhDThesis{ ha:decomposition, 30226 author = {C. D. Ha}, 30227 title = {Decomposition Methods for Structured Convex Programming}, 30228 year = {1980}, 30229 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30230} 30231 30232@TechReport{ haakonsen.mathiesen:toward, 30233 author = {L. Haakonsen and L. Mathiesen}, 30234 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 30235 institution = {NHH, Bergen}, 30236 year = {1995}, 30237 type = {Discussion Paper}, 30238 number = {3/95} 30239} 30240 30241@Article{ haaland.norman.ea:vemod, 30242 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 30243 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 30244 journal = {Scandinavian Journal of Economics}, 30245 year = {1987} 30246} 30247 30248@Article{ haarhoff.buys:method, 30249 author = {P. C. Haarhoff and J. D. Buys}, 30250 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 30251 Constraints}, 30252 journal = {Computer Journal}, 30253 year = {1970}, 30254 volume = {12}, 30255 pages = {178--184} 30256} 30257 30258@Article{ habetler.kostreva:direct, 30259 author = {G. J. Habetler and M. M. Kostreva}, 30260 title = {On a direct algorithm for nonlinear complementarity problems}, 30261 journal = {SIAM Journal on Control and Optimization}, 30262 volume = {16}, 30263 year = {1978}, 30264 pages = {504--511} 30265} 30266 30267@Book{ hadamard:cauchys, 30268 author = {J. Hadamard}, 30269 title = {Cauchy's Problem in Linear Partial Differential Equations}, 30270 year = {1923}, 30271 publisher = {Yale University Press} 30272} 30273 30274@Article{ haddock.mittenthal:simulation, 30275 author = {J. Haddock and J. Mittenthal}, 30276 title = {Simulation optimization using simulated annealing}, 30277 journal = {Comput. Ind. Eng.}, 30278 year = {1992}, 30279 volume = {22}, 30280 pages = {387--395} 30281} 30282 30283@TechReport{ hamala:general, 30284 author = {M. Hamala}, 30285 title = {A General Approach to Interior Point Methods with Linear Parameter for 30286 Mathematical Programming}, 30287 institution = {Royal Institute of Technology}, 30288 year = {1978}, 30289 number = {1978--20}, 30290 type = {Department of Mathematics Paper TRITA--MAT} 30291} 30292 30293@Article{ han.mangasarian:dual, 30294 author = {S.--P. Han and O. L. Mangasarian}, 30295 title = {A Dual Differentiable Exact Penalty Function}, 30296 journal = {Mathematical Programming}, 30297 year = {1983}, 30298 volume = {25}, 30299 pages = {293--301} 30300} 30301 30302@Article{ han.mangasarian:exact, 30303 author = {S.--P. Han and O. L. Mangasarian}, 30304 title = {Exact Penalty Functions in Nonlinear Programming}, 30305 journal = {Mathematical Programming}, 30306 year = {1979}, 30307 volume = {17}, 30308 pages = {251--269} 30309} 30310 30311@Article{ han.pang.ea:globally, 30312 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 30313 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 30314 journal = {Mathematics of Operations Research}, 30315 year = {1992}, 30316 volume = {17}, 30317 pages = {586--607} 30318} 30319 30320@Article{ han:decomposition, 30321 author = {S.--P. Han}, 30322 title = {A Decomposition Method and its Application to Convex Programming}, 30323 journal = {Mathematics of Operations Research}, 30324 year = {1989}, 30325 volume = {14}, 30326 pages = {237--248} 30327} 30328 30329@Article{ han:globally, 30330 author = {S.--P. Han}, 30331 title = {A Globally Convergent Method for Nonlinear Programming}, 30332 journal = {Journal of Optimization Theory and Applications}, 30333 year = {1977}, 30334 volume = {22}, 30335 pages = {297--309} 30336} 30337 30338@Article{ han:superlinearly, 30339 author = {S.--P. Han}, 30340 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 30341 Programming Problems}, 30342 journal = {Mathematical Programming}, 30343 year = {1976}, 30344 volume = {11}, 30345 pages = {263--282} 30346} 30347 30348@Article{ hansen.koopmans:definition, 30349 author = {T. Hansen and T. C. Koopmans}, 30350 title = {On the Definition and Computation of a Capital Stock Invariant Under 30351 Optimization}, 30352 journal = {Journal of Economic Theory}, 30353 year = {1972}, 30354 volume = {5}, 30355 pages = {487--523} 30356} 30357 30358@InCollection{ harker.pang:damped, 30359 author = {P. T. Harker and J. S. Pang}, 30360 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 30361 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 30362 publisher = {AMS}, 30363 year = {1990}, 30364 editor = {E. L. Allgower and K. Georg}, 30365 number = {26}, 30366 series = {Lectures on Applied Mathematics}, 30367 address = {Providence, Rhode Island}, 30368 pages = {265--284} 30369} 30370 30371@Article{ harker.pang:existence, 30372 author = {P. T. Harker and J. S. Pang}, 30373 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 30374 Constraints}, 30375 journal = {Operations Research Letters}, 30376 year = {1988}, 30377 volume = {7}, 30378 pages = {61--64} 30379} 30380 30381@Article{ harker.pang:finite-dimensional, 30382 author = {P. T. Harker and J. S. Pang}, 30383 title = {Finite--dimensional variational inequality and nonlinear complementarity 30384 problems: {A} survey of theory, algorithms and applications}, 30385 journal = {Mathematical Programming}, 30386 year = {1990}, 30387 volume = {48}, 30388 pages = {161--220} 30389} 30390 30391@Article{ harker.xiao:newtons, 30392 author = {P. T. Harker and B. Xiao}, 30393 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 30394 {B}--Differentiable Equation Approach}, 30395 journal = {Mathematical Programming}, 30396 year = {1990}, 30397 volume = {48}, 30398 pages = {339--358} 30399} 30400 30401@Article{ harker:accelerating, 30402 author = {P. T. Harker}, 30403 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 30404 Finite--Dimensional Variational Inequalities}, 30405 journal = {Mathematical Programming}, 30406 year = {1988}, 30407 volume = {41}, 30408 pages = {29--50} 30409} 30410 30411@Article{ harker:generalized, 30412 author = {P. T. Harker}, 30413 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 30414 journal = {European Journal of Operations Research}, 30415 volume = {54}, 30416 pages = {81--94}, 30417 year = {1987} 30418} 30419 30420@Book{ harker:lectures, 30421 author = {P. T. Harker}, 30422 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 30423 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 30424 year = {1993}, 30425 series = {CORE Lecture Series} 30426} 30427 30428@Article{ harris:pivot, 30429 author = {P. M. J. Harris}, 30430 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 30431 journal = {Mathematical Programming}, 30432 year = {1973}, 30433 volume = {5}, 30434 pages = {1--28} 30435} 30436 30437@InCollection{ harrison.kristrom:carbon, 30438 author = {G. W. Harrison and B. Kristrom}, 30439 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 30440 booktitle = {Environment and Transport in Economic Modelling}, 30441 publisher = {Kluwer Academic Publishers}, 30442 year = {1997}, 30443 editor = {R. Roson and K. A. Small}, 30444 address = {Amsterdam} 30445} 30446 30447@Article{ harrison.rutherford.ea:increased, 30448 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30449 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 30450 journal = {Journal of Economic Integration}, 30451 year = {1996}, 30452 volume = {11}, 30453 pages = {332--365} 30454} 30455 30456@Article{ harrison.rutherford.ea:liberalizing, 30457 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 30458 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 30459 journal = {Journal of Policy Modeling}, 30460 year = {1995}, 30461 volume = {17} 30462} 30463 30464@Article{ harrison.rutherford.ea:quantifying, 30465 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30466 title = {Quantifying the {U}ruguay Round}, 30467 journal = {Finance and Development}, 30468 year = {1995}, 30469 volume = {32}, 30470 pages = {38--41} 30471} 30472 30473@InProceedings{ harrison.rutherford.ea:quantifying*1, 30474 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30475 title = {Quantifying the {U}ruguay Round}, 30476 year = {1996}, 30477 booktitle = {The {U}ruguay Round and the Developing Economies}, 30478 address = {New York}, 30479 editors = {W. Martin and L. A. Winters}, 30480 publisher = {Cambridge University Press} 30481} 30482 30483@Article{ harrison.rutherford.ea:quantifying*2, 30484 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30485 title = {Quantifying the {U}ruguay Round}, 30486 journal = {The Economic Journal}, 30487 year = {1997}, 30488 volume = {107}, 30489 pages = {1405--1430} 30490} 30491 30492@Article{ harrison.rutherford.ea:trade, 30493 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30494 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 30495 journal = {The World Bank Economic Review}, 30496 year = {1993}, 30497 volume = {7}, 30498 pages = {191--217} 30499} 30500 30501@Article{ hartman.stampacchia:nonlinear, 30502 author = {P. Hartman and G. Stampacchia}, 30503 title = {On some nonlinear differential-functional equations}, 30504 journal = {Acta Mathematica}, 30505 year = {1966}, 30506 volume = {115}, 30507 pages = {271--310} 30508} 30509 30510@Book{ harvey:forecasting, 30511 author = {Andrew C. Harvey}, 30512 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 30513 publisher = {Cambridge University Press}, 30514 address = {New York, NY}, 30515 year = {1989} 30516} 30517 30518@Article{ haurie.marcotte:relationship, 30519 author = {A. Haurie and P. Marcotte}, 30520 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 30521 journal = {Networks}, 30522 year = {1985}, 30523 volume = {15}, 30524 pages = {295--308} 30525} 30526 30527@Article{ hearn.lawphongpanich.ea:restricted, 30528 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 30529 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 30530 journal = {Mathematical Programming Study}, 30531 year = {1987}, 30532 volume = {31}, 30533 pages = {99--118} 30534} 30535 30536@Article{ hearn:gap, 30537 author = {D. W. Hearn}, 30538 title = {The Gap Function of a Convex Program}, 30539 journal = {Operations Research Letters}, 30540 year = {1982}, 30541 volume = {1}, 30542 pages = {67--71} 30543} 30544 30545@Article{ hedlund.gustavsson:design, 30546 author = {P. Hedlund and A. Gustavsson}, 30547 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 30548 Ability}, 30549 journal = {Analytica Chimica Acta}, 30550 year = {1992}, 30551 volume = {259}, 30552 pages = {243--256} 30553} 30554 30555@Article{ helgason.kennington.ea:parallelization, 30556 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 30557 title = {A Parallelization of the Simplex Method}, 30558 journal = {Annals of Operations Research}, 30559 year = {1988}, 30560 volume = {14}, 30561 pages = {17--40} 30562} 30563 30564@Article{ helgason.kennington.ea:polynomially, 30565 author = {Richard Helgason and James Kennington and H. Lall}, 30566 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 30567 journal = {Mathematical Programming}, 30568 year = {1980}, 30569 volume = {18}, 30570 pages = {338--343} 30571} 30572 30573@Book{ henderson.quandt:microeconomic, 30574 author = {J. M. Henderson and R. E. Quandt}, 30575 title = {Microeconomic Theory}, 30576 publisher = {McGraw--Hill}, 30577 address = {New York}, 30578 year = {1980}, 30579 edition = {Third} 30580} 30581 30582@TechReport{ hendrickson.leland:chaco, 30583 author = {B. Hendrickson and R. Leland}, 30584 title = {The {C}haco User's Guide: Version 2}, 30585 institution = {Sandia National Laboratories}, 30586 type = {Technical Report}, 30587 number = {SAND94-2692}, 30588 address = {Albuquerque, New Mexico}, 30589 year = {1994} 30590} 30591 30592@InProceedings{ hendrickson.leland:multilevel, 30593 author = {B. Hendrickson and R. Leland}, 30594 title = {A Multilevel Algorithm for Partitioning Graphs}, 30595 booktitle = {Proceedings of Supercomputing '95}, 30596 year = {1995} 30597} 30598 30599@Book{ hertz.krogh.ea:introduction, 30600 author = {J. Hertz and A. Krogh and R. G. Palmer}, 30601 title = {Introduction to the Theory of Neural Computation}, 30602 year = {1991}, 30603 publisher = {Addison-Wesley}, 30604 address = {Redwood City, California} 30605} 30606 30607@Article{ hertz.werra:tabu, 30608 author = {A. Hertz and D. de Werra}, 30609 title = {Using {T}abu Search techniques for Graph Coloring}, 30610 journal = {Computing}, 30611 year = {1987}, 30612 volume = {29}, 30613 pages = {345--351} 30614} 30615 30616@InCollection{ hettich:review, 30617 author = {R. Hettich}, 30618 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 30619 booktitle = {Semi-Infinite Programming and Applications}, 30620 year = {1983}, 30621 editor = {A. V. Fiacco and K. O. Kortanek}, 30622 publisher = {Springer-Verlag}, 30623 address = {Berlin} 30624} 30625 30626@Article{ highleyman:note, 30627 author = {W. H. Highleyman}, 30628 title = {A Note on Linear Separation}, 30629 journal = {IRE Transactions on Electronic Computers}, 30630 year = {1961}, 30631 volume = {10}, 30632 pages = {777--778} 30633} 30634 30635@Article{ hildreth:quadratic, 30636 author = {C. Hildreth}, 30637 title = {A Quadratic Programming Procedure}, 30638 journal = {Naval Research Logistics Quarterly}, 30639 year = {1957}, 30640 volume = {4}, 30641 pages = {79--85}, 30642 note = {Erratum, p. 361} 30643} 30644 30645@Book{ himmelblau:applied, 30646 author = {D. M. Himmelblau}, 30647 title = {Applied Nonlinear Programming}, 30648 year = {1972}, 30649 publisher = {McGraw--Hill}, 30650 address = {New York} 30651} 30652 30653@Book{ hiriart-urruty.lemarechal:convex, 30654 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 30655 title = {Convex Analysis and Minimization Algorithms {I}}, 30656 year = {1993}, 30657 publisher = {Springer Verlag}, 30658 address = {Berlin}, 30659 volume = {305}, 30660 series = {Grundlehren der mathematischen Wissenschaften} 30661} 30662 30663@TechReport{ hironaka:introduction, 30664 author = {H. Hironaka}, 30665 title = {Introduction to real-analytic sets and real-analytic maps}, 30666 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 30667 year = {1973}, 30668 type = {Technical Report}, 30669 address = {Pisa, Italy} 30670} 30671 30672@Article{ ho.lee.ea:decomposition, 30673 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 30674 title = {Decomposition of Linear Programs Using Parallel Computation}, 30675 journal = {Mathematical Programming}, 30676 year = {1988}, 30677 volume = {42}, 30678 pages = {391--405} 30679} 30680 30681@Article{ ho.loute:computational, 30682 author = {J. K. Ho and E. Loute}, 30683 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 30684 for Linear Programming}, 30685 journal = {Mathematical Programming}, 30686 year = {1983}, 30687 volume = {27}, 30688 pages = {283--290} 30689} 30690 30691@Book{ hock.schittkowski:test, 30692 author = {W. Hock and K. Schittkowski}, 30693 title = {Test Examples for Nonlinear Programming Codes}, 30694 volume = {187}, 30695 series = {Lecture Notes in Economics and Mathematical Systems}, 30696 year = {1981}, 30697 publisher = {Springer Verlag}, 30698 address = {Berlin, Germany} 30699} 30700 30701@Book{ hockney.jesshope:parallel, 30702 author = {R. W. Hockney and C. R. Jesshope}, 30703 title = {Parallel Computers 2}, 30704 publisher = {Adam Hilger}, 30705 year = {1988}, 30706 address = {Bristol} 30707} 30708 30709@Article{ hoffman:approximate, 30710 author = {A. J. Hoffman}, 30711 title = {On Approximate Solutions of Systems of Linear Inequalities}, 30712 journal = {Journal of Research of the National Bureau of Standards}, 30713 year = {1952}, 30714 volume = {49}, 30715 pages = {263--265} 30716} 30717 30718@Article{ hogan:comments, 30719 author = {W. W. Hogan}, 30720 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 30721 for the {USA}}, 30722 journal = {The Energy Journal}, 30723 year = {1990}, 30724 volume = {11}, 30725 pages = {75--84} 30726} 30727 30728@Article{ hogan:energy, 30729 author = {W. W. Hogan}, 30730 title = {Energy Policy Models for {P}roject {I}ndependence}, 30731 journal = {Computers \& Operations Research}, 30732 year = {1975}, 30733 volume = {2}, 30734 pages = {251--271} 30735} 30736 30737@Book{ holland:adaptation, 30738 author = {J. Holland}, 30739 title = {Adaptation in Natural and Artificial Systems}, 30740 year = {1975}, 30741 publisher = {The University of Michigan Press}, 30742 address = {Ann Arbor, Michigan} 30743} 30744 30745@Article{ holmes.mackie:comparison, 30746 author = {T. Holmes and T. R. Mackie}, 30747 title = {A comparison of three inverse treatment planning algorithms}, 30748 journal = {Physics in Medicine and Biology}, 30749 year = {1994}, 30750 volume = {39}, 30751 number = {1}, 30752 pages = {91--106} 30753} 30754 30755@Article{ holmes.mackie:filtered, 30756 author = {T. Holmes and T. R. Mackie}, 30757 title = {A filtered backprojection dose calculation method for inverse treatment 30758 planning}, 30759 journal = {Medical Physics}, 30760 year = {1994}, 30761 volume = {21}, 30762 number = {2}, 30763 pages = {303--313} 30764} 30765 30766@Article{ hooke.jeeves:direct, 30767 author = {R. Hooke and T. A. Jeeves}, 30768 title = {Direct Search Solution of Numerical and Statistical Problems}, 30769 journal = {Journal of Associated Computing Machinery}, 30770 year = {1961}, 30771 volume = {8}, 30772 pages = {212--229} 30773} 30774 30775@Article{ hoppe.mittelmann:multi-grid, 30776 author = {R. H. W. Hoppe and H. D. Mittelmann}, 30777 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 30778 Inequalities}, 30779 journal = {Journal of Computational and Applied Mathematics}, 30780 year = {1989}, 30781 volume = {26}, 30782 pages = {35--46} 30783} 30784 30785@Book{ horn.johnson:matrix, 30786 author = {R. A. Horn and C. R. Johnson}, 30787 title = {Matrix Anaysis}, 30788 publisher = {Cambridge University Press}, 30789 year = {1985}, 30790 address = {Cambridge, England} 30791} 30792 30793@Article{ hornik.stinchcombe.ea:multilayer, 30794 author = {K. Hornik and M. Stinchcombe and H. White}, 30795 title = {Multilayer Feedforward Networks are Universal Approximators}, 30796 journal = {Neural Networks}, 30797 year = {1989}, 30798 volume = {2}, 30799 pages = {359--366} 30800} 30801 30802@Article{ horowitz.sahni:computing, 30803 author = {E. Horowitz and S. Sahni}, 30804 title = {Computing Partitions with Applications to the Knapsack Problem}, 30805 journal = {jacm}, 30806 year = {1974}, 30807 volume = {21}, 30808 pages = {277--292} 30809} 30810 30811@Article{ hristov.fallone:continuous, 30812 author = {D. H. Hristov and B. G. Fallone}, 30813 title = {A continuous penalty function method for inverse treatment planning}, 30814 journal = {Medical Physics}, 30815 year = {1998}, 30816 volume = {25}, 30817 number = {2}, 30818 pages = {208--223} 30819} 30820 30821@Article{ hu.cheng.ea:numerical, 30822 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 30823 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 30824 analysis}, 30825 journal = {Transactions of the {ASME}}, 30826 volume = {116}, 30827 year = {1994}, 30828 pages = {470--478} 30829} 30830 30831@InProceedings{ hua.sheu:skyscraper, 30832 author = {K. A. Hua and S. Sheu}, 30833 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 30834 Video-On-Demand Systems}, 30835 year = {1997}, 30836 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 30837 address = {Cannes, France}, 30838 pages = {89--100} 30839} 30840 30841@Article{ huang.pang:option, 30842 author = {J. Huang and J. S. Pang}, 30843 title = {Option Pricing and Linear Complementarity}, 30844 journal = {Journal of Computational Finance}, 30845 volume = {2}, 30846 year = {1998}, 30847 pages = {31--60} 30848} 30849 30850@InCollection{ huard:resolution, 30851 author = {P. Huard}, 30852 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 30853 of Centers}, 30854 booktitle = {Nonlinear Programming}, 30855 year = {1967}, 30856 editor = {J. Abadie}, 30857 publisher = {North--Holland}, 30858 address = {Amsterdam}, 30859 pages = {207--219} 30860} 30861 30862@Book{ huber:robust, 30863 author = {P. J. Huber}, 30864 title = {Robust Statistics}, 30865 year = {1981}, 30866 publisher = {John Wiley}, 30867 address = {New York} 30868} 30869 30870@Book{ hudson:piecewise, 30871 author = {J. F. P. Hudson}, 30872 title = {Piecewise Linear Topology}, 30873 publisher = {Benjamin}, 30874 address = {New York}, 30875 year = {1969} 30876} 30877 30878@InCollection{ hunter.markusen.ea:north, 30879 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 30880 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 30881 booktitle = {Modeling North American Economic Integration}, 30882 publisher = {Kluwer Academic Publishers}, 30883 year = {1995}, 30884 editor = {T. Kehoe and P. Kehoe}, 30885 pages = {117--130} 30886} 30887 30888@Article{ ibarra.kim:fast, 30889 author = {O. H. Ibarra and C. E. Kim}, 30890 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 30891 journal = {jacm}, 30892 year = {1975}, 30893 volume = {22}, 30894 pages = {463--468} 30895} 30896 30897@Article{ ijiri:fundamental, 30898 author = {Y. Ijiri}, 30899 title = {Fundamental Queries in Aggregation Theory}, 30900 journal = {Journal of the American Statistical Association}, 30901 year = {1971}, 30902 volume = {66}, 30903 pages = {766--782} 30904} 30905 30906@Article{ ingargiola.korsh:reduction, 30907 author = {G. P. Ingargiola and J. F. Korsh}, 30908 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 30909 journal = {Management Science}, 30910 year = {1973}, 30911 volume = {20}, 30912 pages = {460--463} 30913} 30914 30915@Article{ ioffe:variational, 30916 author = {A. D. Ioffe}, 30917 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 30918 Second--Order Directional Derivative}, 30919 journal = {Journal of Mathematical Analysis and its Applications}, 30920 year = {1993} 30921} 30922 30923@Article{ iri.imai:multiplicative, 30924 author = {M. Iri and H. Imai}, 30925 title = {A Multiplicative Barrier Function Method for Linear Programming}, 30926 journal = {Algorithmica}, 30927 year = {1986}, 30928 volume = {1}, 30929 pages = {455--482} 30930} 30931 30932@Article{ isac.goeleven:implicit, 30933 author = {G. Isac and D. Goeleven}, 30934 title = {The Implicit General Order Complementarity Problem, Models and Iterative 30935 Methods}, 30936 journal = {Annals of Operations Research}, 30937 year = {1993} 30938} 30939 30940@Article{ isac.kostreva:generalized, 30941 author = {G. Isac and M. M. Kostreva}, 30942 title = {The Generalized Order Complementarity Problem}, 30943 journal = {Journal of Optimization Theory and Applications}, 30944 volume = {19}, 30945 pages = {227--232}, 30946 year = {1991} 30947} 30948 30949@Book{ isac:complementarity, 30950 author = {G. Isac}, 30951 title = {Complementarity Problems}, 30952 publisher = {Springer-Verlag}, 30953 year = {1992}, 30954 series = {Lecture Notes in Mathematics}, 30955 address = {New York} 30956} 30957 30958@Article{ iusem.svaiter:variant, 30959 author = {A. N. Iusem and B. F. Svaiter}, 30960 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 30961 Search Strategy}, 30962 journal = {Optimization}, 30963 year = {1997}, 30964 volume = {42}, 30965 pages = {309--321} 30966} 30967 30968@Article{ iusem:convergence, 30969 author = {A. N. Iusem}, 30970 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 30971 Problems}, 30972 journal = {Mathematical Programming}, 30973 year = {1993}, 30974 volume = {59}, 30975 pages = {33--48} 30976} 30977 30978@Article{ jackson.kutcher.ea:probability, 30979 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 30980 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 30981 Architecture subject to Non-Uniform Irradiation}, 30982 journal = {Medical Physics}, 30983 year = {1993}, 30984 volume = {20}, 30985 pages = {613--625} 30986} 30987 30988@Article{ jackson:optimization, 30989 author = {A. Jackson and X. H. Wang and R. Mohan}, 30990 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 30991 (abstract)}, 30992 journal = {Medical Physics}, 30993 year = {1994}, 30994 volume = {21}, 30995 pages = {1006} 30996} 30997 30998@TechReport{ jackson:scheduling, 30999 author = {J. R. Jackson}, 31000 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 31001 institution = {University of California}, 31002 year = {1955}, 31003 address = {Los Angeles}, 31004 number = {43}, 31005 type = {Research Report} 31006} 31007 31008@Article{ jansen.roos.ea:polynomiality, 31009 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 31010 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 31011 Complementarity Problems}, 31012 journal = {Mathematical Programming}, 31013 volume = {78}, 31014 pages = {315--346}, 31015 year = {1997} 31016} 31017 31018@Article{ jiang.fukushima.ea:trust, 31019 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 31020 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 31021 journal = {SIAM Journal on Optimization}, 31022 volume = {8}, 31023 pages = {140--157}, 31024 year = {1998} 31025} 31026 31027@Article{ jiang.qi:nonsmooth, 31028 author = {H. Jiang and L. Qi}, 31029 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 31030 journal = {SIAM Journal on Control and Optimization}, 31031 volume = {35}, 31032 pages = {178--193}, 31033 year = {1997} 31034} 31035 31036@TechReport{ jiang.ralph:qpecgen, 31037 author = {H. Jiang and D. Ralph}, 31038 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 31039 Objectives and Affine Variational Inequality Constraints}, 31040 year = {1997}, 31041 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31042 address = {Australia} 31043} 31044 31045@TechReport{ jiang.ralph:smooth, 31046 author = {H. Jiang and D. Ralph}, 31047 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 31048 Constraints}, 31049 year = {1997}, 31050 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31051 address = {Australia} 31052} 31053 31054@Article{ jiang:unconstrained, 31055 author = {H. Jiang}, 31056 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 31057 journal = {Journal of Global Optimization, forthcoming}, 31058 year = {1997} 31059} 31060 31061@Article{ jittorntrum.osborne:strong, 31062 author = {K. Jittorntrum and M. R. Osborne}, 31063 title = {Strong uniqueness and second order convergence in nonlinear discrete 31064 approximation}, 31065 journal = {Numerische Mathematik}, 31066 year = {1980}, 31067 volume = {34}, 31068 pages = {439--455} 31069} 31070 31071@InProceedings{ jog.suh.ea:effects, 31072 crossref = {schaeffer:third}, 31073 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31074 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 31075 Genetic Algorithm for the Travelling Salesman Problem}, 31076 pages = {110--115} 31077} 31078 31079@Article{ jog.suh.ea:parallel, 31080 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31081 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 31082 journal = {SIAM Journal on Optimization}, 31083 year = {1991}, 31084 volume = {1} 31085} 31086 31087@Article{ johansson.klarbring:rigid, 31088 author = {L. Johansson and A. Klarbring}, 31089 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 31090 Complementarity}, 31091 journal = {Mechanics of Structures \& Machines}, 31092 volume = {20}, 31093 pages = {293--319}, 31094 year = {1992} 31095} 31096 31097@Article{ johnson.aragon.ea:optimization, 31098 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 31099 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 31100 Partitioning}, 31101 journal = {Operations Research}, 31102 year = {1989}, 31103 volume = {37}, 31104 pages = {865--892} 31105} 31106 31107@Article{ johnson:optimally, 31108 author = {R. Johnson}, 31109 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 31110 journal = {Management Science}, 31111 year = {1988}, 31112 volume = {34}, 31113 pages = {240--253} 31114} 31115 31116@Article{ johnsson:solving, 31117 author = {S. L. Johnsson}, 31118 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 31119 journal = {SIAM Journal on Scientific and Statistical Computing}, 31120 year = {1987}, 31121 volume = {8}, 31122 pages = {475--489} 31123} 31124 31125@Article{ jorgenson.wilcoxen:reducing, 31126 author = {D. W. Jorgenson and P. J. Wilcoxen}, 31127 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 31128 journal = {Resource and Energy Economics}, 31129 year = {1993}, 31130 volume = {15}, 31131 pages = {7--25} 31132} 31133 31134@TechReport{ josephy:hogans, 31135 author = {N. H. Josephy}, 31136 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 31137 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31138 year = {1979}, 31139 address = {Madison, Wisconsin}, 31140 number = {1972}, 31141 type = {Technical Summary Report} 31142} 31143 31144@TechReport{ josephy:newton, 31145 author = {N. H. Josephy}, 31146 title = {A {N}ewton Method for the {PIES} Energy Model}, 31147 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31148 year = {1979}, 31149 address = {Madison, Wisconsin}, 31150 number = {1971}, 31151 type = {Technical Summary Report} 31152} 31153 31154@PhDThesis{ josephy:newtons, 31155 author = {N. H. Josephy}, 31156 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 31157 year = {1979}, 31158 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 31159} 31160 31161@TechReport{ josephy:newtons*1, 31162 author = {N. H. Josephy}, 31163 title = {{N}ewton's Method for Generalized Equations}, 31164 institution = {Mathematics Research Center, University of Wisconsin}, 31165 year = {1979}, 31166 address = {Madison, Wisconsin}, 31167 number = {1965}, 31168 type = {Technical Summary Report} 31169} 31170 31171@TechReport{ josephy:quasi-newton, 31172 author = {N. H. Josephy}, 31173 title = {Quasi--{N}ewton Methods for Generalized Equations}, 31174 institution = {Mathematics Research Center, University of Wisconsin}, 31175 year = {1979}, 31176 address = {Madison, Wisconsin}, 31177 number = {1966}, 31178 type = {Technical Summary Report} 31179} 31180 31181@PhDThesis{ kabbadj:methodes, 31182 author = {S. Kabbadj}, 31183 title = {Methodes Proximales Entropiques}, 31184 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 31185 year = {1994}, 31186 type = {Doctoral Thesis} 31187} 31188 31189@Book{ kall.wallace:stochastic, 31190 author = {P. Kall and S. W. Wallace}, 31191 title = {Stochastic Programming}, 31192 publisher = {John Wiley \& Sons}, 31193 year = {1994}, 31194 address = {Chichester} 31195} 31196 31197@Article{ kallman.agren.ea:tumor, 31198 author = {P. Kallman and A. Agren and A. Brahme}, 31199 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 31200 journal = {International Journal of Radiation Biology}, 31201 year = {1992}, 31202 volume = {62}, 31203 pages = {249--262} 31204} 31205 31206@Misc{ kalvelagen:gams, 31207 author = {Erwin Kalvelagen}, 31208 title = {The {GAMS} {I/O} Library}, 31209 howpublished = {mimeo, GAMS Development Corporation}, 31210 year = {1992}, 31211 note = {Preliminary Version} 31212} 31213 31214@Article{ kaneko:complete, 31215 author = {I. Kaneko}, 31216 title = {Complete solution of a class of elastic-plastic structures}, 31217 journal = {Computer Methods in Applied Mechanics and Engineering}, 31218 volume = {21}, 31219 year = {1980}, 31220 pages = {193--209} 31221} 31222 31223@Article{ kaneko:mathematical, 31224 author = {I. Kaneko}, 31225 title = {A mathematical programming method for the inelastic analysis of reinforced 31226 concrete frames}, 31227 journal = {International Journal for Numerical Methods in Engineering}, 31228 volume = {11}, 31229 year = {1977}, 31230 pages = {1137--1154} 31231} 31232 31233@Article{ kaneko:piecewise, 31234 author = {I. Kaneko}, 31235 title = {Piecewise linear elastic-plastic analysis}, 31236 journal = {International Journal for Numerical Methods in Engineering}, 31237 volume = {14}, 31238 year = {1979}, 31239 pages = {757--767} 31240} 31241 31242@Article{ kanet:minimizing, 31243 author = {J. J. Kanet}, 31244 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 31245 Date}, 31246 journal = {Naval Research Logistics Quarterly}, 31247 year = {1981}, 31248 volume = {28}, 31249 pages = {643--651} 31250} 31251 31252@Article{ kantorovich:mathematical, 31253 author = {L. V. Kantorovich}, 31254 title = {Mathematical Methods in the Organization and Planning of Production}, 31255 journal = {Management Science}, 31256 year = {1960}, 31257 volume = {6}, 31258 pages = {366--422}, 31259 note = {English translation, Russian version 1939} 31260} 31261 31262@Article{ kanzow.fukushima:equivalence, 31263 author = {C. Kanzow and M. Fukushima}, 31264 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 31265 Unconstrained Minimization}, 31266 journal = {Journal of Optimization Theory and Applications}, 31267 year = {1996}, 31268 volume = {90}, 31269 pages = {581--603} 31270} 31271 31272@Article{ kanzow.fukushima:theoretical, 31273 author = {C. Kanzow and M. Fukushima}, 31274 title = {Theoretical and Numerical Investigation of the {D}-gap function for 31275 Box-Constrained Variational Inequalities}, 31276 journal = {Mathematical Programming}, 31277 year = {1998}, 31278 volume = {83}, 31279 pages = {55--88} 31280} 31281 31282@Article{ kanzow.jiang:continuation, 31283 author = {C. Kanzow and H. Jiang}, 31284 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 31285 journal = {Mathematical Programming}, 31286 year = {1998}, 31287 volume = {81}, 31288 pages = {103--125} 31289} 31290 31291@Article{ kanzow.kleinmichel:class, 31292 author = {C. Kanzow and H. Kleinmichel}, 31293 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 31294 Optimization}, 31295 journal = {Optimization Methods and Software}, 31296 year = {1995}, 31297 volume = {5}, 31298 pages = {173--198} 31299} 31300 31301@Article{ kanzow.kleinmichel:new, 31302 author = {C. Kanzow and H. Kleinmichel}, 31303 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 31304 Problems}, 31305 journal = {Computational Optimization and Applications}, 31306 volume = {11}, 31307 pages = {227--251}, 31308 year = {1998} 31309} 31310 31311@Article{ kanzow.pieper:jacobian, 31312 author = {C. Kanzow and H. Pieper}, 31313 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 31314 journal = {SIAM Journal on Optimization}, 31315 year = {1999}, 31316 volume = {9}, 31317 pages = {342--373} 31318} 31319 31320@Article{ kanzow.qi:qp-free, 31321 author = {C. Kanzow and H. -D. Qi}, 31322 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 31323 problems}, 31324 journal = {Mathematical Programming}, 31325 year = {1999}, 31326 volume = {85}, 31327 pages = {81--106} 31328} 31329 31330@Article{ kanzow.yamashita.ea:ncp-functions, 31331 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 31332 title = {New {NCP}-functions and their properties}, 31333 journal = {Journal of Optimization Theory and Applications}, 31334 year = {1997}, 31335 volume = {94}, 31336 pages = {115--135} 31337} 31338 31339@TechReport{ kanzow.zupke:inexact, 31340 author = {C. Kanzow and M. Zupke}, 31341 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 31342 year = {1997}, 31343 institution = {Institute of Applied Mathematics, University of Hamburg}, 31344 type = {Preprint}, 31345 number = {127}, 31346 address = {Hamburg, Germany} 31347} 31348 31349@Article{ kanzow:approach, 31350 author = {C. Kanzow}, 31351 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 31352 {P}-Functions}, 31353 journal = {Operations Research Letters}, 31354 volume = {20}, 31355 year = {1997}, 31356 pages = {85--92} 31357} 31358 31359@Article{ kanzow:equation-based, 31360 author = {C. Kanzow}, 31361 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 31362 journal = {Optimization Methods and Software}, 31363 year = {1994}, 31364 volume = {3}, 31365 pages = {327--340} 31366} 31367 31368@Article{ kanzow:global, 31369 author = {C. Kanzow}, 31370 title = {Global Convergence Properties of Some Iterative Methods for Linear 31371 Complementarity Problems}, 31372 journal = {SIAM Journal on Optimization}, 31373 year = {1996}, 31374 volume = {6}, 31375 pages = {326--341} 31376} 31377 31378@Article{ kanzow:inexact, 31379 author = {C. Kanzow}, 31380 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 31381 journal = {Numerische Mathematik, forthcoming}, 31382 year = {1999} 31383} 31384 31385@Article{ kanzow:noninterior, 31386 author = {C. Kanzow}, 31387 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 31388 journal = {SIAM Journal on Matrix Analysis and Applications}, 31389 volume = {17}, 31390 pages = {851--868}, 31391 year = {1996} 31392} 31393 31394@Article{ kanzow:nonlinear, 31395 author = {C. Kanzow}, 31396 title = {Nonlinear Complementarity as Unconstrained Optimization}, 31397 journal = {Journal of Optimization Theory and Applications}, 31398 year = {1996}, 31399 volume = {88}, 31400 pages = {139--155} 31401} 31402 31403@TechReport{ kanzow:semismooth, 31404 author = {C. Kanzow}, 31405 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 31406 Problems}, 31407 institution = {Institute of Applied Mathematics, University of Hamburg}, 31408 year = {1997}, 31409 type = {Preprint}, 31410 address = {Hamburg, Germany} 31411} 31412 31413@TechReport{ kanzow:tools, 31414 annote = {This should be replaced by kanzow:noninterior}, 31415 author = {C. Kanzow}, 31416 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 31417 institution = {Institute of Applied Mathematics, University of Hamburg}, 31418 year = {1994}, 31419 address = {Germany} 31420} 31421 31422@Article{ kaplan.meier:nonparametric, 31423 author = {E. L. Kaplan and P. Meier}, 31424 title = {Nonparametric Estimation from Incomplete Observations}, 31425 journal = {J. Am. Stat. Assoc.}, 31426 year = {1958}, 31427 volume = {53}, 31428 pages = {457--481} 31429} 31430 31431@Article{ karamardian:complementarity, 31432 author = {S. Karamardian}, 31433 title = {The Complementarity Problem}, 31434 journal = {Mathematical Programming}, 31435 year = {1972}, 31436 volume = {2}, 31437 pages = {107--129} 31438} 31439 31440@Article{ karamardian:complementarity*1, 31441 author = {S. Karamardian}, 31442 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 31443 journal = {Journal of Optimization Theory and Applications}, 31444 year = {1976}, 31445 volume = {18}, 31446 pages = {445--454} 31447} 31448 31449@Article{ karamardian:generalized, 31450 author = {S. Karamardian}, 31451 title = {Generalized Complementarity Problem}, 31452 journal = {Journal of Optimization Theory and Applications}, 31453 year = {1971}, 31454 volume = {8}, 31455 pages = {161--167} 31456} 31457 31458@Article{ karmarkar.karp.ea:probabilistic, 31459 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 31460 title = {Probabilistic Analysis of Optimum Partitioning}, 31461 journal = {Journal of Applied Probability}, 31462 year = {1986}, 31463 volume = {23}, 31464 pages = {626--645} 31465} 31466 31467@Article{ karmarkar:polynomial, 31468 author = {N. Karmarkar}, 31469 title = {A New Polynomial Time Algorithm for Linear Programming}, 31470 journal = {Combinatorica}, 31471 year = {1984}, 31472 volume = {4}, 31473 pages = {373--395} 31474} 31475 31476@Unpublished{ karp:probabilistic, 31477 author = {R. M. Karp}, 31478 title = {Probabilistic Analysis of Algorithms}, 31479 note = {(Lecture Notes)} 31480} 31481 31482@InCollection{ karp:reducibility, 31483 author = {R. M. Karp}, 31484 title = {Reducibility among Combinatorial Problems}, 31485 booktitle = {Complexity of Computer Computations}, 31486 year = {1972}, 31487 editor = {R. E. Miller and J. W. Thatcher}, 31488 publisher = {Plenum Press}, 31489 address = {New York}, 31490 pages = {85--103} 31491} 31492 31493@MastersThesis{ karush:minima, 31494 author = {W. Karush}, 31495 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 31496 year = {1939}, 31497 school = {Department of Mathematics, University of Chicago} 31498} 31499 31500@TechReport{ karypis.kumar:metis, 31501 author = {G. Karypis and V. Kumar}, 31502 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 31503 Version 2.0}, 31504 institution = {University of Minnesota, Department of Computer Science}, 31505 type = {Technical Report}, 31506 address = {Minnesota}, 31507 year = {1995} 31508} 31509 31510@TechReport{ karypis.kumar:multilevel, 31511 author = {G. Karypis and V. Kumar}, 31512 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 31513 institution = {University of Minnesota, Department of Computer Science}, 31514 type = {Technical Report}, 31515 number = {95-064}, 31516 address = {Minnesota}, 31517 year = {1995} 31518} 31519 31520@Article{ katukani:generalization, 31521 author = {S. Katukani}, 31522 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 31523 journal = {Duke Mathematical Journal}, 31524 year = {1941}, 31525 volume = {8}, 31526 pages = {457--459} 31527} 31528 31529@Article{ keifer.wolfowitz:stochastic, 31530 author = {J. Keifer and J. Wolfowitz}, 31531 title = {Stochastic Estimation of the Maximum of a Regression Function}, 31532 journal = {Annals of Mathematical Statistics}, 31533 year = {1952}, 31534 volume = {23}, 31535 pages = {462--466} 31536} 31537 31538@InCollection{ kellog.li.ea:method, 31539 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 31540 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 31541 booktitle = {Computing Fixed Points with Applications}, 31542 year = {1977}, 31543 editor = {S. Karamardian}, 31544 publisher = {Academic Press}, 31545 pages = {133--147} 31546} 31547 31548@Book{ kennington.helgason:algorithms, 31549 author = {J. L. Kennington and R. V. Helgason}, 31550 title = {Algorithms for Network Programming}, 31551 year = {1980}, 31552 publisher = {John Wiley \& Sons}, 31553 address = {New York} 31554} 31555 31556@Article{ kernighan.lin:efficient, 31557 author = {B. W. Kernighan and S. Lin}, 31558 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 31559 journal = {The Bell System Technical Journal}, 31560 pages = {291--307}, 31561 volume = {29}, 31562 year = {1970} 31563} 31564 31565@Article{ khachian:polynomial, 31566 author = {L. G. Khachian}, 31567 title = {A Polynomial Algorithm for Linear Programming}, 31568 journal = {Soviet Mathematics Doklady}, 31569 year = {1979}, 31570 volume = {20}, 31571 pages = {191--194} 31572} 31573 31574@Article{ khobotov:modification, 31575 author = {E. N. Khobotov}, 31576 title = {A Modification of the Extragradient Method for the Solution of Variational 31577 Inequalities and some Optimization Problems}, 31578 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 31579 year = {1987}, 31580 volume = {27}, 31581 pages = {1462--1473} 31582} 31583 31584@Book{ khuri.cornell:response, 31585 author = {A. I. Khuri and J. A. Cornell}, 31586 title = {Response Surfaces: Designs and Analyses}, 31587 publisher = {Marcel Dekker}, 31588 year = {1987}, 31589 address = {New York} 31590} 31591 31592@Article{ kibardin:decomposition, 31593 author = {V. M. Kibardin}, 31594 title = {Decomposition into Functions in the Minimization Problems}, 31595 journal = {Automation and Remote Control}, 31596 year = {1980}, 31597 volume = {40}, 31598 pages = {1311--1323} 31599} 31600 31601@TechReport{ king:sposl, 31602 author = {A. J. King}, 31603 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 31604 institution = {IBM T.J. Watson Research Center}, 31605 year = {1994}, 31606 number = {RC 19757}, 31607 address = {Yorktown Heights, New York} 31608} 31609 31610@Article{ kirkpatrick.gelatt.ea:optimization, 31611 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 31612 title = {Optimization by Simulated Annealing}, 31613 journal = {Science}, 31614 year = {1983}, 31615 volume = {220}, 31616 pages = {671--680} 31617} 31618 31619@Book{ kiwiel:methods, 31620 author = {K. C. Kiwiel}, 31621 title = {Methods of Descent for Nondifferentiable Optimization}, 31622 year = {1985}, 31623 publisher = {Springer-Verlag}, 31624 address = {Berlin}, 31625 series = {Lecture Notes in Mathematics}, 31626 number = {1133} 31627} 31628 31629@Article{ kiwiel:twice, 31630 author = {K. C. Kiwiel}, 31631 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 31632 journal = {Journal of Optimization Theory and Applications}, 31633 year = {1996}, 31634 volume = {88}, 31635 pages = {233--236} 31636} 31637 31638@Article{ klarbring.bjorkman:mathematical, 31639 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31640 title = {A mathematical programming approach to contact problems with friction and varying 31641 contact surface}, 31642 journal = {Computers \& Structures}, 31643 volume = {30}, 31644 year = {1988}, 31645 pages = {1185--1198} 31646} 31647 31648@Article{ klarbring.bjorkman:solution, 31649 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31650 title = {Solution of large displacement contact problems with friction using {N}ewton's 31651 method for generalized equations}, 31652 journal = {International Journal for Numerical Methods in Engineering}, 31653 volume = {34}, 31654 year = {1992}, 31655 pages = {249--269} 31656} 31657 31658@Article{ klarbring.pang:existence, 31659 author = {A. Klarbring and J. S. Pang}, 31660 title = {Existence of solution to discrete semicoercive frictional contact problems}, 31661 journal = {{SIAM} Journal on Optimization, under review}, 31662 year = {1996} 31663} 31664 31665@Article{ klarbring:discrete, 31666 author = {A. Klarbring}, 31667 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 31668 (Stability, Uniqueness and Variational Principles)}, 31669 journal = {International Journal on Solids and Structures}, 31670 volume = {24}, 31671 pages = {459--479}, 31672 year = {1988} 31673} 31674 31675@TechReport{ klarbring:large, 31676 author = {A. Klarbring}, 31677 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 31678 Discretization}, 31679 number = {LiTH-IKP-R-798}, 31680 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 31681 address = {Link{\"o}ping}, 31682 year = {1994} 31683} 31684 31685@Article{ klarbring:mathematical, 31686 author = {A. Klarbring}, 31687 title = {A mathematical programming approach to three dimensional contact problems with 31688 friction}, 31689 journal = {Computer Methods in Applied Mechanics and Engineering}, 31690 volume = {58}, 31691 year = {1986}, 31692 pages = {175--200} 31693} 31694 31695@InCollection{ klarbring:mathematical*1, 31696 author = {A. Klarbring}, 31697 title = {Mathematical programming and augmented {L}agrangian methods for frictional 31698 contact problems}, 31699 editor = {A. Curnier}, 31700 booktitle = {Proceedings Contact Mechanics International Symposium}, 31701 publisher = {Presse Polytechniques et Universitaires Romandes}, 31702 address = {Lausanne}, 31703 year = {1992}, 31704 pages = {409--422} 31705} 31706 31707@InCollection{ klarbring:mathematical*2, 31708 author = {A. Klarbring}, 31709 title = {Mathematical programming in contact problems}, 31710 editors = {M. H. Aliabadi and C. A. Brebbia}, 31711 booktitle = {Computational Methods for Contact Problems}, 31712 publisher = {Computational Mechanics Publications}, 31713 address = {Southampton}, 31714 year = {1993}, 31715 pages = {233--264} 31716} 31717 31718@Article{ klarbring:quadratic, 31719 author = {A. Klarbring}, 31720 title = {A quadratic program in frictionless contact problems}, 31721 journal = {International Journal of Engineering Science}, 31722 volume = {24}, 31723 pages = {1207--1217}, 31724 year = {1986} 31725} 31726 31727@InCollection{ klee.minty:how, 31728 author = {V. Klee and G. J. Minty}, 31729 title = {How Good is the Simplex Algorithm?}, 31730 booktitle = {Inequalities--III}, 31731 year = {1972}, 31732 publisher = {Academic Press}, 31733 pages = {159--175} 31734} 31735 31736@Article{ kleywegt.shapiro:sample, 31737 author = {A. Kleywegt and A. Shapiro}, 31738 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 31739 journal = {Stochastic Programming E-Print Series}, 31740 year = {1999}, 31741 note = {Available from dochost.rz.hu-berlin.de/speps} 31742} 31743 31744@Book{ knuth:art, 31745 author = {D. E. Knuth}, 31746 title = {The Art of Computer Programming}, 31747 publisher = {Addison-Wesley Longman Inc.}, 31748 address = {Reading, Massachusetts}, 31749 year = {1998}, 31750 edition = {Third}, 31751 volume = {2} 31752} 31753 31754@InProceedings{ kocvara.outrata:nonsmooth, 31755 author = {M. Ko\v{c}vara and J. V. Outrata}, 31756 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 31757 crossref = {ferris.pang:complementarity}, 31758 pages = {148--164} 31759} 31760 31761@Article{ kocvara.outrata:optimization, 31762 author = {M. Ko\v{c}vara and J. V. Outrata}, 31763 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 31764 volume = {15}, 31765 journal = {Numerical Fucntional Analysis and Optimization}, 31766 year = {1994}, 31767 pages = {869--887} 31768} 31769 31770@InCollection{ kocvara.outrata:solution, 31771 author = {M. Ko\v{c}vara and J. V. Outrata}, 31772 title = {On the solution of optimum design problems with variational inequalities}, 31773 editors = {D. Z. Du and L. Qi and R. Womersley}, 31774 booktitle = {Recent Advances in Nonsmooth Optimization}, 31775 publisher = {World Scientific Publishers}, 31776 address = {Singapore}, 31777 year = {1995}, 31778 pages = {172--192} 31779} 31780 31781@Article{ kojima.hirabayashi:homotopy, 31782 author = {M. Kojima and R. Hirabayashi}, 31783 title = {Continuous deformation of nonlinear programs}, 31784 journal = {Mathematical Programming Study}, 31785 editor = {A.~V. Fiacco}, 31786 publisher = {North--Holland}, 31787 address = {Amsterdam}, 31788 year = {1984}, 31789 volume = {21}, 31790 pages = {150--198} 31791} 31792 31793@Article{ kojima.megiddo.ea:homotopy, 31794 author = {M. Kojima and N. Megiddo and T. Noma}, 31795 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 31796 journal = {Mathematics of Operations Research}, 31797 year = {1991}, 31798 volume = {16}, 31799 pages = {754--774} 31800} 31801 31802@TechReport{ kojima.megiddo.ea:primal-dual, 31803 author = {M. Kojima and N. Megiddo and S. Mizuno}, 31804 title = {A primal-dual exterior point algorithm for linear programming}, 31805 institution = {IBM Alamaden Research Center}, 31806 year = {1991}, 31807 number = {RJ 8500}, 31808 address = {San Jose, California} 31809} 31810 31811@Book{ kojima.megiddo.ea:unified, 31812 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 31813 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 31814 Problems}, 31815 year = {1991}, 31816 publisher = {Springer-Verlag}, 31817 address = {Berlin}, 31818 volume = {538}, 31819 series = {Lecture Notes in Computer Science} 31820} 31821 31822@Article{ kojima.mizuno.ea:continuation, 31823 author = {M. Kojima and S. Mizuno and T. Noma}, 31824 title = {A New Continuation Method for Complementarity Problems with Uniform 31825 {P}-function}, 31826 journal = {Mathematical Programming}, 31827 year = {1989}, 31828 volume = {43}, 31829 pages = {107--113} 31830} 31831 31832@TechReport{ kojima.mizuno.ea:infeasible, 31833 author = {M. Kojima and S. Mizuno and M. Todd}, 31834 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 31835 programming}, 31836 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 31837 year = {1992}, 31838 number = {1023}, 31839 address = {Ithaca, New York}, 31840 month = aug 31841} 31842 31843@Article{ kojima.mizuno.ea:onl, 31844 author = {M. Kojima and S. Mizuno and A. Yoshise}, 31845 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 31846 complementarity problems}, 31847 journal = {Mathematical Programming}, 31848 year = {1991}, 31849 volume = {50}, 31850 pages = {331--342} 31851} 31852 31853@Article{ kojima.mizuno.ea:polynomial-time, 31854 author = {M. Kojima and S. Mizuno and A. Yoshise}, 31855 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 31856 journal = {Mathematical Programming}, 31857 year = {1989}, 31858 volume = {44}, 31859 pages = {1--20} 31860} 31861 31862@Article{ kojima.noma.ea:global, 31863 author = {M. Kojima and T. Noma and A. Yoshise}, 31864 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 31865 journal = {Mathematical Programming}, 31866 volume = {65}, 31867 pages = {43--72}, 31868 year = {1994} 31869} 31870 31871@Article{ kojima.shindo.ea:interior-point, 31872 author = {M. Kojima and S. Shindo and S. Hara}, 31873 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 31874 Problem in Symmetric Matrices}, 31875 journal = {SIAM Journal on Optimization}, 31876 volume = {7}, 31877 pages = {86--125} 31878} 31879 31880@Article{ kojima.shindo:extensions, 31881 author = {M. Kojima and S. Shindo}, 31882 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 31883 Equations}, 31884 journal = {Journal of Operations Research Society of Japan}, 31885 year = {1986}, 31886 volume = {29}, 31887 pages = {352--374} 31888} 31889 31890@Article{ kojima:computational, 31891 author = {M. Kojima}, 31892 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 31893 journal = {Keio Engineering Reports}, 31894 year = {1974}, 31895 volume = {27}, 31896 pages = {1--41} 31897} 31898 31899@Article{ kojima:recent, 31900 author = {M. Kojima}, 31901 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 31902 continuation methods}, 31903 journal = {Systems and Control}, 31904 year = {1981}, 31905 volume = {25}, 31906 pages = {421--430} 31907} 31908 31909@Article{ kolesar:branch, 31910 author = {P. J. Kolesar}, 31911 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 31912 journal = {Management Science}, 31913 year = {1967}, 31914 volume = {13}, 31915 pages = {723--735} 31916} 31917 31918@Book{ kolman.beck:elementary, 31919 author = {B. Kolman and R. E. Beck}, 31920 title = {Elementary Linear Programming with Applications}, 31921 year = {1980}, 31922 publisher = {Academic Press} 31923} 31924 31925@Book{ koopmans:activity, 31926 editor = {T. C. Koopmans}, 31927 title = {Activity Analysis of Production and Allocation}, 31928 publisher = {John Wiley}, 31929 address = {New York}, 31930 year = {1951} 31931} 31932 31933@Article{ korpelevich:extragradient, 31934 author = {G. M. Korpelevich}, 31935 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 31936 journal = {Matecon}, 31937 year = {1976}, 31938 volume = {12}, 31939 pages = {747--756} 31940} 31941 31942@Article{ kortanek.shi:convergence, 31943 author = {K. O. Kortanek and M. Shi}, 31944 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 31945 Algorithm}, 31946 journal = {European Journal of Operational Research}, 31947 year = {1987}, 31948 volume = {32}, 31949 pages = {47--61} 31950} 31951 31952@TechReport{ kortanek.shi:remarks, 31953 author = {K. O. Kortanek and M. Shi}, 31954 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 31955 Hybrid Algorithm 1985-6'}, 31956 institution = {College of Business Administration, University of Iowa}, 31957 year = {1987}, 31958 address = {Iowa City}, 31959 number = {87--1}, 31960 type = {Working Paper} 31961} 31962 31963@TechReport{ kortanek:vector-supercomputer, 31964 author = {K. O. Kortanek}, 31965 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 31966 institution = {College of Business Administration, University of Iowa}, 31967 year = {1987}, 31968 address = {Iowa City}, 31969 number = {87--2}, 31970 type = {Working Paper} 31971} 31972 31973@Article{ kostreva:block, 31974 author = {M. M. Kostreva}, 31975 title = {Block Pivot Methods for Solving the Complementarity Problem}, 31976 journal = {Linear Algebra and Its Applications}, 31977 volume = {21}, 31978 pages = {207--215}, 31979 year = {1978} 31980} 31981 31982@Article{ kostreva:elasto-hydrodynamic, 31983 author = {M. M. Kostreva}, 31984 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 31985 journal = {International Journal for Numerical Methods in Fluids}, 31986 year = {1984}, 31987 volume = {4}, 31988 pages = {377--397} 31989} 31990 31991@Article{ kostreva:recent, 31992 author = {M. M. Kostreva}, 31993 title = {Recent Results on Complementarity Models for Engineering and Economics}, 31994 journal = {Infor, Journal of the Canadian {OR} Society}, 31995 year = {1990}, 31996 volume = {28}, 31997 pages = {324--334} 31998} 31999 32000@Article{ kotiah.steinberg:occurrences, 32001 author = {T. C. T. Kotiah and D. I. Steinberg}, 32002 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 32003 Programming Models}, 32004 journal = {Communications of the ACM}, 32005 volume = {20}, 32006 year = {1977}, 32007 pages = {107--112} 32008} 32009 32010@Article{ kotiah.steinberg:possibility, 32011 author = {T. C. T. Kotiah and D. I. Steinberg}, 32012 title = {On the Possibility of Cycling with the Simplex Method}, 32013 journal = {Operations Research}, 32014 volume = {26}, 32015 year = {1978}, 32016 pages = {374--376} 32017} 32018 32019@InCollection{ kuhn.tucker:nonlinear, 32020 author = {H. W. Kuhn and A. W. Tucker}, 32021 title = {Nonlinear Programming}, 32022 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 32023 Probability}, 32024 year = {1951}, 32025 editor = {J. Neyman}, 32026 publisher = {University of California Press}, 32027 address = {Berkeley and Los Angeles}, 32028 pages = {481--492} 32029} 32030 32031@Article{ kummer:metric, 32032 author = {B. Kummer}, 32033 title = {Metric regularity: characterizations, nonsmooth variations, and successive 32034 approximation}, 32035 journal = {Journal of Mathematical Analysis and its Applications}, 32036 year = {}, 32037 optkey = {}, 32038 optvolume = {}, 32039 optnumber = {}, 32040 optpages = {}, 32041 optmonth = {}, 32042 optnote = {}, 32043 optannote = {} 32044} 32045 32046@InCollection{ kummer:newtons, 32047 author = {B. Kummer}, 32048 title = {{N}ewton's Method for Non--Differentiable Functions}, 32049 booktitle = {Advances in Mathematical Optimization}, 32050 publisher = {Akademie--Verlag}, 32051 year = {1988}, 32052 editors = {J. Guddat et al.}, 32053 pages = {114--125}, 32054 address = {Berlin} 32055} 32056 32057@Unpublished{ kuntsevich.kappel:solvopt, 32058 author = {A. Kuntsevich and F. Kappel}, 32059 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 32060 year = {1997}, 32061 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 32062 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 32063} 32064 32065@Book{ kushner.clark:stochastic, 32066 author = {H. J. Kushner and D. S. Clark}, 32067 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 32068 publisher = {Springer-Verlag}, 32069 year = {1978}, 32070 address = {New York} 32071} 32072 32073@Article{ kutcher.burman.ea:histogram, 32074 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 32075 title = {Histogram reduction method for calculating complication probabilities for 32076 three-dimensional treatment planning evaluation}, 32077 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32078 year = {1991}, 32079 optvolume = {21}, 32080 optpages = {137-146} 32081} 32082 32083@Article{ kutcher.burman:calculation, 32084 author = {G. J. Kutcher and C. Burman}, 32085 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 32086 Irradiation: The Effective Volume Method}, 32087 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32088 year = {1989}, 32089 volume = {16}, 32090 pages = {1623--1630} 32091} 32092 32093@Article{ kwak.lee:complementarity, 32094 author = {B. M. Kwak and B. C. Lee.}, 32095 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 32096 Problem}, 32097 journal = {Computers and Structures}, 32098 volume = {18}, 32099 pages = {469--480}, 32100 year = {1988} 32101} 32102 32103@Article{ kwak:complementarity, 32104 author = {B. M. Kwak}, 32105 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 32106 journal = {Journal of Applied Mechanics}, 32107 volume = {58}, 32108 pages = {134--140}, 32109 year = {1991} 32110} 32111 32112@Article{ lagarias.reeds.ea:convergence, 32113 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 32114 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 32115 journal = {SIAM Journal on Optimization}, 32116 year = {1998}, 32117 volume = {9}, 32118 pages = {112--147} 32119} 32120 32121@Article{ lahaye:methode, 32122 author = {E. Lahaye}, 32123 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 32124 transcendantes}, 32125 journal = {C. R. Acad. Sci. Paris}, 32126 year = {1934}, 32127 volume = {198}, 32128 pages = {1840--1842} 32129} 32130 32131@Article{ lahaye:solution, 32132 author = {E. Lahaye}, 32133 title = {Solution of Systems of Transcendental Equations}, 32134 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 32135 year = {1948}, 32136 volume = {5}, 32137 pages = {805--822} 32138} 32139 32140@Article{ lahenbruch.mickey:estimation, 32141 author = {P. A. Lahenbruch and R. M. Mickey}, 32142 title = {Estimation of Error Rates in Discriminant Analysis}, 32143 journal = {Technometrics}, 32144 year = {1968}, 32145 volume = {10}, 32146 pages = {1--11} 32147} 32148 32149@Article{ lakshminarayan.lakshmanan.ea:optimal, 32150 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 32151 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 32152 journal = {Operations Research}, 32153 year = {1978}, 32154 volume = {26}, 32155 pages = {1079--1082} 32156} 32157 32158@Article{ land.doig:automatic, 32159 author = {A. H. Land and A. G. Doig}, 32160 title = {An Automatic Method for Solving Discrete Programming Problems}, 32161 journal = {Econometrica}, 32162 volume = {28}, 32163 year = {1960}, 32164 pages = {497-520} 32165} 32166 32167@Article{ langer.morrill:comparison, 32168 author = {M. Langer and S. Morrill}, 32169 title = {A comparison of mixed integer programming and fast simulated annealing for 32170 optimized beam weights in radiation therapy}, 32171 journal = {Medical Physics}, 32172 year = {1996}, 32173 volume = {23}, 32174 number = {6}, 32175 pages = {957--964} 32176} 32177 32178@Article{ larsson.patriksson:class, 32179 author = {T. Larsson and M. Patriksson}, 32180 title = {A Class of Gap Functions for Variational Inequalities}, 32181 journal = {Mathematical Programming}, 32182 year = {1994}, 32183 volume = {64}, 32184 pages = {53--79} 32185} 32186 32187@Article{ lasdon.waren.ea:solving, 32188 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 32189 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 32190 Linear Programming Algorithms}, 32191 journal = {ACM SIGMAP Bulletin}, 32192 year = {1979}, 32193 volume = {27}, 32194 pages = {9--15} 32195} 32196 32197@TechReport{ lawler.lenstra.ea:sequencing, 32198 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 32199 title = {Sequencing and Scheduling: Algorithms and Complexity}, 32200 institution = {Centre for Mathematics and Computer Science}, 32201 year = {1989}, 32202 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 32203 number = {BS--R89xx} 32204} 32205 32206@Article{ lawler:fast, 32207 author = {E. L. Lawler}, 32208 title = {Fast Approximations Algorithms for Knapsack Problems}, 32209 journal = {Mathematics of Operations Research}, 32210 year = {1979}, 32211 volume = {4}, 32212 pages = {339--356} 32213} 32214 32215@Book{ lawless:statistical, 32216 author = {J. F. Lawless}, 32217 title = {Statistical Models and Methods for Lifetime Data}, 32218 year = {1982}, 32219 publisher = {John Wiley and Sons}, 32220 address = {New York, NY} 32221} 32222 32223@Article{ lawrence.spingarn:fixed, 32224 author = {J. Lawrence and J. E. Spingarn}, 32225 title = {On fixed points of non-expansive piecewise isometric mappings}, 32226 journal = {Proceedings of the London Mathematical Society}, 32227 year = {1987}, 32228 volume = {55}, 32229 number = {3}, 32230 pages = {605--624} 32231} 32232 32233@Article{ leavitt.martin.ea:dynamic, 32234 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 32235 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 32236 dose delivery}, 32237 journal = {Medical Physics}, 32238 year = {1990}, 32239 volume = {17}, 32240 number = {1}, 32241 pages = {87--92} 32242} 32243 32244@Article{ leblanc.morlok.ea:efficient, 32245 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 32246 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 32247 Problem}, 32248 journal = {Transportation Research}, 32249 volume = {9}, 32250 year = {1975}, 32251 pages = {309--318} 32252} 32253 32254@Article{ lee:computational, 32255 author = {S. S. Lee}, 32256 title = {A computational method for frictional contact problem using finite element 32257 method}, 32258 journal = {International Journal for Numerical Methods in Engineering}, 32259 volume = {37}, 32260 year = {1994}, 32261 pages = {217--228} 32262} 32263 32264@PhDThesis{ lee:military, 32265 author = {D. K. Lee}, 32266 title = {Military Force Planning Problems Under Uncertainty}, 32267 school = {University of Wisconsin -- Madison}, 32268 year = {1996}, 32269 address = {Madison, Wisconsin} 32270} 32271 32272@Article{ leibel.kutcher.ea:improved, 32273 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 32274 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 32275 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 32276 the Nasopharynx}, 32277 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32278 year = {1991}, 32279 volume = {20}, 32280 pages = {823--833} 32281} 32282 32283@Article{ lee.gallagher.ea:treatment, 32284 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 32285 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 32286 Computational Approaches and Experiments with Permanent Prostate Implant 32287 Planning}, 32288 journal = {Physics in Medicine and Biology}, 32289 year = {1999}, 32290 volume = {44}, 32291 pages = {145--165} 32292} 32293 32294@Article{ lemarechal.nemirovskii.ea:variants, 32295 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 32296 title = {New Variants of Bundle Methods}, 32297 year = {1995}, 32298 journal = {Mathematical Programming}, 32299 volume = {69}, 32300 pages = {111--147} 32301} 32302 32303@InCollection{ lemarechal.strodiot.ea:bundle, 32304 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 32305 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 32306 booktitle = {Nonlinear Programming}, 32307 year = {1981}, 32308 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 32309 publisher = {Academic Press}, 32310 pages = {245--282}, 32311 volume = {4} 32312} 32313 32314@Article{ lemke.howson:equilibrium, 32315 author = {C. E. Lemke and J. T. Howson}, 32316 title = {Equilibrium Points of Bimatrix Games}, 32317 journal = {SIAM Journal on Applied Mathematics}, 32318 year = {1964}, 32319 volume = {12}, 32320 pages = {413--423} 32321} 32322 32323@Article{ lemke:bimatrix, 32324 author = {C. E. Lemke}, 32325 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 32326 journal = {Management Science}, 32327 year = {1965}, 32328 volume = {11}, 32329 pages = {681--689} 32330} 32331 32332@InCollection{ lemke:complementary, 32333 author = {C. E. Lemke}, 32334 title = {On Complementary Pivot Theory}, 32335 booktitle = {Mathematics of the Decision Sciences: Part 1}, 32336 publisher = {American Mathematical Society}, 32337 year = {1968}, 32338 editor = {G. B. Dantzig and A. F. Veinott}, 32339 volume = {11}, 32340 series = {Lectures in Applied Mathematics}, 32341 address = {Providence}, 32342 pages = {95--114} 32343} 32344 32345@Article{ levenberg:method, 32346 author = {K. Levenberg}, 32347 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 32348 journal = {Quarterly Applied Mathematics}, 32349 year = {1944}, 32350 volume = {2}, 32351 pages = {164--168} 32352} 32353 32354@Article{ levitin.polyak:constrained, 32355 author = {E. S. Levitin and B. T. Polyak}, 32356 title = {Constrained minimization methods}, 32357 journal = {Computational Mathematics and Mathematical Physics}, 32358 year = {1968}, 32359 volume = {6}, 32360 pages = {1--50}, 32361 note = {Translated from Russian} 32362} 32363 32364@Article{ li.swetis:linear, 32365 author = {W. Li and J. J. Swetits}, 32366 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 32367 journal = {SIAM Journal on Optimization}, 32368 volume = {8}, 32369 pages = {457-475}, 32370 year = {1998} 32371} 32372 32373@TechReport{ li:error, 32374 author = {W. Li}, 32375 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 32376 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32377 year = {1993}, 32378 address = {Norfolk, VA 23529}, 32379 number = {TR93-1}, 32380 note = {SIAM Journal on Control and Optimization, to appear} 32381} 32382 32383@TechReport{ li:linearly, 32384 author = {W. Li}, 32385 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 32386 Quadratic Splines}, 32387 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32388 year = {1993}, 32389 address = {Norfolk, VA 23529}, 32390 number = {TR93-3}, 32391 note = {Journal of Optimization Theory and Applications, to appear} 32392} 32393 32394@InProceedings{ li:merit, 32395 author = {W. Li}, 32396 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 32397 Problems}, 32398 crossref = {ferris.pang:complementarity} 32399} 32400 32401@Article{ li:remarks, 32402 author = {W. Li}, 32403 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 32404 Complementarity Problem}, 32405 journal = {SIAM Journal on Optimization}, 32406 year = {1993}, 32407 volume = {3}, 32408 pages = {155--163} 32409} 32410 32411@TechReport{ li:sharp, 32412 author = {W. Li}, 32413 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 32414 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32415 year = {1991}, 32416 address = {Norfolk, VA 23529}, 32417 number = {TR91-13}, 32418 note = {SIAM Journal on Control and Optimization, to appear} 32419} 32420 32421@Article{ lin.kernighan:efficient, 32422 author = {S. Lin and B. W. Kernighan}, 32423 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 32424 journal = {Operations Research}, 32425 year = {1973}, 32426 volume = {21}, 32427 pages = {498--516} 32428} 32429 32430@Article{ lin.pang:iterative, 32431 author = {Y. Y. Lin and J. S. Pang}, 32432 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 32433 journal = {SIAM Journal on Control and Optimization}, 32434 year = {1987}, 32435 volume = {25}, 32436 pages = {383--411} 32437} 32438 32439@Unpublished{ linderoth:branch, 32440 author = {J. Linderoth}, 32441 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 32442 institution = {Argonne National Laboratories}, 32443 year = {2000}, 32444 note = {Working Paper} 32445} 32446 32447@Article{ lions.stampacchia:variational, 32448 author = {J. L. Lions and G. Stampacchia}, 32449 title = {Variational Inequalities}, 32450 journal = {Communications on Pure and Applied Math}, 32451 year = {1967}, 32452 volume = {20}, 32453 pages = {493--19} 32454} 32455 32456@Article{ lions.mercier:splitting, 32457 author = {P.--L. Lions and B. Mercier}, 32458 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 32459 journal = {SIAM Journal on Numerical Analysis}, 32460 year = {1979}, 32461 volume = {16}, 32462 pages = {964--979} 32463} 32464 32465@Article{ lions:methode, 32466 author = {P.--L. Lions}, 32467 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 32468 journal = {Israel Journal of Mathematics}, 32469 year = {1978}, 32470 volume = {31}, 32471 number = {2}, 32472 pages = {204--208} 32473} 32474 32475@InProceedings{ litzkow.livny.ea:condor, 32476 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 32477 title = {Condor: {A} Hunter of Idle Workstations}, 32478 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 32479 Systems}, 32480 year = {1988}, 32481 pages = {104--111}, 32482 month = jun 32483} 32484 32485@Article{ liu.nocedal:limited, 32486 author = {D. C. Liu and J. Nocedal}, 32487 title = {On the Limited Memory Method for Large Scale Optimization}, 32488 journal = {Mathematical Programming}, 32489 year = {1989}, 32490 volume = {45}, 32491 pages = {503--528} 32492} 32493 32494@InBook{ livny.raman:high, 32495 author = {M. Livny and R. Raman}, 32496 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 32497 chapter = {High Throughput Resource Management}, 32498 publisher = {Morgan Kaufmann Publishers}, 32499 year = {1999}, 32500 pages = {311--337} 32501} 32502 32503@Article{ llacer:inverse, 32504 author = {J. Llacer}, 32505 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 32506 Method}, 32507 journal = {Medical Physics}, 32508 year = {1997}, 32509 volume = {24}, 32510 number = {11}, 32511 pages = {1751--1764} 32512} 32513 32514@Book{ lojasiewicz:ensembles, 32515 author = {M. S. Lojasiewicz}, 32516 title = {Ensembles semi-analytiques}, 32517 publisher = {Institut des Hautes Etudes Scientifiques}, 32518 year = {1964}, 32519 address = {Bures-sur-Yvette} 32520} 32521 32522@Article{ lootsma:logarithmic, 32523 author = {F. A. Lootsma}, 32524 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 32525 journal = {Phillips Research Reports}, 32526 year = {1967}, 32527 volume = {22}, 32528 pages = {329--344} 32529} 32530 32531@InCollection{ lootsma:survey, 32532 author = {F. A. Lootsma}, 32533 title = {A Survey of Methods for Solving Constrained Minimization Problems via 32534 Unconstrained Minimization}, 32535 booktitle = {Numerical Methods for Nonlinear Optimization}, 32536 year = {1972}, 32537 editor = {F. A. Lootsma}, 32538 publisher = {Academic Press}, 32539 address = {London} 32540} 32541 32542@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 32543 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32544 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 32545 Regional Trade Blocks}, 32546 institution = {National Bureau of Economic Research, Inc.}, 32547 year = {1993}, 32548 number = {4512}, 32549 address = {Cambridge, Massechusetts} 32550} 32551 32552@InCollection{ lopezdesilanes.markusen.ea:auto, 32553 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32554 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 32555 year = {1994}, 32556 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 32557 publisher = {Cambridge University Press}, 32558 editor = {C. Shields and J. Francois} 32559} 32560 32561@Article{ lopezdesilanes.markusen.ea:complementarity, 32562 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32563 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 32564 journal = {Journal of Development Economics}, 32565 year = {1994}, 32566 volume = {45}, 32567 pages = {133--151} 32568} 32569 32570@Article{ lopezdesilanes.markusen.ea:trade, 32571 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32572 title = {Trade Policy Subtleties with Multinational Firms}, 32573 journal = {European Economic Review}, 32574 year = {1996} 32575} 32576 32577@Article{ lotstedt:coulomb, 32578 author = {P. L{\"{o}}tstedt}, 32579 title = {Coulomb friction in two-dimensional rigid body systems}, 32580 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 32581 volume = {61}, 32582 year = {1981}, 32583 pages = {605--615} 32584} 32585 32586@Article{ lotstedt:mechanical, 32587 author = {P. L{\"{o}}tstedt}, 32588 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 32589 journal = {SIAM Journal on Applied Mathematics}, 32590 volume = {42}, 32591 year = {1982}, 32592 pages = {281--296} 32593} 32594 32595@Book{ luenberger:linear, 32596 author = {D. G. Luenberger}, 32597 title = {Linear and Nonlinear Programming}, 32598 year = {1984}, 32599 publisher = {Addison-Wesley}, 32600 edition = {Second} 32601} 32602 32603@Book{ luenberger:optimization, 32604 author = {D. G. Luenberger}, 32605 title = {Optimization by Vector Space Methods}, 32606 year = {1969}, 32607 publisher = {John Wiley \& Sons}, 32608 address = {New York} 32609} 32610 32611@Article{ lundy.mees:convergence, 32612 author = {M. Lundy and A. Mees}, 32613 title = {Convergence of an Annealing Algorithm}, 32614 journal = {Mathematical Programming}, 32615 year = {1986}, 32616 volume = {34}, 32617 pages = {111--124} 32618} 32619 32620@Article{ luo.luo:extension, 32621 author = {X.-D. Luo and Z.-Q. Luo}, 32622 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 32623 journal = {SIAM Journal on Optimization}, 32624 year = {1994}, 32625 volume = {4}, 32626 pages = {383--392} 32627} 32628 32629@Article{ luo.mangasarian.ea:error, 32630 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 32631 title = {New Error Bounds for the Linear Complementarity Problem}, 32632 journal = {Mathematics of Operations Research}, 32633 year = {1994}, 32634 pages = {880--892}, 32635 volume = {19} 32636} 32637 32638@Article{ luo.pang.ea:exact, 32639 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 32640 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 32641 Equilibrium Constraints}, 32642 journal = {Mathematical Programming}, 32643 volume = {75}, 32644 pages = {19--76}, 32645 year = {1996} 32646} 32647 32648@Book{ luo.pang.ea:mathematical, 32649 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 32650 title = {Mathematical Programs with Equilibrium Constraints}, 32651 publisher = {Cambridge University Press}, 32652 year = {1996} 32653} 32654 32655@Article{ luo.pang:error, 32656 author = {Z.-Q. Luo and J. S. Pang}, 32657 title = {Error Bounds for Analytic Systems and their Applications}, 32658 journal = {Mathematical Programming}, 32659 year = {1994}, 32660 volume = {67}, 32661 pages = {1--28} 32662} 32663 32664@Article{ luo.shu.ea:optimizing, 32665 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 32666 title = {Optimizing computerized treatment planning for the Gamma Knife by source 32667 culling}, 32668 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32669 year = {1999}, 32670 volume = {45}, 32671 number = {5}, 32672 pages = {1339--1346} 32673} 32674 32675@InProceedings{ luo.tseng:class, 32676 author = {Z.-Q. Luo and P. Tseng}, 32677 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 32678 crossref = {ferris.pang:complementarity}, 32679 pages = {204--225} 32680} 32681 32682@Article{ luo.tseng:convergence, 32683 author = {Z.-Q. Luo and P. Tseng}, 32684 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 32685 Minimization}, 32686 journal = {Journal of Optimization Theory and Applications}, 32687 year = {1992}, 32688 volume = {72}, 32689 pages = {7--35} 32690} 32691 32692@Article{ luo.tseng:convergence*1, 32693 author = {Z.-Q. Luo and P. Tseng}, 32694 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 32695 Linear Complementarity Problem}, 32696 journal = {SIAM Journal on Control and Optimization}, 32697 year = {1991}, 32698 volume = {29}, 32699 pages = {1037--1060} 32700} 32701 32702@Article{ luo.tseng:convergence*2, 32703 author = {Z.-Q. Luo and P. Tseng}, 32704 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 32705 journal = {Mathematics of Operations Research}, 32706 year = {1993}, 32707 volume = {18}, 32708 pages = {846--867} 32709} 32710 32711@Article{ luo.tseng:error, 32712 author = {Z.--Q. Luo and P. Tseng}, 32713 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 32714 Affine Variational Inequality Problem}, 32715 journal = {SIAM Journal on Optimization}, 32716 year = {1992}, 32717 volume = {2}, 32718 pages = {43--54} 32719} 32720 32721@Article{ luo.tseng:error*1, 32722 author = {Z.-Q. Luo and P. Tseng}, 32723 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 32724 Over a Polyhedral Set}, 32725 journal = {SIAM Journal on Optimization}, 32726 year = {1993}, 32727 volume = {3}, 32728 pages = {43--59} 32729} 32730 32731@Article{ luo.tseng:error*2, 32732 author = {Z.-Q. Luo and P. Tseng}, 32733 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 32734 Approach}, 32735 journal = {Annals of Operations Research}, 32736 year = {1993}, 32737 volume = {46}, 32738 pages = {157--178} 32739} 32740 32741@Article{ luo.tseng:global, 32742 author = {Z.-Q. Luo and P. Tseng}, 32743 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 32744 Problems}, 32745 journal = {Operations Research Letters}, 32746 year = {1992}, 32747 volume = {11}, 32748 pages = {159--165} 32749} 32750 32751@Article{ luo.tseng:linear, 32752 author = {Z.-Q. Luo and P. Tseng}, 32753 title = {On the linear convergence of descent methods for convex essentially smooth 32754 minimization}, 32755 journal = {SIAM Journal on Control and Optimization}, 32756 year = {1992}, 32757 volume = {30}, 32758 pages = {408--425} 32759} 32760 32761@TechReport{ luo:convergence, 32762 author = {Z.-Q. Luo}, 32763 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 32764 Quadratic Programs}, 32765 institution = {Communications Research Laboratory, McMaster University}, 32766 year = {1992}, 32767 address = {Hamilton, Ontario} 32768} 32769 32770@Article{ lustig.marsten.ea:computational, 32771 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32772 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 32773 Programming}, 32774 journal = {Linear Algebra and Its Applications}, 32775 year = {1991}, 32776 volume = {152}, 32777 pages = {191--222} 32778} 32779 32780@Article{ lustig.marsten.ea:implementing, 32781 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32782 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 32783 programming}, 32784 journal = {SIAM Journal on Optimization}, 32785 year = {1992}, 32786 volume = {2}, 32787 pages = {435--449} 32788} 32789 32790@Article{ lustig.marsten.ea:interior-point, 32791 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32792 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 32793 journal = {ORSA Journal on Computing}, 32794 year = {1994}, 32795 volume = {6}, 32796 number = {1}, 32797 pages = {1--38} 32798} 32799 32800@Article{ lyman.wolbarst:optimization, 32801 author = {J. T. Lyman and A. B. Wolbarst}, 32802 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 32803 Algorithm}, 32804 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32805 year = {1989}, 32806 volume = {17}, 32807 pages = {433--436} 32808} 32809 32810@Article{ mackie.holmes.ea:tomotherapy*1, 32811 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 32812 J. Yang and B. Paliwal and T. Kinsella}, 32813 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 32814 journal = {Medical Physics}, 32815 year = {1993}, 32816 volume = {20}, 32817 number = {6}, 32818 pages = {1709--1719} 32819} 32820 32821@Article{ mackie.holmes.ea:tomotherapy*2, 32822 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 32823 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 32824 journal = {Int. J. of Imaging Systems and Technology}, 32825 year = {1995}, 32826 volume = {6}, 32827 pages = {43--55} 32828} 32829 32830@Article{ mackie.scrimger.ea:convolution, 32831 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 32832 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 32833 journal = {Medical Physics}, 32834 year = {1985}, 32835 volume = {12}, 32836 pages = {188--196} 32837} 32838 32839@Article{ mackinnon:technique, 32840 author = {James G. Mac{K}innon}, 32841 title = {A Technique for the Solution of Spatial Equilibrium Models}, 32842 journal = {Journal of Regional Science}, 32843 year = {1976}, 32844 volume = {16}, 32845 pages = {293--307} 32846} 32847 32848@PhDThesis{ madsen:minimization, 32849 author = {K. Madsen}, 32850 title = {Minimization of Nonlinear Approximation Functions}, 32851 year = {1985}, 32852 address = {Lyngby, Denmark}, 32853 school = {Institute of Numerical Analysis, Technical University of Denmark}, 32854 annote = {Dissertation} 32855} 32856 32857@Book{ magill.quinzii:theory, 32858 author = {M. Magill and M. Quinzii}, 32859 title = {Theory of Incomplete Markets}, 32860 publisher = {MIT Press}, 32861 year = {1996} 32862} 32863 32864@InCollection{ magnanti:models, 32865 author = {T. L. Magnanti}, 32866 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 32867 booktitle = {Transportation Planning Models}, 32868 year = {1984}, 32869 editor = {M. Florian}, 32870 publisher = {North Holland}, 32871 pages = {153--186} 32872} 32873 32874@InCollection{ maguregui:modified, 32875 author = {J. Maguregui}, 32876 title = {A modified {N}ewton algorithm for functions over convex sets}, 32877 crossref = {mangasarian.meyer.ea:nonlinear*3}, 32878 pages = {461--473} 32879} 32880 32881@PhDThesis{ maguregui:regular, 32882 author = {J. Maguregui}, 32883 title = {Regular Multivalued Functions and Algorithmic Applications}, 32884 year = {1977}, 32885 address = {Madison, Wisconsin}, 32886 school = {Computer Sciences Department, University of Wisconsin} 32887} 32888 32889@Article{ mahey.oualibouch.ea:proximal, 32890 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 32891 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 32892 journal = {SIAM Journal on Optimization}, 32893 year = {1995}, 32894 volume = {5}, 32895 pages = {454--466} 32896} 32897 32898@Article{ mahey.pham:partial, 32899 author = {P. Mahey and D. T. Pham}, 32900 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 32901 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 32902 year = {1993}, 32903 volume = {27}, 32904 pages = {375--392} 32905} 32906 32907@InCollection{ maier.novati:shakedown, 32908 author = {G. Maier and G. Novati}, 32909 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 32910 geometric effects with reference to discrete structural models}, 32911 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 32912 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 32913 publisher = {Pineridge Press}, 32914 address = {Swansea}, 32915 year = {1990}, 32916 pages = {451--471} 32917} 32918 32919@Article{ maier:incremental, 32920 author = {G. Maier}, 32921 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 32922 Instabilizing Effects}, 32923 journal = {International Journal of Solids and Structures}, 32924 volume = {7}, 32925 year = {1971}, 32926 pages = {345--372} 32927} 32928 32929@InCollection{ maier:inverse, 32930 author = {G. Maier}, 32931 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 32932 booktitle = {Serie VIII}, 32933 publisher = {Academia Nazionale dei Lincei}, 32934 year = {1981}, 32935 volume = {LXX}, 32936 pages = {203--209} 32937} 32938 32939@Article{ maier:matrix, 32940 author = {G. Maier}, 32941 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 32942 yield planes}, 32943 journal = {Meccanica}, 32944 volume = {5}, 32945 year = {1970}, 32946 pages = {54--66} 32947} 32948 32949@Article{ maier:quadratic, 32950 author = {G. Maier}, 32951 title = {A quadratic programming approach for certain classes of nonlinear structural 32952 problems}, 32953 journal = {Meccanica}, 32954 volume = {3}, 32955 year = {1968}, 32956 pages = {121--130} 32957} 32958 32959@Book{ manber:introduction, 32960 author = {U. Manber}, 32961 title = {Introduction to Algorithms: {A} Creative Approach}, 32962 year = {1989}, 32963 publisher = {Addison-Wesley} 32964} 32965 32966@Article{ mangasarian.deleone:error, 32967 author = {O. L. Mangasarian and R. {De~Leone}}, 32968 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 32969 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 32970 journal = {Applied Mathematics and Optimization}, 32971 year = {1988}, 32972 volume = {17}, 32973 pages = {1--14} 32974} 32975 32976@Article{ mangasarian.deleone:parallel, 32977 author = {O. L. Mangasarian and R. {De~Leone}}, 32978 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 32979 Problems and Linear Programs}, 32980 journal = {Journal of Optimization Theory and Applications}, 32981 year = {1987}, 32982 volume = {54}, 32983 pages = {437--446} 32984} 32985 32986@Article{ mangasarian.fromovitz:fritz, 32987 author = {O. L. Mangasarian and S. Fromovitz}, 32988 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 32989 and inequality constraints}, 32990 journal = {Journal of Mathematical Analysis and its Applications}, 32991 year = {1967}, 32992 volume = {17}, 32993 pages = {37--47} 32994} 32995 32996@Article{ mangasarian.mclinden:simple, 32997 author = {O. L. Mangasarian and L. McLinden}, 32998 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 32999 Programs}, 33000 journal = {Mathematical Programming}, 33001 year = {1985}, 33002 volume = {32}, 33003 pages = {32--40} 33004} 33005 33006@Article{ mangasarian.meyer:nonlinear, 33007 author = {O. L. Mangasarian and R. R. Meyer}, 33008 title = {Nonlinear Perturbation of Linear Programs}, 33009 journal = {SIAM Journal on Control and Optimization}, 33010 year = {1979}, 33011 volume = {17}, 33012 pages = {745--752} 33013} 33014 33015@TechReport{ mangasarian.musicant:active, 33016 author = {O. L. Mangasarian and David R. Musicant}, 33017 title = {Active Set Support Vector Machine Classification}, 33018 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33019 year = {2000}, 33020 number = {00-04}, 33021 address = {Madison, Wisconsin} 33022} 33023 33024@TechReport{ mangasarian.musicant:lagrangian, 33025 author = {O. L. Mangasarian and D. R. Musicant}, 33026 title = {Lagrangian Support Vector Machines}, 33027 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33028 year = {2000}, 33029 number = {00-06}, 33030 address = {Madison, Wisconsin} 33031} 33032 33033@TechReport{ mangasarian.musicant:robust, 33034 author = {O. L. Mangasarian and David R. Musicant}, 33035 title = {Robust Linear and Support Vector Regression}, 33036 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33037 year = {1999}, 33038 number = {99-09}, 33039 address = {Madison, Wisconsin} 33040} 33041 33042@Article{ mangasarian.musicant:successive, 33043 author = {O. L. Mangasarian and David R. Musicant}, 33044 title = {Successive Overrelaxation for Support Vector Machines}, 33045 journal = {IEEE Transactions on Neural Networks}, 33046 volume = {10}, 33047 year = {1999}, 33048 pages = {1032-1037} 33049} 33050 33051@Article{ mangasarian.pang:exact, 33052 author = {O. L. Mangasarian and J. S. Pang}, 33053 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 33054 Constraints}, 33055 journal = {Optimization}, 33056 year = {1997}, 33057 volume = {42}, 33058 pages = {1--8} 33059} 33060 33061@Article{ mangasarian.pang:extended, 33062 author = {O. L. Mangasarian and J. S. Pang}, 33063 title = {The Extended Linear Complementarity Problem}, 33064 journal = {SIAM Journal on Matrix Analysis and Applications}, 33065 year = {1994}, 33066 volume = {16} 33067} 33068 33069@Article{ mangasarian.ren:error, 33070 author = {O. L. Mangasarian and J. Ren}, 33071 title = {New error bounds for the nonlinear complementarity problem}, 33072 year = {1994}, 33073 volume = {1}, 33074 pages = {49--56}, 33075 journal = {Communications on Applied Nonlinear Analysis} 33076} 33077 33078@Article{ mangasarian.ren:improved, 33079 author = {O. L. Mangasarian and J. Ren}, 33080 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 33081 year = {1994}, 33082 volume = {66}, 33083 journal = {Mathematical Programming}, 33084 pages = {241--255} 33085} 33086 33087@InProceedings{ mangasarian.setiono.ea:pattern, 33088 crossref = {coleman.li:large-scale}, 33089 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 33090 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 33091 Diagnosis}, 33092 pages = {22--31} 33093} 33094 33095@Article{ mangasarian.shiau:error, 33096 author = {O. L. Mangasarian and T.--H. Shiau}, 33097 title = {Error Bounds for Monotone Linear Complementarity Problems}, 33098 journal = {Mathematical Programming}, 33099 year = {1986}, 33100 volume = {36}, 33101 pages = {81--89} 33102} 33103 33104@Article{ mangasarian.shiau:lipschitz, 33105 author = {O. L. Mangasarian and T.--H. Shiau}, 33106 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 33107 Complementarity Problems}, 33108 journal = {SIAM Journal on Control and Optimization}, 33109 year = {1987}, 33110 volume = {25}, 33111 pages = {583--595} 33112} 33113 33114@Article{ mangasarian.solodov:nonlinear, 33115 author = {O. L. Mangasarian and M. V. Solodov}, 33116 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 33117 journal = {Mathematical Programming}, 33118 year = {1993}, 33119 volume = {62}, 33120 pages = {277--298} 33121} 33122 33123@Article{ mangasarian.solodov:serial, 33124 author = {O. L. Mangasarian and M. V. Solodov}, 33125 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 33126 Minimization}, 33127 year = {1994}, 33128 journal = {Optimization Methods and Software}, 33129 volume = {4}, 33130 pages = {103--116} 33131} 33132 33133@Article{ mangasarian.street.ea:breast, 33134 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 33135 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 33136 journal = {Operations Research}, 33137 year = {1995}, 33138 volume = {43}, 33139 pages = {570--577} 33140} 33141 33142@Article{ mangasarian.wolberg:cancer, 33143 author = {O. L. Mangasarian and W. H. Wolberg}, 33144 title = {Cancer Diagnosis via Linear Programming}, 33145 journal = {SIAM News}, 33146 year = {1990}, 33147 volume = {23}, 33148 pages = {1 \& 18} 33149} 33150 33151@InCollection{ mangasarian:applications, 33152 author = {O. L. Mangasarian}, 33153 title = {Some Applications of Penalty Functions in Mathematical Programming}, 33154 booktitle = {Optimization and Related Fields}, 33155 year = {1986}, 33156 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 33157 publisher = {Springer-Verlag}, 33158 address = {Heidelberg}, 33159 pages = {307--329}, 33160 note = {Lecture Notes in Mathematics 1190} 33161} 33162 33163@Article{ mangasarian:characterization, 33164 author = {O. L. Mangasarian}, 33165 title = {Characterization of linear complementarity problems as linear programs}, 33166 journal = {Mathematical Programming Study}, 33167 year = {1978}, 33168 volume = {7}, 33169 pages = {74--87} 33170} 33171 33172@InProceedings{ mangasarian:condition, 33173 author = {O. L. Mangasarian}, 33174 title = {A condition number for linear inequalities and linear programs}, 33175 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 33176 1981}, 33177 year = {1981}, 33178 editor = {G. Bamberg and O. Opitz}, 33179 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 33180 address = {Konigstein}, 33181 pages = {3--15} 33182} 33183 33184@Article{ mangasarian:convergence, 33185 author = {O. L. Mangasarian}, 33186 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 33187 Symmetric Monotone Linear Complementarity Problem}, 33188 journal = {SIAM Journal on Optimization}, 33189 volume = {1}, 33190 pages = {114--122}, 33191 year = {1991} 33192} 33193 33194@Article{ mangasarian:equivalence, 33195 author = {O. L. Mangasarian}, 33196 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 33197 journal = {SIAM Journal on Applied Mathematics}, 33198 year = {1976}, 33199 volume = {31}, 33200 pages = {89--92} 33201} 33202 33203@Article{ mangasarian:error, 33204 author = {O. L. Mangasarian}, 33205 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 33206 journal = {ORSA Journal on Computing}, 33207 volume = {15}, 33208 pages = {187--192}, 33209 year = {1994} 33210} 33211 33212@Article{ mangasarian:error*1, 33213 author = {O. L. Mangasarian}, 33214 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 33215 journal = {Mathematical Programming}, 33216 year = {1990}, 33217 volume = {48}, 33218 pages = {437--445} 33219} 33220 33221@Article{ mangasarian:generalized, 33222 author = {O. L. Mangasarian}, 33223 title = {Generalized Linear Complementarity Problems as Linear Programs}, 33224 journal = {Methods of Operations Research}, 33225 year = {1979}, 33226 editor = {W. Oettli and F. Steffens}, 33227 volume = {31}, 33228 pages = {393--402} 33229} 33230 33231@InCollection{ mangasarian:generalized*1, 33232 author = {O. L. Mangasarian}, 33233 title = {Generalized Support Vector Machines}, 33234 year = {2000}, 33235 pages = {135-146}, 33236 booktitle = {Advances in Large Margin Classifiers}, 33237 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 33238 publisher = {MIT Press}, 33239 address = {Cambridge, MA} 33240} 33241 33242@Article{ mangasarian:global, 33243 author = {O. L. Mangasarian}, 33244 title = {Global error bounds for monotone affine variational inequality problems}, 33245 journal = {Linear Algebra and Its Applications}, 33246 year = {1992}, 33247 pages = {153--164} 33248} 33249 33250@InCollection{ mangasarian:least, 33251 author = {O. L. Mangasarian}, 33252 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 33253 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 33254 year = {1990}, 33255 publisher = {Oxford University Press}, 33256 address = {New York}, 33257 pages = {217--221} 33258} 33259 33260@Article{ mangasarian:least-norm, 33261 author = {O. L. Mangasarian}, 33262 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 33263 Problem}, 33264 journal = {Journal of Mathematical Analysis and Applications}, 33265 year = {1983}, 33266 volume = {92}, 33267 pages = {240--251} 33268} 33269 33270@Article{ mangasarian:linear, 33271 author = {O. L. Mangasarian}, 33272 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 33273 journal = {Mathematical Programming}, 33274 year = {1976}, 33275 volume = {10}, 33276 pages = {263--270} 33277} 33278 33279@Article{ mangasarian:linear*1, 33280 author = {O. L. Mangasarian}, 33281 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 33282 journal = {Operations Research}, 33283 year = {1965}, 33284 volume = {13}, 33285 pages = {444--452} 33286} 33287 33288@Article{ mangasarian:locally, 33289 author = {O. L. Mangasarian}, 33290 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 33291 Complementarity Problems}, 33292 journal = {Mathematical Programming}, 33293 year = {1980}, 33294 volume = {19}, 33295 pages = {200--212} 33296} 33297 33298@InCollection{ mangasarian:machine, 33299 author = {O. L. Mangasarian}, 33300 title = {Machine Learning via Polyhedral Concave Minimization}, 33301 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 33302 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 33303 pages = {175-188}, 33304 year = {1996}, 33305 address = {Heidelberg}, 33306 publisher = {Physica-Verlag A Springer-Verlag Company} 33307} 33308 33309@Article{ mangasarian:mathematical, 33310 author = {O. L. Mangasarian}, 33311 title = {Mathematical Programming in Neural Networks}, 33312 journal = {ORSA Journal on Computing}, 33313 volume = {5}, 33314 pages = {349--360}, 33315 year = {1993} 33316} 33317 33318@InProceedings{ mangasarian:mathematical*1, 33319 author = {O. L. Mangasarian}, 33320 title = {Mathematical Programming in Machine Learning}, 33321 booktitle = {Nonlinear Optimization and Applications}, 33322 editor = {G. Di Pillo and F. Giannessi}, 33323 publisher = {Plenum Publishing}, 33324 address = {New York}, 33325 pages = {283--295}, 33326 year = {1996} 33327} 33328 33329@Article{ mangasarian:mathematical*2, 33330 author = {O. L. Mangasarian}, 33331 title = {Mathematical Programming in Data Mining}, 33332 journal = {Data Mining and Knowledge Discovery}, 33333 volume = {1}, 33334 year = {1997}, 33335 pages = {183-201} 33336} 33337 33338@Article{ mangasarian:multi-surface, 33339 author = {O. L. Mangasarian}, 33340 title = {Multi-surface Method of Pattern Separation}, 33341 journal = {IEEE Transactions on Information Theory}, 33342 year = {1968}, 33343 volume = {IT-14}, 33344 pages = {801--807} 33345} 33346 33347@Book{ mangasarian:nonlinear, 33348 author = {O. L. Mangasarian}, 33349 title = {Nonlinear Programming}, 33350 year = {1969}, 33351 publisher = {McGraw--Hill}, 33352 address = {New York}, 33353 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 33354} 33355 33356@Article{ mangasarian:normal, 33357 author = {O. L. Mangasarian}, 33358 title = {Normal Solutions of Linear Programs}, 33359 journal = {Mathematical Programming Study}, 33360 year = {1984}, 33361 volume = {22}, 33362 pages = {206--216} 33363} 33364 33365@Article{ mangasarian:optimal, 33366 author = {O. L. Mangasarian}, 33367 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 33368 Linear Programs}, 33369 journal = {Journal of Optimization Theory and Applications}, 33370 year = {1981}, 33371 volume = {35}, 33372 pages = {123--128} 33373} 33374 33375@Article{ mangasarian:parallel, 33376 author = {O. L. Mangasarian}, 33377 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 33378 journal = {SIAM Journal on Control and Optimization}, 33379 volume = {33}, 33380 pages = {1916--1925}, 33381 year = {1995} 33382} 33383 33384@TechReport{ mangasarian:regularized, 33385 author = {O. L. Mangasarian}, 33386 title = {Regularized Linear Programs with Equilibrium Constraints}, 33387 institution = {Computer Sciences Department, University of Wisconsin}, 33388 year = {1997}, 33389 address = {Madison, Wisconsin}, 33390 type = {Mathematical Programming Technical Report}, 33391 number = {97--13}, 33392 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 33393} 33394 33395@Article{ mangasarian:simple, 33396 author = {O. L. Mangasarian}, 33397 title = {A Simple Characterization of Solution Sets of Convex Programs}, 33398 journal = {Operations Research Letters}, 33399 year = {1988}, 33400 volume = {7}, 33401 pages = {21--26} 33402} 33403 33404@Article{ mangasarian:solution, 33405 author = {O. L. Mangasarian}, 33406 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 33407 journal = {Journal of Optimization Theory and Applications}, 33408 year = {1977}, 33409 month = aug, 33410 volume = {22}, 33411 pages = {465--485} 33412} 33413 33414@Article{ mangasarian:stable, 33415 author = {O. L. Mangasarian}, 33416 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 33417 journal = {Linear Algebra and Its Applications}, 33418 year = {1981}, 33419 volume = {41}, 33420 pages = {209--223} 33421} 33422 33423@Article{ mangasarian:sufficiency, 33424 author = {O. L. Mangasarian}, 33425 title = {Sufficiency of Exact Penalty Minimization}, 33426 journal = {SIAM Journal on Control and Optimization}, 33427 year = {1985}, 33428 month = jan, 33429 volume = {23}, 33430 pages = {30--37} 33431} 33432 33433@Article{ mangasarian:unconstrained, 33434 author = {O. L. Mangasarian}, 33435 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 33436 journal = {SIAM Journal on Control and Optimization}, 33437 year = {1975}, 33438 volume = {13}, 33439 pages = {772--791} 33440} 33441 33442@Book{ manne.richels:buying, 33443 author = {A. S. Manne and R. G. Richels}, 33444 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 33445 publisher = {MIT Press}, 33446 year = {1992}, 33447 address = {Cambridge MA} 33448} 33449 33450@Article{ manne.richels:global, 33451 author = {A. S. Manne and R. G. Richels}, 33452 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 33453 journal = {The Energy Journal}, 33454 year = {1991}, 33455 volume = {12}, 33456 pages = {87--107} 33457} 33458 33459@Article{ manne.richels:international, 33460 author = {A. S. Manne and R. G. Richels}, 33461 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 33462 journal = {Economic Review}, 33463 year = {1991}, 33464 volume = {81}, 33465 pages = {135--139} 33466} 33467 33468@Article{ manne.rutherford:international, 33469 author = {A. S. Manne and T. F. Rutherford}, 33470 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 33471 General Equilibrium Model}, 33472 journal = {The Energy Journal}, 33473 year = {1993}, 33474 volume = {14}, 33475 pages = {1--20} 33476} 33477 33478@InCollection{ manne:eta-macro, 33479 author = {A. S. Manne}, 33480 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 33481 booktitle = {Modeling Energy-Economy Interactions}, 33482 year = {1977}, 33483 editor = {C. J. Hitch}, 33484 publisher = {Resources for the Future}, 33485 address = {Washington DC} 33486} 33487 33488@PhDThesis{ maratos:exact, 33489 author = {N. Maratos}, 33490 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 33491 Problems}, 33492 year = {1978}, 33493 school = {Imperial College, University of London} 33494} 33495 33496@Article{ marcotte.dussault:note, 33497 author = {P. Marcotte and J.--P. Dussault}, 33498 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 33499 Inequalities}, 33500 journal = {Operations Research Letters}, 33501 year = {1987}, 33502 volume = {6}, 33503 pages = {35--42} 33504} 33505 33506@Article{ marcotte.zhu:exact, 33507 author = {P. Marcotte and D. L. Zhu}, 33508 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 33509 Problem}, 33510 journal = {Mathematical Programming}, 33511 year = {1996}, 33512 volume = {74}, 33513 pages = {141--158} 33514} 33515 33516@Article{ marcotte:algorithm, 33517 author = {P. Marcotte}, 33518 title = {A New Algorithm for Solving Variational Inequalities with Application to the 33519 Traffic Assignment Problem}, 33520 journal = {Mathematical Programming}, 33521 year = {1985}, 33522 volume = {33}, 33523 pages = {339--351} 33524} 33525 33526@Article{ marcotte:application, 33527 author = {P. Marcotte}, 33528 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 33529 Equilibrium Problems}, 33530 journal = {Information Systems and Operational Research}, 33531 year = {1991}, 33532 volume = {29}, 33533 pages = {258--270} 33534} 33535 33536@Article{ marcotte:network, 33537 author = {P. Marcotte}, 33538 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 33539 journal = {Mathematical Programming}, 33540 year = {1986}, 33541 volume = {34}, 33542 pages = {142--162} 33543} 33544 33545@Article{ markusen.rutherford.ea:el, 33546 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33547 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 33548 journal = {Cuadernos Economicos de Ice}, 33549 year = {1995}, 33550 volume = {59}, 33551 pages = {57--68} 33552} 33553 33554@Article{ markusen.rutherford.ea:trade, 33555 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33556 title = {Trade liberalization in a multinational-dominated industry}, 33557 journal = {Journal of International Economics}, 33558 year = {1995}, 33559 volume = {38}, 33560 pages = {95--118} 33561} 33562 33563@Article{ markusen.rutherford:discrete, 33564 author = {J. R. Markusen and T. F. Rutherford}, 33565 title = {Discrete plant-location decisions in an applied general equilibrium model of 33566 trade liberalization}, 33567 journal = {Weltwirtshchaftliches Archiv}, 33568 year = {1994} 33569} 33570 33571@Article{ markusen.wigle:nash, 33572 author = {J. Markusen and R. Wigle}, 33573 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 33574 Country Size, Scale Economies and Capital Mobility}, 33575 journal = {Journal of Political Mobility}, 33576 year = {1989}, 33577 volume = {97}, 33578 pages = {368--386} 33579} 33580 33581@Article{ marquardt:algorithm, 33582 author = {D. W. Marquardt}, 33583 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 33584 journal = {SIAM Journal on Applied Mathematics}, 33585 year = {1963}, 33586 volume = {11}, 33587 pages = {431--441} 33588} 33589 33590@Article{ martello.toth:algorithm, 33591 author = {S. Martello and P. Toth}, 33592 title = {A New Algorithm for the 0--1 Knapsack Problem}, 33593 journal = {Management Science}, 33594 year = {1988}, 33595 volume = {34}, 33596 pages = {633--644} 33597} 33598 33599@InCollection{ martello.toth:algorithms, 33600 author = {S. Martello and P. Toth}, 33601 title = {Algorithms for Knapsack Problems}, 33602 booktitle = {Surveys in Combinatorial Optimization}, 33603 year = {1987}, 33604 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 33605 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 33606 address = {Amsterdam} 33607} 33608 33609@Article{ martello.toth:mixture, 33610 author = {S. Martello and P. Toth}, 33611 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 33612 Problem}, 33613 journal = {Management Science}, 33614 year = {1984}, 33615 volume = {30}, 33616 pages = {765--771} 33617} 33618 33619@Article{ martello.toth:worst-case, 33620 author = {S. Martello and P. Toth}, 33621 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 33622 journal = {Mathematical Programming}, 33623 year = {1984}, 33624 volume = {28}, 33625 pages = {198--205} 33626} 33627 33628@Article{ martinet:regularisation, 33629 author = {Bernard Martinet}, 33630 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 33631 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 33632 year = {1970}, 33633 volume = {4}, 33634 pages = {154--159} 33635} 33636 33637@Article{ maskin.tirole:theory, 33638 author = {E. Maskin and J. Tirole}, 33639 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 33640 fixed costs}, 33641 journal = {Econometrica}, 33642 volume = {56}, 33643 year = {1988}, 33644 pages = {549--569} 33645} 33646 33647@Article{ maskin.tirole:theory*1, 33648 author = {E. Maskin and J. Tirole}, 33649 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 33650 Edgeworth cycles}, 33651 journal = {Econometrica}, 33652 volume = {56}, 33653 year = {1988}, 33654 pages = {571--579} 33655} 33656 33657@Article{ maskus.rutherford.ea:economic, 33658 author = {K. Maskus and T. F. Rutherford and S. Selby}, 33659 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 33660 {M}exico}, 33661 journal = {North American Journal of Economics and Finance}, 33662 year = {1996} 33663} 33664 33665@Article{ mastor:experimental, 33666 author = {A. A. Mastor}, 33667 title = {An Experimental Investigation and Comparative Evaluation of Production Line 33668 Balancing Techniques}, 33669 journal = {Management Science}, 33670 year = {1970}, 33671 volume = {16}, 33672 pages = {728--746} 33673} 33674 33675@Article{ mathias.pang:error, 33676 author = {R. Mathias and J. S. Pang}, 33677 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 33678 journal = {Linear Algebra and Its Applications}, 33679 year = {1990}, 33680 volume = {132}, 33681 pages = {123--136} 33682} 33683 33684@Article{ mathiesen:algorithm, 33685 author = {L. Mathiesen}, 33686 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 33687 {W}alrasian Equilibrium Model: An Example}, 33688 journal = {Mathematical Programming}, 33689 year = {1987}, 33690 volume = {37}, 33691 pages = {1--18} 33692} 33693 33694@Article{ mathiesen:computation, 33695 author = {L. Mathiesen}, 33696 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 33697 Problems}, 33698 journal = {Mathematical Programming Study}, 33699 year = {1985}, 33700 volume = {23}, 33701 pages = {144--162} 33702} 33703 33704@Article{ mathiesen:computational, 33705 author = {L. Mathiesen}, 33706 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 33707 Complementarity Problems}, 33708 journal = {Operations Research}, 33709 year = {1985}, 33710 volume = {33}, 33711 pages = {1225--1250} 33712} 33713 33714@Book{ matlab:users, 33715 author = {{MATLAB}}, 33716 title = {User's Guide}, 33717 year = {1992}, 33718 publisher = {The MathWorks, Inc.} 33719} 33720 33721@Book{ mcclelland.rummelhart:explorations, 33722 author = {J. L. McClelland and D. E. Rummelhart}, 33723 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 33724 Programs, and Exercises}, 33725 year = {1987}, 33726 publisher = {MIT Press}, 33727 address = {Cambridge, Massachusetts} 33728} 33729 33730@Article{ mccormick:modification, 33731 author = {G. P. McCormick}, 33732 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 33733 journal = {Mathematical Programming}, 33734 year = {1977}, 33735 volume = {13}, 33736 pages = {111--115} 33737} 33738 33739@Book{ mccormick:nonlinear, 33740 author = {G. P. McCormick}, 33741 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 33742 year = {1983}, 33743 publisher = {John Wiley \& Sons}, 33744 address = {New York} 33745} 33746 33747@Article{ mcculloch.pitts:logical, 33748 author = {W. McCulloch and W. Pitts}, 33749 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 33750 journal = {Bulletin of Mathematical Biophysics}, 33751 year = {1943}, 33752 volume = {7}, 33753 pages = {115--133} 33754} 33755 33756@TechReport{ mckenna.zenios:optimal, 33757 author = {M. McKenna and S. A. Zenios}, 33758 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 33759 institution = {Thinking Machines Corporation}, 33760 year = {1990}, 33761 type = {Working Paper}, 33762 address = {Cambridge, MA} 33763} 33764 33765@Article{ mckinnon:convergence, 33766 author = {K. I. M. McKinnon}, 33767 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 33768 journal = {SIAM Journal on Optimization}, 33769 year = {1998}, 33770 volume = {9}, 33771 pages = {148--158} 33772} 33773 33774@Article{ mcshane.monma.ea:implementation, 33775 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 33776 title = {An implementation of a primal-dual interior point method for linear programming}, 33777 journal = {ORSA Journal of Computing}, 33778 year = {1989}, 33779 volume = {1}, 33780 pages = {70--83} 33781} 33782 33783@PhDThesis{ medhi:decomposition, 33784 author = {D. Medhi}, 33785 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 33786 Optimization}, 33787 school = {Computer Sciences Department, University of Wisconsin}, 33788 year = {1987}, 33789 address = {Madison, Wisconsin}, 33790 note = {Technical Report 718} 33791} 33792 33793@Article{ medhi:parallel, 33794 author = {D. Medhi}, 33795 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 33796 Programming Problems}, 33797 journal = {Annals of Operations Research}, 33798 year = {1990}, 33799 volume = {22}, 33800 pages = {101--127} 33801} 33802 33803@Article{ megiddo:complexity, 33804 author = {N. Megiddo}, 33805 title = {On the complexity of polyhedral separability}, 33806 journal = {Discrete and Computational Geometry}, 33807 year = {1988}, 33808 volume = {3}, 33809 pages = {325--337} 33810} 33811 33812@Article{ megiddo:finding, 33813 author = {N. Megiddo}, 33814 title = {On Finding Primal-- and Dual--Optimal Bases}, 33815 journal = {ORSA Journal on Computing}, 33816 year = {1991}, 33817 volume = {3}, 33818 pages = {63--65} 33819} 33820 33821@Article{ mehrotra:implementation, 33822 author = {S. Mehrotra}, 33823 title = {On the implementation of a primal-dual interior point method}, 33824 journal = {SIAM Journal on Optimization}, 33825 year = {1992}, 33826 volume = {2}, 33827 pages = {575--601} 33828} 33829 33830@PhDThesis{ merrill:applications, 33831 author = {O. H. Merrill}, 33832 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 33833 Semicontinuous Point to Set Mappings}, 33834 year = {1972}, 33835 school = {University of Michigan} 33836} 33837 33838@Article{ merten.muller:variance, 33839 author = {A. G. Merten and M. E. Muller}, 33840 title = {Variance Minimization in Single Machine Sequencing Problems}, 33841 journal = {Management Science}, 33842 year = {1972}, 33843 volume = {18}, 33844 pages = {518--528} 33845} 33846 33847@TechReport{ meyer:continuity, 33848 author = {R. R. Meyer}, 33849 title = {Continuity Properties of Linear Programs}, 33850 institution = {Computer Sciences Department, University of Wisconsin}, 33851 year = {1979}, 33852 address = {Madison, Wisconsin}, 33853 number = {373} 33854} 33855 33856@Article{ miersemann.mittelmann:continuation, 33857 author = {E. Miersemann and H. D. Mittelmann}, 33858 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 33859 journal = {Journal of Computational and Applied Mathematics}, 33860 year = {1989}, 33861 volume = {26}, 33862 pages = {23--34} 33863} 33864 33865@Article{ mifflin:semismooth, 33866 author = {R. Mifflin}, 33867 title = {Semismooth and semiconvex functions in constrained optimization}, 33868 journal = {SIAM Journal on Control and Optimization}, 33869 year = {1977}, 33870 volume = {15}, 33871 pages = {957--972} 33872} 33873 33874@Article{ mifflin:stable, 33875 author = {R. Mifflin}, 33876 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 33877 journal = {Mathematical Programming}, 33878 vol = {16}, 33879 pages = {141--158}, 33880 year = {1979} 33881} 33882 33883@Book{ miller:survival, 33884 author = {Jr. R. G. Miller}, 33885 title = {Survival Analysis}, 33886 year = {1981}, 33887 publisher = {John Wiley \& Sons}, 33888 address = {New York} 33889} 33890 33891@Book{ minsky.papert:perceptrons, 33892 author = {M. Minsky and S. Papert}, 33893 title = {Perceptrons: An Introduction to Computational Geometry}, 33894 year = {1969}, 33895 publisher = {MIT Press}, 33896 address = {Cambridge, Massachusetts} 33897} 33898 33899@Article{ minty:monotone, 33900 author = {G. J. Minty}, 33901 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 33902 journal = {Duke Mathematics Journal}, 33903 year = {1962}, 33904 volume = {29}, 33905 pages = {341--346} 33906} 33907 33908@Article{ minty:monotonicity, 33909 author = {G. J. Minty}, 33910 title = {On the Monotonicity of the Gradient of a Convex Function}, 33911 journal = {Pacific Journal of Mathematics}, 33912 year = {1964}, 33913 volume = {14}, 33914 pages = {243--247} 33915} 33916 33917@TechReport{ mizuno.jarre.ea:unified, 33918 author = {S. Mizuno and F. Jarre and J. Stoer}, 33919 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 33920 linear complementarity problems}, 33921 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 33922 address = {W{\"{u}}rzburg, Germany}, 33923 year = {1994}, 33924 number = {Nr. 213}, 33925 type = {Preprint} 33926} 33927 33928@TechReport{ mizuno:polynomiality, 33929 author = {S. Mizuno}, 33930 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 33931 for linear programming}, 33932 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 33933 year = {1993}, 33934 number = {1006}, 33935 address = {Ithaca, New York}, 33936 month = jan 33937} 33938 33939@Article{ mohan.mageras.ea:clinically, 33940 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 33941 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 33942 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 33943 journal = {Medical Physics}, 33944 year = {1992}, 33945 volume = {19}, 33946 number = {4}, 33947 pages = {933--944} 33948} 33949 33950@Article{ mohan:field, 33951 author = {R. Mohan}, 33952 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 33953 Collimation}, 33954 journal = {Seminars in Radiation Oncology}, 33955 year = {1995}, 33956 volume = {5}, 33957 number = {2}, 33958 pages = {86--99} 33959} 33960 33961@Article{ monteiro.pang.ea:positive, 33962 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 33963 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 33964 journal = {SIAM Journal on Optimization}, 33965 year = {1995}, 33966 volume = {5}, 33967 pages = {129--148} 33968} 33969 33970@Article{ monteiro.tsuchiya:limiting, 33971 author = {R. D. C. Monteiro and T. Tsuchiya}, 33972 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 33973 Monotone Horizontal Linear Complementarity Problem}, 33974 year = {1996}, 33975 journal = {Mathematics of Operations Research}, 33976 pages = {793--814}, 33977 volume = {21} 33978} 33979 33980@Article{ monteiro.wright:local, 33981 author = {R. D. C. Monteiro and S. J. Wright}, 33982 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 33983 journal = {Computational Optimization and Applications}, 33984 year = {1994}, 33985 volume = {3}, 33986 pages = {131--155} 33987} 33988 33989@Article{ monteiro.wright:superlinear, 33990 author = {R. D. C. Monteiro and S. J. Wright}, 33991 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 33992 year = {1996}, 33993 journal = {SIAM Journal on Optimization}, 33994 volume = {6}, 33995 pages = {1--18} 33996} 33997 33998@Article{ monteiro.wright:superlinear*1, 33999 author = {R. D. C. Monteiro and S. J. Wright}, 34000 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 34001 journal = {Mathematical Programming}, 34002 year = {1995}, 34003 volume = {69}, 34004 pages = {311--333} 34005} 34006 34007@Article{ more.garbow.ea:testing, 34008 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 34009 title = {Testing Unconstrained Optimization Software}, 34010 journal = {ACM Transactions on Mathematical Software}, 34011 year = {1981}, 34012 volume = {7}, 34013 pages = {17--41} 34014} 34015 34016@Article{ more.rheinboldt:p, 34017 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 34018 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 34019 Mappings}, 34020 journal = {Linear Algebra and Its Applications}, 34021 year = {1973}, 34022 volume = {6}, 34023 pages = {45--68} 34024} 34025 34026@Article{ more.sorensen:use, 34027 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34028 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 34029 journal = {Mathematical Programming}, 34030 year = {1979}, 34031 volume = {16}, 34032 pages = {1--20} 34033} 34034 34035@Article{ more.sorensen:computing, 34036 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34037 title = {Computing a Trust Region Step}, 34038 journal = {SIAM Journal on Scientific and Statistical Computing}, 34039 year = {1983}, 34040 volume = {4}, 34041 pages = {553--572} 34042} 34043 34044@Article{ more.toraldo:solution, 34045 author = {J. J. Mor\'e and G. Toraldo}, 34046 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 34047 journal = {SIAM Journal on Optimization}, 34048 year = {1991}, 34049 volume = {1}, 34050 pages = {93--113} 34051} 34052 34053@TechReport{ more.vavasis:solution, 34054 author = {J. J. Mor\'{e} and S. A. Vavasis}, 34055 title = {On the Solution of Concave Knapsack Problems}, 34056 institution = {Argonne National Laboratory}, 34057 year = {1988}, 34058 address = {Argonne, Illinois}, 34059 number = {ANL/MCS--P40--1288}, 34060 type = {Mathematics and Computer Science Division Report} 34061} 34062 34063@Book{ more.wright:optimization, 34064 author = {J. J. Mor\'{e} and S. J. Wright}, 34065 title = {Optimization Software Guide}, 34066 publisher = {SIAM}, 34067 address = {Philadelphia, Pennsylvania}, 34068 series = {Frontiers in Applied Mathematics}, 34069 number = {14}, 34070 year = {1993} 34071} 34072 34073@TechReport{ more.wu:global, 34074 author = {J. J. Mor\'{e} and Z. Wu}, 34075 title = {Global Continuation for Distance Geometry Problems}, 34076 institution = {Argonne National Laboratory}, 34077 year = {1995}, 34078 type = {Preprint}, 34079 number = {MCS-P505-0395}, 34080 address = {Argonne, Illinois} 34081} 34082 34083@TechReport{ more.wu:issues, 34084 author = {J. J. Mor\'{e} and Z. Wu}, 34085 title = {Issues in Large-Scale Global Molecular Optimization}, 34086 institution = {Argonne National Laboratory}, 34087 year = {1995}, 34088 type = {Preprint}, 34089 number = {MCS-P539-1095}, 34090 address = {Argonne, Illinois} 34091} 34092 34093@TechReport{ more:collection, 34094 author = {J. J. Mor\'e}, 34095 title = {A Collection of Nonlinear Model Problems}, 34096 institution = {Argonne National Laboratory}, 34097 year = {1989}, 34098 type = {Preprint}, 34099 address = {Argonne, Illinois}, 34100 number = {MCS-P60-0289} 34101} 34102 34103@Article{ more:global, 34104 author = {J. J. Mor\'e}, 34105 title = {Global Methods for Nonlinear Complementarity Problems}, 34106 year = {1996}, 34107 journal = {Mathematics of Operations Research}, 34108 pages = {589--614}, 34109 volume = {21} 34110} 34111 34112@Article{ moreau:proximite, 34113 author = {J.--J. Moreau}, 34114 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 34115 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 34116 year = {1965}, 34117 volume = {93}, 34118 pages = {273--299} 34119} 34120 34121@Article{ morrill.lane.ea:dose-volume, 34122 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 34123 title = {Dose-volume considerations with linear programming}, 34124 journal = {Medical Physics}, 34125 year = {1991}, 34126 volume = {18}, 34127 number = {6}, 34128 pages = {1201--1210} 34129} 34130 34131@Article{ morrill:very, 34132 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 34133 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 34134 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34135 year = {1995}, 34136 volume = {31}, 34137 pages = {179--188} 34138} 34139 34140@TechReport{ morshedi.tapia:karmarkar, 34141 author = {A. M. Morshedi and R. A. Tapia}, 34142 title = {Karmarkar as a Classical Method}, 34143 institution = {Department of Mathematical Sciences, Rice University}, 34144 year = {1987}, 34145 number = {87--7}, 34146 type = {Technical Report} 34147} 34148 34149@Article{ mosco:dual, 34150 author = {U. Mosco}, 34151 title = {Dual Variational Inequalities}, 34152 journal = {Journal of Mathematical Analysis and its Applications}, 34153 year = {1972}, 34154 volume = {40}, 34155 pages = {202--206} 34156} 34157 34158@Article{ motzkin.schoenberg:relaxation, 34159 author = {T. S. Motzkin and I. J. Schoenberg}, 34160 title = {The relaxation method for linear inequalities}, 34161 journal = {Canadian Journal of Mathematics}, 34162 year = {1954}, 34163 volume = {6}, 34164 pages = {393--404} 34165} 34166 34167@InProceedings{ muhlenbein:parallel, 34168 crossref = {schaeffer:third}, 34169 author = {H. M{\"{}u}hlenbein}, 34170 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 34171 pages = {416--421} 34172} 34173 34174@Article{ mukhopadhyay.roy.ea:polynomial, 34175 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 34176 title = {A polynomial time algorithm for generating neural networks for pattern 34177 classification: Its stability properties and some test results}, 34178 journal = {Neural Computation}, 34179 year = {1993}, 34180 volume = {5}, 34181 pages = {317--330} 34182} 34183 34184@Article{ mulvey.ruszczynski:diagonal, 34185 author = {J. M. Mulvey and A. Ruszczynski}, 34186 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 34187 journal = {Operations Research Letters}, 34188 year = {1992}, 34189 volume = {12}, 34190 pages = {205--215} 34191} 34192 34193@TechReport{ mulvey.ruszczynski:scenario, 34194 author = {J. M. Mulvey and A. Ruszczynski}, 34195 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 34196 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 34197 year = {1991}, 34198 address = {Princeton, New Jersey}, 34199 number = {SOR 91-19}, 34200 type = {Technical Report} 34201} 34202 34203@PhDThesis{ munson:algorithms, 34204 author = {T. S. Munson}, 34205 title = {Algorithms and Environments for Complementarity}, 34206 school = {University of Wisconsin--Madison}, 34207 year = {2000}, 34208 address = {Madison, Wisconsin}, 34209 month = aug, 34210 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 34211} 34212 34213@Article{ munson.facchinei.ea:semismooth, 34214 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 34215 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 34216 journal = {INFORMS Journal on Computing}, 34217 year = {2001}, 34218 volume = {forthcoming} 34219} 34220 34221@Article{ murchland:braess, 34222 author = {J. D. Murchland}, 34223 title = {Braess' Paradox of Traffic Flow}, 34224 journal = {Transportation Research}, 34225 year = {1970}, 34226 volume = {4}, 34227 pages = {391--394} 34228} 34229 34230@Unpublished{ murphy.aha:uci, 34231 author = {P. M. Murphy and D. W. Aha}, 34232 title = {{UCI} Repository of Machine Learning Databases}, 34233 year = {1992}, 34234 note = {Department of Information and Computer Science, University of California, Irvine, 34235 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 34236} 34237 34238@Book{ murphy.lawrence.ea:american, 34239 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 34240 title = {American Cancer Society Textbook of Clinical Oncology}, 34241 publisher = {The American Cancer Society, Inc.}, 34242 address = {Atlanta, Georgia}, 34243 year = {1995} 34244} 34245 34246@Article{ murphy.sherali.ea:mathematical, 34247 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 34248 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 34249 Equilibrium}, 34250 journal = {Mathematical Programming}, 34251 year = {1982}, 34252 volume = {24}, 34253 pages = {92--106} 34254} 34255 34256@TechReport{ murtagh.saunders:minos, 34257 author = {B. A. Murtagh and M. A. Saunders}, 34258 title = {{MINOS} 5.0 User's Guide}, 34259 institution = {Stanford University}, 34260 address = {Stanford, California}, 34261 year = {1983}, 34262 number = {{SOL} 83.20}, 34263 type = {Technical Report} 34264} 34265 34266@InProceedings{ murthy.kasif.ea:oc1, 34267 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 34268 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 34269 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 34270 year = {1993}, 34271 publisher = {The AAAI Press/The MIT Press}, 34272 address = {Cambridge, MA 02142}, 34273 pages = {322--327} 34274} 34275 34276@Book{ murty:linear, 34277 author = {K. G. Murty}, 34278 title = {Linear Complementarity, Linear and Nonlinear Programming}, 34279 year = {1988}, 34280 publisher = {Helderman-Verlag}, 34281 address = {Berlin} 34282} 34283 34284@Book{ murty:linear*1, 34285 author = {K. G. Murty}, 34286 title = {Linear Programming}, 34287 year = {1983}, 34288 publisher = {John Wiley \& Sons}, 34289 address = {New York} 34290} 34291 34292@Article{ murty:number, 34293 author = {K. G. Murty}, 34294 title = {On the number of solutions of the complementarity problem and spanning properties 34295 of cones}, 34296 journal = {Linear Algebra and Its Applications}, 34297 year = {1972}, 34298 volume = {5}, 34299 pages = {65--108} 34300} 34301 34302@Book{ murty:linear*2, 34303 author = {K. G. Murty}, 34304 title = {Linear and Combinatorial Programming}, 34305 year = {1976}, 34306 publisher = {John Wiley \& Sons}, 34307 address = {New York} 34308} 34309 34310@Book{ nagurney:network, 34311 author = {A. Nagurney}, 34312 title = {Network Economics -- {A} Variational Inequality Approach}, 34313 publisher = {Kluwer Academic Publishers}, 34314 year = {1993}, 34315 address = {Dordrecht, The Netherlands} 34316} 34317 34318@Article{ nash.nocedal:numerical, 34319 author = {S. G. Nash and J. Nocedal}, 34320 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 34321 Method for Large Scale Optimization}, 34322 journal = {SIAM Journal on Optimization}, 34323 year = {1991}, 34324 volume = {3}, 34325 pages = {358--372} 34326} 34327 34328@Article{ nash:equilibrium, 34329 author = {J. F. Nash}, 34330 title = {Equilibrium Points in {N}--Person Games}, 34331 journal = {Proceedings of the National Academy of Sciences}, 34332 year = {1950}, 34333 volume = {36}, 34334 pages = {48--49} 34335} 34336 34337@Article{ nash:non-cooperative, 34338 author = {J. F. Nash}, 34339 title = {Non-cooperative games}, 34340 journal = {Annals of Mathematics}, 34341 year = {1951}, 34342 volume = {54}, 34343 pages = {286--295} 34344} 34345 34346@Article{ nash:newton-type, 34347 author = {S. G. Nash}, 34348 title = {{N}ewton--Type Minimization via {L}anczos Method}, 34349 journal = {SIAM Journal on Numerical Analysis}, 34350 year = {1984}, 34351 volume = {21}, 34352 pages = {770--788} 34353} 34354 34355@Article{ nauss:efficient, 34356 author = {R. M. Nauss}, 34357 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 34358 journal = {Management Science}, 34359 year = {1976}, 34360 volume = {23}, 34361 pages = {27--31} 34362} 34363 34364@Book{ nazareth:computer, 34365 author = {J. L. Nazareth}, 34366 title = {Computer Solution of Linear Programs}, 34367 year = {1987}, 34368 publisher = {Oxford University Press}, 34369 address = {Oxford} 34370} 34371 34372@Article{ nelder.mead:simplex, 34373 title = {A Simplex Method for Function Minimization}, 34374 author = {J. A. Nelder and R. Mead}, 34375 journal = {Computer Journal}, 34376 volume = {7}, 34377 pages = {308--313}, 34378 year = {1965} 34379} 34380 34381@Article{ nemhauser.savelsbergh.ea:minto, 34382 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 34383 title = {{MINTO}, {A} Mixed Integer Optimizer}, 34384 journal = {Operations Research Letters}, 34385 year = {1994}, 34386 optkey = {}, 34387 optvolume = {15}, 34388 optnumber = {}, 34389 optpages = {47--58}, 34390 optmonth = {}, 34391 optnote = {}, 34392 optannote = {} 34393} 34394 34395@Book{ nemhauser.wolsey:integer, 34396 author = {G. L. Nemhauser and L. A. Wolsey}, 34397 title = {Integer and Combinatorial Optimization}, 34398 publisher = {John Wiley \& Sons}, 34399 year = {1988}, 34400 address = {New York, NY} 34401} 34402 34403@Article{ nestor.pasurka:alternative, 34404 author = {D. Vaughn Nestor and C. Pasurka}, 34405 title = {Alternative Specifications for Environmental Control Costs in a General 34406 Equilibrium Framework}, 34407 journal = {Economics Letters}, 34408 year = {1995}, 34409 volume = {48}, 34410 pages = {273--280} 34411} 34412 34413@Article{ nestor.pasurka:cge, 34414 author = {D. Vaughn Nestor and C. Pasurka}, 34415 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 34416 of Environmental Policy}, 34417 journal = {Economic Modelling}, 34418 year = {1995}, 34419 volume = {12}, 34420 pages = {53--59} 34421} 34422 34423@Article{ newman.shapiro:theorems, 34424 author = {D. J. Newman and H. S. Shapiro}, 34425 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 34426 journal = {Duke Mathematical Journal}, 34427 year = {1963}, 34428 volume = {30}, 34429 pages = {673--682} 34430} 34431 34432@Article{ ng.peyton:block, 34433 author = {E. Ng and B. Peyton}, 34434 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 34435 journal = {SIAM Journal on Scientific and Statistical Computing}, 34436 year = {1993}, 34437 volume = {14}, 34438 pages = {1034--1056} 34439} 34440 34441@TechReport{ nielsen.zenios:solving, 34442 author = {S. S. Nielsen and S. A. Zenios}, 34443 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 34444 Algorithms}, 34445 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 34446 year = {1992}, 34447 address = {Philadelphia}, 34448 number = {92-01-05} 34449} 34450 34451@Article{ niemierko:optimization, 34452 author = {A. Niemierko}, 34453 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 34454 Points and Constraints}, 34455 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34456 year = {1992}, 34457 volume = {23}, 34458 pages = {99--108} 34459} 34460 34461@InCollection{ niemierko:treatment, 34462 author = {A. Niemierko}, 34463 title = {Treatment Plan Optimization}, 34464 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 34465 editor = {J. A. Purdy and B. Emami}, 34466 publisher = {Medical Physics Publishing}, 34467 year = {1993}, 34468 pages = {49--55}, 34469 address = {St. Louis, Missouri} 34470} 34471 34472@Article{ niemireko:optimization, 34473 author = {A. Niemierko}, 34474 title = {Optimization of intensity modulated beams: Local or global optimum?}, 34475 journal = {Medical Physics}, 34476 year = {1996}, 34477 optvolume = {23}, 34478 optpages = {1072} 34479} 34480 34481@Manual{ nih:radiation, 34482 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 34483 author = {N. C. I. National Institutes of Health}, 34484 organization = {NIH Publication}, 34485 address = {Bethesda, Maryland}, 34486 edition = {97-2227}, 34487 year = {1997} 34488} 34489 34490@Book{ nilsson:learning, 34491 author = {N. J. Nilsson}, 34492 title = {Learning Machines}, 34493 year = {1966}, 34494 publisher = {MIT Press}, 34495 address = {Cambridge, Massachusetts} 34496} 34497 34498@Article{ nocedal:theory, 34499 author = {J. Nocedal}, 34500 title = {Theory of Algorithms for Unconstrained Optimization}, 34501 journal = {Acta Numerica}, 34502 year = {1992}, 34503 pages = {199--242} 34504} 34505 34506@InProceedings{ noyes:neural, 34507 author = {J. L. Noyes}, 34508 title = {Neural Network Optimization Methods}, 34509 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 34510 Processing}, 34511 year = {1991}, 34512 publisher = {Indiana-Purdue University}, 34513 address = {Fort Wayne, Indiana}, 34514 pages = {1--12} 34515} 34516 34517@Article{ nygard.juell.ea:neural, 34518 author = {K. E. Nygard and P. Juell and N. Kadaba}, 34519 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 34520 journal = {ORSA Journal on Computing}, 34521 year = {1990}, 34522 volume = {4}, 34523 pages = {353--364} 34524} 34525 34526@Article{ oh.goenka:elastohydrodynamic, 34527 author = {K. P. Oh and P. K. Goenka}, 34528 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 34529 journal = {Transactions of the {ASME}, Journal of Tribology}, 34530 volume = {107}, 34531 year = {1985}, 34532 pages = {389--395} 34533} 34534 34535@Article{ oh.li.ea:elastohydrodynamic, 34536 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 34537 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 34538 journal = {Transactions of the {ASME}, Journal of Tribology}, 34539 volume = {109}, 34540 pages = {356--362}, 34541 year = {1987} 34542} 34543 34544@Article{ oh:analysis, 34545 author = {K. P. Oh}, 34546 title = {Analysis of a Needle Bearing}, 34547 journal = {Transactions of the {ASME}, Journal of Tribology}, 34548 volume = {106}, 34549 pages = {78--87}, 34550 year = {1984} 34551} 34552 34553@Article{ oh:formulation, 34554 author = {K. P. Oh}, 34555 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 34556 Complementarity Problem}, 34557 journal = {Transactions of the {ASME}, Journal of Tribology}, 34558 volume = {108}, 34559 year = {1986}, 34560 pages = {598--604} 34561} 34562 34563@Article{ oh:numerical, 34564 author = {K. P. Oh}, 34565 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 34566 Nonlinear Complementarity Problem}, 34567 journal = {Transactions of the {ASME}, Journal of Tribology}, 34568 volume = {106}, 34569 year = {1984}, 34570 pages = {88--95} 34571} 34572 34573@Article{ olivera.shepard.ea:maximum, 34574 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 34575 and E. E. Fitchard and T. R. Mackie}, 34576 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 34577 journal = {Physics in Medicine and Biology}, 34578 year = {1998}, 34579 pages = {3277--3294} 34580} 34581 34582@Article{ opial:weak, 34583 author = {Z. Opial}, 34584 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 34585 Mappings}, 34586 journal = {Bulletin of the American Mathematical Society}, 34587 year = {1967}, 34588 volume = {73}, 34589 pages = {591--597} 34590} 34591 34592@Book{ orchard-hays:advanced, 34593 author = {W. Orchard--Hays}, 34594 title = {Advanced Linear Programming Computing Techniques}, 34595 year = {1968}, 34596 publisher = {McGraw--Hill}, 34597 address = {New York} 34598} 34599 34600@Article{ orourke.taylor.ea:factor, 34601 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 34602 title = {Factor price convergence in the late nineteenth century}, 34603 journal = {International Economic Review}, 34604 year = {1996} 34605} 34606 34607@Article{ orourke.williamson:open, 34608 author = {K. O'Rourke and J. G. Williamson}, 34609 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 34610 accounting}, 34611 journal = {Scandinavian Economic and Social History}, 34612 year = {1995}, 34613 volume = {XLIII}, 34614 pages = {171--203} 34615} 34616 34617@Article{ orourke:costs, 34618 author = {K. O'Rourke}, 34619 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 34620 journal = {Research in Economic History}, 34621 year = {1995}, 34622 volume = {15}, 34623 pages = {215--259} 34624} 34625 34626@Article{ orourke:industrial, 34627 author = {K. O'Rourke}, 34628 title = {Industrial policy, employment policy and the non-traded sector}, 34629 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 34630 year = {1996} 34631} 34632 34633@Article{ orourke:measuring, 34634 author = {K. O'Rourke}, 34635 title = {Measuring protection: a cautionary tale}, 34636 journal = {Journal of Development Economics}, 34637 year = {1996} 34638} 34639 34640@Book{ ortega.rheinboldt:iterative, 34641 author = {J. M. Ortega and W. C. Rheinboldt}, 34642 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 34643 year = {1970}, 34644 publisher = {Academic Press}, 34645 address = {San Diego, California} 34646} 34647 34648@Book{ ortega:introduction, 34649 author = {J. M. Ortega}, 34650 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 34651 year = {1988}, 34652 publisher = {Plenum Press}, 34653 address = {New York} 34654} 34655 34656@Book{ ortega:numerical, 34657 author = {J. M. Ortega}, 34658 title = {Numerical Analysis, {A} Second Course}, 34659 year = {1972}, 34660 publisher = {Academic Press} 34661} 34662 34663@Article{ osborne.womersley:strong, 34664 author = {M. R. Osborne and R. S. Womersley}, 34665 title = {Strong uniqueness in sequential linear programming}, 34666 journal = {Journal of the Australian Mathematical Society, Series B}, 34667 year = {1990}, 34668 volume = {31}, 34669 pages = {379--384} 34670} 34671 34672@InCollection{ osborne:strong, 34673 author = {M. R. Osborne}, 34674 title = {Strong uniqueness in nonlinear approximation}, 34675 booktitle = {The numerical solution of nonlinear problems}, 34676 year = {1981}, 34677 editor = {C. T. H. Baker and C. Phillips}, 34678 publisher = {Clarendon Press}, 34679 address = {Oxford} 34680} 34681 34682@Book{ outrata.kocvara.ea:nonsmooth, 34683 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 34684 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 34685 publisher = {Kluwer Academic Publishers}, 34686 year = {1998}, 34687 address = {Dordrecht, The Netherlands} 34688} 34689 34690@Article{ outrata.zowe:numerical, 34691 author = {J. V. Outrata and J. Zowe}, 34692 title = {A Numerical Approach to Optimization Problems with Variational Inequality 34693 Constraints}, 34694 journal = {Mathematical Programming}, 34695 year = {1995}, 34696 volume = {68}, 34697 pages = {105--130} 34698} 34699 34700@Article{ outrata:necessary, 34701 author = {J. V. Outrata}, 34702 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 34703 journal = {Journal of Optimization Theory and Applications}, 34704 volume = {76}, 34705 year = {1993}, 34706 pages = {305--320} 34707} 34708 34709@Article{ outrata:numerical, 34710 author = {J. V. Outrata}, 34711 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 34712 journal = {Zeitschrift f{\"{u}}r Operations Research}, 34713 volume = {4}, 34714 year = {1990}, 34715 pages = {255--278} 34716} 34717 34718@Article{ outrata:optimization, 34719 author = {J. V. Outrata}, 34720 title = {On Optimization Problems with Variational Inequality Constraints}, 34721 journal = {SIAM Journal on Optimization}, 34722 volume = {4}, 34723 year = {1994}, 34724 pages = {340--357} 34725} 34726 34727@Article{ paige.saunders:lsqr, 34728 author = {C. C. Paige and M. A. Saunders}, 34729 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 34730 journal = {{ACM} Transactions on Mathematical Software}, 34731 year = {1982}, 34732 volume = {8}, 34733 pages = {43--71} 34734} 34735 34736@Article{ paige.saunders:solution, 34737 author = {C. C. Paige and M. A. Saunders}, 34738 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 34739 journal = {SIAM Journal on Numerical Analysis}, 34740 year = {1975}, 34741 volume = {12}, 34742 pages = {617--629} 34743} 34744 34745@Article{ palacios-gomez.lasdon.ea:nonlinear, 34746 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 34747 title = {Nonlinear Optimization by Successive Linear Programming}, 34748 journal = {Management Science}, 34749 year = {1982}, 34750 volume = {28}, 34751 pages = {1106--1120} 34752} 34753 34754@Article{ palomares.mangasarian:superlinearly, 34755 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 34756 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 34757 Optimization Problems}, 34758 journal = {Mathematical Programming}, 34759 year = {1976}, 34760 volume = {11}, 34761 pages = {1--13} 34762} 34763 34764@Article{ panagiotopoulos.al-fahed:robot, 34765 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 34766 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 34767 journal = {The International Journal of Robotics Research}, 34768 year = {1994}, 34769 volume = {13}, 34770 pages = {127--136} 34771} 34772 34773@Book{ panagiotopoulos:hemivariational, 34774 author = {P. D. Panagiotopoulos}, 34775 title = {Hemivariational Inequalities}, 34776 publisher = {Springer-Verlag}, 34777 address = {Berlin}, 34778 year = {1993} 34779} 34780 34781@Book{ panagiotopoulos:inequality, 34782 author = {P. D. Panagiotopoulos}, 34783 title = {Inequality Problems in Mechanics and Applications}, 34784 publisher = {Birkh{\"{a}}user}, 34785 address = {Boston}, 34786 year = {1985} 34787} 34788 34789@Article{ pang.chan:iterative, 34790 author = {J. S. Pang and D. Chan}, 34791 title = {Iterative Methods for Variational and Complementarity Problems}, 34792 journal = {Mathematical Programming}, 34793 year = {1982}, 34794 volume = {24}, 34795 pages = {284--313} 34796} 34797 34798@Article{ pang.gabriel:nesqp, 34799 author = {J. S. Pang and S. A. Gabriel}, 34800 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 34801 journal = {Mathematical Programming}, 34802 year = {1993}, 34803 volume = {60}, 34804 pages = {295--338} 34805} 34806 34807@Article{ pang.han.ea:minimization, 34808 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 34809 title = {Minimization of Locally {L}ipschitzian Functions}, 34810 journal = {SIAM Journal on Optimization}, 34811 year = {1991}, 34812 volume = {1}, 34813 pages = {57--82} 34814} 34815 34816@Article{ pang.qi:nonsmooth, 34817 author = {J. S. Pang and L. Qi}, 34818 title = {Nonsmooth Equations: Motivation and Algorithms}, 34819 journal = {SIAM Journal on Optimization}, 34820 year = {1993}, 34821 volume = {3}, 34822 pages = {443--465} 34823} 34824 34825@Article{ pang.trinkle.ea:complementarity, 34826 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 34827 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 34828 journal = {Computational Optimization and Applications}, 34829 volume = {5}, 34830 pages = {97--138}, 34831 year = {1996} 34832} 34833 34834@Article{ pang.trinkle:complementarity, 34835 author = {J. S. Pang and J. C. Trinkle}, 34836 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 34837 Contact Problems with {C}oulomb Friction}, 34838 year = {1996}, 34839 journal = {Mathematical Programming}, 34840 volume = {73}, 34841 pages = {199--226} 34842} 34843 34844@TechReport{ pang.wang:embedding, 34845 author = {J. S. Pang and Z. P. Wang}, 34846 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 34847 Problems}, 34848 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 34849 year = {1990}, 34850 address = {Baltimore, Maryland} 34851} 34852 34853@TechReport{ pang.yang:parallel, 34854 author = {J. S. Pang and J. M. Yang}, 34855 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 34856 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 34857 year = {1987}, 34858 address = {Baltimore, Maryland}, 34859 type = {Manuscript} 34860} 34861 34862@Article{ pang.yu:linearized, 34863 author = {J. S. Pang and C. S. Yu}, 34864 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 34865 Networks}, 34866 journal = {Networks}, 34867 volume = {14}, 34868 pages = {427--438}, 34869 year = {1984} 34870} 34871 34872@Article{ pang:b-differentiable, 34873 author = {J. S. Pang}, 34874 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 34875 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 34876 Inequality Problems}, 34877 journal = {Mathematical Programming}, 34878 year = {1991}, 34879 volume = {51}, 34880 pages = {101--132} 34881} 34882 34883@InCollection{ pang:complementarity, 34884 author = {J. S. Pang}, 34885 title = {Complementarity Problems}, 34886 booktitle = {Handbook in Global Optimization}, 34887 publisher = {Kluwer Academic Publishers}, 34888 year = {1994}, 34889 editor = {R. Horst and P. Pardalos}, 34890 address = {Boston} 34891} 34892 34893@Article{ pang:convergence, 34894 author = {J. S. Pang}, 34895 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 34896 Problem}, 34897 journal = {Journal of Optimization Theory and Applications}, 34898 year = {1982}, 34899 volume = {37}, 34900 pages = {149--162} 34901} 34902 34903@Article{ pang:convergence*1, 34904 author = {J. S. Pang}, 34905 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 34906 Application of some Sensitivity Results}, 34907 journal = {Mathematical Programming}, 34908 year = {1993}, 34909 volume = {58}, 34910 pages = {149--160} 34911} 34912 34913@Article{ pang:inexact, 34914 author = {J. S. Pang}, 34915 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 34916 journal = {Mathematical Programming}, 34917 year = {1986}, 34918 volume = {36}, 34919 pages = {54--71} 34920} 34921 34922@Article{ pang:more, 34923 author = {J. S. Pang}, 34924 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 34925 Complementarity Problem}, 34926 journal = {Journal of Optimization Theory and Applications}, 34927 year = {1986}, 34928 volume = {49}, 34929 pages = {107--134} 34930} 34931 34932@Article{ pang:more*1, 34933 author = {J. S. Pang}, 34934 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 34935 Complementarity Problems}, 34936 journal = {Journal of Optimization Theory and Applications}, 34937 year = {1986}, 34938 volume = {49}, 34939 pages = {107--134} 34940} 34941 34942@Article{ pang:necessary, 34943 author = {J. S. Pang}, 34944 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 34945 the Linear Complementarity Problem}, 34946 journal = {Journal of Optimization Theory and Applications}, 34947 year = {1984}, 34948 volume = {42}, 34949 pages = {1--17} 34950} 34951 34952@Article{ pang:newtons, 34953 author = {J. S. Pang}, 34954 title = {{N}ewton's Method for {B}--Differentiable Equations}, 34955 journal = {Mathematics of Operations Research}, 34956 year = {1990}, 34957 volume = {15}, 34958 pages = {311--341} 34959} 34960 34961@Article{ pang:posteriori, 34962 author = {J. S. Pang}, 34963 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 34964 Problem}, 34965 journal = {Mathematics of Operations Research}, 34966 year = {1987}, 34967 volume = {12}, 34968 pages = {474--484} 34969} 34970 34971@Article{ pantoja.mayne:sequential, 34972 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 34973 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 34974 with Control Inequality Constraints}, 34975 journal = {International Journal on Control}, 34976 year = {1991}, 34977 volume = {53}, 34978 pages = {823--836} 34979} 34980 34981@Book{ papadimitriou.steiglitz:combinatorial, 34982 author = {C. H. Papadimitriou and K. Steiglitz}, 34983 title = {Combinatorial Optimization: Algorithms and Complexity}, 34984 year = {1982}, 34985 publisher = {Prentice-Hall, Inc}, 34986 address = {Englewood Cliffs, New Jersey} 34987} 34988 34989@Article{ papanikolau.mackie.ea:investigation, 34990 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 34991 Reckwerdt}, 34992 title = {Investigation of the convolution method for polyenergetic spectra}, 34993 journal = {Medical Physics}, 34994 year = {1993}, 34995 volume = {20}, 34996 number = {5}, 34997 pages = {1327--1336} 34998} 34999 35000@Article{ parisot:resolution, 35001 author = {G. R. Parisot}, 35002 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 35003 Lin\'{e}aire par Application de la Programmation Logarithmique}, 35004 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 35005 year = {1961}, 35006 volume = {20}, 35007 pages = {227--259} 35008} 35009 35010@Article{ parker.cave.ea:comparison, 35011 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 35012 title = {Comparison of Simplex Algorithms}, 35013 journal = {Analytica Chimica Acta}, 35014 year = {1985}, 35015 volume = {175}, 35016 pages = {231--237} 35017} 35018 35019@InProceedings{ parker:optimal, 35020 author = {D. Parker}, 35021 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 35022 Second Order Hebbian Learning}, 35023 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 35024 II}, 35025 year = {1987}, 35026 address = {San Diego:IEEE}, 35027 pages = {593--600} 35028} 35029 35030@Book{ pascali.sburlan:nonlinear, 35031 author = {D. Pascali and S. Sburlan}, 35032 title = {Nonlinear Mappings of Monotone Type}, 35033 publisher = {Editura Academeie}, 35034 year = {1978} 35035} 35036 35037@Article{ passty:ergodic, 35038 author = {G. B. Passty}, 35039 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 35040 space}, 35041 journal = {Journal of Mathematical Analysis and Applications}, 35042 year = {1979}, 35043 volume = {72}, 35044 pages = {383--390} 35045} 35046 35047@Article{ peaceman.rachford:numerical, 35048 author = {D. W. Peaceman and H. H. Rachford}, 35049 title = {The numerical solution of parabolic and elliptic differential equations}, 35050 journal = {SIAM Journal}, 35051 year = {1955}, 35052 volume = {3}, 35053 pages = {28--41} 35054} 35055 35056@Book{ peck.tiesberg:global, 35057 author = {S. Peck and T. Tiesberg}, 35058 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 35059 {CETA}}, 35060 publisher = {The Electric Power Institute}, 35061 year = {1992}, 35062 address = {Paolo Alto CA} 35063} 35064 35065@TechReport{ peng:convexity, 35066 author = {J. -M. Peng}, 35067 title = {The Convexity of the Implicit {L}agrangian}, 35068 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35069 year = {1995}, 35070 type = {Technical Report}, 35071 address = {Beijing} 35072} 35073 35074@Article{ peng:equivalence, 35075 author = {J. -M. Peng}, 35076 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 35077 journal = {Mathematical Programming}, 35078 year = {1997}, 35079 volume = {78}, 35080 pages = {347--356} 35081} 35082 35083@Article{ pennisi:taking, 35084 author = {E. Pennisi}, 35085 title = {Taking a structured approach to understanding proteins}, 35086 journal = {Science}, 35087 year = {1998}, 35088 volume = {279}, 35089 pages = {978--979} 35090} 35091 35092@Article{ penot:regularity, 35093 author = {J. P. Penot}, 35094 title = {On regularity conditions in mathematical programming}, 35095 journal = {Mathematical Programming Study}, 35096 year = {1982}, 35097 volume = {17}, 35098 pages = {28--66} 35099} 35100 35101@Book{ perez:principles, 35102 author = {C. A. Perez and L. W. Brady}, 35103 title = {Principles and practice of radiotherapy}, 35104 publisher = {Lippincott-Raven}, 35105 year = {1998}, 35106 address = {Philadelphia}, 35107 edition = {3rd} 35108} 35109 35110@Article{ perroni.rutherford:international, 35111 author = {C. Perroni and T. Rutherford}, 35112 title = {International Trade in Carbon Emission Rights and Basic Materials: General 35113 Equilibrium Calculations for 2020}, 35114 journal = {Scandinavian Journal of Economics}, 35115 year = {1993} 35116} 35117 35118@Article{ perroni.rutherford:regular, 35119 author = {C. Perroni and T. Rutherford}, 35120 title = {Regular Flexibility of Nested {CES} Functions}, 35121 journal = {European Economic Review}, 35122 year = {1995}, 35123 volume = {39}, 35124 pages = {335--343} 35125} 35126 35127@InCollection{ perroni.wigle:environmental, 35128 author = {C. Perroni and R. M. Wigle}, 35129 title = {Environmental Policy Modeling}, 35130 booktitle = {Global Trade Analysis: Modeling and Applications}, 35131 publisher = {Cambridge University Press}, 35132 year = {1996}, 35133 editor = {T. Hertel} 35134} 35135 35136@Article{ peterson:review, 35137 author = {D. W. Peterson}, 35138 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 35139 journal = {SIAM Review}, 35140 year = {1973}, 35141 volume = {15}, 35142 pages = {639--654} 35143} 35144 35145@PhDThesis{ petersson:optimization, 35146 author = {J. Petersson}, 35147 title = {Optimization of Structures in Unilateral Contact}, 35148 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 35149 number = {397}, 35150 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 35151 University}, 35152 address = {Link{\"o}ping, Sweden}, 35153 year = {1995} 35154} 35155 35156@Book{ petri:modelling, 35157 author = {P. Petri}, 35158 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 35159 publisher = {Harvard University Press}, 35160 year = {1984} 35161} 35162 35163@InProceedings{ petrzykowski:application, 35164 author = {T. Petrzykowski}, 35165 title = {Application of the Steepest Ascent Method to Concave Programming}, 35166 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 35167 year = {1962}, 35168 publisher = {North--Holland}, 35169 address = {Amsterdam}, 35170 pages = {185--189} 35171} 35172 35173@InProceedings{ pettey.leuze.ea:parallel, 35174 crossref = {grefenstette:genetic}, 35175 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 35176 title = {A Parallel Genetic Algorithm}, 35177 pages = {155--161} 35178} 35179 35180@InProceedings{ pettey.leuze:theoretical, 35181 crossref = {schaeffer:third}, 35182 author = {C. C. Pettey and M. R. Leuze}, 35183 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 35184 pages = {398--405} 35185} 35186 35187@Book{ pfeiffer.glocker:multibody, 35188 author = {F. Pfeiffer and C. Glocker}, 35189 title = {Multibody Dynamics with Unilateral Contact}, 35190 year = {1996}, 35191 publisher = {John Wiley \& Sons} 35192} 35193 35194@TechReport{ pierro.iusem:convergence, 35195 author = {A. R. de Pierro and A. N. Iusem}, 35196 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 35197 Linear Complementarity Problems}, 35198 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 35199 year = {1990}, 35200 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 35201} 35202 35203@InCollection{ pillo.grippo.ea:class, 35204 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 35205 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 35206 booktitle = {System Modelling and Optimization}, 35207 year = {1981}, 35208 editor = {R. F. Drenick and F. Kozin}, 35209 publisher = {Springer-Verlag}, 35210 address = {Berlin} 35211} 35212 35213@Article{ pillo.grippo:augmented, 35214 author = {G. Di Pillo and L. Grippo}, 35215 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 35216 Problems}, 35217 journal = {Journal of Optimization Theory and Applications}, 35218 year = {1982}, 35219 volume = {36}, 35220 pages = {495--519} 35221} 35222 35223@Article{ pillo.grippo:class, 35224 author = {G. Di Pillo and L. Grippo}, 35225 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 35226 journal = {SIAM Journal on Control and Optimization}, 35227 year = {1979}, 35228 volume = {17}, 35229 pages = {618--628} 35230} 35231 35232@Article{ pillo.grippo:continuously, 35233 author = {G. Di Pillo and L. Grippo}, 35234 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 35235 Problems with Inequality Constraints}, 35236 journal = {SIAM Journal on Control and Optimization}, 35237 year = {1985}, 35238 volume = {23}, 35239 pages = {72--84} 35240} 35241 35242@Article{ pillo.grippo:exact, 35243 author = {G. Di Pillo and L. Grippo}, 35244 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 35245 Programming Problems}, 35246 journal = {Mathematical Programming}, 35247 year = {1986}, 35248 volume = {36}, 35249 pages = {1--18} 35250} 35251 35252@InProceedings{ plambeck.fu.ea:throughput, 35253 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35254 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 35255 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 35256 editor = {J. Schoen}, 35257 year = {1993}, 35258 publisher = {Society for Computer Simulation}, 35259 address = {San Diego, CA}, 35260 pages = {70--75} 35261} 35262 35263@Article{ plambeck.fu.ea:sample-path, 35264 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35265 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 35266 journal = {Mathematical Programming}, 35267 year = {1996}, 35268 volume = {75}, 35269 pages = {137--176} 35270} 35271 35272@InProceedings{ platt:sequential, 35273 author = {J. Platt}, 35274 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 35275 Machines}, 35276 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 35277 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 35278 publisher = {MIT Press}, 35279 pages = {185-208}, 35280 year = {1999} 35281} 35282 35283@Book{ poincare:sur, 35284 author = {H. Poincar\'{e}}, 35285 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 35286 year = {1881}, 35287 publisher = {Oeuvres I}, 35288 address = {Gauthier--Villars, Paris} 35289} 35290 35291@Article{ polak.ribiere:note, 35292 author = {E. Polak and G. Ribi\`{e}re}, 35293 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 35294 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 35295 year = {1969}, 35296 volume = {16-R1}, 35297 pages = {35--43} 35298} 35299 35300@Book{ polak:computational, 35301 author = {E. Polak}, 35302 title = {Computational Methods in Optimization; {A} Unified Approach}, 35303 year = {1971}, 35304 publisher = {Academic Press}, 35305 address = {New York} 35306} 35307 35308@Article{ polak:global, 35309 author = {E. Polak}, 35310 title = {On the Global Stabilization of Locally Convergent Algorithms}, 35311 journal = {Automatica}, 35312 year = {1976}, 35313 volume = {12}, 35314 pages = {337--349} 35315} 35316 35317@Article{ polyak.tretiyakov:concerning, 35318 author = {B. T. Polyak and N. V. Tretiyakov}, 35319 title = {Concerning an Iterative Method for Linear Programming and its Economic 35320 Interpretation}, 35321 journal = {Economics and Mathematical Methods}, 35322 year = {1972}, 35323 volume = {8}, 35324 pages = {740--751}, 35325 note = {(Russian)} 35326} 35327 35328@Article{ polyak.tretiyakov:method, 35329 author = {B. T. Polyak and N. V. Tretiyakov}, 35330 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 35331 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 35332 year = {1973}, 35333 volume = {13}, 35334 pages = {42--58} 35335} 35336 35337@Article{ polyak:conjugate, 35338 author = {B. T. Polyak}, 35339 title = {The conjugate gradient method in extremal problems}, 35340 journal = {USSR Computational Mathematics and Mathematical Physics}, 35341 year = {1969}, 35342 volume = {9}, 35343 pages = {94--112}, 35344 note = {Translated from Russian} 35345} 35346 35347@Book{ polyak:introduction, 35348 author = {B. T. Polyak}, 35349 title = {Introduction to Optimization}, 35350 year = {1987}, 35351 publisher = {Optimization Software, Inc.}, 35352 address = {Publications Division, New York} 35353} 35354 35355@Unpublished{ polyak:methods, 35356 author = {R. A. Polyak}, 35357 title = {On the Methods of Centers}, 35358 year = {1988}, 35359 note = {Unpublished manuscript} 35360} 35361 35362@Unpublished{ polyak:sharp, 35363 author = {B. T. Polyak}, 35364 title = {Sharp Minima}, 35365 year = {1979}, 35366 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 35367 Applications, {IIASA}, Laxenburg, Austria} 35368} 35369 35370@InProceedings{ polyak:smooth, 35371 author = {R. A. Polyak}, 35372 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 35373 Problems with Constraints}, 35374 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 35375 Programming}, 35376 year = {1982}, 35377 address = {Bonn} 35378} 35379 35380@Article{ polychronopoulos.tsitsiklis:analysis, 35381 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 35382 title = {Stochastic Shortest Path Problems with Recourse}, 35383 journal = {Networks}, 35384 year = {1996}, 35385 volume = {27}, 35386 pages = {133--143} 35387} 35388 35389@TechReport{ potra.bonnans:infeasible, 35390 author = {F. A. Potra and J. F. Bonnans}, 35391 title = {Infeasible path following algorithms for linear complementarity problems}, 35392 institution = {INRIA}, 35393 year = {1994}, 35394 month = dec, 35395 number = {RR--2445}, 35396 type = {Research Report} 35397} 35398 35399@Article{ potra.sheng:large-step, 35400 author = {F. A. Potra and R. Sheng}, 35401 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 35402 year = {1997}, 35403 journal = {SIAM Journal on Optimization}, 35404 volume = {7}, 35405 pages = {318--335} 35406} 35407 35408@Article{ potra:infeasible, 35409 author = {F. A. Potra}, 35410 title = {An infeasible interior-point predictor-corrector algorithm for linear 35411 programming}, 35412 journal = {SIAM Journal on Optimization}, 35413 year = {1996}, 35414 volume = {6}, 35415 pages = {19--32} 35416} 35417 35418@TechReport{ potra:onl, 35419 author = {F. A. Potra}, 35420 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 35421 convergence.}, 35422 institution = {Department of Mathematics, The University of Iowa}, 35423 address = {Iowa City, Iowa}, 35424 year = {1994}, 35425 number = {50}, 35426 type = {Reports on Computational Mathematics} 35427} 35428 35429@TechReport{ potra:predictor-corrector, 35430 author = {F. A. Potra}, 35431 title = {On a predictor-corrector method for solving linear programs from infeasible 35432 starting points}, 35433 institution = {Department of Mathematics, University of Iowa}, 35434 address = {Iowa City, Iowa}, 35435 year = {1992}, 35436 number = {34}, 35437 type = {Reports on Computational Mathematics} 35438} 35439 35440@TechReport{ potra:quadratically, 35441 author = {F. A. Potra}, 35442 title = {A quadratically convergent infeasible interior-point algorithm for linear 35443 programming}, 35444 institution = {Department of Mathematics, University of Iowa}, 35445 year = {1992}, 35446 number = {28}, 35447 address = {Iowa City, Iowa}, 35448 month = jul 35449} 35450 35451@InCollection{ powell:convergence, 35452 author = {M. J. D. Powell}, 35453 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 35454 Optimization Calculations}, 35455 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35456 pages = {27--63} 35457} 35458 35459@InProceedings{ powell:direct, 35460 author = {M. J. D. Powell}, 35461 title = {A Direct Search Optimization Method that Models the Objective and Constraint 35462 Functions by Linear Interpolation}, 35463 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 35464 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 35465 volume = {275}, 35466 year = {1994}, 35467 publisher = {Kluwer Academic Publishers}, 35468 pages = {51--67}, 35469 address = {Dordrecht, The Netherlands} 35470} 35471 35472@Article{ powell:efficient, 35473 author = {M. J. D. Powell}, 35474 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 35475 without Calculating Derivatives}, 35476 journal = {Computer Journal}, 35477 year = {1964}, 35478 volume = {17}, 35479 pages = {155--162} 35480} 35481 35482@InCollection{ powell:general, 35483 author = {M. J. D. Powell}, 35484 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 35485 booktitle = {Approximation Theory IV}, 35486 year = {1983}, 35487 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 35488 publisher = {Academic Press}, 35489 address = {New York}, 35490 pages = {187--218} 35491} 35492 35493@InCollection{ powell:hybrid, 35494 author = {M. J. D. Powell}, 35495 title = {A hybrid method for nonlinear equations}, 35496 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 35497 publisher = {Gordon and Breach}, 35498 year = {1970}, 35499 editor = {P. Rabinowitz} 35500} 35501 35502@TechReport{ powell:karmarkars, 35503 author = {M. J. D. Powell}, 35504 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 35505 institution = {Department of Applied Mathematics and Theoretical Physics, University of 35506 Cambridge}, 35507 year = {1989}, 35508 month = nov, 35509 address = {Cambridge, CB3 9EW, England} 35510} 35511 35512@InCollection{ powell:method, 35513 author = {M. J. D. Powell}, 35514 title = {A Method for Nonlinear Constraints in Minimization Problems}, 35515 booktitle = {Optimization}, 35516 year = {1969}, 35517 editor = {R. Fletcher}, 35518 publisher = {Academic Press}, 35519 address = {London}, 35520 pages = {283--298} 35521} 35522 35523@Book{ prekopa:stochastic, 35524 author = {A. Pr{\'{e}}kopa}, 35525 title = {Stochastic Programming}, 35526 publisher = {Kluwer Academic Publishers}, 35527 year = {1995}, 35528 address = {Dordrecht, The Netherlands} 35529} 35530 35531@Book{ press.flannery.ea:numerical, 35532 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 35533 Vetterling}, 35534 title = {Numerical Recipes : the Art of Scientific Computing}, 35535 publisher = {Cambridge University Press}, 35536 year = {1988} 35537} 35538 35539@Article{ pruyne.livny:interfacing, 35540 author = {J. Pruyne and M. Livny}, 35541 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 35542 journal = {Journal on Future Generations of Computer Systems}, 35543 volume = {12}, 35544 year = {1996}, 35545 pages = {67--85} 35546} 35547 35548@InCollection{ pruyne.livny:parallel, 35549 author = {J. Pruyne and M. Livny}, 35550 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 35551 booktitle = {Job Scheduling Strategies for Parallel Processing}, 35552 publisher = {Springer-Verlag}, 35553 year = {1995}, 35554 editor = {D. G. Feitelson and L. Rudolph}, 35555 volume = {949}, 35556 series = {Lecture Notes in Computer Science} 35557} 35558 35559@PhDThesis{ pruyne:resource, 35560 author = {J. C. Pruyne}, 35561 title = {Resource Management Services for Parallel Applications}, 35562 school = {University of Wisconsin--Madison}, 35563 year = {1996}, 35564 address = {Madison, Wisconsin} 35565} 35566 35567@Book{ pshenichny.danilin:numerical, 35568 author = {B. N. Pshenichny and Yu. M. Danilin}, 35569 title = {Numerical Methods in Extremal Problems}, 35570 year = {1978}, 35571 publisher = {MIR Publishers}, 35572 address = {Moscow} 35573} 35574 35575@TechReport{ qi.chen:globally, 35576 author = {L. Qi and X. Chen}, 35577 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 35578 institution = {School of Mathematics, University of New South Wales}, 35579 year = {1993}, 35580 annote = {revised}, 35581 address = {Sydney} 35582} 35583 35584@Article{ qi.jiang:semismooth, 35585 author = {L. Qi and H. Jiang}, 35586 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 35587 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 35588 journal = {Mathematics of Operations Research}, 35589 volume = {22}, 35590 pages = {301--325}, 35591 year = {1997} 35592} 35593 35594@TechReport{ qi.peng:unconstrained, 35595 author = {H. -D. Qi and J. -M. Peng}, 35596 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 35597 Problems}, 35598 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35599 year = {1996}, 35600 type = {Technical Report}, 35601 address = {Beijing} 35602} 35603 35604@InCollection{ qi.sun:survey, 35605 author = {L. Qi and D. Sun}, 35606 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 35607 year = {1999}, 35608 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 35609 booktitle = {Progress in Optimization}, 35610 pages = {121--146}, 35611 series = {Applied Optimization}, 35612 volume = {30}, 35613 publisher = {Kluwer Academic Publishers}, 35614 address = {Dordrecht} 35615} 35616 35617@Article{ qi.sun:nonsmooth, 35618 author = {L. Qi and J. Sun}, 35619 title = {A Nonsmooth Version of {N}ewton's Method}, 35620 journal = {Mathematical Programming}, 35621 year = {1993}, 35622 volume = {58}, 35623 pages = {353--368} 35624} 35625 35626@Article{ qi:convergence, 35627 author = {L. Qi}, 35628 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 35629 journal = {Mathematics of Operations Research}, 35630 year = {1993}, 35631 volume = {18}, 35632 pages = {227--244} 35633} 35634 35635@TechReport{ qi:regular, 35636 author = {L. Qi}, 35637 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 35638 convergent generalized {N}ewton methods for complementarity and variational 35639 inequality problems}, 35640 institution = {School of Mathematics, University of New South Wales}, 35641 year = {1997}, 35642 type = {Applied Mathematics Report}, 35643 number = {AMR 97/14}, 35644 address = {Sydney, Australia} 35645} 35646 35647@Article{ radner:competitive, 35648 author = {R. Radner}, 35649 title = {Competitive Equilibrium under Uncertainty}, 35650 journal = {Econometrica}, 35651 year = {1968}, 35652 volume = {36}, 35653 pages = {31--58} 35654} 35655 35656@Article{ radstrom:embedding, 35657 author = {H. R{\aa}dstr{\"{o}}m}, 35658 title = {An embedding theorem for spaces of convex sets}, 35659 journal = {Proc. Amer. Math. Soc.}, 35660 year = {1952}, 35661 volume = {3}, 35662 pages = {165--169} 35663} 35664 35665@Article{ raghavachari:connections, 35666 author = {M. Raghavachari}, 35667 title = {On Connections between Zero--One Integer Programming and Concave Programming 35668 Under Linear Constraints}, 35669 journal = {Operations Research}, 35670 year = {1969}, 35671 volume = {17}, 35672 pages = {680--684} 35673} 35674 35675@Article{ rajan.burridge.ea:dynamics, 35676 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 35677 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 35678 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 35679 month = mar, 35680 year = {1987}, 35681 pages = {671--677} 35682} 35683 35684@Article{ ralph:branching, 35685 author = {D. Ralph}, 35686 title = {On Branching Numbers of Normal Manifolds}, 35687 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 35688 volume = {22}, 35689 pages = {1041--1050}, 35690 year = {1994} 35691} 35692 35693@Article{ ralph:global, 35694 author = {D. Ralph}, 35695 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 35696 Path Search}, 35697 journal = {Mathematics of Operations Research}, 35698 year = {1994}, 35699 volume = {19}, 35700 pages = {352--389} 35701} 35702 35703@InProceedings{ ralph:piecewise, 35704 author = {D. Ralph}, 35705 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 35706 with Linear Complementarity Constraints}, 35707 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 35708 Applications (CTAC95)}, 35709 year = {1996} 35710} 35711 35712@PhDThesis{ raman:integration, 35713 author = {R. Raman}, 35714 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 35715 for process systems.}, 35716 address = {Pittsburgh, Pennsylvania}, 35717 year = {1993}, 35718 school = {Department of Chemical Engineering, Carnegie Mellon University} 35719} 35720 35721@PhDThesis{ rangaraj:nonsmooth, 35722 author = {Narayan Rangaraj}, 35723 title = {Nonsmooth Optimization: Algorithms and Applications}, 35724 year = {1990}, 35725 address = {Baltimore, MD}, 35726 school = {Department of Mathematical Sciences, The Johns Hopkins University} 35727} 35728 35729@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 35730 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 35731 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 35732 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35733 Radiation Therapy, Salt Lake City}, 35734 year = {1997}, 35735 editor = {D. D. Leavitt and G. Starkshall}, 35736 publisher = {Medical Physics Publishing}, 35737 address = {St. Louis, Missouri}, 35738 pages = {420--422} 35739} 35740 35741@Article{ reid:sparsity-exploiting, 35742 author = {J. K. Reid}, 35743 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear 35744 Programming Bases}, 35745 journal = {Mathematical Programming}, 35746 year = {1982}, 35747 volume = {24}, 35748 pages = {55--69} 35749} 35750 35751@Book{ reingold.nievergelt.ea:combinatorial, 35752 author = {E. Reingold and J. Nievergelt and N. Deo}, 35753 title = {Combinatorial Algorithms: Theory and Practice}, 35754 publisher = {Prentice-Hall, Inc}, 35755 address = {Englewood Cliffs, New Jersey} 35756} 35757 35758@PhDThesis{ reinoza:degree, 35759 author = {J. A. Reinoza}, 35760 title = {A Degree for Generalized Equations}, 35761 year = {1979}, 35762 address = {Madison, Wisconsin}, 35763 school = {University of Wisconsin} 35764} 35765 35766@Article{ reinoza:solving, 35767 author = {A. Reinoza}, 35768 title = {Solving Generalized Equations via Homotopies}, 35769 journal = {Mathematical Programming}, 35770 year = {1985}, 35771 volume = {31}, 35772 pages = {307--320} 35773} 35774 35775@PhDThesis{ ren:computable, 35776 author = {J. Ren}, 35777 title = {Computable Error Bounds in Mathematical Programming}, 35778 school = {Computer Sciences Department, University of Wisconsin}, 35779 year = {1993}, 35780 address = {Madison, Wisconsin}, 35781 note = {Technical Report 1173} 35782} 35783 35784@Article{ renegar:polynomial-time, 35785 author = {J. Renegar}, 35786 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 35787 Programming}, 35788 journal = {Mathematical Programming}, 35789 year = {1988}, 35790 volume = {40}, 35791 pages = {59--94} 35792} 35793 35794@Article{ robbins.monro:stochastic, 35795 author = {H. Robbins and S. Monro}, 35796 title = {A Stochastic Approximation Method}, 35797 journal = {Annals of Mathematical Statistics}, 35798 year = {1951}, 35799 volume = {22}, 35800 pages = {400--407} 35801} 35802 35803@Article{ robinson:analysis, 35804 author = {S. M. Robinson}, 35805 title = {Analysis of Sample-Path Optimization}, 35806 journal = {Mathematics of Operations Research}, 35807 year = {1996}, 35808 volume = {21}, 35809 pages = {513--528} 35810} 35811 35812@InCollection{ robinson:bundle-based, 35813 author = {S. M. Robinson}, 35814 title = {Bundle-Based Decomposition: Conditions for Convergence}, 35815 booktitle = {Analyse Non Lin\'{e}aire}, 35816 year = {1989}, 35817 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 35818 publisher = {Gauthier-Villaars}, 35819 address = {Paris}, 35820 pages = {435--447} 35821} 35822 35823@InCollection{ robinson:bundle-based*1, 35824 author = {S. M. Robinson}, 35825 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 35826 booktitle = {System Modeling and Optimization}, 35827 year = {1986}, 35828 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 35829 publisher = {Springer-Verlag}, 35830 address = {Berlin}, 35831 pages = {751--756}, 35832 volume = {84}, 35833 series = {Lecture Notes in Control and Information Sciences} 35834} 35835 35836@Article{ robinson:continuity, 35837 author = {S. M. Robinson}, 35838 title = {Some Continuity Properties of Polyhedral Multifunctions}, 35839 journal = {Mathematical Programming Study}, 35840 year = {1981}, 35841 volume = {14}, 35842 pages = {206--214} 35843} 35844 35845@Article{ robinson:extension, 35846 author = {S. M. Robinson}, 35847 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 35848 journal = {Numerische Mathematik}, 35849 year = {1972}, 35850 volume = {19}, 35851 pages = {341--347} 35852} 35853 35854@InCollection{ robinson:generalized, 35855 crossref = {bachem.grotschel.ea:mathematical}, 35856 author = {S. M. Robinson}, 35857 title = {Generalized Equations}, 35858 pages = {346--367} 35859} 35860 35861@Article{ robinson:generalized*1, 35862 author = {S. M. Robinson}, 35863 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 35864 journal = {Mathematical Programming Study}, 35865 year = {1979}, 35866 volume = {10}, 35867 pages = {128--141} 35868} 35869 35870@InCollection{ robinson:homeomorphism, 35871 author = {S. M. Robinson}, 35872 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 35873 booktitle = {Optimization and Nonlinear Analysis}, 35874 year = {1992}, 35875 editor = {A. Ioffe and M. Marcus and S. Reich}, 35876 publisher = {Longman}, 35877 address = {Harlow, Essex, England}, 35878 pages = {240--248}, 35879 series = {Pitman Research Notes in Mathematics Series No. 244} 35880} 35881 35882@Article{ robinson:implicit-function, 35883 author = {S. M. Robinson}, 35884 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 35885 journal = {Mathematics of Operations Research}, 35886 year = {1991}, 35887 volume = {16}, 35888 pages = {292--309} 35889} 35890 35891@Article{ robinson:local*1, 35892 author = {S. M. Robinson}, 35893 title = {Local Epi--Continuity and Local Optimization}, 35894 journal = {Mathematical Programming}, 35895 year = {1987}, 35896 volume = {37}, 35897 pages = {208--222} 35898} 35899 35900@Article{ robinson:local*2, 35901 author = {S. M. Robinson}, 35902 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 35903 Nondegeneracy}, 35904 journal = {Mathematical Programming Study}, 35905 year = {1984}, 35906 volume = {22}, 35907 pages = {217--230} 35908} 35909 35910@Article{ robinson:local*3, 35911 author = {S. M. Robinson}, 35912 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 35913 Stability and Sensitivity}, 35914 journal = {Mathematical Programming Study}, 35915 year = {1987}, 35916 volume = {30}, 35917 pages = {45--66} 35918} 35919 35920@Article{ robinson:mathematical, 35921 author = {S. M. Robinson}, 35922 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 35923 journal = {Mathematical Programming}, 35924 year = {1990}, 35925 volume = {48}, 35926 pages = {221--229} 35927} 35928 35929@Article{ robinson:newtons, 35930 author = {S. M. Robinson}, 35931 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 35932 journal = {Set Valued Analysis}, 35933 year = {1994}, 35934 volume = {2}, 35935 pages = {291--305} 35936} 35937 35938@Article{ robinson:nonsingularity, 35939 author = {S. M. Robinson}, 35940 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 35941 journal = {Mathematical Programming}, 35942 year = {1993}, 35943 volume = {62}, 35944 pages = {415--425} 35945} 35946 35947@InCollection{ robinson:nonsmooth, 35948 author = {S. M. Robinson}, 35949 title = {Nonsmooth Continuation for Generalized Equations}, 35950 year = {1997}, 35951 pages = {282--291}, 35952 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 35953 booktitle = {Recent Advances in Optimization}, 35954 series = {Lecture Notes in Economics and Mathematical Systems}, 35955 volume = {452}, 35956 publisher = {Springer-Verlag}, 35957 address = {Heidelberg} 35958} 35959 35960@Article{ robinson:normal, 35961 author = {S. M. Robinson}, 35962 title = {Normal Maps Induced by Linear Transformations}, 35963 journal = {Mathematics of Operations Research}, 35964 year = {1992}, 35965 volume = {17}, 35966 pages = {691--714} 35967} 35968 35969@Article{ robinson:normed, 35970 author = {S. M. Robinson}, 35971 title = {Normed Convex Processes}, 35972 journal = {Transactions of the American Mathematical Society}, 35973 year = {1972}, 35974 volume = {174}, 35975 pages = {127--140} 35976} 35977 35978@Article{ robinson:reduction, 35979 author = {S. M. Robinson}, 35980 title = {A reduction method for variational inequalities}, 35981 journal = {Mathematical Programming}, 35982 year = {1998}, 35983 volume = {80}, 35984 pages = {161--169} 35985} 35986 35987@Article{ robinson:regularity, 35988 author = {S. M. Robinson}, 35989 title = {Regularity and stability for convex multivalued functions}, 35990 journal = {Mathematics of Operations Research}, 35991 year = {1976}, 35992 volume = {1}, 35993 pages = {130--143} 35994} 35995 35996@Unpublished{ robinson:shadow, 35997 author = {S. M. Robinson}, 35998 title = {Shadow {JUNK} for biblio file}, 35999 year = {1800} 36000} 36001 36002@Article{ robinson:shadow*1, 36003 author = {S. M. Robinson}, 36004 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 36005 journal = {Operations Research}, 36006 year = {1993}, 36007 volume = {41}, 36008 pages = {518--535} 36009} 36010 36011@Article{ robinson:shadow*2, 36012 author = {S. M. Robinson}, 36013 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 36014 journal = {Operations Research}, 36015 year = {1993}, 36016 volume = {41}, 36017 pages = {536--548} 36018} 36019 36020@Unpublished{ robinson:stability, 36021 author = {S. M. Robinson}, 36022 title = {Stability {JUNK} for biblio file}, 36023 year = {1800} 36024} 36025 36026@Article{ robinson:stability*1, 36027 author = {S. M. Robinson}, 36028 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 36029 journal = {SIAM Journal on Numerical Analysis}, 36030 year = {1975}, 36031 volume = {12}, 36032 pages = {754--769} 36033} 36034 36035@Article{ robinson:stability*2, 36036 author = {S. M. Robinson}, 36037 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 36038 Nonlinear Systems}, 36039 journal = {SIAM Journal on Numerical Analysis}, 36040 year = {1976}, 36041 volume = {13}, 36042 pages = {497--513} 36043} 36044 36045@Article{ robinson:strongly, 36046 author = {S. M. Robinson}, 36047 title = {Strongly Regular Generalized Equations}, 36048 journal = {Mathematics of Operations Research}, 36049 year = {1980}, 36050 volume = {5}, 36051 pages = {43--62} 36052} 36053 36054@Article{ rockafellar.wets:generalized, 36055 author = {R. T. Rockafellar and R. J.--B. Wets}, 36056 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 36057 Control in Discrete Time}, 36058 journal = {SIAM Journal on Control and Optimization}, 36059 year = {1990}, 36060 volume = {28}, 36061 pages = {810--822} 36062} 36063 36064@Article{ rockafellar.wets:lagrangian, 36065 author = {R. T. Rockafellar and R. J.--B. Wets}, 36066 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 36067 in Stochastic Programming}, 36068 journal = {Mathematical Programming Study}, 36069 year = {1986}, 36070 volume = {28}, 36071 pages = {63--93} 36072} 36073 36074@InCollection{ rockafellar.wets:linear-quadratic, 36075 author = {R. T. Rockafellar and R. J.--B. Wets}, 36076 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 36077 Generation Algorithm}, 36078 booktitle = {Stochastic Optimization}, 36079 publisher = {Springer-Verlag}, 36080 year = {1987}, 36081 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 36082 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 36083 pages = {545--560}, 36084 address = {New York, Berlin} 36085} 36086 36087@Article{ rockafellar.wets:scenarios, 36088 author = {R. T. Rockafellar and R. J.--B. Wets}, 36089 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 36090 journal = {Mathematics of Operations Research}, 36091 year = {1991}, 36092 volume = {10}, 36093 pages = {119--147} 36094} 36095 36096@InProceedings{ rockafellar:applications, 36097 author = {R. T. Rockafellar}, 36098 title = {New Applications of Duality in Convex Programming}, 36099 booktitle = {Proceedings of the Fourth Conference on Probability}, 36100 year = {1971}, 36101 address = {Brasov, Romania} 36102} 36103 36104@Article{ rockafellar:augmented, 36105 author = {R. T. Rockafellar}, 36106 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 36107 journal = {SIAM Journal on Control and Optimization}, 36108 year = {1974}, 36109 volume = {12}, 36110 pages = {268--285} 36111} 36112 36113@Article{ rockafellar:augmented*1, 36114 author = {R. T. Rockafellar}, 36115 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 36116 Convex Programming}, 36117 journal = {Mathematics of Operations Research}, 36118 year = {1976}, 36119 volume = {1}, 36120 pages = {97--116} 36121} 36122 36123@Article{ rockafellar:characterization, 36124 author = {R. T. Rockafellar}, 36125 title = {Characterization of the subdifferentials of convex functions}, 36126 journal = {Pacific Journal of Mathematics}, 36127 year = {1966}, 36128 volume = {17}, 36129 number = {3}, 36130 pages = {497--510} 36131} 36132 36133@Article{ rockafellar:computational, 36134 author = {R. T. Rockafellar}, 36135 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 36136 Programming}, 36137 journal = {Mathematical Programming}, 36138 year = {1990}, 36139 volume = {48}, 36140 pages = {447--474} 36141} 36142 36143@Book{ rockafellar:conjugate, 36144 author = {R. T. Rockafellar}, 36145 title = {Conjugate Duality and Optimization}, 36146 year = {1974}, 36147 publisher = {SIAM}, 36148 address = {Philadelphia, Pennsylvania}, 36149 volume = {16}, 36150 series = {Conference Board of the Mathematical Sciences} 36151} 36152 36153@Book{ rockafellar:convex, 36154 author = {R. T. Rockafellar}, 36155 title = {Convex Analysis}, 36156 year = {1970}, 36157 publisher = {Princeton University Press}, 36158 address = {Princeton, New Jersey} 36159} 36160 36161@Article{ rockafellar:first-, 36162 author = {R. T. Rockafellar}, 36163 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 36164 journal = {Transactions of the American Mathematical Society}, 36165 year = {1988}, 36166 volume = {307}, 36167 pages = {75--108} 36168} 36169 36170@InProceedings{ rockafellar:generalized, 36171 author = {R. T. Rockafellar}, 36172 title = {A Generalized Approach to Linear-Quadratic Programming}, 36173 booktitle = {Proceedings of the International Conference on Numerical Optimization and 36174 Applications}, 36175 year = {1986}, 36176 pages = {58--66}, 36177 note = {(Xi'an, China)} 36178} 36179 36180@InProceedings{ rockafellar:generalized*1, 36181 crossref = {bachem.grotschel.ea:mathematical}, 36182 author = {R. T. Rockafellar}, 36183 title = {Generalized Subgradients in Mathematical Programming}, 36184 pages = {368--390} 36185} 36186 36187@InCollection{ rockafellar:large-scale, 36188 author = {R. T. Rockafellar}, 36189 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 36190 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 36191 chapter = {15}, 36192 year = {1991}, 36193 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 36194 publisher = {SIAM Publications}, 36195 pages = {247--261} 36196} 36197 36198@Article{ rockafellar:linear-quadratic, 36199 author = {R. T. Rockafellar}, 36200 title = {Linear-Quadratic Programming and Optimal Control}, 36201 journal = {SIAM Journal on Control and Optimization}, 36202 year = {1987}, 36203 volume = {25}, 36204 pages = {781--814} 36205} 36206 36207@Article{ rockafellar:maximality, 36208 author = {R. T. Rockafellar}, 36209 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 36210 journal = {Transactions of the American Mathematical Society}, 36211 year = {1970}, 36212 volume = {149}, 36213 pages = {75--88} 36214} 36215 36216@InCollection{ rockafellar:monotone, 36217 author = {R. T. Rockafellar}, 36218 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 36219 crossref = {mangasarian.meyer.ea:nonlinear*3}, 36220 pages = {1--26} 36221} 36222 36223@Article{ rockafellar:monotone*1, 36224 author = {R. T. Rockafellar}, 36225 title = {Monotone Operators and the Proximal Point Algorithm}, 36226 journal = {SIAM Journal on Control and Optimization}, 36227 year = {1976}, 36228 volume = {14}, 36229 pages = {877--898} 36230} 36231 36232@Article{ rockafellar:multiplier, 36233 author = {R. T. Rockafellar}, 36234 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 36235 journal = {Journal of Optimization Theory and Applications}, 36236 year = {1973}, 36237 volume = {12}, 36238 pages = {555--562} 36239} 36240 36241@Article{ rockafellar:multistage, 36242 author = {R. T. Rockafellar}, 36243 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 36244 journal = {Control and Cybernetics}, 36245 year = {1988}, 36246 volume = {17}, 36247 number = {2-3}, 36248 pages = {225--245} 36249} 36250 36251@Book{ rockafellar:network, 36252 author = {R. T. Rockafellar}, 36253 title = {Network Flows and Monotropic Optimization}, 36254 publisher = {John Wiley}, 36255 year = {1984}, 36256 address = {New York} 36257} 36258 36259@Article{ rodrigues:mixed, 36260 author = {H. C. Rodrigues}, 36261 title = {A mixed variational formulation for shape optimization of solids with contact 36262 conditions}, 36263 journal = {Structural Optimization}, 36264 volume = {6}, 36265 year = {1993}, 36266 pages = {19--28} 36267} 36268 36269@Book{ rodrigues:obstacle, 36270 author = {J. F. Rodrigues}, 36271 title = {Obstacle Problems in Mathematical Physics}, 36272 publisher = {Elsevier Publishing Company}, 36273 address = {Amsterdam}, 36274 year = {1987} 36275} 36276 36277@Book{ roos.terlaky.ea:theory, 36278 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 36279 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 36280 publisher = {John Wiley \& Sons}, 36281 year = {1997}, 36282 address = {Chichester} 36283} 36284 36285@TechReport{ rosa:decomposition, 36286 author = {C. H. Rosa}, 36287 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 36288 institution = {IIASA}, 36289 year = {1996}, 36290 number = {WP-96-013}, 36291 address = {A-2361 Laxenburg, Austria} 36292} 36293 36294@Article{ rosen.lane.ea:treatment, 36295 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 36296 title = {Treatment Plan Optimization Using Linear Programming}, 36297 journal = {Medical Physics}, 36298 year = {1990}, 36299 volume = {18}, 36300 number = {2}, 36301 pages = {141--152} 36302} 36303 36304@TechReport{ rosenblatt:perceptron-a, 36305 author = {F. Rosenblatt}, 36306 title = {The perceptron--a perceiving and recognizing automaton}, 36307 institution = {Cornell Aeronautical Laboratory}, 36308 year = {1957}, 36309 month = jan, 36310 address = {Ithaca, New York}, 36311 number = {85-460-1} 36312} 36313 36314@Book{ rosenblatt:principles, 36315 author = {F. Rosenblatt}, 36316 title = {Principles of Neurodynamics}, 36317 year = {1962}, 36318 publisher = {Spartan Books}, 36319 address = {New York} 36320} 36321 36322@InProceedings{ rosenblatt:two, 36323 author = {F. Rosenblatt}, 36324 title = {Two theorems of statistical separability in the perceptron}, 36325 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 36326 year = {1959}, 36327 publisher = {{HMS} Stationery Office}, 36328 address = {London}, 36329 volume = {1} 36330} 36331 36332@Article{ rosenbrock:automatic, 36333 author = {H. H. Rosenbrock}, 36334 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 36335 journal = {Computer Journal}, 36336 year = {1960}, 36337 volume = {3}, 36338 pages = {175--184} 36339} 36340 36341@Article{ roy.mukhopadhyay:pattern, 36342 author = {A. Roy and S. Mukhopadhyay}, 36343 title = {Pattern Classification Using Linear Programming}, 36344 journal = {ORSA Journal on Computing}, 36345 year = {1990}, 36346 volume = {3}, 36347 pages = {66--80} 36348} 36349 36350@Book{ rubinstein:monte, 36351 author = {R. Rubinstein}, 36352 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 36353 Networks}, 36354 publisher = {Wiley}, 36355 address = {New York, NY}, 36356 year = {1986} 36357} 36358 36359@Article{ ruchala.olivera.ea:comparison, 36360 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 36361 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 36362 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 36363 journal = {Physics in Medicine and Biology, forthcoming}, 36364 year = {1999} 36365} 36366 36367@Book{ rudin:principles, 36368 author = {W. Rudin}, 36369 title = {Principles of Mathematical Analysis}, 36370 year = {1976}, 36371 publisher = {McGraw--Hill}, 36372 address = {Tokyo, Japan}, 36373 edition = {Third} 36374} 36375 36376@Book{ rudin:real, 36377 author = {W. Rudin}, 36378 title = {Real and Complex Analysis}, 36379 year = {1974}, 36380 publisher = {McGraw--Hill}, 36381 address = {Tokyo, Japan}, 36382 edition = {Second} 36383} 36384 36385@InProceedings{ rumelhart.hinton.ea:learning, 36386 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 36387 title = {Learning Internal Representations by Error Propagation}, 36388 booktitle = {Parallel Distributed Processing}, 36389 year = {1986}, 36390 editor = {D. E. Rumelhart and J. L. McClelland}, 36391 publisher = {MIT Press}, 36392 address = {Cambridge, Massachusetts}, 36393 pages = {318--362} 36394} 36395 36396@Book{ rumelhart.mcclelland:parallel, 36397 author = {D. E. Rumelhart and J. L. McClelland}, 36398 title = {Parallel Distributed Processing}, 36399 year = {1986}, 36400 publisher = {MIT Press}, 36401 address = {Cambridge, Massachusetts} 36402} 36403 36404@InCollection{ ruszczynski:regularized, 36405 author = {A. Ruszczynski}, 36406 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 36407 year = {1995}, 36408 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 36409 editor = {K. Marti and P. Kall}, 36410 publisher = {Springer-Verlag}, 36411 address = {Berlin}, 36412 volume = {425}, 36413 series = {Lecture Notes in Control and Information Sciences}, 36414 pages = {93--108} 36415} 36416 36417@Article{ rutherford.rutstrom.ea:lacord, 36418 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 36419 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 36420 quantitative}, 36421 journal = {Revue d' Economie du developpement}, 36422 year = {1994} 36423} 36424 36425@InCollection{ rutherford.tarr:blueprints, 36426 author = {T. Rutherford and D. Tarr}, 36427 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 36428 Open Economy}, 36429 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 36430 publisher = {Cambridge University Press}, 36431 year = {1997}, 36432 editor = {R. Baldwin and J. Francois}, 36433 address = {New York} 36434} 36435 36436@Article{ rutherford:applied, 36437 author = {T. F. Rutherford}, 36438 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 36439 Overview of the Modeling Framework and Syntax}, 36440 year = {1999}, 36441 volume = {14}, 36442 pages = {1--46}, 36443 journal = {Computational Economics} 36444} 36445 36446@PhDThesis{ rutherford:applied*1, 36447 author = {T. F. Rutherford}, 36448 title = {Applied General Equilibrium Modeling}, 36449 school = {Stanford University}, 36450 year = {1987} 36451} 36452 36453@Article{ rutherford:extensions, 36454 author = {T. F. Rutherford}, 36455 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 36456 Analysis}, 36457 journal = {Journal of Economic Dynamics and Control}, 36458 volume = {19}, 36459 pages = {1299--1324}, 36460 year = {1995} 36461} 36462 36463@Misc{ rutherford:gnuplot, 36464 author = {T. F. Rutherford}, 36465 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 36466 organization = {Department of Economics, University of Colorado}, 36467 address = {Boulder, Colorado}, 36468 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 36469} 36470 36471@Unpublished{ rutherford:miles, 36472 author = {T. F. Rutherford}, 36473 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 36474 year = {1993}, 36475 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 36476} 36477 36478@TechReport{ rutherford:modeling, 36479 author = {T. F. Rutherford}, 36480 title = {A Modeling System for Applied General Equilibrium Analysis}, 36481 type = {Cowles Foundation Discussion Paper}, 36482 number = {836}, 36483 institution = {Yale University}, 36484 year = {1987} 36485} 36486 36487@TechReport{ rutherford:mpsge, 36488 author = {T. F. Rutherford}, 36489 title = {{MPSGE}}, 36490 institution = {University of Western Ontario}, 36491 year = {1988}, 36492 address = {London, Ontario} 36493} 36494 36495@Article{ rykov:simplex, 36496 author = {A. S. Rykov}, 36497 title = {Simplex Direct Search Algorithms}, 36498 journal = {Automation and Remote Control}, 36499 year = {1980}, 36500 volume = {41}, 36501 pages = {784--793} 36502} 36503 36504@Article{ saad.schultz:gmres, 36505 author = {Y. Saad and M. Schultz}, 36506 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 36507 Linear Systems}, 36508 journal = {SIAM Journal on Scientific and Statistical Computing}, 36509 year = {1986}, 36510 volume = {44}, 36511 pages = {856--869} 36512} 36513 36514@Book{ saad:iterative, 36515 author = {Y. Saad}, 36516 title = {Iterative Methods for Sparse Linear Systems}, 36517 year = {1996}, 36518 publisher = {PWS Publishing Company}, 36519 address = {Boston, Massachusetts} 36520} 36521 36522@Article{ sahni:approximate, 36523 author = {S. Sahni}, 36524 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 36525 journal = {jacm}, 36526 year = {1975}, 36527 volume = {22}, 36528 pages = {115--124} 36529} 36530 36531@InProceedings{ sauer.shepard.ea:comparison, 36532 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 36533 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 36534 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36535 Radiation Therapy, Salt Lake City}, 36536 year = {1997}, 36537 editor = {D. D. Leavitt and G. Starkshall}, 36538 publisher = {Medical Physics Publishing}, 36539 address = {St. Louis, Missouri} 36540} 36541 36542@Article{ sauer.xu:multivariate, 36543 author = {Th. Sauer and Y. Xu}, 36544 title = {On Multivariate {L}agrange Interpolation}, 36545 journal = {Mathematics of Computation}, 36546 year = {1995}, 36547 volume = {64}, 36548 pages = {1147--1170} 36549} 36550 36551@Article{ savelsbergh:preprocessing, 36552 author = {M. W. P. Savelsbergh}, 36553 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 36554 journal = {ORSA Journal on Computing}, 36555 year = {1994}, 36556 volume = {6}, 36557 pages = {445--454} 36558} 36559 36560@Article{ scarf:approximation, 36561 author = {H. E. Scarf}, 36562 title = {The Approximation of Fixed Points of a Continuous Mapping}, 36563 journal = {SIAM Journal on Applied Mathematics}, 36564 year = {1967}, 36565 volume = {15}, 36566 pages = {1328--1343} 36567} 36568 36569@Book{ scarf:computation, 36570 author = {H. E. Scarf}, 36571 title = {The Computation of Economic Equilibria}, 36572 year = {1973}, 36573 publisher = {Yale University Press}, 36574 address = {New Haven, Connecticut} 36575} 36576 36577@TechReport{ scheel.scholtes:mathematical, 36578 author = {H. Scheel and S. Scholtes}, 36579 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 36580 and Sensitivity}, 36581 institution = {Judge Institute of Management Studies, University of Cambridge}, 36582 year = {1998}, 36583 type = {Technical Report}, 36584 address = {Cambridge, England} 36585} 36586 36587@Article{ schlick:modified, 36588 author = {T. Schlick}, 36589 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 36590 journal = {SIAM Journal on Scientific Computing}, 36591 year = {1993}, 36592 volume = {14}, 36593 pages = {424--445} 36594} 36595 36596@Article{ schnabel.eskow:modified, 36597 author = {R. B. Schnabel and E. Eskow}, 36598 title = {A New Modified {C}holesky Factorization}, 36599 journal = {SIAM Journal on Scientific and Statistical Computing}, 36600 year = {1991}, 36601 volume = {11}, 36602 pages = {1136--1158} 36603} 36604 36605@Article{ schneider.zenios:comparative, 36606 author = {M. H. Schneider and S. A. Zenios}, 36607 title = {A Comparative Study of Algorithms for Matrix Balancing}, 36608 journal = {Operations Research}, 36609 year = {1990}, 36610 volume = {38}, 36611 pages = {439--455} 36612} 36613 36614@Book{ scholkopf.burges.ea:advances, 36615 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 36616 title = {Advances in Kernel Methods: Support Vector Machines}, 36617 publisher = {MIT Press}, 36618 address = {Cambridge, MA }, 36619 year = {1998}, 36620 isbn = {0-262-19416-3} 36621} 36622 36623@Article{ scholtes.stohr:exact, 36624 author = {S. Scholtes and M. St{\"{o}}hr}, 36625 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 36626 journal = {SIAM Journal on Control and Optimization}, 36627 volume = {37}, 36628 pages = {617--652}, 36629 year = {1999} 36630} 36631 36632@TechReport{ scholtes:introduction, 36633 author = {S. Scholtes}, 36634 title = {Introduction to piecewise differentiable equations}, 36635 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 36636 Universit{\"{a}}t Karlsruhe}, 36637 year = {1994}, 36638 type = {Preprint}, 36639 number = {No. 53/1994}, 36640 address = {Karlsruhe, Germany} 36641} 36642 36643@Article{ schramm.zowe:version, 36644 author = {H. Schramm and J. Zowe}, 36645 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 36646 Idea, Convergence Analysis, Numerical Results}, 36647 journal = {SIAM Journal on Optimization}, 36648 year = {1992}, 36649 volume = {2}, 36650 pages = {121--152} 36651} 36652 36653@Article{ schultz.meyer:interior, 36654 author = {G. L. Schultz and R. R. Meyer}, 36655 title = {An Interior Point Method for Block Angular Optimization}, 36656 journal = {SIAM Journal on Optimization}, 36657 year = {1991}, 36658 volume = {1}, 36659 pages = {583--602} 36660} 36661 36662@InProceedings{ sekiguchi.sato.ea:ninf, 36663 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 36664 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 36665 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 36666 year = {1996}, 36667 address = {Santa Fe} 36668} 36669 36670@InCollection{ sellami.robinson:homotopies, 36671 author = {H. Sellami and S. M. Robinson}, 36672 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 36673 Inequalities}, 36674 booktitle = {Nonlinear Optimization and Applications}, 36675 editor = {G. Di Pillo and F. Giannessi}, 36676 year = {1996}, 36677 pages = {327--343}, 36678 publisher = {Plenum Press}, 36679 address = {New York} 36680} 36681 36682@Article{ sellami.robinson:implementation, 36683 author = {H. Sellami and S. M. Robinson}, 36684 title = {Implementation of a Continuation Method for Normal Maps}, 36685 journal = {Mathematical Programming}, 36686 year = {1997}, 36687 volume = {76}, 36688 pages = {563--578} 36689} 36690 36691@PhDThesis{ sellami:continuation, 36692 author = {H. Sellami}, 36693 title = {A Continuation Method for Normal Maps}, 36694 school = {University of Wisconsin -- Madison}, 36695 year = {1994}, 36696 address = {Madison, Wisconsin} 36697} 36698 36699@Article{ sellami:homotopy, 36700 author = {H. Sellami}, 36701 title = {A Homotopy Continuation Method for Normal Maps}, 36702 journal = {Mathematical Programming}, 36703 vol = {82}, 36704 year = {1998}, 36705 pages = {317--337} 36706} 36707 36708@Book{ seuss:one, 36709 author = {{Dr.} A. Seuss}, 36710 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 36711 year = {1960}, 36712 publisher = {Beginner Books}, 36713 address = {New York}, 36714 series = {Beginner Books, B13}, 36715 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 36716 Yink, Yop, Gack, and the Zeds} 36717} 36718 36719@Article{ seyfferth.pfeiffer:dynamics, 36720 author = {W. Seyfferth and F. Pfeiffer}, 36721 title = {Dynamics of Assembly Processes With a Manipulator}, 36722 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 36723 and Systems}, 36724 year = {1992}, 36725 pages = {1303--1310} 36726} 36727 36728@Article{ shanno.simantiraki:infeasible, 36729 author = {D. Shanno and E. Simantiraki}, 36730 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 36731 year = {1997}, 36732 journal = {SIAM Journal on Optimization}, 36733 volume = {7}, 36734 pages = {620--640} 36735} 36736 36737@InProceedings{ shanno.simantiraki:interior, 36738 author = {D. Shanno and E. Simantiraki}, 36739 title = {Interior Point Methods for Linear and Nonlinear Programming}, 36740 booktitle = {State of the Art in Numerical Analysis}, 36741 year = {1997}, 36742 editor = {I. S. Duff and G. A. Watson}, 36743 publisher = {Oxford University Press}, 36744 address = {Oxford} 36745} 36746 36747@Article{ shannon:introduction, 36748 author = {R. E. Shannon}, 36749 title = {Introduction to the Art and Science of simulation}, 36750 journal = {WSC98 1998 Winter simulation conference proceedings}, 36751 year = {1998}, 36752 volume = {1}, 36753 pages = {7--14} 36754} 36755 36756@TechReport{ shapiro:concepts, 36757 author = {A. Shapiro}, 36758 title = {On Concepts of Directional Differentiability}, 36759 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 36760 year = {1988}, 36761 address = {Pretoria, South Africa}, 36762 number = {73/88(18)}, 36763 type = {Research Report} 36764} 36765 36766@Book{ shavlik.editors:readings, 36767 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 36768 title = {Readings in Machine Learning}, 36769 year = {1990}, 36770 publisher = {Morgan Kaufman}, 36771 address = {San Mateo, California} 36772} 36773 36774@Article{ shavlik.mooney.ea:symbolic, 36775 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 36776 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 36777 journal = {Machine Learning}, 36778 year = {1991}, 36779 volume = {6}, 36780 pages = {111--143} 36781} 36782 36783@Book{ sheffi:urban, 36784 author = {Y. Sheffi}, 36785 title = {Urban Transportation Networks}, 36786 publisher = {Prentice-Hall, Inc}, 36787 year = {1985}, 36788 address = {Englewood Cliffs, New Jersey} 36789} 36790 36791@Article{ sheng.potra:quadratically, 36792 author = {R. Sheng and F. A. Potra}, 36793 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 36794 Polynomial {CO}mplexity}, 36795 journal = {SIAM Journal on Optimization}, 36796 year = {1997}, 36797 volume = {7}, 36798 pages = {304--317} 36799} 36800 36801@InProceedings{ shepard.angelos.ea:simple, 36802 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 36803 title = {A Simple Model for Examining Radiotherapy Optimization}, 36804 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36805 Radiation Therapy, Salt Lake City}, 36806 year = {1997}, 36807 editor = {D. D. Leavitt and G. Starkshall}, 36808 publisher = {Medical Physics Publishing}, 36809 address = {St. Louis, Missouri} 36810} 36811 36812@Article{ shepard.ferris.ea:inverse, 36813 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 36814 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 36815 journal = {Medical Physics}, 36816 volume = {27}, 36817 pages = {12}, 36818 year = {2000}, 36819 key = {93} 36820} 36821 36822@Article{ shepard.ferris.ea:optimizing, 36823 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 36824 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 36825 journal = {SIAM Review}, 36826 volume = {41}, 36827 pages = {721--744}, 36828 year = {1999}, 36829 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 36830 key = {68}, 36831 institution = {Computer Sciences Department, University of Wisconsin}, 36832 address = {Madison, Wisconsin}, 36833 number = {98-07}, 36834 type = {Mathematical Programming Technical Report} 36835} 36836 36837@Article{ sherali.shetty:finitely, 36838 author = {H. D. Sherali and C. M. Shetty}, 36839 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 36840 Cuts and Disjunctive Face Cuts}, 36841 journal = {Mathematical Programming}, 36842 year = {1980}, 36843 volume = {19}, 36844 pages = {14--31} 36845} 36846 36847@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 36848 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 36849 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 36850 journal = {Operations Research}, 36851 year = {1983}, 36852 volume = {31}, 36853 pages = {253--276} 36854} 36855 36856@Article{ shi.olafsson.ea:hybrid, 36857 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 36858 title = {A New Hybrid Optimization Algorithm}, 36859 journal = {Computers and Industrial Engineering}, 36860 year = {1999}, 36861 volume = {36}, 36862 pages = {409--426} 36863} 36864 36865@PhDThesis{ shiau:iterative, 36866 author = {T.--H. Shiau}, 36867 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 36868 school = {Computer Sciences Department, University of Wisconsin}, 36869 year = {1983}, 36870 address = {Madison, Wisconsin}, 36871 note = {Technical Report 507} 36872} 36873 36874@InProceedings{ shor:generalized, 36875 crossref = {bachem.grotschel.ea:mathematical}, 36876 author = {N. Z. Shor}, 36877 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 36878 Dilation Operations}, 36879 pages = {501--529} 36880} 36881 36882@Book{ shor:minimization, 36883 author = {N. Z. Shor}, 36884 title = {Minimization Methods for Nondifferentiable Functions}, 36885 year = {1985}, 36886 publisher = {Springer-Verlag}, 36887 address = {Berlin} 36888} 36889 36890@Article{ shoven.whalley:applied, 36891 author = {J. Shoven and J. Whalley}, 36892 title = {Applied General Equilibrium Models of Taxation and International Trade: 36893 Introduction and Survey}, 36894 journal = {Journal of Economic Literature}, 36895 year = {1984}, 36896 volume = {22}, 36897 pages = {1007--1051} 36898} 36899 36900@Article{ shultz.meyer:interior, 36901 author = {G. L. Shultz and R. R. Meyer}, 36902 title = {An Interior Point Method for Block Angular Optimization}, 36903 journal = {SIAM Journal on Optimization}, 36904 year = {1991}, 36905 volume = {1}, 36906 pages = {583--602} 36907} 36908 36909@Article{ shultz.schnabel.ea:family, 36910 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 36911 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 36912 journal = {SIAM Journal on Numerical Analysis}, 36913 year = {1985}, 36914 volume = {22}, 36915 pages = {44--67} 36916} 36917 36918@Article{ sibony:methodes, 36919 author = {M. Sibony}, 36920 title = {Methodes iteratives pur les equations et inequations aux derives partielles 36921 nonlineaires de type monotone}, 36922 journal = {Calcolo}, 36923 year = {1970}, 36924 volume = {7}, 36925 pages = {65--183} 36926} 36927 36928@Article{ sidney:optimal, 36929 author = {J. B. Sidney}, 36930 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 36931 journal = {Operations Research}, 36932 year = {1977}, 36933 volume = {25}, 36934 pages = {62--69} 36935} 36936 36937@Book{ siegel:corba, 36938 author = {J. Siegel}, 36939 title = {{CORBA} - Fundamentals and Programming}, 36940 publisher = {John Wiley \& Sons}, 36941 year = {1996}, 36942 address = {New York, New York} 36943} 36944 36945@TechReport{ simantiraki.shanno:infeasible-interior-point, 36946 author = {E. Simantiraki and D. F. Shanno}, 36947 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 36948 type = {Research Report}, 36949 number = {7-95}, 36950 institution = {Rutgers Center for Operations Research, Rutgers University}, 36951 address = {New Brunswick, New Jersey}, 36952 year = {1995} 36953} 36954 36955@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 36956 author = {E. Simantiraki and D. F. Shanno}, 36957 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 36958 Problems}, 36959 crossref = {ferris.pang:complementarity}, 36960 pages = {386--404} 36961} 36962 36963@Book{ simpson:artificial, 36964 author = {P. K. Simpson}, 36965 title = {Artificial Neural Systems}, 36966 year = {1990}, 36967 publisher = {Pergamon Press}, 36968 address = {New York} 36969} 36970 36971@Article{ smeers:computable, 36972 author = {Y. Smeers}, 36973 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 36974 and Gas Markets}, 36975 journal = {The Energy Journal}, 36976 year = {1997}, 36977 optkey = {}, 36978 optvolume = {18}, 36979 optnumber = {}, 36980 optmonth = {}, 36981 optpages = {1--32}, 36982 optnote = {}, 36983 optannote = {} 36984} 36985 36986@Article{ smith:design, 36987 author = {F. W. Smith}, 36988 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 36989 Procedures}, 36990 journal = {IEEE Transactions on Computers}, 36991 year = {1969}, 36992 volume = {18}, 36993 pages = {367--372} 36994} 36995 36996@Article{ smith:existence, 36997 author = {M. J. Smith}, 36998 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 36999 journal = {Transportation Research}, 37000 year = {1979}, 37001 volume = {13B}, 37002 pages = {295--304} 37003} 37004 37005@Article{ smith:existence*1, 37006 author = {M. J. Smith}, 37007 title = {The existence and calculation of traffic equilibria}, 37008 journal = {Transportation Research}, 37009 volume = {17B}, 37010 year = {1983}, 37011 pages = {291--303} 37012} 37013 37014@Article{ smith:pattern, 37015 author = {F. W. Smith}, 37016 title = {Pattern Classifier Design by Linear Programming}, 37017 journal = {IEEE Transactions on Computers}, 37018 year = {1968}, 37019 volume = {C-17}, 37020 pages = {367--372} 37021} 37022 37023@Article{ solodov.svaiter:projection, 37024 author = {M. V. Solodov and B. F. Svaiter}, 37025 title = {A New Projection Method for Variational Inequality Problems}, 37026 journal = {SIAM Journal on Control and Optimization}, 37027 volume = {37}, 37028 pages = {765--776}, 37029 year = {1999} 37030} 37031 37032@Article{ solodov.tseng:modified, 37033 author = {M. V. Solodov and P. Tseng}, 37034 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 37035 year = {1996}, 37036 journal = {SIAM Journal on Control and Optimization}, 37037 pages = {1814--1830}, 37038 volume = {34} 37039} 37040 37041@Article{ solodov:stationary, 37042 author = {M. V. Solodov}, 37043 title = {Stationary Points of Bound Constrained Minimization Reformulations of 37044 Complementarity Problems}, 37045 journal = {Journal of Optimization Theory and Applications, forthcoming}, 37046 year = {1997} 37047} 37048 37049@Article{ spendley.hext.ea:sequential, 37050 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 37051 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 37052 Operation}, 37053 journal = {Technometrics}, 37054 year = {1962}, 37055 pages = {441--461}, 37056 volume = {4} 37057} 37058 37059@Article{ spingarn:applications, 37060 author = {J. E. Spingarn}, 37061 title = {Applications of the Method of Partial Inverses to Convex Programming}, 37062 journal = {Mathematical Programming}, 37063 year = {1985}, 37064 volume = {32}, 37065 pages = {199--223} 37066} 37067 37068@Book{ srinivasan.whalley:general, 37069 author = {T. Srinivasan and J. Whalley}, 37070 title = {General Equilibrium Trade Policy Modelling}, 37071 publisher = {MIT Press}, 37072 year = {1986}, 37073 address = {Boston} 37074} 37075 37076@Book{ stackelberg:theory, 37077 author = {H. Van Stackelberg}, 37078 title = {The Theory of Market Economy}, 37079 publisher = {Oxford University Press}, 37080 year = {1952} 37081} 37082 37083@Article{ stavroulakis.panagiotopoulos.ea:rigid, 37084 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 37085 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 37086 Applications}, 37087 journal = {Computers \& Structures}, 37088 volume = {40}, 37089 year = {1991}, 37090 pages = {599--614} 37091} 37092 37093@Article{ stavroulakis:optimal, 37094 author = {G. E. Stavroulakis}, 37095 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 37096 optimal control problem for variational inequalities}, 37097 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 37098 year = {1996} 37099} 37100 37101@Article{ stavroulakis:optimal*1, 37102 author = {G. E. Stavroulakis}, 37103 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 37104 journal = {Archives of Applied Mechanics, forthcoming}, 37105 year = {1996} 37106} 37107 37108@Book{ steenbrink:optimization, 37109 author = {P. A. Steenbrink}, 37110 title = {Optimization of Transport Networks}, 37111 publisher = {John Wiley \& Sons}, 37112 address = {London, England}, 37113 year = {1974} 37114} 37115 37116@Article{ stephens:asymptotic, 37117 author = {M. A. Stephens}, 37118 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 37119 journal = {Annals of Statistics}, 37120 year = {1976}, 37121 volume = {4}, 37122 pages = {357--369} 37123} 37124 37125@Article{ stephens:edf, 37126 author = {M. A. Stephens}, 37127 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 37128 journal = {Journal of the American Statistical Association}, 37129 year = {1974}, 37130 volume = {69}, 37131 pages = {730--737} 37132} 37133 37134@Article{ stevens:location, 37135 author = {B. H. Stevens}, 37136 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 37137 journal = {Papers of the Regional Science Association}, 37138 year = {1968}, 37139 volume = {21}, 37140 pages = {19--34} 37141} 37142 37143@Article{ stewart.trinkle:implicit, 37144 author = {D. E. Stewart and J. C. Trinkle}, 37145 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 37146 Collisions and {C}oulomb Friction}, 37147 journal = {International Journal for Numerical Methods in Engineering}, 37148 year = {1996}, 37149 volume = {39}, 37150 pages = {2673--2691} 37151} 37152 37153@Book{ stoer.bulirsch:introduction, 37154 author = {J. Stoer and R. Bulirsch}, 37155 title = {Introduction to Numerical Analysis}, 37156 year = {1980}, 37157 publisher = {Springer-Verlag}, 37158 address = {New York} 37159} 37160 37161@Article{ stoer:complexity, 37162 author = {J. Stoer}, 37163 title = {The complexity of an infeasible interior--point path--following method for the 37164 solution of linear programs}, 37165 journal = {Optimization Methods and Software}, 37166 year = {1994}, 37167 volume = {3}, 37168 pages = {1--12} 37169} 37170 37171@Article{ stone:cross-validatory, 37172 author = {M. Stone}, 37173 title = {Cross-validatory choice and assessment of statistical predictions}, 37174 journal = {Journal of the Royal Statistical Society}, 37175 year = {1974}, 37176 volume = {36}, 37177 pages = {111--147} 37178} 37179 37180@Article{ stone.smith.ea:inverse, 37181 author = {R. A. Stone and V. Smith and L. Verhey}, 37182 title = {Inverse Planning for the {G}amma {K}nife}, 37183 journal = {Medical Physics}, 37184 year = {1993}, 37185 volume = {20}, 37186 pages = {865} 37187} 37188 37189@Book{ strang:linear, 37190 author = {G. Strang}, 37191 title = {Linear Algebra and its Applications}, 37192 year = {1980}, 37193 publisher = {Academic Press}, 37194 address = {New York}, 37195 edition = {Second} 37196} 37197 37198@InProceedings{ street.wolberg.ea:nuclear, 37199 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 37200 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 37201 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 37202 year = {1993}, 37203 publisher = {SPIE--The International Society for Optical Engineering}, 37204 address = {San Jose, California}, 37205 pages = {861--870}, 37206 volume = {1905} 37207} 37208 37209@Article{ subramanian:gauss-newton, 37210 author = {P. K. Subramanian}, 37211 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 37212 journal = {Journal of Optimization Theory and Applications}, 37213 year = {1993}, 37214 volume = {77}, 37215 pages = {467--482} 37216} 37217 37218@PhDThesis{ subramanian:iterative, 37219 author = {P. K. Subramanian}, 37220 title = {Iterative Methods of Solution for Complementarity Problems}, 37221 year = {1985}, 37222 address = {Madison, Wisconsin}, 37223 school = {Computer Sciences Department, University of Wisconsin} 37224} 37225 37226@TechReport{ subramanian:note, 37227 author = {P. K. Subramanian}, 37228 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 37229 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 37230 year = {1985}, 37231 address = {Madison, Wisconsin}, 37232 number = {2844}, 37233 type = {Technical Summary Report} 37234} 37235 37236@TechReport{ suh.gucht:distributed, 37237 author = {J. Y. Suh and D. Van Gucht}, 37238 title = {Distributed Genetic Algorithms}, 37239 institution = {Computer Science Department, Indiana University}, 37240 year = {1987}, 37241 address = {Bloomington}, 37242 number = {225} 37243} 37244 37245@Article{ sun.natori.ea:computational, 37246 author = {S. M. Sun and M. C. Natori and K. C. Park}, 37247 title = {A Computational Procedure for Flexible Beams with Frictional Contact 37248 Constraints}, 37249 journal = {International Journal for Numerical Methods in Engineering}, 37250 volume = {36}, 37251 pages = {3781--3800}, 37252 year = {1993} 37253} 37254 37255@Article{ sun.qi:ncp-functions, 37256 author = {D. Sun and L. Qi}, 37257 title = {On {NCP}-Functions}, 37258 journal = {Computational Optimization and Applications, forthcoming}, 37259 year = {1998} 37260} 37261 37262@Article{ sun.womersley:unconstrained, 37263 author = {D. Sun and R. S. Womersley}, 37264 title = {A new unconstrained differentiable merit function for box constrained variational 37265 inequality problems and a damped {G}auss-{N}ewton method}, 37266 journal = {SIAM Journal on Optimization}, 37267 year = {1999}, 37268 volume = {9}, 37269 pages = {388--413} 37270} 37271 37272@Article{ sun:class, 37273 author = {D. Sun}, 37274 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 37275 journal = {Journal of Optimization Theory and Applications}, 37276 year = {1996}, 37277 volume = {91}, 37278 pages = {123--140} 37279} 37280 37281@PhDThesis{ sun:monotropic, 37282 author = {J. Sun}, 37283 title = {On Monotropic Piecewise Quadratic Programming}, 37284 school = {University of Washington}, 37285 year = {1986}, 37286 address = {Seattle, Washington} 37287} 37288 37289@Article{ sun:thermal, 37290 author = {D. C. Sun}, 37291 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 37292 journal = {Journal of Applied Mechanics}, 37293 volume = {58}, 37294 pages = {141--153}, 37295 year = {1991} 37296} 37297 37298@Article{ sundararaghavan.ahmed:minimizing, 37299 author = {P. S. Sundararaghavan and M. U. Ahmed}, 37300 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 37301 Scheduling}, 37302 journal = {Naval Research Logistics Quarterly}, 37303 year = {1984}, 37304 volume = {31}, 37305 pages = {325--333} 37306} 37307 37308@TechReport{ sznajder.gowda:generalizations, 37309 author = {R. Sznajder and M. S. Gowda}, 37310 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 37311 horizontal {LCP}s}, 37312 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 37313 year = {1992}, 37314 address = {Catonsville, Maryland}, 37315 number = {92--16}, 37316 type = {Research Report} 37317} 37318 37319@Article{ sznajder.gowda:nondegeneracy, 37320 author = {R. Sznajder and M. S. Gowda}, 37321 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 37322 journal = {Mathematics of Operations Research}, 37323 year = {1998}, 37324 volume = {23}, 37325 pages = {221--238} 37326} 37327 37328@Article{ taji.fukushima.ea:globally, 37329 author = {K. Taji and M. Fukushima and T. Ibaraki}, 37330 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 37331 Inequalities}, 37332 journal = {Mathematical Programming}, 37333 year = {1993}, 37334 volume = {58}, 37335 pages = {369--383} 37336} 37337 37338@Article{ taji.fukushima:optimization, 37339 author = {K. Taji and M. Fukushima}, 37340 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 37341 Problem}, 37342 journal = {Journal of the Operations Research Society of Japan}, 37343 year = {1994}, 37344 volume = {37}, 37345 pages = {310--331} 37346} 37347 37348@Article{ talbot.patterson.ea:comparative, 37349 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 37350 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 37351 journal = {Management Science}, 37352 year = {1986}, 37353 volume = {32}, 37354 pages = {430--454} 37355} 37356 37357@Article{ talman.yamamoto:simplicial, 37358 author = {A. J. J. Talman and Y. Yamamoto}, 37359 title = {A {S}implicial Algorithm for Stationary Point Problems}, 37360 journal = {Mathematics of Operations Research}, 37361 year = {1989}, 37362 volume = {14}, 37363 pages = {383--399} 37364} 37365 37366@InProceedings{ tanese:distributed, 37367 crossref = {schaeffer:third}, 37368 author = {R. Tanese}, 37369 title = {Distributed Genetic Algorithms}, 37370 pages = {434--439} 37371} 37372 37373@InProceedings{ tanese:parallel, 37374 crossref = {grefenstette:genetic}, 37375 author = {R. Tanese}, 37376 title = {Parallel Genetic Algorithms for a Hypercube}, 37377 pages = {177--183} 37378} 37379 37380@Article{ teboulle:entropic, 37381 author = {M. Teboulle}, 37382 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 37383 year = {1992}, 37384 journal = {Mathematics of Operations Research}, 37385 volume = {17}, 37386 pages = {670--690} 37387} 37388 37389@Article{ thuente:duality, 37390 author = {D. J. Thuente}, 37391 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 37392 journal = {Operations Research}, 37393 year = {1980}, 37394 volume = {28}, 37395 pages = {1005--1011} 37396} 37397 37398@Book{ tikhonov.arsenin:solutions, 37399 author = {A. N. Tikhonov and V. Y. Arsenin}, 37400 title = {Solutions of Ill--Posed Problems}, 37401 year = {1977}, 37402 publisher = {John Wiley \& Sons}, 37403 address = {New York} 37404} 37405 37406@InProceedings{ tin-loi.ferris:complementarity, 37407 author = {F. Tin-Loi and M. C. Ferris}, 37408 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 37409 booktitle = {Computational Mechanics for the Next Millenium}, 37410 key = {79}, 37411 pages = {1029--1036}, 37412 year = {1999}, 37413 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 37414 volume = {2}, 37415 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 37416 Mechanics}, 37417 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 37418 publisher = {Elsevier Science Ltd}, 37419 type = {Mathematical Programming Technical Report}, 37420 institution = {Computer Sciences Department, University of Wisconsin}, 37421 address = {Madison, Wisconsin}, 37422 number = {99-02} 37423} 37424 37425@InProceedings{ tin-loi.ferris:holonomic, 37426 author = {F. Tin-Loi and M. C. Ferris}, 37427 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 37428 booktitle = {Advances in Fracture Research}, 37429 year = {1997}, 37430 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 37431 volume = {2}, 37432 publisher = {Pergamon Press}, 37433 pages = {2183--2190}, 37434 key = {53} 37435} 37436 37437@InProceedings{ tin-loi.ferris:simple, 37438 author = {F. Tin-Loi and M. C. Ferris}, 37439 title = {A Simple Mathematical Programming Method for a Structural Identification 37440 Problem}, 37441 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 37442 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 37443 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 37444 publisher = {Techno-Press}, 37445 address = {Korea}, 37446 year = {1997}, 37447 pages = {511--518}, 37448 key = {59} 37449} 37450 37451@Article{ tin-loi.misa:large, 37452 author = {F. Tin-Loi and J. S. Misa}, 37453 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 37454 journal = {International Journal for Numerical Methods in Engineering}, 37455 volume = {39}, 37456 pages = {741--762}, 37457 year = {1996} 37458} 37459 37460@Article{ tin-loi.pang:elastoplastic, 37461 author = {F. Tin-Loi and J. S. Pang}, 37462 title = {Elastoplastic analysis of structures with nonlinear hardening}, 37463 journal = {Computer Methods in Applied Mechanics and Engineering}, 37464 volume = {107}, 37465 year = {1993}, 37466 pages = {299--312} 37467} 37468 37469@Article{ tin-loi.vimonsatit:nonlinear, 37470 author = {F. Tin-Loi and V. Vimonsatit}, 37471 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 37472 journal = {Engineering Structures}, 37473 volume = {18}, 37474 year = {1996}, 37475 pages = {115--124} 37476} 37477 37478@Article{ tobin:uniqueness, 37479 author = {R. L. Tobin}, 37480 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 37481 journal = {Annals of Operations Research}, 37482 volume = {34}, 37483 year = {1992}, 37484 pages = {21--36} 37485} 37486 37487@Article{ tobin:variable, 37488 author = {R. L. Tobin}, 37489 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 37490 Problem}, 37491 journal = {Mathematical Programming}, 37492 year = {1988}, 37493 volume = {40}, 37494 pages = {33--51} 37495} 37496 37497@Article{ todd.burrell:extension, 37498 author = {M. J. Todd and B. P. Burrell}, 37499 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 37500 Variables}, 37501 journal = {Algorithmica}, 37502 year = {1986}, 37503 volume = {1}, 37504 pages = {409--424} 37505} 37506 37507@Book{ todd:computation, 37508 author = {M. J. Todd}, 37509 title = {Computation of Fixed Points and Applications}, 37510 publisher = {Springer-Verlag}, 37511 year = {1976}, 37512 volume = {124}, 37513 series = {Lecture Notes in Economics and Mathematical Systems}, 37514 address = {Heidelberg} 37515} 37516 37517@Article{ todd:note, 37518 author = {M. J. Todd}, 37519 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 37520 Production}, 37521 journal = {Journal of Mathematical Economics}, 37522 year = {1976}, 37523 volume = {6}, 37524 pages = {135--144} 37525} 37526 37527@Article{ toint:assesment, 37528 author = {Ph. L. Toint}, 37529 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37530 Optimization}, 37531 year = {1996}, 37532 journal = {SIAM Journal on Scientific Computing}, 37533 volume = {17}, 37534 pages = {725=-739} 37535} 37536 37537@TechReport{ toint:assesment*1, 37538 author = {Ph. L. Toint}, 37539 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37540 Optimization: The Complete Numerical Results}, 37541 institution = {Department of Mathematics, FUNDP}, 37542 year = {1994}, 37543 number = {94/15}, 37544 address = {Namur, Belgium} 37545} 37546 37547@Article{ toint:global, 37548 author = {Ph. L. Toint}, 37549 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 37550 in a {H}ilbert Space}, 37551 journal = {IMA Journal of Numerical Analysis}, 37552 year = {1988}, 37553 volume = {8}, 37554 pages = {231--252} 37555} 37556 37557@Article{ toint:non-monotone, 37558 author = {Ph. L. Toint}, 37559 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 37560 Convex Constraints}, 37561 year = {1997}, 37562 journal = {Mathematical Programming}, 37563 volume = {77}, 37564 pages = {69--94} 37565} 37566 37567@InCollection{ toint:transportation, 37568 author = {Ph. L. Toint}, 37569 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 37570 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 37571 Management}, 37572 publisher = {Springer-Verlag}, 37573 series = {NATO ASI Series F}, 37574 year = {1997}, 37575 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 37576} 37577 37578@Article{ tomlin.welch:finding, 37579 author = {J. Tomlin and J. Welch}, 37580 title = {Finding Duplicate Rows in a Linear Programming Model}, 37581 journal = {Operations Research Letters}, 37582 year = {1986}, 37583 volume = {5}, 37584 number = {1}, 37585 pages = {7--11} 37586} 37587 37588@Article{ torczon:convergence, 37589 author = {V. Torczon}, 37590 title = {On the Convergence of the Multidirectional Search Algorithm}, 37591 journal = {SIAM Journal on Optimization}, 37592 year = {1991}, 37593 volume = {1}, 37594 pages = {123--145} 37595} 37596 37597@Article{ torczon:convergence*1, 37598 author = {V. Torczon}, 37599 title = {On the Convergence of Pattern Search Algorithms}, 37600 journal = {SIAM Journal on Optimization}, 37601 year = {1997}, 37602 volume = {7}, 37603 pages = {1--25} 37604} 37605 37606@Misc{ torma.rutherford:general, 37607 author = {H. Torma and T. Rutherford}, 37608 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 37609 year = {1992}, 37610 howpublished = {Working Paper 15/1992}, 37611 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 37612} 37613 37614@Article{ trinkle.pang.ea:dynamic, 37615 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 37616 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 37617 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 37618 year = {1997}, 37619 pages = {267--279}, 37620 volume = {77} 37621} 37622 37623@InProceedings{ trinkle.pang:dynamic, 37624 author = {J. C. Trinkle and J. S. Pang}, 37625 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 37626 book = {{IEEE} International Conference on Robotics and Automation}, 37627 pages = {2276--2281}, 37628 year = {1997} 37629} 37630 37631@TechReport{ tseng.bertsekas:convergence, 37632 author = {P. Tseng and D. P. Bertsekas}, 37633 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 37634 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 37635 Technology}, 37636 year = {1990}, 37637 type = {technical report}, 37638 number = {LIDS-P-1995}, 37639 address = {Cambridge, MA} 37640} 37641 37642@Article{ tseng.yamashita.ea:equivalence, 37643 author = {P. Tseng and N. Yamashita and M. Fukushima}, 37644 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 37645 Approach}, 37646 year = {1996}, 37647 journal = {SIAM Journal on Optimization}, 37648 volume = {6}, 37649 pages = {446--460} 37650} 37651 37652@Article{ tseng:applications, 37653 author = {P. Tseng}, 37654 title = {Applications of a splitting algorithm to decomposition in convex programming and 37655 variational inequalities}, 37656 journal = {SIAM Journal on Control and Optimization}, 37657 year = {1991}, 37658 volume = {29}, 37659 pages = {119--138} 37660} 37661 37662@Article{ tseng:dual, 37663 author = {P. Tseng}, 37664 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 37665 Constraints: a Unified Approach}, 37666 journal = {SIAM Journal on Control and Optimization}, 37667 year = {1990}, 37668 volume = {28}, 37669 pages = {214--242} 37670} 37671 37672@Article{ tseng:dual*1, 37673 author = {P. Tseng}, 37674 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 37675 Unified Approach}, 37676 journal = {SIAM Journal on Control and Optimization}, 37677 year = {1990}, 37678 volume = {28}, 37679 pages = {214--242} 37680} 37681 37682@Article{ tseng:dual*2, 37683 author = {P. Tseng}, 37684 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 37685 journal = {Mathematical Programming}, 37686 year = {1993}, 37687 volume = {59}, 37688 pages = {231--248} 37689} 37690 37691@Article{ tseng:fortified-descent, 37692 author = {P. Tseng}, 37693 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 37694 journal = {SIAM Journal on Optimization}, 37695 volume = {10}, 37696 pages = {269--288}, 37697 year = {2000} 37698} 37699 37700@Article{ tseng:growth, 37701 author = {P. Tseng}, 37702 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 37703 Problem}, 37704 journal = {Journal of Optimization Theory and Applications}, 37705 volume = {89}, 37706 year = {1996}, 37707 pages = {17--37} 37708} 37709 37710@Unpublished{ tseng:matlab, 37711 author = {P. Tseng}, 37712 title = {Matlab Implementations of Complementarity Codes}, 37713 year = {1995}, 37714 note = {Private Communication} 37715} 37716 37717@Article{ ursescu:multifunctions, 37718 author = {C. Ursescu}, 37719 title = {Multifunctions with closed convex graph}, 37720 journal = {Czech. Math. J.}, 37721 year = {1975}, 37722 volume = {35}, 37723 pages = {438--441} 37724} 37725 37726@TechReport{ vaidya:algorithm, 37727 author = {P. M. Vaidya}, 37728 title = {An Algorithm for Linear Programming which Requires 37729 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 37730 institution = {AT\&T Bell Laboratories}, 37731 year = {1987}, 37732 address = {Murray Hill, New Jersey} 37733} 37734 37735@Article{ val:unloading, 37736 author = {P. Du Val}, 37737 title = {The Unloading Problem for Plane Curves}, 37738 journal = {American Journal of Mathematics}, 37739 year = {1940}, 37740 volume = {62}, 37741 pages = {307--311} 37742} 37743 37744@InCollection{ valentine:problem, 37745 author = {F. A. Valentine}, 37746 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 37747 Conditions}, 37748 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 37749 year = {1937}, 37750 publisher = {University of Chicago Press}, 37751 address = {Chicago}, 37752 pages = {407--448} 37753} 37754 37755@Article{ valle.poch.ea:comparison, 37756 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 37757 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 37758 Flow-Injection Systems}, 37759 journal = {Analytica Chimica Acta}, 37760 year = {1990}, 37761 volume = {241}, 37762 pages = {31--42} 37763} 37764 37765@Article{ vandenberghe.demoor.ea:generalized, 37766 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 37767 title = {The generalized linear complementarity problem applied to the complete analysis 37768 of resistive piecewise-linear circuits}, 37769 journal = {IEEE Transactions on Circuits and Systems}, 37770 volume = {36}, 37771 year = {1989}, 37772 pages = {1382--1391} 37773} 37774 37775@Article{ vanderbei.meketon.ea:modification, 37776 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 37777 title = {A Modification of {K}armarkar's Algorithm}, 37778 journal = {Algorithmica}, 37779 year = {1986}, 37780 volume = {1}, 37781 pages = {395--407} 37782} 37783 37784@Article{ vanderbei:affine-scaling, 37785 author = {R. J. Vanderbei}, 37786 title = {Affine--Scaling for Linear Programs with Free Variables}, 37787 journal = {Mathematical Programming}, 37788 year = {1989}, 37789 volume = {43}, 37790 pages = {31--44} 37791} 37792 37793@Article{ vanroy.wolsey:solving, 37794 author = {T. J. Van~Roy and L. A. Wolsey}, 37795 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 37796 journal = {Operations Research}, 37797 volume = {35}, 37798 pages = {45--57}, 37799 year = {1987} 37800} 37801 37802@Book{ vapnik:nature, 37803 author = {V. N. Vapnik}, 37804 title = {The Nature of Statistical Learning Theory}, 37805 publisher = {John Wiley \& Sons}, 37806 address = {New York}, 37807 year = {1996} 37808} 37809 37810@Book{ varian:microeconomic, 37811 author = {Hal R. Varian}, 37812 title = {Microeconomic Analysis}, 37813 year = {1978}, 37814 publisher = {W.W. Norton \& Company}, 37815 address = {New York, New York} 37816} 37817 37818@Article{ verhey:immobilizing, 37819 author = {L. J. Verhey}, 37820 title = {Immobilizing and Positioning Patients for Radiotherapy}, 37821 journal = {Seminars in Radiation Oncology}, 37822 year = {1995}, 37823 volume = {5}, 37824 number = {2}, 37825 pages = {100--113} 37826} 37827 37828@Article{ vinante.pintos:differentiable, 37829 author = {C. Vinante and S. Pintos}, 37830 title = {On Differentiable Exact Penalty Functions}, 37831 journal = {Journal of Optimization Theory and Applications}, 37832 year = {1986}, 37833 volume = {50}, 37834 pages = {479--493} 37835} 37836 37837@Article{ vlach:scheduling, 37838 author = {M. Vlach}, 37839 title = {On Scheduling with Earliness and Tardiness Penalties}, 37840 journal = {Methods of Operations Research}, 37841 year = {1983}, 37842 volume = {45}, 37843 pages = {367--375} 37844} 37845 37846@InCollection{ wacker:summary, 37847 author = {H.--J. Wacker}, 37848 title = {A Summary of the Developments on Imbedding Methods}, 37849 booktitle = {Continuation Methods}, 37850 year = {1978}, 37851 editor = {H.--J. Wacker}, 37852 publisher = {Academic Press}, 37853 address = {New York}, 37854 pages = {1--35} 37855} 37856 37857@Article{ wakefield.tin-loi:large, 37858 author = {R. R. Wakefield and F. Tin-Loi}, 37859 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 37860 Formulation}, 37861 journal = {Computer Methods in Applied Mechanics and Engineering}, 37862 volume = {84}, 37863 year = {1990}, 37864 pages = {229--242} 37865} 37866 37867@Article{ wakefield.tin-loi:large*1, 37868 author = {R. R. Wakefield and F. Tin-Loi}, 37869 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 37870 Approach}, 37871 journal = {International Journal Mechanical Science}, 37872 volume = {33}, 37873 year = {1991}, 37874 pages = {379--391} 37875} 37876 37877@Article{ walker:implementation, 37878 author = {H. F. Walker}, 37879 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 37880 journal = {SIAM Journal on Scientific Computing}, 37881 volume = {9}, 37882 year = {1988}, 37883 pages = {152--163} 37884} 37885 37886@Book{ wall.schwartz:programming, 37887 author = {L. Wall and R. L. Schwartz}, 37888 title = {Programming Perl}, 37889 publisher = {O'Reilly and Associates, Inc.}, 37890 address = {Sebastopol, CA}, 37891 year = {1991} 37892} 37893 37894@Book{ walras:elements, 37895 author = {L. Walras}, 37896 title = {Elements of Pure Economics}, 37897 publisher = {Allen and Unwin}, 37898 year = {1954}, 37899 address = {London} 37900} 37901 37902@Article{ wang.monteiro.ea:interior, 37903 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 37904 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 37905 journal = {Mathematical Programming}, 37906 volume = {74}, 37907 pages = {159--196}, 37908 year = {1996} 37909} 37910 37911@Article{ wardi:stochastic, 37912 author = {Y. Wardi}, 37913 title = {A Stochastic Steepest-Descent Algorithm}, 37914 journal = {Journal of Optimization Theory and Applications}, 37915 year = {1988}, 37916 volume = {59}, 37917 pages = {307--323} 37918} 37919 37920@Article{ wardi:stochastic*1, 37921 author = {Y. Wardi}, 37922 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 37923 journal = {Journal of Optimization Theory and Applications}, 37924 year = {1990}, 37925 volume = {64}, 37926 pages = {399--417} 37927} 37928 37929@Article{ wardrop:theoretical, 37930 author = {J. G. Wardrop}, 37931 title = {Some Theoretical Aspects of Road Traffic Research}, 37932 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 37933 year = {1952}, 37934 pages = {325--378} 37935} 37936 37937@Article{ warga:minimizing, 37938 author = {J. Warga}, 37939 title = {Minimizing certain convex functions}, 37940 journal = {Journal of SIAM on Applied Mathematics}, 37941 year = {1963}, 37942 volume = {11}, 37943 pages = {588--593} 37944} 37945 37946@Article{ watson.billups.ea:hompack, 37947 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 37948 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 37949 Algorithms}, 37950 journal = {{ACM} Transactions on Mathematical Software}, 37951 year = {1987}, 37952 volume = {13}, 37953 pages = {281--310} 37954} 37955 37956@Article{ watson.billups.ea:slow, 37957 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 37958 title = {Slow Viscous Flow in a Syringe}, 37959 journal = {Journal of Biomechanical Engineering}, 37960 year = {1986}, 37961 volume = {108}, 37962 pages = {317--323} 37963} 37964 37965@Article{ watson:discrete, 37966 author = {G. A. Watson}, 37967 title = {Discrete $\ell_1$ approximation by rational functions}, 37968 journal = {IMA Journal of Numerical Analysis}, 37969 year = {1984}, 37970 volume = {4}, 37971 pages = {275--288} 37972} 37973 37974@Article{ watson:solving, 37975 author = {L. T. Watson}, 37976 title = {Solving the nonlinear complementarity problem by a homotopy method}, 37977 journal = {SIAM Journal on Control and Optimization}, 37978 year = {1979}, 37979 volume = {17}, 37980 pages = {36--46} 37981} 37982 37983@Article{ webb:optimum, 37984 author = {S. Webb}, 37985 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 37986 Heterogeneity}, 37987 journal = {Physics in Medicine and Biology}, 37988 year = {1994}, 37989 volume = {39}, 37990 pages = {1895--1914} 37991} 37992 37993@Book{ webb:physics, 37994 author = {S. Webb}, 37995 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 37996 publisher = {Institute of Physics Publishing Ltd.}, 37997 year = {1997}, 37998 optaddress = {Philadelphia} 37999} 38000 38001@InBook{ webb:theory, 38002 author = {S. Webb}, 38003 editor = {E. Sternick}, 38004 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 38005 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 38006 publisher = {Advanced Medical Publishing}, 38007 year = {1997} 38008} 38009 38010@Book{ weiss.kulikowski:computer, 38011 author = {S. M. Weiss and C. A. Kulikowski}, 38012 title = {Computer Systems that Learn}, 38013 year = {1991}, 38014 publisher = {Morgan Kaufmann Publishers, Inc}, 38015 address = {San Mateo, California} 38016} 38017 38018@PhDThesis{ werbos:beyond, 38019 author = {P. J. Werbos}, 38020 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 38021 Sciences}, 38022 year = {1974}, 38023 school = {Harvard University} 38024} 38025 38026@InCollection{ wets:convergence, 38027 author = {R. J.-B. Wets}, 38028 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 38029 Problems}, 38030 booktitle = {Variational Inequalites and Complementarity Problems}, 38031 year = {1980}, 38032 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 38033 publisher = {John Wiley \& Sons}, 38034 address = {New York}, 38035 pages = {375--403} 38036} 38037 38038@InCollection{ wets:large, 38039 author = {R. J.-B. Wets}, 38040 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 38041 booktitle = {Numerical Techniques for Stochastic Optimization}, 38042 publisher = {Springer-Verlag}, 38043 year = {1988}, 38044 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 38045 address = {Berlin}, 38046 pages = {65--93} 38047} 38048 38049@Article{ white:asymptotic, 38050 author = {H. White}, 38051 title = {Some asymptotic results for learning in single hidden-layer feedforward network 38052 models}, 38053 journal = {Journal of the American Stattistical Association}, 38054 year = {1989}, 38055 volume = {84}, 38056 number = {408}, 38057 pages = {1003--1013} 38058} 38059 38060@Article{ white:learning, 38061 author = {H. White}, 38062 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 38063 journal = {Neural Computation}, 38064 year = {1989}, 38065 volume = {1}, 38066 pages = {425--461} 38067} 38068 38069@InProceedings{ whitley.starkweather.ea:scheduling, 38070 crossref = {schaeffer:third}, 38071 author = {D. Whitley and T. Starkweather and D. Fuquay}, 38072 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 38073 Operator}, 38074 pages = {133--140} 38075} 38076 38077@Book{ williams:model, 38078 author = {H. P. Williams}, 38079 title = {Model Building in Mathematical Programming}, 38080 publisher = {John Wiley \& Sons}, 38081 year = {1990}, 38082 edition = {Third} 38083} 38084 38085@Book{ wilmott.dewynne.ea:option, 38086 author = {P. Wilmott and J. Dewynne and S. Howison}, 38087 title = {Option Pricing}, 38088 publisher = {Oxford Financial Press}, 38089 year = {1993}, 38090 address = {Oxford, England} 38091} 38092 38093@PhDThesis{ wilson:simplicial, 38094 author = {R. B. Wilson}, 38095 title = {A Simplicial Algorithm for Concave Programming}, 38096 year = {1963}, 38097 address = {Boston, MA}, 38098 school = {Graduate School of Business Administration, Harvard University} 38099} 38100 38101@TechReport{ wolberg.bennett.ea:breast, 38102 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 38103 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 38104 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 38105 Wisconsin}, 38106 year = {1992}, 38107 address = {Madison, WI 53706}, 38108 type = {Manuscript} 38109} 38110 38111@Article{ wolberg.mangasarian:multisurface, 38112 author = {W. H. Wolberg and O. L. Mangasarian}, 38113 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 38114 Cytology}, 38115 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 38116 year = {1990}, 38117 volume = {87}, 38118 pages = {9193--9196} 38119} 38120 38121@Unpublished{ wolberg.mangasarian:wbcd, 38122 author = {W. H. Wolberg and O. L. Mangasarian}, 38123 title = {{WBCD: Wisconsin Breast Cancer Database}}, 38124 year = {1991}, 38125 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 38126 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 38127} 38128 38129@Article{ wolberg.street.ea:breast, 38130 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38131 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 38132 journal = {Analytical and Quantitative Cytology and Histology}, 38133 year = {1993}, 38134 volume = {15}, 38135 number = {6}, 38136 pages = {396--404} 38137} 38138 38139@Unpublished{ wolberg.street.ea:wdbc, 38140 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38141 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 38142 year = {1995}, 38143 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38144 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 38145} 38146 38147@Unpublished{ wolberg.street.ea:wpbc, 38148 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38149 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 38150 year = {1995}, 38151 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38152 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 38153} 38154 38155@Book{ wolsey:integer, 38156 author = {L. A. Wolsey}, 38157 title = {Integer Programming}, 38158 publisher = {John Wiley \& Sons}, 38159 year = {1998}, 38160 address = {New York, NY} 38161} 38162 38163@Article{ womersley:local, 38164 author = {R. S. Womersley}, 38165 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 38166 journal = {Mathematical Programming}, 38167 year = {1985}, 38168 volume = {32}, 38169 pages = {69--89} 38170} 38171 38172@Article{ woo.sanders.ea:peacock, 38173 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 38174 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 38175 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38176 year = {1994}, 38177 volume = {29}, 38178 number = {1}, 38179 pages = {213--214} 38180} 38181 38182@Article{ wright.ralph:superlinear, 38183 author = {S. J. Wright and D. Ralph}, 38184 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 38185 Problems}, 38186 year = {1996}, 38187 journal = {Mathematics of Operations Research}, 38188 volume = {21}, 38189 pages = {815--838} 38190} 38191 38192@TechReport{ wright.zhang:superquadratic, 38193 author = {S. J. Wright and Y. Zhang}, 38194 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 38195 problems}, 38196 institution = {Argonne National Laboratory}, 38197 year = {1994}, 38198 annote = {revised}, 38199 number = {MCS--P418--0294}, 38200 address = {Argonne, Illinois}, 38201 type = {Preprint} 38202} 38203 38204@TechReport{ wright:dynfgm, 38205 author = {S. E. Wright}, 38206 title = {{DYNFGM}: Dynamic Finite Generation Method}, 38207 institution = {Department of Mathematics, University of Washington}, 38208 year = {1989}, 38209 address = {Seattle, Washington} 38210} 38211 38212@Article{ wright:infeasible-interior-point, 38213 author = {S. J. Wright}, 38214 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 38215 journal = {Mathematical Programming}, 38216 volume = {67}, 38217 pages = {29--51}, 38218 year = {1994} 38219} 38220 38221@Article{ wright:path-following, 38222 author = {S. J. Wright}, 38223 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 38224 Complementarity Problems}, 38225 journal = {Optimization Methods and Software}, 38226 year = {1993}, 38227 volume = {2}, 38228 pages = {79--106} 38229} 38230 38231@TechReport{ wright:path-following*1, 38232 author = {S. J. Wright}, 38233 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 38234 Problems}, 38235 institution = {Argonne National Laboratory}, 38236 year = {1993}, 38237 number = {MCS--P401--1293}, 38238 address = {Argonne, Illinois} 38239} 38240 38241@Book{ wright:primal-dual, 38242 author = {S. J. Wright}, 38243 title = {Primal--Dual Interior--Point Methods}, 38244 year = {1997}, 38245 publisher = {SIAM}, 38246 address = {Philadelphia, Pennsylvania} 38247} 38248 38249@TechReport{ wright:reduced, 38250 author = {S. J. Wright}, 38251 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 38252 institution = {Argonne National Laboratory}, 38253 year = {2000}, 38254 number = {MCS--P808--0400}, 38255 address = {Argonne, Illinois} 38256} 38257 38258@Article{ wright:solution, 38259 author = {S. J. Wright}, 38260 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 38261 journal = {Parallel Computing}, 38262 year = {1990}, 38263 volume = {16}, 38264 pages = {221--238} 38265} 38266 38267@Article{ wu.bourland:morphology, 38268 author = {Q. J. Wu and J. D. Bourland}, 38269 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 38270 isocenters}, 38271 journal = {Medical Physics}, 38272 year = {1999}, 38273 volume = {26}, 38274 number = {10}, 38275 pages = {2151--2160} 38276} 38277 38278@Misc{ wunderling:soplex, 38279 author = {R. Wunderling}, 38280 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 38281 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 38282} 38283 38284@Article{ xiao.harker:nonsmooth, 38285 author = {B. Xiao and P. T. Harker}, 38286 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 38287 journal = {Mathematical Programming}, 38288 year = {1994}, 38289 volume = {65}, 38290 pages = {151--194} 38291} 38292 38293@Article{ xiao.harker:nonsmooth*1, 38294 author = {B. Xiao and P. T. Harker}, 38295 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 38296 Results}, 38297 journal = {Mathematical Programming}, 38298 year = {1994}, 38299 volume = {65}, 38300 pages = {195--216} 38301} 38302 38303@Article{ xiao.zhou:nonmonotone, 38304 author = {Y. Xiao and F. J. Zhou}, 38305 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 38306 Minimization}, 38307 journal = {Computing}, 38308 year = {1992}, 38309 volume = {48}, 38310 pages = {303--317} 38311} 38312 38313@TechReport{ xiao:global, 38314 author = {B. Xiao}, 38315 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 38316 {B}-differentiable equation approach}, 38317 type = {{Ph.D. Thesis}}, 38318 year = {1990}, 38319 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 38320 address = {Philadelphia, PA} 38321} 38322 38323@Article{ xu.burke:polynomial, 38324 author = {S. Xu and J. V. Burke}, 38325 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 38326 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 38327 year = {1999}, 38328 journal = {Mathematical Programming}, 38329 volume = {86}, 38330 pages = {91--104} 38331} 38332 38333@TechReport{ xu:global, 38334 author = {S. Xu}, 38335 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 38336 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 38337 institution = {Department of Mathematics, University of Washington}, 38338 year = {1996}, 38339 type = {Technical Report}, 38340 address = {Seattle, WA} 38341} 38342 38343@Article{ yajima.konno:efficient, 38344 author = {Y. Yajima and H. Konno}, 38345 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 38346 Problems}, 38347 journal = {Journal of Global Optimization}, 38348 year = {1991}, 38349 volume = {1:1}, 38350 pages = {155--171} 38351} 38352 38353@Article{ yamamoto:path-following, 38354 author = {Y. Yamamoto}, 38355 title = {A Path--Following Algorithm for Stationary Point Problems}, 38356 journal = {Journal of Operations Society of Japan}, 38357 year = {1987}, 38358 volume = {30}, 38359 pages = {181--198} 38360} 38361 38362@Article{ yamashita.fukushima:modified, 38363 author = {N. Yamashita and M. Fukushima}, 38364 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 38365 Complementarity Problems}, 38366 journal = {Mathematical Programming}, 38367 year = {1997}, 38368 volume = {76}, 38369 pages = {469--492} 38370} 38371 38372@Article{ yamashita.fukushima:stationary, 38373 author = {N. Yamashita and M. Fukushima}, 38374 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 38375 Problems}, 38376 journal = {Journal of Optimization Theory and Applications}, 38377 volume = {84}, 38378 pages = {653--663}, 38379 year = {1995} 38380} 38381 38382@Article{ yamashita.taji.ea:unconstrained, 38383 author = {N. Yamashita and K. Taji and M. Fukushima}, 38384 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 38385 journal = {Journal of Optimization Theory and Applications}, 38386 year = {1997}, 38387 volume = {92}, 38388 pages = {439--456} 38389} 38390 38391@TechReport{ yamashita:properties, 38392 author = {N. Yamashita}, 38393 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 38394 Complementarity Problem}, 38395 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 38396 year = {1996}, 38397 type = {Technical Report}, 38398 address = {Kyoto, Japan} 38399} 38400 38401@Article{ yang.mackie.ea:investigation, 38402 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 38403 Thomadsen}, 38404 title = {An investigation of tomotherapy beam delivery}, 38405 journal = {Medical Physics}, 38406 year = {1997}, 38407 volume = {24}, 38408 number = {3}, 38409 pages = {425--436} 38410} 38411 38412@Article{ yan.shu.ea:clinical, 38413 author = {Y. Yan and H. Shu and X. Bao}, 38414 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 38415 Treatmen System}, 38416 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38417 year = {1997}, 38418 volume = {39}, 38419 pages = {247--254} 38420} 38421 38422@Article{ yau.gao:obstacle, 38423 author = {S. T. Yau and Y. Gao}, 38424 title = {Obstacle problem for von {K}arm\'an equations}, 38425 journal = {Advances in Applied Mathematics}, 38426 volume = {13}, 38427 year = {1992}, 38428 pages = {123--141} 38429} 38430 38431@Article{ ye.tse:extension, 38432 author = {Y. Ye and E. Tse}, 38433 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 38434 Programming}, 38435 journal = {Mathematical Programming}, 38436 year = {1989}, 38437 volume = {44} 38438} 38439 38440@Article{ ye:affine, 38441 author = {Y. Ye}, 38442 title = {On affine scaling algorithms for nonconvex quadratic programming}, 38443 journal = {Mathematical Programming}, 38444 year = {1992}, 38445 volume = {56}, 38446 pages = {285--300} 38447} 38448 38449@PhDThesis{ ye:interior, 38450 author = {Y. Ye}, 38451 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 38452 Programming}, 38453 year = {1987}, 38454 address = {Stanford, California}, 38455 school = {Department of Engineering--Economic Systems, Stanford University} 38456} 38457 38458@Book{ ye:interior*1, 38459 author = {Y. Ye}, 38460 title = {Interior-Point Algorithms: Theory and Analysis}, 38461 publisher = {John Wiley \& Sons}, 38462 year = {1997}, 38463 address = {New York, NY} 38464} 38465 38466@Article{ yu:convergence, 38467 author = {W. --C. Yu}, 38468 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 38469 journal = {Scientia Sinica, Special issue of Mathematics}, 38470 year = {1979}, 38471 volume = {1}, 38472 pages = {68--77} 38473} 38474 38475@Article{ yu.schell:genetic, 38476 author = {Y. Yu and M. C. Schell}, 38477 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 38478 journal = {Medical Physics}, 38479 year = {1996}, 38480 volume = {23}, 38481 pages = {2085--2091} 38482} 38483 38484@Article{ yuan:superlinear, 38485 author = {Y. Yuan}, 38486 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 38487 Optimization}, 38488 journal = {Mathematical Programming}, 38489 year = {1985}, 38490 volume = {31}, 38491 pages = {269--285} 38492} 38493 38494@Book{ zangwill:nonlinear, 38495 author = {W. I. Zangwill}, 38496 title = {Nonlinear Programming: {A} Unified Approach}, 38497 year = {1969}, 38498 publisher = {Prentice-Hall, Inc}, 38499 address = {Englewood Cliffs, New Jersey} 38500} 38501 38502@TechReport{ zangwill:nonlinear*1, 38503 author = {W. I. Zangwill}, 38504 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 38505 institution = {Center for Research in Management Science, University of California}, 38506 year = {1965}, 38507 address = {Berkeley}, 38508 number = {131}, 38509 type = {Working Paper} 38510} 38511 38512@Article{ zangwill:nonlinear*2, 38513 author = {W. I. Zangwill}, 38514 title = {Nonlinear Programming via Penalty Functions}, 38515 journal = {Management Science}, 38516 year = {1967}, 38517 volume = {13}, 38518 pages = {344--358} 38519} 38520 38521@TechReport{ zenios.censor:massively, 38522 author = {S. A. Zenios and Y. Censor}, 38523 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 38524 Problems}, 38525 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 38526 year = {1990}, 38527 type = {report}, 38528 number = {89-09-10}, 38529 address = {Philadelphia, PA} 38530} 38531 38532@Article{ zenios.lasken:nonlinear, 38533 author = {S. A. Zenios and R. A. Lasken}, 38534 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 38535 journal = {Annals of Operations Research}, 38536 year = {1988}, 38537 volume = {14}, 38538 pages = {147--163} 38539} 38540 38541@Article{ zenios.mulvey:distributed, 38542 author = {S. A. Zenios and J. M. Mulvey}, 38543 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 38544 journal = {Parallel Computing}, 38545 year = {1988}, 38546 volume = {6}, 38547 pages = {43--56} 38548} 38549 38550@TechReport{ zenios.neilsen:massively, 38551 author = {S. A. Zenios and S. Neilsen}, 38552 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 38553 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38554 year = {1990}, 38555 type = {report}, 38556 number = {90-03-01}, 38557 address = {Philadelphia, PA} 38558} 38559 38560@TechReport{ zenios.qi.ea:comparative, 38561 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 38562 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 38563 Nonlinear Network Optimization}, 38564 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38565 year = {1990}, 38566 type = {report}, 38567 number = {89-10-02}, 38568 address = {Philadelphia, PA} 38569} 38570 38571@Article{ zhang.kim.ea:improved, 38572 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 38573 title = {An Improved Successive Linear Programming Algorithm}, 38574 year = {1985}, 38575 journal = {Management Science}, 38576 volume = {31}, 38577 pages = {1312--1331} 38578} 38579 38580@Article{ zhang.tapia.ea:superlinear, 38581 author = {Y. Zhang and R. A. Tapia and F. Potra}, 38582 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 38583 of problems}, 38584 journal = {SIAM Journal on Optimization}, 38585 year = {1993}, 38586 volume = {3}, 38587 number = {?}, 38588 pages = {413--422}, 38589} 38590 38591@Article{ zhang.tapia:superlinearly, 38592 author = {Y. Zhang and R. A. Tapia}, 38593 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 38594 linear programming}, 38595 journal = {SIAM Journal on Optimization}, 38596 year = {1993}, 38597 volume = {3}, 38598 pages = {118--133} 38599} 38600 38601@TechReport{ zhang.zhang:superlinear, 38602 author = {Y. Zhang and D. Zhang}, 38603 title = {Superlinear convergence of infeasible interior-point methods for linear 38604 programming}, 38605 institution = {Department of Mathematics and Statistics, University of Maryland}, 38606 year = {1992}, 38607 number = {92-15}, 38608 address = {Baltimore County, Maryland} 38609} 38610 38611@Article{ zhang:convergence, 38612 author = {Yin Zhang}, 38613 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 38614 Horizontal Linear Complementarity Problem}, 38615 journal = {SIAM Journal on Optimization}, 38616 year = {1994}, 38617 volume = {4}, 38618 pages = {208--227} 38619} 38620 38621@Article{ zhang:convergence*1, 38622 author = {Y. Zhang}, 38623 title = {On the convergence of a class of infeasible interior-point methods for the 38624 horizontal linear complementarity problem}, 38625 journal = {SIAM Journal on Optimization}, 38626 year = {1994}, 38627 volume = {4}, 38628 pages = {208--227} 38629} 38630 38631@Article{ zhu.rockafellar:primal-dual, 38632 author = {C. Y. Zhu and R. T. Rockafellar}, 38633 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 38634 Programming}, 38635 journal = {SIAM Journal on Optimization}, 38636 year = {1993}, 38637 volume = {3}, 38638 pages = {751--783} 38639} 38640 38641@Article{ zhu:modified, 38642 author = {C. Y. Zhu}, 38643 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 38644 journal = {Computational Optimization and Applications}, 38645 year = {1992}, 38646 volume = {2}, 38647 pages = {182--205} 38648} 38649 38650@Article{ zhu:primal-dual, 38651 author = {C. Y. Zhu}, 38652 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 38653 Programming}, 38654 journal = {SIAM Journal on Optimization}, 38655 year = {1995}, 38656 volume = {5}, 38657 pages = {114--128} 38658} 38659 38660@Book{ zoutendijk:methods, 38661 author = {G. Zoutendijk}, 38662 title = {Methods of Feasible Directions}, 38663 year = {1960}, 38664 publisher = {Elsevier Publishing Company}, 38665 address = {Amsterdam} 38666} 38667 38668@Article{ zowe.kurcyusz:regularity, 38669 author = {J. Zowe and S. Kurcyusz}, 38670 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 38671 journal = {Applied Mathematics and Optimization}, 38672 year = {1979}, 38673 volume = {5}, 38674 pages = {49--62} 38675} 38676 38677@InProceedings{ zowe:nondifferentiable, 38678 author = {J. Zowe}, 38679 title = {Nondifferentiable Optimization}, 38680 booktitle = {Computational Mathematical Programming}, 38681 year = {1985}, 38682 editor = {K. Schittkowski}, 38683 publisher = {Springer-Verlag}, 38684 address = {Berlin} 38685} 38686 38687@Proceedings{ bachem.grotschel.ea:mathematical, 38688 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 38689 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 38690 year = {1983}, 38691 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 38692 publisher = {Springer Verlag}, 38693 address = {Berlin} 38694} 38695 38696@Proceedings{ belew.booker:fourth, 38697 year = {1991}, 38698 editor = {R. K. Belew and L. B. Booker}, 38699 publisher = {Morgan Kaufmann Publishers, Inc}, 38700 address = {San Mateo, California}, 38701 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 38702} 38703 38704@Proceedings{ coleman.li:large-scale, 38705 year = {1990}, 38706 editor = {T. F. Coleman and Y. Li}, 38707 publisher = {SIAM}, 38708 address = {Philadelphia, Pennsylvania}, 38709 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 38710 University, Ithaca, New York, October 19-20, 1989}, 38711 booktitle = {Large-Scale Numerical Optimization} 38712} 38713 38714@Book{ davis:genetic, 38715 title = {Genetic Algorithms and Simulated Annealing}, 38716 year = {1987}, 38717 editor = {L. D. Davis}, 38718 publisher = {Pitman}, 38719 address = {London}, 38720 booktitle = {Genetic Algorithms and Simulated Annealing} 38721} 38722 38723@Proceedings{ ferris.pang:complementarity, 38724 title = {Complementarity and Variational Problems: State of the Art}, 38725 booktitle = {Complementarity and Variational Problems: State of the Art}, 38726 year = {1997}, 38727 key = {57}, 38728 editor = {M. C. Ferris and J. S. Pang}, 38729 publisher = {SIAM Publications}, 38730 address = {Philadelphia, Pennsylvania} 38731} 38732 38733@Proceedings{ ferris.mangasarian.ea:complementarity, 38734 title = {Complementarity: Applications, Algorithms and Extensions}, 38735 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 38736 year = {2001}, 38737 key = {95}, 38738 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 38739 publisher = {Kluwer Academic Publishers}, 38740 address = {Dordrecht, The Netherlands} 38741} 38742 38743@Proceedings{ florian:traffic, 38744 title = {Traffic Equilibrium Methods}, 38745 year = {1976}, 38746 editor = {M. Florian}, 38747 publisher = {Springer-Verlag}, 38748 address = {Berlin} 38749} 38750 38751@Proceedings{ grefenstette:genetic, 38752 title = {Genetic Algorithms and their Applications: Proceedings of the Second 38753 International Conference on Genetic Algorithms}, 38754 year = {1987}, 38755 editor = {J. J. Grefenstette}, 38756 publisher = {Lawrence Erlbaum Associates}, 38757 address = {Hillsdale, New Jersey}, 38758 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 38759 International Conference on Genetic Algorithms} 38760} 38761 38762@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 38763 booktitle = {Nonlinear Programming}, 38764 volume = {2}, 38765 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38766 publisher = {Academic Press}, 38767 address = {New York}, 38768 year = {1975} 38769} 38770 38771@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 38772 booktitle = {Nonlinear Programming}, 38773 volume = {3}, 38774 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38775 publisher = {Academic Press}, 38776 address = {London}, 38777 year = {1978} 38778} 38779 38780@Proceedings{ robinson:local, 38781 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 38782 Regularity}, 38783 year = {1983}, 38784 editor = {V. Pereyra and A. Reinoza}, 38785 publisher = {Springer-Verlag}, 38786 address = {Berlin}, 38787 author = {S. M. Robinson}, 38788 pages = {240--251}, 38789 series = {Numerical Methods: Proceedings, Caracas 1982} 38790} 38791 38792@Proceedings{ schaeffer:third, 38793 year = {1989}, 38794 editor = {J. D. Schaeffer}, 38795 publisher = {Morgan Kaufmann Publishers, Inc}, 38796 address = {San Mateo, California}, 38797 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 38798} 38799 38800@Book{ vanderbei:linear, 38801 author = {R. J. Vanderbei}, 38802 title = {Linear Programming: Foundations and Extensions}, 38803 year = {1997}, 38804 publisher = {Kluwer Academic Publishers}, 38805 address = {Boston, Massachusetts} 38806} 38807 38808@Book{ dfobook, 38809 title = {Introduction to Derivative-Free Optimization}, 38810 publisher = {Society for Industrial and Applied Mathematics}, 38811 year = {2009}, 38812 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 38813 series = {MPS/SIAM Series on Optimization}, 38814 address = {Philadelphia, PA, USA}, 38815 isbn = {0-89871-460-5} 38816} 38817 38818@Article{ unedf0, 38819 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 38820 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 38821 title = {Nuclear Energy Density Optimization}, 38822 journal = {Physical Review C}, 38823 year = {2010}, 38824 volume = {82}, 38825 number = {2}, 38826 pages = {024313}, 38827 doi = {10.1103/PhysRevC.82.024313} 38828} 38829 38830@Article{ hestenes1969multiplier, 38831 title = {Multiplier and gradient methods}, 38832 author = {Hestenes, Magnus R}, 38833 journal = {Journal of optimization theory and applications}, 38834 volume = {4}, 38835 number = {5}, 38836 pages = {303--320}, 38837 year = {1969}, 38838 publisher = {Springer} 38839} 38840 38841@Article{ powell1969method, 38842 title = {A method for nonlinear constraints in minimization problems}, 38843 author = {Powell, Michael JD}, 38844 journal = {Optimization}, 38845 pages = {283--298}, 38846 year = {1969}, 38847 publisher = {Academic Press} 38848} 38849 38850@Book{ nocedal2006numerical, 38851 title = {Numerical optimization}, 38852 author = {Jorge Nocedal and Stephen Wright}, 38853 year = {2006}, 38854 publisher = {Springer Science \& Business Media} 38855} 38856 38857@Article{ rockafellar1974augmented, 38858 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 38859 author = {Rockafellar, R Tyrrell}, 38860 journal = {SIAM Journal on Control}, 38861 volume = {12}, 38862 number = {2}, 38863 pages = {268--285}, 38864 year = {1974}, 38865 publisher = {SIAM} 38866} 38867 38868@Article{ bacuta2006, 38869 title = {A unified approach for Uzawa algorithms}, 38870 author = {Constantin Bacuta}, 38871 journal = {SIAM Journal on Numerical Analysis}, 38872 volume = {44}, 38873 number = {6}, 38874 pages = {2633--2649}, 38875 year = {2006} 38876} 38877 38878@Article{ manteuffelrugesouthworth2018, 38879 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 38880 (AIR)}, 38881 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 38882 journal = {SIAM Journal on Scientific Computing}, 38883 volume = {40}, 38884 number = {6}, 38885 pages = {A4105--A4130}, 38886 year = {2018} 38887} 38888 38889@Article{ manteuffelmunzenmaierrugesouthworth2019, 38890 title = {Nonsymmetric reduction-based algebraic multigrid}, 38891 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 38892 journal = {SIAM Journal on Scientific Computing}, 38893 volume = {41}, 38894 number = {5}, 38895 pages = {S242--S268}, 38896 year = {2019} 38897} 38898 38899@PhDThesis{ sivas2021, 38900 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 38901 author = {Abdullah Ali Sivas}, 38902 department = {Applied Mathematics}, 38903 institution = {University of Waterloo}, 38904 year = {2021} 38905} 38906 38907@Article{ brookshughes1982, 38908 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 38909 with particular emphasis on the incompressible {Navier-Stokes} equations}, 38910 author = {Alexander N Brooks and Thomas JR Hughes}, 38911 journal = {Computer methods in applied mechanics and engineering}, 38912 volume = {32}, 38913 number = {1-3}, 38914 pages = {199--259}, 38915 year = {1982}, 38916 publisher = {Elsevier} 38917} 38918 38919@InProceedings{ suhisaac2020, 38920 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 38921 author = {Hansol Suh and Tobin Isaac}, 38922 booktitle = {SC20: International Conference for High Performance Computing, Networking, 38923 Storage and Analysis}, 38924 pages = {1--12}, 38925 year = {2020}, 38926 organization = {IEEE} 38927} 38928 38929@Misc{ alauzet2010, 38930 title = {Metric-Based Anisotropic Mesh Adaptation}, 38931 author = {Fr\'{e}d\'{e}ric Alauzet}, 38932 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 38933 year = {2010} 38934} 38935 38936@Article{ chan1994qmrcgs, 38937 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 38938 systems}, 38939 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 38940 and Tong, Charles H}, 38941 journal = {SIAM Journal on Scientific Computing}, 38942 volume = {15}, 38943 number = {2}, 38944 pages = {338--347}, 38945 year = {1994}, 38946 publisher = {SIAM} 38947} 38948 38949@Article{ ghai2019comparison, 38950 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 38951 nonsymmetric linear systems}, 38952 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 38953 journal = {Numerical Linear Algebra with Applications}, 38954 volume = {26}, 38955 number = {1}, 38956 pages = {e2215}, 38957 year = {2019}, 38958 publisher = {Wiley Online Library} 38959} 38960 38961@Article{ mishrasalacknepley2022, 38962 title = {On the order of accuracy for finite difference approximations of partial 38963 differential equations using stencil composition}, 38964 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 38965 journal = {International Journal on Numerical Methods in Engineering}, 38966 note = {Submitted}, 38967 year = {2022} 38968} 38969 38970@Article{ nathawaniknepley2022, 38971 title = {Droplet formation simulation using mixed finite elements}, 38972 author = {Darsh K. Nathawani and Matthew G. Knepley}, 38973 journal = {Physics of Fluids}, 38974 volume = {34}, 38975 pages = {064105}, 38976 doi = {10.1063/5.0089752}, 38977 year = {2022} 38978} 38979 38980@InProceedings{ nathawaniknepley2022b, 38981 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 38982 author = {Darsh K. Nathawani and Matthew G. Knepley}, 38983 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 38984 (ICCFD11)}, 38985 editor = {Christoph Brehm and Shishir Pandya}, 38986 number = {4103}, 38987 year = {2022} 38988} 38989 38990@Article{ nathawaniknepley2023, 38991 title = {One-dimensional model to simulate shear-induced droplet formation}, 38992 author = {Darsh K. Nathawani and Matthew G. Knepley}, 38993 journal = {International Journal of Multiphase Flow}, 38994 note = {Submitted}, 38995 year = {2023} 38996} 38997 38998@InProceedings{ georgalisnathawaniknepleypatra2023, 38999 title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, 39000 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 39001 Patra}, 39002 booktitle = {AIAA SciTech 2024}, 39003 note = {Accepted}, 39004 year = {2023} 39005} 39006 39007@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 39008 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 39009 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 39010 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 39011 Thompson and Junchao Zhang}, 39012 doi = {10.48550/ARXIV.2204.01722}, 39013 url = {https://arxiv.org/abs/2204.01722}, 39014 publisher = {arXiv}, 39015 note = {Submitted}, 39016 year = {2022} 39017} 39018 39019@InCollection{ mayknepley2023, 39020 title = {Numerical Modeling of Subduction}, 39021 author = {Dave A. May and Matthew G. Knepley}, 39022 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 39023 editor = {João C. Duarte}, 39024 pages = {539-571}, 39025 isbn = {978-0-323-85733-8}, 39026 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 39027 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 39028 year = {2023} 39029} 39030 39031@Article{ adamsknepley2023, 39032 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 39033 plasmas in {PETSc}}, 39034 author = {Mark F. Adams and Matthew G. Knepley}, 39035 url = {https://arxiv.org/abs/2302.10242}, 39036 note = {In preparation}, 39037 year = {2023}, 39038 petsc_uses = {DMPlex} 39039} 39040 39041@Article{ finnknepleypusztayadams2023, 39042 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 39043 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 39044 url = {https://arxiv.org/abs/2303.12620}, 39045 journal = {Communications in Applied Mathematics and Computational Science}, 39046 volume = {18}, 39047 number = {1}, 39048 pages = {135--152}, 39049 doi = {10.2140/camcos.2023.18.135}, 39050 year = {2023} 39051} 39052 39053@Article{ eggersdupont1994, 39054 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 39055 equation}, 39056 author = {Jens Eggers and Todd F. Dupont}, 39057 journal = {Journal of fluid mechanics}, 39058 volume = {262}, 39059 pages = {205--221}, 39060 year = {1994}, 39061 publisher = {Cambridge University Press} 39062} 39063 39064@PhDThesis{ pusztaythesis2023, 39065 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 39066 author = {Joseph V. Pusztay}, 39067 type = {{PhD} thesis}, 39068 school = {University at Buffalo, Department of Computer Science and Engineering}, 39069 address = {Buffalo, NY}, 39070 month = may, 39071 year = {2022} 39072} 39073 39074@PhDThesis{ finnthesis2023, 39075 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 39076 System}, 39077 author = {Daniel S. Finn}, 39078 type = {{PhD} thesis}, 39079 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39080 Engineering}, 39081 address = {Buffalo, NY}, 39082 month = may, 39083 year = {2023} 39084} 39085 39086@PhDThesis{ nathawanithesis2023, 39087 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 39088 author = {Darsh Kiritbhai Nathawani}, 39089 type = {{PhD} thesis}, 39090 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39091 Engineering}, 39092 address = {Buffalo, NY}, 39093 month = may, 39094 year = {2023} 39095} 39096 39097@article{MckayEriksonKozdon2019, 39098 title = {A computational method for earthquake cycles within anisotropic media}, 39099 author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, 39100 journal = {Geophysical Journal International}, 39101 volume = {219}, 39102 number = {2}, 39103 pages = {816--833}, 39104 year = {2019}, 39105} 39106 39107article{EricksonOReillyNordstrom2019, 39108 title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, 39109 author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, 39110 journal = {Journal of Scientific Computing}, 39111 volume = {81}, 39112 pages = {2356--2387}, 39113 year = {2019}, 39114} 39115 39116@article{KozdonEricksonWilcox2021, 39117 title = {Hybridized summation-by-parts finite difference methods}, 39118 author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, 39119 journal = {Journal of Scientific Computing}, 39120 volume = {87}, 39121 number = {3}, 39122 pages = {85}, 39123 year = {2021}, 39124} 39125 39126@article{SEAS2022, 39127 title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, 39128 author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, 39129 journal = {Journal of Geophysical Research: Solid Earth}, 39130 volume = {127}, 39131 number = {3}, 39132 pages = {e2021JB023519}, 39133 year = {2022}, 39134} 39135 39136@article{EricksonKozdonHarvey2022, 39137 title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, 39138 author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, 39139 journal = {Journal of Scientific Computing}, 39140 volume = {93}, 39141 number = {1}, 39142 pages = {17}, 39143 year = {2022}, 39144} 39145 39146@article{RuckerEriksonKarlstromLeeGopalakrishnan2022, 39147 title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, 39148 author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, 39149 journal = {Journal of Geophysical Research: Solid Earth}, 39150 volume = {127}, 39151 number = {9}, 39152 pages = {e2022JB024506}, 39153 year = {2022}, 39154} 39155 39156@article{HarveyEriksonKozdon2023, 39157 title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, 39158 author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, 39159 journal = {Journal of Geophysical Research: Solid Earth}, 39160 pages = {e2022JB025357}, 39161 year = {2023}, 39162} 39163 39164@article{SEAS2023, 39165 title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, 39166 author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, 39167 journal = {Bulletin of the Seismological Society of America}, 39168 volume = {113}, 39169 number = {2}, 39170 pages = {499--523}, 39171 year = {2023}, 39172} 39173