1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@Misc{ semver-webpage, 20 author = {{Semantic Versioning 2.0.0}}, 21 note = {\url{https://semver.org}} 22} 23 24@article{veldhuizen1984d, 25 title = {{D}-stability and {K}aps-{R}entrop-methods}, 26 author = {Veldhuizen, M van}, 27 journal = {Computing}, 28 volume = {32}, 29 number = {3}, 30 pages = {229--237}, 31 year = {1984}, 32 publisher = {Springer} 33} 34 35@article{shampine1982implementation, 36 title = {Implementation of {R}osenbrock methods}, 37 author = {Shampine, Lawrence F}, 38 journal = {ACM Transactions on Mathematical Software (TOMS)}, 39 volume = {8}, 40 number = {2}, 41 pages = {93--113}, 42 year = {1982}, 43 publisher = {ACM New York, NY, USA} 44} 45 46@book{wanner1996solving, 47 title = {Solving ordinary differential equations {II}}, 48 author = {Wanner, Gerhard and Hairer, Ernst}, 49 volume = {375}, 50 year = {1996}, 51 publisher = {Springer Berlin Heidelberg New York} 52} 53 54@article{kaps1979generalized, 55 title = {Generalized {R}unge--{K}utta methods of order four with stepsize control for stiff ordinary differential equations}, 56 author = {Kaps, Peter and Rentrop, Peter}, 57 journal = {Numerische Mathematik}, 58 volume = {33}, 59 pages = {55--68}, 60 year = {1979}, 61 publisher = {Springer} 62} 63 64@book{butcher2016numerical, 65 title = {Numerical methods for ordinary differential equations}, 66 author = {Butcher, John Charles}, 67 year = {2016}, 68 publisher = {John Wiley \& Sons} 69} 70 71@article{chung1993, 72 author = {Chung, J. and Hulbert, G. M.}, 73 title = {A Time Integration Algorithm for Structural Dynamics With Improved Numerical Dissipation: The Generalized-alpha Method}, 74 journal = {Journal of Applied Mechanics}, 75 volume = {60}, 76 number = {2}, 77 pages = {371-375}, 78 year = {1993}, 79 month = {06}, 80 issn = {0021-8936}, 81 doi = {10.1115/1.2900803}, 82 url = {https://doi.org/10.1115/1.2900803}, 83 eprint = {https://asmedigitalcollection.asme.org/appliedmechanics/article-pdf/60/2/371/5463014/371\_1.pdf}, 84} 85 86@article{hosea1996analysis, 87 title = {Analysis and implementation of {TR-BDF2}}, 88 author = {Hosea, ME and Shampine, LF}, 89 journal = {Applied Numerical Mathematics}, 90 volume = {20}, 91 number = {1-2}, 92 pages = {21--37}, 93 year = {1996}, 94 publisher = {Elsevier} 95} 96 97@article{kennedy2019diagonally, 98 title = {Diagonally implicit {R}unge--{K}utta methods for stiff {ODE}s}, 99 author = {Kennedy, Christopher A and Carpenter, Mark H}, 100 journal = {Applied Numerical Mathematics}, 101 volume = {146}, 102 pages = {221--244}, 103 year = {2019}, 104 publisher = {Elsevier} 105} 106 107@inproceedings{xu2017adaptive, 108 title = {Adaptive relaxed {ADMM}: Convergence theory and practical implementation}, 109 author = {Xu, Zheng and Figueiredo, Mario AT and Yuan, Xiaoming and Studer, Christoph and Goldstein, Tom}, 110 booktitle = {Proceedings of the IEEE conference on computer vision and pattern recognition}, 111 pages = {7389--7398}, 112 year = {2017} 113} 114 115@article{hindmarsh1996time, 116 title = {Time-step limits for stable solutions of the ice-sheet equation}, 117 author = {Hindmarsh, Richard CA and Payne, Antony J}, 118 journal = {Annals of Glaciology}, 119 volume = {23}, 120 pages = {74--85}, 121 year = {1996}, 122 publisher = {Cambridge University Press} 123} 124 125@article{benson2006flexible, 126 title = {Flexible complementarity solvers for large-scale applications}, 127 author = {Benson, Steven J and Munson, Todd S}, 128 journal = {Optimization Methods and Software}, 129 volume = {21}, 130 number = {1}, 131 pages = {155--168}, 132 year = {2006}, 133 publisher ={Taylor \& Francis} 134} 135 136@article{byrd1994representations, 137 title = {Representations of quasi-{N}ewton matrices and their use in limited memory methods}, 138 author = {Byrd, Richard H and Nocedal, Jorge and Schnabel, Robert B}, 139 journal = {Mathematical Programming}, 140 volume = {63}, 141 number = {1-3}, 142 pages = {129--156}, 143 year = {1994}, 144 publisher = {Springer} 145} 146 147@article{gilbert1989some, 148 title = {Some numerical experiments with variable-storage quasi-{N}ewton algorithms}, 149 author = {Gilbert, Jean Charles and Lemar{\'e}chal, Claude}, 150 journal = {Mathematical programming}, 151 volume = {45}, 152 number = {1-3}, 153 pages = {407--435}, 154 year = {1989}, 155 publisher = {Springer} 156} 157 158@inproceedings{dener2019accelerating, 159 title = {Accelerating limited-memory quasi-{N}ewton convergence for large-scale optimization}, 160 author = {Dener, Alp and Munson, Todd}, 161 booktitle = {Computational Science--ICCS 2019: 19th International Conference, Faro, Portugal, June 12--14, 2019, Proceedings, Part III 19}, 162 pages = {495--507}, 163 year = {2019}, 164 organization = {Springer} 165} 166 167@article{park2021linear, 168 title = {Linear and nonlinear solvers for simulating multiphase flow within large-scale engineered subsurface systems}, 169 author = {Park, Heeho D and Hammond, Glenn E and Valocchi, Albert J and LaForce, Tara}, 170 journal = {Advances in Water Resources}, 171 volume = {156}, 172 pages = {104029}, 173 year = {2021}, 174 publisher = {Elsevier} 175} 176 177@inproceedings{va1981design, 178 title = {Design of optimally smoothing multi-stage schemes for the {E}uler equations}, 179 author = {Van Leer, Bram and Tai, Chang-Hsien and Powell, Kenneth}, 180 booktitle = {9th Computational Fluid Dynamics Conference}, 181 pages = {1933}, 182 year = {1981} 183} 184 185@article{pierce1997preconditioned, 186 title = {Preconditioned multigrid methods for compressible flow calculations on stretched meshes}, 187 author = {Pierce, Niles A and Giles, Michael B}, 188 journal = {Journal of Computational Physics}, 189 volume = {136}, 190 number = {2}, 191 pages = {425--445}, 192 year = {1997}, 193 publisher = {Elsevier} 194} 195 196@article{kong2016highly, 197 title = {A highly scalable multilevel {S}chwarz method with boundary geometry preserving coarse spaces for {3D} elasticity problems on domains with complex geometry}, 198 author = {Kong, Fande and Cai, Xiao-Chuan}, 199 journal = {SIAM Journal on Scientific Computing}, 200 volume = {38}, 201 number = {2}, 202 pages = {C73--C95}, 203 year = {2016}, 204 publisher = {SIAM} 205} 206 207@inproceedings{gutierrez2017accommodating, 208 title = {Accommodating thread-level heterogeneity in coupled parallel applications}, 209 author = {Guti{\'e}rrez, Samuel K and Davis, Kei and Arnold, Dorian C and Baker, Randal S and Robey, Robert W and McCormick, Patrick and 210 Holladay, Daniel and Dahl, Jon A and Zerr, R Joe and Weik, Florian and others}, 211 booktitle = {2017 {IEEE} International Parallel and Distributed Processing Symposium ({IPDPS})}, 212 pages = {469--478}, 213 year = {2017}, 214 organization = {IEEE} 215} 216 217@article{heroux2011bi, 218 title = {Bi-modal MPI and MPI+ threads computing on scalable multicore systems}, 219 author = {Heroux, Michael A and Brightwell, R and Wolf, Michael M}, 220 journal = {IJHPCA (Submitted)}, 221 year = {2011} 222} 223 224@inproceedings{bozdaug2005parallel, 225 title = {A parallel distance-2 graph coloring algorithm for distributed memory computers}, 226 author = {Bozda{\u{g}}, Doruk and Catalyurek, Umit and Gebremedhin, Assefaw H and Manne, Fredrik and Boman, Erik G and {\"O}zg{\"u}ner, F{\"u}sun}, 227 booktitle = {International conference on high performance computing and communications}, 228 pages = {796--806}, 229 year = {2005}, 230 organization = {Springer} 231} 232 233@article{dohrmann2009overlapping, 234 title = {An overlapping {S}chwarz algorithm for almost incompressible elasticity}, 235 author = {Dohrmann, Clark R and Widlund, Olof B}, 236 journal = {SIAM journal on numerical analysis}, 237 volume = {47}, 238 number = {4}, 239 pages = {2897--2923}, 240 year = {2009}, 241 publisher = {SIAM} 242} 243 244@article{dohrmann2008domain, 245 title = {Domain decomposition for less regular subdomains: Overlapping {S}chwarz in two dimensions}, 246 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 247 journal = {SIAM journal on numerical analysis}, 248 volume = {46}, 249 number = {4}, 250 pages = {2153--2168}, 251 year = {2008}, 252 publisher = {SIAM} 253} 254 255@incollection{dohrmann2008family, 256 title = {A family of energy minimizing coarse spaces for overlapping {S}chwarz preconditioners}, 257 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 258 booktitle = {Domain decomposition methods in science and engineering XVII}, 259 pages = {247--254}, 260 year = {2008}, 261 publisher = {Springer} 262} 263 264@book{dohrmann2008extending, 265 title = {Extending theory for domain decomposition algorithms to irregular subdomains}, 266 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 267 year = {2008}, 268 publisher = {Springer} 269} 270 271@article{dryja1994schwarz, 272 title = {{S}chwarz analysis of iterative substructuring algorithms for elliptic problems in three dimensions}, 273 author = {Dryja, Maksymilian and Smith, Barry F and Widlund, Olof B}, 274 journal = {SIAM journal on numerical analysis}, 275 volume = {31}, 276 number = {6}, 277 pages = {1662--1694}, 278 year = {1994}, 279 publisher = {SIAM} 280} 281 282@book{smith1990domain, 283 title = {Domain decomposition algorithms for the partial differential equations of linear elasticity}, 284 author = {Smith, Barry F}, 285 year = {1990}, 286 publisher = {New York University} 287} 288 289@article{bramble1989construction, 290 title = {The construction of preconditioners for elliptic problems by substructuring. {IV}}, 291 author = {Bramble, James H and Pasciak, Joseph E and Schatz, Alfred H}, 292 journal = {Mathematics of Computation}, 293 volume = {53}, 294 number = {187}, 295 pages = {1--24}, 296 year = {1989} 297} 298 299@article{kaczmarz1937angenaherte, 300 title = {Angenaherte auflosung von systemen linearer gleichungen}, 301 author = {Kaczmarz, Stefan}, 302 journal = {Bull. Int. Acad. Pol. Sic. Let., Cl. Sci. Math. Nat.}, 303 pages = {355--357}, 304 year = {1937} 305} 306 307@article{nataf2022recent, 308 title = {Recent advances in domain decomposition methods for large-scale saddle point problems}, 309 author = {Nataf, Fr{\'e}d{\'e}ric and Tournier, Pierre-Henri}, 310 journal = {Comptes Rendus. M{\'e}canique}, 311 volume = {350}, 312 number = {S1}, 313 pages = {1--15}, 314 year = {2022} 315} 316 317@article{al2022robustpd, 318 title = {A robust algebraic multilevel domain decomposition preconditioner for sparse symmetric positive definite matrices}, 319 author = {Al Daas, Hussam and Jolivet, Pierre}, 320 journal = {SIAM Journal on Scientific Computing}, 321 volume = {44}, 322 number = {4}, 323 pages = {A2582--A2598}, 324 year = {2022}, 325 publisher = {SIAM} 326} 327 328@article{al2022robust, 329 title = {A robust algebraic domain decomposition preconditioner for sparse normal equations}, 330 author = {Al Daas, Hussam and Jolivet, Pierre and Scott, Jennifer A}, 331 journal = {SIAM Journal on Scientific Computing}, 332 volume = {44}, 333 number = {3}, 334 pages = {A1047--A1068}, 335 year = {2022}, 336 publisher = {SIAM} 337} 338 339@article{al2021multilevel, 340 title = {A multilevel {S}chwarz preconditioner based on a hierarchy of robust coarse spaces}, 341 author = {Al Daas, Hussam and Grigori, Laura and Jolivet, Pierre and Tournier, Pierre-Henri}, 342 journal = {SIAM Journal on Scientific Computing}, 343 volume = {43}, 344 number = {3}, 345 pages = {A1907--A1928}, 346 year = {2021}, 347 publisher = {SIAM} 348} 349 350@book{dolean2015introduction, 351 title = {An introduction to domain decomposition methods: algorithms, theory, and parallel implementation}, 352 author = {Dolean, Victorita and Jolivet, Pierre and Nataf, Fr{\'e}d{\'e}ric}, 353 year = {2015}, 354 publisher = {SIAM} 355} 356 357@article{spillane2011robust, 358 title = {A robust two-level domain decomposition preconditioner for systems of {PDE}s}, 359 author = {Spillane, Nicole and Dolean, Victorita and Hauret, Patrice and Nataf, Fr{\'e}d{\'e}ric and Pechstein, Clemens and Scheichl, Robert}, 360 journal = {Comptes Rendus Mathematique}, 361 volume = {349}, 362 number = {23-24}, 363 pages = {1255--1259}, 364 year = {2011}, 365 publisher = {Elsevier} 366} 367 368@article{kong2020highly, 369 title = {A Highly Parallel Multilevel {N}ewton--{K}rylov--{S}chwarz Method with Subspace-Based Coarsening and 370 Partition-Based Balancing for the Multigroup Neutron Transport Equation on Three-Dimensional Unstructured Meshes}, 371 author = {Kong, Fande and Wang, Yaqi and Gaston, Derek R and Permann, Cody J and Slaughter, Andrew E and Lindsay, 372 Alexander D and DeHart, Mark D and Martineau, Richard C}, 373 journal = {SIAM Journal on Scientific Computing}, 374 volume = {42}, 375 number = {5}, 376 pages = {C193--C220}, 377 year = {2020}, 378 publisher = {SIAM} 379} 380 381@article{ipsen2001note, 382 title = {A note on preconditioning nonsymmetric matrices}, 383 author = {Ipsen, Ilse CF}, 384 journal = {SIAM Journal on Scientific Computing}, 385 volume = {23}, 386 number = {3}, 387 pages = {1050--1051}, 388 year = {2001}, 389 publisher = {SIAM} 390} 391 392@article{murphy2000note, 393 title = {A note on preconditioning for indefinite linear systems}, 394 author = {Murphy, Malcolm F and Golub, Gene H and Wathen, Andrew J}, 395 journal = {SIAM Journal on Scientific Computing}, 396 volume = {21}, 397 number = {6}, 398 pages = {1969--1972}, 399 year = {2000}, 400 publisher = {SIAM} 401} 402 403@article{oliphant1961implicit, 404 title = {An implicit, numerical method for solving two-dimensional time-dependent diffusion problems}, 405 author = {Oliphant, Thomas A}, 406 journal = {Quarterly of Applied mathematics}, 407 volume = {19}, 408 number = {3}, 409 pages = {221--229}, 410 year = {1961} 411} 412 413@article{dupont1968approximate, 414 title = {An approximate factorization procedure for solving self-adjoint elliptic difference equations}, 415 author = {Dupont, Todd and Kendall, Richard P and Rachford, Jr, HH}, 416 journal = {SIAM Journal on Numerical Analysis}, 417 volume = {5}, 418 number = {3}, 419 pages = {559--573}, 420 year = {1968}, 421 publisher = {SIAM} 422} 423 424@inproceedings{manteuffel1979shifted, 425 title = {Shifted incomplete {C}holesky factorization}, 426 author = {Manteuffel, Thomas A}, 427 booktitle = {Sparse Matrix Proceedings 1978}, 428 pages = {41--61}, 429 year = {1979}, 430 organization = {SIAM, Philadelphia, PA} 431} 432 433@incollection{chan1997approximate, 434 title = {Approximate and incomplete factorizations}, 435 author = {Chan, Tony F and Van Der Vorst, Henk A}, 436 booktitle = {Parallel numerical algorithms}, 437 pages = {167--202}, 438 year = {1997}, 439 publisher = {Springer} 440} 441 442@article{mandel2008multispace, 443 title = {Multispace and multilevel {BDDC}}, 444 author = {Mandel, Jan and Soused{\'\i}k, Bed{\v{r}}ich and Dohrmann, Clark R}, 445 journal = {Computing}, 446 volume = {83}, 447 number = {2-3}, 448 pages = {55--85}, 449 year = {2008}, 450 publisher = {Springer} 451} 452 453@article{klawonn2006dual, 454 title = {Dual-primal {FETI} methods for linear elasticity}, 455 author = {Klawonn, Axel and Widlund, Olof B}, 456 journal = {Communications on Pure and Applied Mathematics: A Journal Issued by the Courant Institute of Mathematical Sciences}, 457 volume = {59}, 458 number = {11}, 459 pages = {1523--1572}, 460 year = {2006}, 461 publisher = {Wiley Online Library} 462} 463 464@article{dohrmann2007approximate, 465 title = {An approximate {BDDC} preconditioner}, 466 author = {Dohrmann, Clark R}, 467 journal = {Numerical Linear Algebra with Applications}, 468 volume = {14}, 469 number = {2}, 470 pages = {149--168}, 471 year = {2007}, 472 publisher = {Wiley Online Library} 473} 474 475@book{dryja1987additive, 476 title = {An additive variant of the {S}chwarz alternating method for the case of many subregions}, 477 author = {Dryja, Maksymilian and Widlund, Olof}, 478 year = {1987}, 479 publisher = {Ultracomputer Research Laboratory, Univ., Courant Inst. of Mathematical~…} 480} 481 482@article{couturier2016tsirm, 483 title = {{TSIRM}: A two-stage iteration with least-squares residual minimization algorithm to solve large sparse linear and nonlinear systems}, 484 author = {Couturier, Rapha{\"e}l and Khodja, Lilia Ziane and Guyeux, Christophe}, 485 journal = {Journal of Computational Science}, 486 volume = {17}, 487 pages = {535--546}, 488 year = {2016}, 489 publisher = {Elsevier} 490} 491 492@article{chan1998transpose, 493 title = {Transpose-free formulations of Lanczos-type methods for nonsymmetric linear systems}, 494 author = {Chan, Tony F and De Pillis, Lisette and Van Der Vorst, Henk}, 495 journal = {Numerical Algorithms}, 496 volume = {17}, 497 pages = {51--66}, 498 year = {1998}, 499 publisher = {Springer} 500} 501 502@article{catabriga2006performance, 503 title = {Performance of {LCD} iterative method in the finite element and finite difference solution of convection--diffusion equations}, 504 author = {Catabriga, L and Valli, AMP and Melotti, BZ and Pessoa, LM and Coutinho, ALGA}, 505 journal = {Communications in numerical methods in engineering}, 506 volume = {22}, 507 number = {6}, 508 pages = {643--656}, 509 year = {2006}, 510 publisher = {Wiley Online Library} 511} 512 513@article{catabriga2004evaluating, 514 title = {Evaluating the {LCD} algorithm for solving linear systems of equations arising from implicit {SUPG} formulation of compressible flows}, 515 author = {Catabriga, Lucia and Coutinho, Alvaro LGA and Franca, Leopoldo P}, 516 journal = {International Journal for Numerical Methods in Engineering}, 517 volume = {60}, 518 number = {9}, 519 pages = {1513--1534}, 520 year = {2004}, 521 publisher = {Wiley Online Library} 522} 523 524@article{dai2004study, 525 title = {Study on semi-conjugate direction methods for non-symmetric systems}, 526 author = {Dai, Yu-Hong and Yuan, Jinyun}, 527 journal = {International journal for numerical methods in engineering}, 528 volume = {60}, 529 number = {8}, 530 pages = {1383--1399}, 531 year = {2004}, 532 publisher = {Wiley Online Library} 533} 534 535@article{yuan2004semi, 536 title = {Semi-conjugate direction methods for real positive definite systems}, 537 author = {Yuan, JY and Golub, Gene H and Plemmons, Robert J and Cecilio, WAG}, 538 journal = {BIT Numerical Mathematics}, 539 volume = {44}, 540 pages = {189--207}, 541 year = {2004}, 542 publisher = {Springer} 543} 544 545@article{ji2017breakdown, 546 title = {A breakdown-free block conjugate gradient method}, 547 author = {Ji, Hao and Li, Yaohang}, 548 journal = {BIT Numerical Mathematics}, 549 volume = {57}, 550 pages = {379--403}, 551 year = {2017}, 552 publisher = {Springer} 553} 554 555@inproceedings{jolivet2016block, 556 title = {Block iterative methods and recycling for improved scalability of linear solvers}, 557 author = {Jolivet, Pierre and Tournier, Pierre-Henri}, 558 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 559 pages = {190--203}, 560 year = {2016}, 561 organization = {IEEE} 562} 563 564@article{calandra2013modified, 565 title = {A modified block flexible {GMRES} method with deflation at each iteration for the solution of non-{H}ermitian linear systems with multiple right-hand sides}, 566 author = {Calandra, Henri and Gratton, Serge and Lago, Rafael and Vasseur, Xavier and Carvalho, Luiz Mariano}, 567 journal = {SIAM Journal on Scientific Computing}, 568 volume = {35}, 569 number = {5}, 570 pages = {S345--S367}, 571 year = {2013}, 572 publisher = {SIAM} 573} 574 575@article{o1980block, 576 title = {The block conjugate gradient algorithm and related methods}, 577 author = {O'Leary, Dianne P}, 578 journal = {Linear algebra and its applications}, 579 volume = {29}, 580 pages = {293--322}, 581 year = {1980}, 582 publisher = {Elsevier} 583} 584 585@article{erhel1996restarted, 586 title = {Restarted {GMRES} preconditioned by deflation}, 587 author = {Erhel, Jocelyne and Burrage, Kevin and Pohl, Bert}, 588 journal = {Journal of computational and applied mathematics}, 589 volume = {69}, 590 number = {2}, 591 pages = {303--318}, 592 year = {1996}, 593 publisher = {Elsevier} 594} 595 596@article{bai1994newton, 597 title = {A {N}ewton basis {GMRES} implementation}, 598 author = {Bai, Zhaojun and Hu, Dan and Reichel, Lothar}, 599 journal = {IMA Journal of Numerical Analysis}, 600 volume = {14}, 601 number = {4}, 602 pages = {563--581}, 603 year = {1994}, 604 publisher = {Oxford University Press} 605} 606 607@article{sidje1997alternatives, 608 title = {Alternatives for parallel Krylov subspace basis computation}, 609 author = {Sidje, Roger B}, 610 journal = {Numerical linear algebra with applications}, 611 volume = {4}, 612 number = {4}, 613 pages = {305--331}, 614 year = {1997}, 615 publisher = {Wiley Online Library} 616} 617 618@inproceedings{mohiyuddin2009minimizing, 619 title = {Minimizing communication in sparse matrix solvers}, 620 author = {Mohiyuddin, Marghoob and Hoemmen, Mark and Demmel, James and Yelick, Katherine}, 621 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage and Analysis}, 622 pages = {1--12}, 623 year = {2009} 624} 625 626@article{demmel2012communication, 627 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 628 author = {Demmel, James and Grigori, Laura and Hoemmen, Mark and Langou, Julien}, 629 journal = {SIAM Journal on Scientific Computing}, 630 volume = {34}, 631 number = {1}, 632 pages = {A206--A239}, 633 year = {2012}, 634 publisher = {SIAM} 635} 636 637@article{philippe2012generation, 638 title = {On the generation of {K}rylov subspace bases}, 639 author = {Philippe, Bernard and Reichel, Lothar}, 640 journal = {Applied Numerical Mathematics}, 641 volume = {62}, 642 number = {9}, 643 pages = {1171--1186}, 644 year = {2012}, 645 publisher = {Elsevier} 646} 647 648@article{wakam2013memory, 649 title = {Memory efficient hybrid algebraic solvers for linear systems arising from compressible flows}, 650 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Pacull, Fran{\c{c}}ois}, 651 journal = {Computers \& Fluids}, 652 volume = {80}, 653 pages = {158--167}, 654 year = {2013}, 655 publisher = {Elsevier} 656} 657 658@misc{wakam2011parallelism, 659 title = {Parallelism and robustness in {GMRES} with the {N}ewton basis and the deflated restarting}, 660 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Erhel, Jocelyne}, 661 year = {2011}, 662 url = {https://hal.inria.fr/inria-00638247/en} 663} 664 665@article{tu2015feti, 666 title = {A {FETI-DP} type domain decomposition algorithm for three-dimensional incompressible {S}tokes equations}, 667 author = {Tu, Xuemin and Li, Jing}, 668 journal = {SIAM Journal on Numerical Analysis}, 669 volume = {53}, 670 number = {2}, 671 pages = {720--742}, 672 year = {2015}, 673 publisher = {SIAM} 674} 675 676@article{farhat2001feti, 677 title = {{FETI-DP}: a dual--primal unified {FETI} method—part {I}: A faster alternative to the two-level {FETI} method}, 678 author = {Farhat, Charbel and Lesoinne, Michel and LeTallec, Patrick and Pierson, Kendall and Rixen, Daniel}, 679 journal = {International journal for numerical methods in engineering}, 680 volume = {50}, 681 number = {7}, 682 pages = {1523--1544}, 683 year = {2001}, 684 publisher = {Wiley Online Library} 685} 686 687@article{lottes2023optimal, 688 title = {Optimal polynomial smoothers for multigrid {V}-cycles}, 689 author = {Lottes, James}, 690 journal = {Numerical Linear Algebra with Applications}, 691 volume = {30}, 692 number = {6}, 693 pages = {e2518}, 694 year = {2023}, 695 publisher = {Wiley Online Library} 696} 697 698@article{phillips2022optimal, 699 title = {Optimal {C}hebyshev Smoothers and One-sided {V}-cycles}, 700 author = {Phillips, Malachi and Fischer, Paul}, 701 journal = {arXiv preprint arXiv:2210.03179}, 702 year = {2022} 703} 704 705@incollection{toint1981towards, 706 title = {Towards an efficient sparsity exploiting {N}ewton method for minimization}, 707 author = {Toint, Philippe}, 708 booktitle = {Sparse matrices and their uses}, 709 pages = {57--88}, 710 year = {1981}, 711 publisher = {Academic press} 712} 713 714@article{cools2019numerically, 715 title = {Numerically stable recurrence relations for the communication hiding pipelined conjugate gradient method}, 716 author = {Cools, Siegfried and Cornelis, Jeffrey and Vanroose, Wim}, 717 journal = {IEEE Transactions on Parallel and Distributed Systems}, 718 volume = {30}, 719 number = {11}, 720 pages = {2507--2522}, 721 year = {2019}, 722 publisher = {IEEE} 723} 724 725@article{cornelis2018communication, 726 title = {The communication-hiding conjugate gradient method with deep pipelines}, 727 author = {Cornelis, Jeffrey and Cools, Siegfried and Vanroose, Wim}, 728 journal = {arXiv preprint arXiv:1801.04728}, 729 year = {2018} 730} 731 732@article{d1993conjugate, 733 title = {Conjugate gradient algorithms with reduced synchronization overhead on distributed memory multiprocessors}, 734 author = {D’Azevedo, EF and Eijkhout, VL and Romine, CH}, 735 journal = {Computer Science Technical Report CS-93-185, University of Tennessee, Knoxville}, 736 year = {1993} 737} 738 739@book{malek2014preconditioning, 740 title = {Preconditioning and the conjugate gradient method in the context of solving {PDEs}}, 741 author = {M{\'a}lek, Josef and Strako{\v{s}}, Zden{\v{e}}k}, 742 year = {2014}, 743 publisher = {SIAM} 744} 745 746@book{fokkema1996enhanced, 747 title = {Enhanced implementation of {BiCGstab}(l) for solving linear systems of equations}, 748 author = {Fokkema, Diederik R}, 749 year = {1996}, 750 publisher = {Citeseer} 751} 752 753@article{sleijpen1994bicgstab, 754 title = {{BiCGstab}(l) and other hybrid {Bi-CG} methods}, 755 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A and Fokkema, Diederik R}, 756 journal = {Numerical Algorithms}, 757 volume = {7}, 758 pages = {75--109}, 759 year = {1994}, 760 publisher = {Springer} 761} 762 763@article{sleijpen1995overview, 764 title = {An overview of approaches for the stable computation of hybrid {BiCG} methods}, 765 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A}, 766 journal = {Applied numerical mathematics}, 767 volume = {19}, 768 number = {3}, 769 pages = {235--254}, 770 year = {1995}, 771 publisher = {Elsevier} 772} 773 774@article{fischer1998projection, 775 title = {Projection techniques for iterative solution of Ax= b with successive right-hand sides}, 776 author = {Fischer, Paul F}, 777 journal = {Computer methods in applied mechanics and engineering}, 778 volume = {163}, 779 number = {1-4}, 780 pages = {193--204}, 781 year = {1998}, 782 publisher = {Elsevier} 783} 784 785@article{maskery2018insights, 786 title = {Insights into the mechanical properties of several triply periodic minimal surface lattice structures 787 made by polymer additive manufacturing}, 788 author = {Maskery, Ian and Sturm, Logan and Aremu, Adedeji O and Panesar, Ajit and Williams, 789 Christopher B and Tuck, Christopher J and Wildman, Ricky D and Ashcroft, Ian A and Hague, Richard JM}, 790 journal = {Polymer}, 791 volume = {152}, 792 pages = {62--71}, 793 year = {2018}, 794 publisher = {Elsevier} 795} 796 797@book{karniadakis2005spectral, 798 title = {Spectral/hp element methods for computational fluid dynamics}, 799 author = {Karniadakis, George and Sherwin, Spencer J}, 800 year = {2005}, 801 publisher = {Oxford University Press, USA} 802} 803 804@article{golub1969calculation, 805 title = {Calculation of {G}auss quadrature rules}, 806 author = {Golub, Gene H and Welsch, John H}, 807 journal = {Mathematics of computation}, 808 volume = {23}, 809 number = {106}, 810 pages = {221--230}, 811 year = {1969} 812} 813 814@article{soderlind2006adaptive, 815 title = {Adaptive time-stepping and computational stability}, 816 author = {S{\"o}derlind, Gustaf and Wang, Lina}, 817 journal = {Journal of Computational and Applied Mathematics}, 818 volume = {185}, 819 number = {2}, 820 pages = {225--243}, 821 year = {2006}, 822 publisher = {Elsevier} 823} 824 825@article{soderlind2003digital, 826 title = {Digital filters in adaptive time-stepping}, 827 author = {S{\"o}derlind, Gustaf}, 828 journal = {{ACM} Transactions on Mathematical Software ({TOMS})}, 829 volume = {29}, 830 number = {1}, 831 pages = {1--26}, 832 year = {2003}, 833 publisher = {ACM New York, NY, USA} 834} 835 836@article{volkwein2013proper, 837 title = {Proper orthogonal decomposition: Theory and reduced-order modelling}, 838 author = {Volkwein, Stefan}, 839 journal = {Lecture Notes, University of Konstanz}, 840 volume = {4}, 841 number = {4}, 842 pages = {1--29}, 843 year = {2013}, 844 url = {http://www.math.uni-konstanz.de/numerik/personen/volkwein/teaching/POD-Book.pdf} 845} 846 847@article{frisvad2012building, 848 title = {Building an orthonormal basis from a {3D} unit vector without normalization}, 849 author = {Frisvad, Jeppe Revall}, 850 journal = {Journal of Graphics Tools}, 851 volume = {16}, 852 number = {3}, 853 pages = {151--159}, 854 year = {2012}, 855 publisher = {Taylor \& Francis} 856} 857 858@article{constantinescu2007multirate, 859 title = {Multirate timestepping methods for hyperbolic conservation laws}, 860 author = {Constantinescu, Emil M and Sandu, Adrian}, 861 journal = {Journal of Scientific Computing}, 862 volume = {33}, 863 number = {3}, 864 pages = {239--278}, 865 year = {2007}, 866 publisher = {Springer} 867} 868 869@article{liu2022newton, 870 title = {A {N}ewton-{MR} algorithm with complexity guarantees for nonconvex smooth unconstrained optimization}, 871 author = {Liu, Yang and Roosta, Fred}, 872 journal = {arXiv preprint arXiv:2208.07095}, 873 year = {2022} 874} 875 876@article{choi2011minres, 877 title = {{MINRES-QLP}: A {K}rylov subspace method for indefinite or singular symmetric systems}, 878 author = {Choi, Sou-Cheng T and Paige, Christopher C and Saunders, Michael A}, 879 journal = {SIAM Journal on Scientific Computing}, 880 volume = {33}, 881 number = {4}, 882 pages = {1810--1836}, 883 year = {2011}, 884 publisher = {SIAM} 885} 886 887@article{chen2020predict, 888 title = {Predict-and-recompute conjugate gradient variants}, 889 author = {Chen, Tyler and Carson, Erin}, 890 journal = {SIAM Journal on Scientific Computing}, 891 volume = {42}, 892 number = {5}, 893 pages = {A3084--A3108}, 894 year = {2020}, 895 publisher = {SIAM} 896} 897 898@article{cools2018analyzing, 899 title = {Analyzing the effect of local rounding error propagation on the maximal attainable accuracy of the pipelined conjugate gradient method}, 900 author = {Cools, Siegfried and Yetkin, Emrullah Fatih and Agullo, Emmanuel and Giraud, Luc and Vanroose, Wim}, 901 journal = {SIAM Journal on Matrix Analysis and Applications}, 902 volume = {39}, 903 number = {1}, 904 pages = {426--450}, 905 year = {2018}, 906 publisher = {SIAM} 907} 908 909@inproceedings{tiwari2020pipelined, 910 title = {Pipelined preconditioned conjugate gradient methods for distributed memory systems}, 911 author = {Tiwari, Manasi and Vadhiyar, Sathish}, 912 booktitle = {2020 IEEE 27th International Conference on High Performance Computing, Data, and Analytics (HiPC)}, 913 pages = {151--160}, 914 year = {2020}, 915 organization = {IEEE} 916} 917 918@article{nash1984newton, 919 title = {Newton-type minimization via the {L}anczos method}, 920 author = {Nash, Stephen G}, 921 journal = {SIAM Journal on Numerical Analysis}, 922 volume = {21}, 923 number = {4}, 924 pages = {770--788}, 925 year = {1984}, 926 publisher = {SIAM} 927} 928 929@inproceedings{eller2016scalable, 930 title = {Scalable non-blocking preconditioned conjugate gradient methods}, 931 author = {Eller, Paul R and Gropp, William}, 932 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 933 pages = {204--215}, 934 year = {2016}, 935 organization = {IEEE} 936} 937 938@article{gould1999solving, 939 title = {Solving the trust-region subproblem using the Lanczos method}, 940 author = {Gould, Nicholas IM and Lucidi, Stefano and Roma, Massimo and Toint, Philippe L}, 941 journal = {SIAM Journal on Optimization}, 942 volume = {9}, 943 number = {2}, 944 pages = {504--525}, 945 year = {1999}, 946 publisher = {SIAM} 947} 948 949@article{cools2017communication, 950 title = {The communication-hiding pipelined {BiCGstab} method for the parallel solution of large unsymmetric linear systems}, 951 author = {Cools, Siegfried and Vanroose, Wim}, 952 journal = {Parallel Computing}, 953 volume = {65}, 954 pages = {1--20}, 955 year = {2017}, 956 publisher = {Elsevier} 957} 958 959@Misc{moabwebsite, 960 key = {MOAB}, 961 title = {{MOAB} Website}, 962 howpublished = {\url{https://www.mcs.anl.gov/~fathom/moab-docs/html/contents.html}}, 963 year = {2023} 964} 965 966@book{deuflhard2011, 967 title = {{N}ewton Methods for Nonlinear Problems}, 968 author = {Peter Deuflhard}, 969 volume = {35}, 970 year = {2011}, 971 isbn = {978-3-642-23898-7}, 972 doi = {10.1007/978-3-642-23899-4}, 973 publisher = {Springer-Verlag}, 974 address = {Berlin, Heidelberg} 975} 976 977@article{ketcheson2010runge, 978 title = {{R}unge--{K}utta methods with minimum storage implementations}, 979 author = {Ketcheson, David I}, 980 journal = {Journal of Computational Physics}, 981 volume = {229}, 982 number = {5}, 983 pages = {1763--1773}, 984 year = {2010}, 985 publisher = {Elsevier} 986} 987 988@article{WalkerNi2011, 989 title = {{A}nderson acceleration for fixed-point iterations}, 990 author = {Homer F Walker and Peng Ni}, 991 journal = {SIAM Journal on Numerical Analysis}, 992 volume = {49}, 993 number = {4}, 994 pages = {1715--1735}, 995 year = {2011}, 996 publisher = {SIAM} 997} 998 999@article{Hua2007, 1000 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 1001 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 1002 journal = {AIChE Journal}, 1003 volume = {53}, 1004 number = {10}, 1005 pages = {2534--2548}, 1006 year = {2007}, 1007 publisher = {Wiley Online Library} 1008} 1009 1010@Article{ openblas, 1011 title = {{OpenBLAS}: A High Performance {BLAS} Library on {L}oongson {3A} {CPU}}, 1012 journal = {Journal of Software}, 1013 volume = {22}, 1014 pages = {208--216}, 1015 year = {2011}, 1016 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 1017 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 1018} 1019 1020@Misc{ openblas-website, 1021 title = {{OpenBLAS}}, 1022 key = {OpenBLAS}, 1023 howpublished = {\url{https://www.openblas.net}} 1024} 1025 1026@Misc{ openacc-website, 1027 title = {{OpenACC}}, 1028 key = {OpenACC}, 1029 howpublished = {\url{https://www.openacc.org}} 1030} 1031 1032@Misc{ bueler2020petsc, 1033 title = {{PETSc} for Partial Differential Equations: Numerical Solutions in {C} and {P}ython}, 1034 author = {Bueler, Ed}, 1035 year = {2020}, 1036 publisher = {SIAM}, 1037 petsc_uses = {KSP} 1038} 1039 1040@TechReport{ petscforgpuexascale, 1041 title = {Toward Performance-Portable {PETSc} for {GPU}-based Exascale Systems}, 1042 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1043 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 1044 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1045 institution = {Argonne National Laboratory}, 1046 number = {ANL/MCS-P9401-1020}, 1047 note = {\url{https://arxiv.org/abs/2011.00715}}, 1048 year = {2020}, 1049 petsc_uses = {KSP} 1050} 1051 1052@Article{ mills2021, 1053 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 1054 journal = {Parallel Computing}, 1055 volume = {108}, 1056 pages = {102831}, 1057 year = {2021}, 1058 issn = {0167-8191}, 1059 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 1060 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 1061 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1062 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 1063 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 1064} 1065 1066@Article{ mills2024, 1067 title = {{PETSc/TAO} Developments for Early Exascale Systems}, 1068 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and 1069 Jacob Faibussowitsch and Tobin Isaac and Matthew G. Knepley and Todd Munson and 1070 Hansul Suh and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1071 journal = {International Journal of High Performance Computing Applications}, 1072 url = {http://arxiv.org/abs/2401.05868}, 1073 doi = {https://doi.org/10.1177/10943420241303710}, 1074 year = {2024} 1075} 1076 1077@Article{ rupp:2016:pis:2988256.2907944, 1078 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 1079 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 1080 journal = {ACM Trans. Math. Softw.}, 1081 issue_date = {September 2016}, 1082 volume = {43}, 1083 number = {2}, 1084 month = aug, 1085 year = {2016}, 1086 issn = {0098-3500}, 1087 pages = {11:1--11:27}, 1088 articleno = {11}, 1089 numpages = {27}, 1090 doi = {10.1145/2907944}, 1091 acmid = {2907944}, 1092 publisher = {ACM}, 1093 address = {New York, NY, USA}, 1094 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 1095 gradient method}, 1096 petsc_uses = {KSP} 1097} 1098 1099@Article{ dalcin2011parallel, 1100 title = {Parallel distributed computing using python}, 1101 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 1102 journal = {Advances in Water Resources}, 1103 volume = {34}, 1104 number = {9}, 1105 pages = {1124--1139}, 1106 year = {2011}, 1107 publisher = {Elsevier}, 1108 petsc_uses = {KSP} 1109} 1110 1111@Article{ mendezpongaortiz2018, 1112 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 1113 author = {JP Mendez and M Ponga and M Ortiz}, 1114 journal = {Journal of the Mechanics and Physics of Solids}, 1115 year = {2018}, 1116 petsc_uses = {KSP} 1117} 1118 1119@TechReport{ morgan2020evaluation, 1120 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 1121 System: Part 1: Vector Node Performance}, 1122 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 1123 year = {2020}, 1124 institution = {Argonne National Laboratory}, 1125 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 1126 petsc_uses = {KSP} 1127} 1128 1129@TechReport{ pdeconstrainedspectraladjoints, 1130 title = {PDE constrained optimization, error estimation and control with spectral elements 1131 using PETSc and TAO}, 1132 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 1133 type = {Preprint}, 1134 number = {ANL/MCS-P9031-1117}, 1135 institution = {ANL}, 1136 month = nov, 1137 year = {2017}, 1138 petsc_uses = {KSP} 1139} 1140 1141@InProceedings{ asc2013, 1142 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 1143 title = {Evaluation of overlapping restricted additive {S}chwarz preconditioning for 1144 parallel solution of very large power flow problems}, 1145 booktitle = {HiPCNA-PG’13}, 1146 year = {2013}, 1147 petsc_uses = {KSP} 1148} 1149 1150@InProceedings{ as2013, 1151 author = {S. Abhyankar and B. F. Smith}, 1152 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 1153 Smart Grid Applications}, 1154 booktitle = {Proceedings of the IEEE PES General Meeting}, 1155 year = {2013}, 1156 petsc_uses = {KSP} 1157} 1158 1159@TechReport{ tspaper, 1160 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 1161 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 1162 Barry F. Smith}, 1163 type = {Preprint}, 1164 number = {ANL/MCS-P5061-0114}, 1165 institution = {ANL}, 1166 month = jan, 1167 year = {2014}, 1168 petsc_uses = {KSP} 1169} 1170 1171@TechReport{ abhyankaretal2018, 1172 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 1173 and Barry F. Smith and Hong Zhang}, 1174 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 1175 journal = {arXiv e-preprints}, 1176 eprint = {1806.01437}, 1177 archiveprefix = {arXiv}, 1178 year = {2018}, 1179 petsc_uses = {KSP} 1180} 1181 1182@Article{ zhang2021cams, 1183 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 1184 author = {Hong Zhang and Emil M. Constantinescu}, 1185 journal = {arXiv e-preprints}, 1186 eprint = {2202.11890}, 1187 archiveprefix = {arXiv}, 1188 year = {2022}, 1189 petsc_uses = {KSP} 1190} 1191 1192@InProceedings{ zhangconstantinescu2021b, 1193 title = {Revolve-based adjoint checkpointing for multistage time integration}, 1194 author = {Hong Zhang and Emil M. Constantinescu}, 1195 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 1196 month = jun, 1197 year = {2021}, 1198 petsc_uses = {KSP} 1199} 1200 1201@Article{ zhang2022tsadjoint, 1202 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 1203 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 1204 Sensitivity Analysis}}, 1205 journal = {SIAM Journal on Scientific Computing}, 1206 volume = {44}, 1207 number = {1}, 1208 pages = {C1-C24}, 1209 year = {2022}, 1210 doi = {10.1137/21M140078X}, 1211 petsc_uses = {KSP} 1212} 1213 1214@TechReport{ bb2008, 1215 author = {Tomasz Blachowicz and Bartlomiej Baron}, 1216 title = {A graphical extension for the Windows version of the Parallel Finite Element 1217 Micromagnetics Package (MagParExt)}, 1218 url = {http://arxiv.org/abs/0807.2655}, 1219 year = {2008}, 1220 petsc_uses = {KSP} 1221} 1222 1223@Article{ jacvgv2008, 1224 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 1225 and J L Vicent}, 1226 title = {Field induced vortex dynamics in magnetic {Ni} nanotriangles}, 1227 journal = {Nanotechnology}, 1228 volume = {19}, 1229 year = {2008}, 1230 doi = {10.1088/0957-4484/19/28/285717}, 1231 petsc_uses = {KSP} 1232} 1233 1234@Article{ yjdwh2008, 1235 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1236 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1237 journal = {Journal of the Magnetics Society of Japan}, 1238 volume = {32}, 1239 year = {2008}, 1240 pages = {50-53}, 1241 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 1242 petsc_uses = {KSP} 1243} 1244 1245@Article{ mtrtrsa2008, 1246 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 1247 Schrefl and M. Albrecht}, 1248 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 1249 journal = {J. Appl. Phys.}, 1250 volume = {103}, 1251 year = {2008}, 1252 doi = {10.1063/1.2894587}, 1253 petsc_uses = {KSP} 1254} 1255 1256@InProceedings{ tmrttsa2008, 1257 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 1258 Schrefl and M. Albrecht}, 1259 title = {Patterning of magnetic films by focused ion beam irradiation}, 1260 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 1261 year = {2008}, 1262 petsc_uses = {KSP} 1263} 1264 1265@Article{ yjdbh2007, 1266 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 1267 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 1268 factor for the single-phase soft magnetic films}, 1269 journal = {J. Magn. Magn. Mater.}, 1270 volume = {320}, 1271 number = {7}, 1272 pages = {1393-1397}, 1273 doi = {10.1016/j.jmmm.2007.11.025}, 1274 petsc_uses = {KSP} 1275} 1276 1277@Article{ lxky2007, 1278 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 1279 title = {Micromagnetic simulation and experimental study on microwave permeability of 1280 nano-magnetic films}, 1281 journal = {Transactions of Nonferrous Metals Society of China}, 1282 year = {2007}, 1283 pages = {756-759}, 1284 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 1285 petsc_uses = {KSP} 1286} 1287 1288@Article{ yjdwh2008a, 1289 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1290 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1291 journal = {Journal of the Magnetics Society of Japan}, 1292 volume = {32}, 1293 year = {2008}, 1294 pages = {50-53}, 1295 doi = {10.3379/msjmag.32.50}, 1296 petsc_uses = {KSP} 1297} 1298 1299@Article{ lylw2007, 1300 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 1301 title = {Micromagnetic study of magnetization reversal in patterned {DyFeCo} thin films}, 1302 journal = {Phys. Stat. Sol.}, 1303 volume = {204}, 1304 number = {12}, 1305 pages = {4049-4052}, 1306 year = {2007}, 1307 doi = {10.1002/pssa.200777359}, 1308 petsc_uses = {KSP} 1309} 1310 1311@InProceedings{ sg2007, 1312 author = {Simon Greaves}, 1313 title = {Micromagnetic Simulations of Magnetic Recording Media}, 1314 booktitle = {High Performance Computing on Vector Systems 2007}, 1315 doi = {10.1007/978-3-540-74384-2_17}, 1316 petsc_uses = {KSP} 1317} 1318 1319@Article{ bsc2007, 1320 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 1321 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm {NiFe} Nanorings}, 1322 journal = {IEEE Trans. Magn.}, 1323 volume = {43}, 1324 year = {2007}, 1325 pages = {2884-2886}, 1326 doi = {10.1109/TMAG.2007.892867}, 1327 petsc_uses = {KSP} 1328} 1329 1330@Article{ ffbf, 1331 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 1332 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 1333 Micromagnetic Simulations: Nmag.}, 1334 journal = {IEEE Trans. Magn. Volume}, 1335 volume = {43}, 1336 pages = {2896-2898}, 1337 doi = {10.1109/TMAG.2007.893843}, 1338 petsc_uses = {KSP} 1339} 1340 1341@InBook{ dfssfs2006, 1342 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 1343 chapter = {Computational Aspects of Micromagnetics}, 1344 title = {The Science of Hysteresis}, 1345 editor = { G. Bertotti and I. Mayergoyz}, 1346 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 1347 petsc_uses = {KSP} 1348} 1349 1350@InBook{ fss, 1351 author = {J. Fidler and T. Schrefl and W. Scholz}, 1352 chapter = {Computational Micromagnetics}, 1353 title = {Handbook of Theoretical and Computational Nanotechnology}, 1354 editor = {M. Rieth and W. Schommers}, 1355 url = {http://www.amazon.com/gp/product/158883042X}, 1356 petsc_uses = {KSP} 1357} 1358 1359@InBook{ shbsef, 1360 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 1361 Josef Fidler}, 1362 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 1363 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 1364 editor = {Helmut Kronmueller and Stuart Parkin}, 1365 doi = {10.1002/9780470022184.hmm203}, 1366 petsc_uses = {KSP} 1367} 1368 1369@InBook{ sfs, 1370 author = {D. Suess and J. Fidler and T. Schrefl}, 1371 chapter = {Micromagnetic Simulation of magnetic materials}, 1372 title = {Handbook of Magnetic Materials}, 1373 editor = {K. H. J. Buschow}, 1374 url = {http://www.amazon.com/gp/product/0444518509}, 1375 petsc_uses = {KSP} 1376} 1377 1378@Article{ fsxzs, 1379 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 1380 Sharma}, 1381 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 1382 Recording.}, 1383 journal = {IEEE Trans. Magn. Volume}, 1384 volume = {43}, 1385 pages = {2175-2177}, 1386 doi = {10.1109/TMAG.2007.893122}, 1387 petsc_uses = {KSP} 1388} 1389 1390@Article{ sb2006, 1391 author = {W. Scholz and S. Batra}, 1392 title = {Effect of write current waveform on magnetization and head field dynamics of 1393 perpendicular recording heads}, 1394 journal = {IEEE Trans. Magn.}, 1395 volume = {42}, 1396 year = {2006}, 1397 pages = {2264--2266}, 1398 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 1399 petsc_uses = {KSP} 1400} 1401 1402@Article{ bsr2006, 1403 author = {S. Batra and W. Scholz and T. Roscamp}, 1404 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 1405 recording system}, 1406 journal = {J. Appl. Phys.}, 1407 volume = {99}, 1408 year = {2006}, 1409 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 1410 petsc_uses = {KSP} 1411} 1412 1413@InProceedings{ japios2006, 1414 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 1415 Subramanian}, 1416 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 1417 in systems with cubic and uniaxial anisotropy.}, 1418 booktitle = {Intermag 2006 Conference}, 1419 petsc_uses = {KSP} 1420} 1421 1422@Article{ kbmb2006, 1423 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 1424 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 1425 Perpendicular Recording Heads}, 1426 journal = {IEEE Trans. Magn.}, 1427 volume = {42}, 1428 year = {2006}, 1429 pages = {2428--2430}, 1430 doi = {10.1109/TMAG.2006.879430}, 1431 petsc_uses = {KSP} 1432} 1433 1434@Article{ cclcw2006, 1435 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 1436 title = {Control of Domain Wall Motion in Permalloy Ring}, 1437 journal = {IEEE Trans. Magn.}, 1438 volume = {42}, 1439 year = {2006}, 1440 pages = {2960--2962}, 1441 doi = {10.1109/TMAG.2006.878414}, 1442 petsc_uses = {KSP} 1443} 1444 1445@Article{ bfmfzczg2007, 1446 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 1447 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 1448 title = {Micromagnetic modelling of ferromagnetic cones}, 1449 journal = {J. Magn. Magn. Mater.}, 1450 volume = {312}, 1451 year = {2007}, 1452 pages = {234-238}, 1453 url = {http://eprints.soton.ac.uk/45900/}, 1454 petsc_uses = {KSP} 1455} 1456 1457@PhDThesis{ rb2005, 1458 author = {Richard Boardman}, 1459 title = {Computer simulation studies of magnetic nanostructures}, 1460 school = {Computational Engineering and Design Group, School of Engineering Sciences, 1461 University of Southampton, United Kingdom}, 1462 year = {2005}, 1463 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 1464 petsc_uses = {KSP} 1465} 1466 1467@InProceedings{ cwwy2006, 1468 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 1469 title = {MPI Performance Analysis Tools on Blue Gene/L}, 1470 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 1471 year = {2006}, 1472 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 1473 petsc_uses = {KSP} 1474} 1475 1476@InProceedings{ ch2006, 1477 author = {I.-H. Chung and J.K. Hollingsworth}, 1478 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 1479 Programs}, 1480 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 1481 pages = {45--56}, 1482 doi = {10.1109/HPDC.2006.1652135}, 1483 petsc_uses = {KSP} 1484} 1485 1486@Article{ lkpl2005, 1487 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1488 title = {Multibit {MRAM} using a pair of memory cells}, 1489 journal = {IEEE Trans. Magn.}, 1490 volume = {41}, 1491 year = {2005}, 1492 pages = {2670-2672}, 1493 doi = {10.1109/TMAG.2005.855288}, 1494 petsc_uses = {KSP} 1495} 1496 1497@Article{ gscn2005, 1498 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 1499 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 1500 journal = {Phys. Rev. B}, 1501 volume = {71}, 1502 year = {2005}, 1503 doi = {10.1103/PhysRevB.71.144407}, 1504 petsc_uses = {KSP} 1505} 1506 1507@PhDThesis{ mda, 1508 author = {Massimiliano d'Aquino}, 1509 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 1510 school = { Universita di Napoli Federico II.}, 1511 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 1512 petsc_uses = {KSP} 1513} 1514 1515@TechReport{ ssdfssf2003, 1516 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 1517 Stehno and J. Fidler}, 1518 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 1519 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 1520 petsc_uses = {KSP} 1521} 1522 1523@InProceedings{ sb2006a, 1524 author = {W. Scholz and S. Batra}, 1525 title = {Effect of write current waveform on magnetization and head field dynamics of 1526 perpendicular recording heads}, 1527 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 1528 petsc_uses = {KSP} 1529} 1530 1531@Article{ scholz-batra1, 1532 author = {W. Scholz and S. Batra}, 1533 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 1534 Recording}, 1535 journal = {IEEE Trans. Magn.}, 1536 note = {submitted}, 1537 year = {2005}, 1538 petsc_uses = {KSP} 1539} 1540 1541@Article{ scholz-batra2, 1542 author = {W. Scholz and S. Batra}, 1543 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 1544 journal = {IEEE Trans. Magn.}, 1545 volume = {41}, 1546 year = {2005}, 1547 pages = {702-706}, 1548 petsc_uses = {KSP} 1549} 1550 1551@Article{ daquino-scholz1, 1552 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1553 title = {Micromagnetic Analysis of Fast Precessional Switching}, 1554 journal = {J. Magn. Magn. Mater.}, 1555 volume = {290-291}, 1556 year = {2005}, 1557 pages = {510-513}, 1558 petsc_uses = {KSP} 1559} 1560 1561@Article{ aq-scholz-fid, 1562 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1563 title = {Numerical and analytical study of fast precessional switching}, 1564 journal = {J. Appl. Phys.}, 1565 volume = {95}, 1566 year = {2004}, 1567 pages = {7055-7057}, 1568 petsc_uses = {KSP} 1569} 1570 1571@InProceedings{ gar-tabik-gar, 1572 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 1573 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 1574 Scatterers}, 1575 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 1576 (PDP'04)}, 1577 year = {2004}, 1578 pages = {80--}, 1579 petsc_uses = {KSP} 1580} 1581 1582@InProceedings{ aq-scholz-mia, 1583 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 1584 title = {Analysis of fast precessional switching in magnetic thin films}, 1585 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 1586 year = {2004}, 1587 pages = {257-260}, 1588 petsc_uses = {KSP} 1589} 1590 1591@Article{ scholz-fid-seus, 1592 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 1593 Dittrich and V. Tsiantos}, 1594 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 1595 Axes}, 1596 journal = {J. Magn. Magn. Mater.}, 1597 year = {2004}, 1598 pages = {1524-1525}, 1599 petsc_uses = {KSP} 1600} 1601 1602@Article{ boardman-zimmerman, 1603 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 1604 Peter de Groot}, 1605 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 1606 journal = {Journal of Applied Physics}, 1607 year = {2005}, 1608 petsc_uses = {KSP} 1609} 1610 1611@Article{ lim-kim-park, 1612 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1613 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 1614 journal = {IEEE Trans. Magn.}, 1615 note = {submitted}, 1616 petsc_uses = {KSP} 1617} 1618 1619@Article{ scholz-suess2, 1620 author = {W. Scholz and D. Suess and T. Schrefl and J. Fidler}, 1621 title = {Micromagnetic simulation of magnetization reversal in small particles with 1622 surface anisotropy}, 1623 journal = {J. Appl. Phys.}, 1624 volume = {95}, 1625 year = {2004}, 1626 pages = {6807-6809}, 1627 petsc_uses = {KSP} 1628} 1629 1630@Article{ scholz-schrefl1, 1631 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 1632 Tsiantos}, 1633 title = {Micromagnetic simulation of the pinning and depinning process in permanent 1634 magnets}, 1635 journal = {IEEE Trans. Magn.}, 1636 volume = {39}, 1637 year = {2003}, 1638 pages = {2920-2922}, 1639 petsc_uses = {KSP} 1640} 1641 1642@Article{ scholz-guslienko, 1643 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 1644 W. Chantrell and J. Fidler}, 1645 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 1646 nanodots}, 1647 journal = {J. Magn. Magn. Mater.}, 1648 volume = {266}, 1649 year = {2003}, 1650 pages = {155-163}, 1651 petsc_uses = {KSP} 1652} 1653 1654@Article{ scholz1, 1655 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 1656 Forster and V. Tsiantos}, 1657 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1658 journal = {Comp. Mat. Sci}, 1659 year = {2003}, 1660 pages = {366--383}, 1661 volume = {28}, 1662 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 1663 petsc_uses = {KSP} 1664} 1665 1666@PhDThesis{ scholz2, 1667 author = {W. Scholz}, 1668 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1669 school = {Vienna University of Technology, Vienna, Austria}, 1670 year = {2003}, 1671 petsc_uses = {KSP} 1672} 1673 1674@Article{ scholz3, 1675 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 1676 Forster and J. Fidler}, 1677 title = {Implementation of a high performance parallel finite element micromagnetics 1678 package}, 1679 journal = {J. Magn. Magn. Mater.}, 1680 year = {2004}, 1681 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 1682 petsc_uses = {KSP} 1683} 1684 1685% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1686@InBook{ zhanggladwell1, 1687 author = {W. Zhang and I. Gladwell}, 1688 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 1689 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 1690 year = {2000}, 1691 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 1692 Physics, vol. 552}, 1693 publisher = {Springer}, 1694 pages = {4190-}, 1695 petsc_uses = {KSP} 1696} 1697 1698@Article{ wolf1, 1699 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 1700 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 1701 thin films}, 1702 journal = {Phil. Mag. A}, 1703 year = {2003}, 1704 lab = {ANL}, 1705 petsc_uses = {KSP} 1706} 1707 1708@Article{ wolf2, 1709 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 1710 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 1711 grain-boundary properties}, 1712 journal = {Computational Materials Science}, 1713 year = {2001}, 1714 volume = {23}, 1715 pages = {15--32}, 1716 lab = {ANL}, 1717 petsc_uses = {KSP} 1718} 1719 1720@Article{ wolf3, 1721 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 1722 title = {Role of grain rotation in grain growth by mesoscale simulation}, 1723 journal = {Phil. Mag. A}, 1724 year = {2002}, 1725 volume = {82}, 1726 pages = {1271--1297}, 1727 lab = {ANL}, 1728 petsc_uses = {KSP} 1729} 1730 1731% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1732@Article{ saut, 1733 author = { Olivier Saut}, 1734 title = {Bidimensional Study of the {M}axwell-{B}loch Model in a Nonlinear Crystal}, 1735 journal = {SIAM Journal on Scientific Computing}, 1736 year = {2004}, 1737 note = {submitted}, 1738 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 1739 petsc_uses = {KSP} 1740} 1741 1742% LiteralHTML: 1743% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 1744% LiteralHTML: 1745@InBook{ khanallorenziayachepennec2016, 1746 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 1747 of Brain Deformation in {Alzheimer's} Disease}, 1748 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 1749 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 1750 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 1751 Miller}, 1752 pages = {167--176}, 1753 isbn = {978-3-319-28329-6}, 1754 doi = {10.1007/978-3-319-28329-6_15}, 1755 publisher = {Springer International Publishing}, 1756 year = {2016}, 1757 petsc_uses = {KSP} 1758} 1759 1760@Article{ ataseven, 1761 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 1762 title = {Parallel implementation of the accelerated {BEM} approach for {EMSI} of the human 1763 brain}, 1764 journal = {Medical and Biological Engineering and Computing}, 1765 month = feb, 1766 year = {2008}, 1767 doi = {10.1007/s11517-008-0316-0}, 1768 petsc_uses = {KSP} 1769} 1770 1771@Article{ dennis-eberhart-03, 1772 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 1773 pages = {832-840}, 1774 volume = {125}, 1775 number = {6}, 1776 title = {Finite-element simulation of cooling of realistic {3-D} human head and neck}, 1777 journal = {J Biomech Eng}, 1778 year = {2003}, 1779 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 1780 petsc_uses = {KSP} 1781} 1782 1783@Conference{ gu7174parallel, 1784 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 1785 frequency-domain small animal optical tomography}}, 1786 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 1787 booktitle = {Proc. of SPIE Vol}, 1788 volume = {7174}, 1789 number = {717406}, 1790 pages = {1}, 1791 petsc_uses = {KSP} 1792} 1793 1794@Article{ barchanski2005using, 1795 title = {{Using domain decomposition techniques for the calculation of low-frequency 1796 electric current densities in high-resolution 3D human anatomy models}}, 1797 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 1798 T.}, 1799 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 1800 and Electronic Engineering}, 1801 volume = {24}, 1802 number = {2}, 1803 pages = {458--467}, 1804 issn = {0332-1649}, 1805 year = {2005}, 1806 publisher = {Emerald Group Publishing Limited}, 1807 petsc_uses = {KSP} 1808} 1809 1810@Article{ motrescurienen05, 1811 author = {V. C. Motrescu and U. van Rienen}, 1812 pages = {227--231}, 1813 volume = {3}, 1814 title = {Computation of currents induced by {ELF} electric fields in anisotropic human 1815 tissues using the Finite Integration Technique}, 1816 journal = {Advances in Radio Science}, 1817 year = {2005}, 1818 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 1819 petsc_uses = {KSP} 1820} 1821 1822@Article{ motrescurienen04, 1823 author = {V. C. Motrescu and U. van Rienen}, 1824 pages = {309--313}, 1825 volume = {2}, 1826 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 1827 Integration Technique (FIT)}, 1828 journal = {Advances in Radio Science}, 1829 year = {2004}, 1830 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 1831 petsc_uses = {KSP} 1832} 1833 1834@InProceedings{ dbl2, 1835 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 1836 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 1837 booktitle = {ECCOMAS2000}, 1838 year = {2000}, 1839 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 1840 petsc_uses = {KSP} 1841} 1842 1843@Unpublished{ cell, 1844 title = {Parallel Simulation Engines for Whole-Cell Models}, 1845 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 1846 Weber}, 1847 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 1848 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 1849 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 1850 year = {2001}, 1851 petsc_uses = {KSP} 1852} 1853 1854@Article{ barker2010two, 1855 title = {Two-level {N}ewton and hybrid {S}chwarz preconditioners for fluid-structure 1856 interaction}, 1857 author = {Barker, A.T. and Cai, X.C.}, 1858 journal = {SIAM Journal on Scientific Computing}, 1859 volume = {32}, 1860 number = {4}, 1861 pages = {2395--2417}, 1862 year = {2010}, 1863 publisher = {Society for Industrial and Applied Mathematics}, 1864 petsc_uses = {KSP} 1865} 1866 1867@Article{ barker2010scalable, 1868 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 1869 with application to blood flow modeling}, 1870 author = {Barker, A.T. and Cai, X.C.}, 1871 journal = {Journal of Computational Physics}, 1872 volume = {229}, 1873 number = {3}, 1874 pages = {642--659}, 1875 year = {2010}, 1876 publisher = {Elsevier}, 1877 petsc_uses = {KSP} 1878} 1879 1880@Article{ barker2009nks, 1881 title = {{NKS} for fully coupled fluid-structure interaction with application}, 1882 author = {Barker, A.T. and Cai, X.C.}, 1883 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 1884 pages = {275--282}, 1885 year = {2009}, 1886 publisher = {Springer}, 1887 petsc_uses = {KSP} 1888} 1889 1890@Article{ mirams2013, 1891 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 1892 and Yi Cui and Gary R Mirams}, 1893 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 1894 to predict {QT} interval changes in the rabbit ventricular wedge}, 1895 journal = {Journal of pharmacological and toxicological methods}, 1896 volume = {68}, 1897 number = {1}, 1898 pages = {88--96}, 1899 year = {2013}, 1900 doi = {10.1016/j.vascn.2013.04.004}, 1901 petsc_uses = {KSP} 1902} 1903 1904% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1905% LiteralHTML: <center><img alt="" 1906% LiteralHTML: src="images/spine0l.jpg"></center></p> 1907% LiteralHTML: <center><img alt="" 1908% LiteralHTML: src="images/vertebra.jpg"></center></p> 1909% LiteralHTML:<font color="#FF0000"> 1910% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 1911% LiteralHTML:Understanding bone mechanical properties and how they may lead to 1912% LiteralHTML:fractures is thus an important medical research activity. PETSc and 1913% LiteralHTML:Prometheus have been used for extremely large scale finite element 1914% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 1915% LiteralHTML:team of doctors and computational scientists. This computation was 1916% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 1917% LiteralHTML:with over 4000 processors.</p> 1918% LiteralHTML: </font> 1919@Article{ arbenz2008scalable, 1920 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 1921 analysis of human bone structures}, 1922 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 1923 journal = {International Journal for Numerical Methods in Engineering}, 1924 volume = {73}, 1925 number = {7}, 1926 pages = {927--947}, 1927 year = {2008}, 1928 publisher = {Wiley Online Library}, 1929 petsc_uses = {KSP} 1930} 1931 1932@InProceedings{ adams-04, 1933 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1934 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 1935 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 1936 half a billion degrees of freedom}, 1937 note = {Gordon Bell Award}, 1938 year = {2004}, 1939 petsc_uses = {KSP} 1940} 1941 1942@InProceedings{ adams-03b, 1943 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1944 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 1945 Whole Bone Micro-Mechanics on the {IBM SP}}, 1946 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 1947 year = {2003}, 1948 petsc_uses = {KSP} 1949} 1950 1951@InProceedings{ oghattas2002, 1952 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 1953 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 1954 booktitle = {Procceedings of SC2002}, 1955 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 1956 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 1957 by time-dependent PDEs, and scalability results for an inverse wave propagation 1958 problem of determining the material field of an acoustic medium. Using the 1959 algorithm, they solved a synthetic inverse wave propagation problem though a 1960 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 1961 processors.}, 1962 year = {2002}, 1963 petsc_uses = {KSP} 1964} 1965 1966% LiteralHTML: <a name="biology:cardiology"> 1967% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1968% LiteralHTML: <center><img alt="" 1969% LiteralHTML: src="images/heart.jpg"> 1970% LiteralHTML: <img alt="" 1971% LiteralHTML: src="images/pump.jpg"></center></p> 1972% LiteralHTML: 1973% LiteralHTML:<font color="#FF0000"> 1974% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 1975% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 1976% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 1977% LiteralHTML: through the heart. PETSc has been used by several research groups to 1978% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 1979% LiteralHTML: fully understand the developments of arrhthmias.</p> 1980% LiteralHTML:</font> 1981@InProceedings{ oghattas2000, 1982 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1983 Walkington}, 1984 title = {A Parallel Dynamic-Mesh {L}agrangian Method for Simulation of Flows with Dynamic 1985 Interfaces}, 1986 booktitle = {Procceedings of SC2000}, 1987 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1988 note = {Blood flow modeling at the microscale including effects on individual blood 1989 cells, for designing heart assist pumps, etc.}, 1990 year = {2000}, 1991 petsc_uses = {KSP} 1992} 1993 1994@InBook{ cfps2006, 1995 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1996 editor = {A. Quarteroni et al.}, 1997 title = {Complex Systems in Biomedicine}, 1998 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1999 publisher = {Springer-Verlag}, 2000 pages = {187--241}, 2001 year = {2006}, 2002 petsc_uses = {KSP} 2003} 2004 2005@InProceedings{ cfpst2007, 2006 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 2007 title = {Determining recovery times from transmembrane action potentials and unipolar 2008 electrograms in normal heart tissue}, 2009 booktitle = {FIMH07}, 2010 publisher = {Springer-Verlag}, 2011 volume = {4466}, 2012 pages = {139--149}, 2013 year = {2007}, 2014 petsc_uses = {KSP} 2015} 2016 2017@Article{ seemann2010framework, 2018 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 2019 Equations Using PETSc}}, 2020 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 2021 D{\\"o}ssel, O.}, 2022 journal = {Progress in Industrial Mathematics at ECMI 2008}, 2023 pages = {363--369}, 2024 year = {2010}, 2025 publisher = {Springer}, 2026 petsc_uses = {KSP} 2027} 2028 2029@InProceedings{ pft2005, 2030 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 2031 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 2032 Intramural Heterogeneity}, 2033 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 2034 pages = {267--277}, 2035 editors = {A. Frangi et al.}, 2036 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 2037 year = {2005}, 2038 petsc_uses = {KSP} 2039} 2040 2041@Article{ bgcp2005, 2042 author = {Boyce E. Griffith and Charles S. Peskin}, 2043 title = {On the order of accuracy of the immersed boundary method: Higher order 2044 convergence rates for sufficiently smooth problems}, 2045 journal = {Journal of Computational Physics}, 2046 year = {2005}, 2047 volume = {208}, 2048 pages = {75--105}, 2049 petsc_uses = {KSP} 2050} 2051 2052@Article{ griffith2007adaptive, 2053 title = {An adaptive, formally second order accurate version of the immersed boundary 2054 method}, 2055 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 2056 journal = {Journal of Computational Physics}, 2057 volume = {223}, 2058 number = {1}, 2059 pages = {10--49}, 2060 year = {2007}, 2061 publisher = {Elsevier}, 2062 petsc_uses = {KSP} 2063} 2064 2065@PhDThesis{ griffith05, 2066 author = {Boyce Griffith}, 2067 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 2068 parallel version of the immersed boundary method}, 2069 school = {New York University}, 2070 year = {2005}, 2071 petsc_uses = {KSP} 2072} 2073 2074@PhDThesis{ murillo, 2075 author = {Maria S. Murillo}, 2076 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 2077 Differential Equations with an Application in Computational Biology}, 2078 school = {University of Colorado at Boulder}, 2079 year = {2002}, 2080 petsc_uses = {KSP} 2081} 2082 2083@Article{ spv2004, 2084 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 2085 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 2086 journal = {IEEE Trans. Biomed. Eng}, 2087 year = {2004}, 2088 volume = {51}, 2089 pages = {1960--1968}, 2090 petsc_uses = {KSP} 2091} 2092 2093@Article{ vphl2003, 2094 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 2095 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 2096 journal = {J. Electrocardiol.}, 2097 year = {2003}, 2098 volume = {36}, 2099 pages = {69--74}, 2100 petsc_uses = {KSP} 2101} 2102 2103@InProceedings{ spbv2003, 2104 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and E.J. Vigmond}, 2105 title = {Preconditioning Techniques for the Bidomain Equations}, 2106 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2107 Methods}, 2108 pages = {571--580}, 2109 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2110 note = {}, 2111 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2112 year = {2003}, 2113 petsc_uses = {KSP} 2114} 2115 2116@Article{ franz-pavir-04, 2117 author = {P. Colli Franzone and L.~F. Pavarino}, 2118 title = {A parallel solver for reaction-diffusion systems in computational 2119 electrocardiology}, 2120 journal = {Mathematical Models and Methods in Applied Sciences}, 2121 year = {2004}, 2122 volume = {14}, 2123 number = {6}, 2124 pages = {883--912}, 2125 petsc_uses = {KSP} 2126} 2127 2128@Article{ franz-pavir-05, 2129 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2130 title = {Simulating patterns of excitation, repolarization and action potential 2131 durationwith cardiac Bidomain and Monodomain models}, 2132 journal = {Mathematical Biosciences}, 2133 year = {2005}, 2134 volume = {197}, 2135 number = {1}, 2136 pages = {35--66}, 2137 petsc_uses = {KSP} 2138} 2139 2140@Article{ franz-pavir-06, 2141 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2142 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 2143 the dispersion of cardiac repolarization and action potential duration: a 2144 simulation study}, 2145 journal = {Mathematical Biosciences}, 2146 year = {2006}, 2147 volume = {204}, 2148 number = {1}, 2149 pages = {132--165}, 2150 petsc_uses = {KSP} 2151} 2152 2153@InProceedings{ colli-franz-sim, 2154 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 2155 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 2156 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 2157 Mediterranean Conference on Medical and Biological Engineering}, 2158 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 2159 year = {2004}, 2160 petsc_uses = {KSP} 2161} 2162 2163@InProceedings{ pf2003, 2164 author = {Luca F. Pavarino and Piero Colli Franzone}, 2165 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 2166 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2167 Methods}, 2168 pages = {669--776}, 2169 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2170 note = {}, 2171 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2172 year = {2003}, 2173 petsc_uses = {KSP} 2174} 2175 2176@Article{ maria-is04, 2177 author = {Maria Murillo and Xiao-Chuan Cai}, 2178 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 2179 activity of the heart}, 2180 journal = {Numerical Linear Algebra with Applications}, 2181 year = {2004}, 2182 volume = {11}, 2183 pages = {261 - 277}, 2184 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 2185 petsc_uses = {KSP} 2186} 2187 2188@Article{ murli2007monitoring, 2189 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 2190 Imaging in a Grid computing PSE}}, 2191 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 2192 and Lapegna, M.}, 2193 journal = {Grid-Based Problem Solving Environments}, 2194 pages = {421--432}, 2195 year = {2007}, 2196 publisher = {Springer}, 2197 petsc_uses = {KSP} 2198} 2199 2200@Article{ carracciuolo:2006:tpc, 2201 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 2202 title = {Towards a parallel component for imaging in {PETSc} programming environment: a case 2203 study in {3-D} echocardiography}, 2204 journal = {Parallel Comput.}, 2205 volume = {32}, 2206 issue = {1}, 2207 month = jan, 2208 year = {2006}, 2209 issn = {0167-8191}, 2210 pages = {67--83}, 2211 numpages = {17}, 2212 doi = {10.1016/j.parco.2005.09.001}, 2213 acmid = {1141218}, 2214 publisher = {Elsevier Science Publishers B. V.}, 2215 address = {Amsterdam, The Netherlands, The Netherlands}, 2216 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 2217 component}, 2218 petsc_uses = {KSP} 2219} 2220 2221@Article{ damore2011integration, 2222 title = {Integration of emerging computer technologies for an efficient image sequences 2223 analysis}, 2224 journal = {Integrated Computer-Aided Engineering }, 2225 volume = {18}, 2226 number = {4}, 2227 pages = {365 - 378}, 2228 year = {2011}, 2229 note = {}, 2230 issn = {1875-8835}, 2231 doi = {10.3233/ICA-2011-0382}, 2232 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 2233 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 2234 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 2235 petsc_uses = {KSP} 2236} 2237 2238@InProceedings{ eth_biwi_00721, 2239 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and G. 2240 Székely}, 2241 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 2242 a {S}chur Complement Preconditioner}, 2243 booktitle = {Euro-Par 2009 Parallel Processing}, 2244 year = {2009}, 2245 month = aug, 2246 pages = {747-759}, 2247 volume = {5704}, 2248 editor = {H. Sips and D. Epema and H.-X. Lin}, 2249 series = {Lecture Notes in Computer Science}, 2250 publisher = {Springer}, 2251 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 2252 parallel Krylov solver}, 2253 petsc_uses = {KSP} 2254} 2255 2256% LiteralHTML: <a name="biology:imagingandsurgery"> 2257% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 2258% LiteralHTML: <center><img alt="" 2259% LiteralHTML: src="images/brain.jpg"></center> 2260@Article{ ganser2004deformable, 2261 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 2262 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 2263 journal = {Medical Image Analysis}, 2264 volume = {8}, 2265 number = {1}, 2266 pages = {3--22}, 2267 year = {2004}, 2268 publisher = {Elsevier}, 2269 petsc_uses = {KSP} 2270} 2271 2272@Unpublished{ taccsurgery, 2273 title = {{TACC} supercomputer performs laser cancer surgery on canine}, 2274 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 2275 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 2276 Austin performed laser surgery on a dog in Houston without the intervention of a 2277 surgeon. The treatment was developed collaboratively by computational experts from 2278 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 2279 leading technologists from the M.D. Anderson Cancer Center in Houston, and 2280 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 2281 state-of-the-art thermal imaging technology, and advanced computational methods, 2282 dynamic, data-driven treatments are being pursued as a minimally invasive 2283 alternative to the standard treatment of cancer.}, 2284 petsc_uses = {KSP} 2285} 2286 2287@Article{ ffhbresso2008, 2288 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 2289 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 2290 Tinsley Oden}, 2291 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 2292 journal = {Engineering with Computers}, 2293 note = {Special issue on Computational Bioengineering}, 2294 year = {2008}, 2295 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 2296 petsc_uses = {KSP} 2297} 2298 2299@TechReport{ dobbhbbbdeffghkkps2008, 2300 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 2301 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 2302 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 2303 and S. Prudhomme and R. J. Stafford}, 2304 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 2305 Cancer}, 2306 year = {2008}, 2307 institution = {University of Texas at Austin}, 2308 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 2309 petsc_uses = {KSP} 2310} 2311 2312@Article{ ogdb2004, 2313 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 2314 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 2315 journal = {Physics in Medicine and Biology}, 2316 year = {2004}, 2317 volume = {49}, 2318 pages = {2955--2947}, 2319 petsc_uses = {KSP} 2320} 2321 2322@InProceedings{ majumdar11, 2323 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 2324 Baldridge and P. Krysl}, 2325 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 2326 booktitle = {ICCS 2005}, 2327 pages = {672--679}, 2328 editor = {V.S. Sunderam et al.}, 2329 year = {2005}, 2330 petsc_uses = {KSP} 2331} 2332 2333@Conference{ sermesant-etal:03, 2334 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 2335 Ayache, H.}, 2336 title = {A parallel implementation of non-rigid registration using a volumetric 2337 biomechanical model}, 2338 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 2339 address = {Philadelphia, PA, USA}, 2340 publisher = {Springer-Verlag}, 2341 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2342 series = {Lecture Notes in Computer Science}, 2343 volume = {2717}, 2344 pages = {398-407}, 2345 date = {june 23-24}, 2346 year = {2003}, 2347 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 2348 petsc_uses = {KSP} 2349} 2350 2351@Conference{ sermesant-etal:04, 2352 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 2353 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 2354 title = {A Novel Nonrigid Registration Algorithm And Applications}, 2355 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 2356 address = {Philadelphia, PA, USA}, 2357 publisher = {Springer-Verlag}, 2358 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2359 series = {Lecture Notes in Computer Science}, 2360 volume = {2208}, 2361 pages = {923}, 2362 year = {2003}, 2363 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 2364 petsc_uses = {KSP} 2365} 2366 2367@Article{ warfield-haker-talos-05, 2368 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 2369 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 2370 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 2371 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 2372 title = {Capturing intraoperative deformations: research experience at {B}righam and {W}omen's 2373 hospital}, 2374 journal = {Medical Image Analysis}, 2375 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 2376 year = {2005}, 2377 petsc_uses = {KSP} 2378} 2379 2380@Article{ brain3, 2381 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 2382 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 2383 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 2384 Deformation during Image Guided Neurosurgery}, 2385 journal = {Computing and Visualization in Science}, 2386 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 2387 year = {2002}, 2388 petsc_uses = {KSP} 2389} 2390 2391@Article{ brain2, 2392 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 2393 Kikinis and Simon K. Warfield}, 2394 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 2395 Element Biomechanical Model}, 2396 journal = {IEEE Transactions on Medical Imaging}, 2397 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 2398 year = {2001}, 2399 petsc_uses = {KSP} 2400} 2401 2402@InProceedings{ brain1, 2403 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 2404 Ferenc A. Jolesz and Ron Kikinis}, 2405 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 2406 Guided Neurosurgery}, 2407 booktitle = {Proceedings of SC2000}, 2408 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 2409 year = {2000}, 2410 petsc_uses = {KSP} 2411} 2412 2413@Article{ vanne06, 2414 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 2415 M. Lassas and M. Kalke}, 2416 title = {Parallelized {B}ayesian inversion for three-dimensional dental {X}-ray imaging}, 2417 journal = {IEEE Transactions on Medical Imaging}, 2418 volume = {25}, 2419 number = {2}, 2420 month = feb, 2421 year = {2006}, 2422 pages = {218--228}, 2423 petsc_uses = {KSP} 2424} 2425 2426@InProceedings{ knepleybardhan2015, 2427 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 2428 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 2429 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 2430 Exposition}, 2431 volume = {9}, 2432 pages = {V009T12A04}, 2433 doi = {10.1115/IMECE2015-53579}, 2434 year = {2015}, 2435 petsc_uses = {KSP} 2436} 2437 2438@InProceedings{ bardhanknepley2015, 2439 title = {Multiscale models and approximation algorithms for protein electrostatics}, 2440 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 2441 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 2442 volume = {61}, 2443 pages = {163--174}, 2444 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 2445 doi = {10.2495/BEM380131}, 2446 publisher = {WIT Press}, 2447 year = {2015}, 2448 petsc_uses = {KSP} 2449} 2450 2451% LiteralHTML: 2452% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 2453% LiteralHTML: 2454@InProceedings{ adamsbrennanknepleywang2022, 2455 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 2456 quench plasmas}, 2457 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 2458 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 2459 (IPDPS '22)}, 2460 doi = {10.1109/IPDPS53621.2022.00020}, 2461 year = {2022}, 2462 petsc_uses = {DMPlex} 2463} 2464 2465@Misc{ adamsknepleybrennan2021, 2466 title = {Runaway Electron Generation with High-Performance, Structure Preserving 2467 Discretization of {F}okker--{P}lank--{L}andau}, 2468 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 2469 year = {2021}, 2470 petsc_uses = {KSP} 2471} 2472 2473@Article{ adamshirvijokiknepleybrownisaacmills2017, 2474 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 2475 Architectures}, 2476 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 2477 Isaac and Richard Mills}, 2478 journal = {SIAM Journal on Scientific Computing}, 2479 volume = {39}, 2480 number = {6}, 2481 pages = {C452--C465}, 2482 doi = {10.1137/17M1118828}, 2483 eprint = {1702.08880}, 2484 year = {2017}, 2485 petsc_uses = {KSP} 2486} 2487 2488@Article{ pusztayknepleyadams2022, 2489 title = {Conservative Projection Between {FEM} and Particle Bases}, 2490 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 2491 journal = {SIAM Journal on Scientific Computing}, 2492 volume = {44}, 2493 number = {4}, 2494 pages = {C310--C319}, 2495 doi = {10.1137/21M145407}, 2496 year = {2022} 2497} 2498 2499@Article{ hirvijoki2017, 2500 author = {Eero Hirvijoki and Mark F. Adams}, 2501 title = {Conservative discretization of the {Landau} collision integral}, 2502 journal = {Physics of Plasmas}, 2503 volume = {24}, 2504 number = {3}, 2505 pages = {032121}, 2506 doi = {10.1063/1.4979122}, 2507 year = {2017}, 2508 petsc_uses = {KSP} 2509} 2510 2511@Article{ mollenadamsknepleyhagerchang2021, 2512 title = {Implementation of higher-order velocity mapping between marker particles and grid 2513 in the particle-in-cell code {XGC}}, 2514 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 2515 S. Chang}, 2516 journal = {Journal of Plasma Physics}, 2517 volume = {87}, 2518 number = {2}, 2519 pages = {905870229}, 2520 eprint = {2012.11764}, 2521 doi = {10.1017/S0022377821000441}, 2522 year = {2021}, 2523 petsc_uses = {KSP} 2524} 2525 2526@Article{ lsmh2014, 2527 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 2528 title = {Comparison of particle trajectories and collision operators for collisional 2529 transport in nonaxisymmetric plasmas}, 2530 journal = { Physics of Plasmas}, 2531 volume = {21}, 2532 year = {2014}, 2533 petsc_uses = {KSP} 2534} 2535 2536@Article{ lpcep2014, 2537 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 2538 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 2539 pedestal}, 2540 journal = {Plasma Physics and Controlled Fusion}, 2541 volume = {56}, 2542 year = {2014}, 2543 petsc_uses = {KSP} 2544} 2545 2546@Article{ facets-scidac08, 2547 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 2548 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 2549 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 2550 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 2551 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 2552 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 2553 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 2554 Stotler and A. Pigarov}, 2555 journal = {J. Phys.: Conf. Ser.}, 2556 volume = {125}, 2557 year = {2008}, 2558 pages = {012040}, 2559 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 2560 petsc_uses = {KSP} 2561} 2562 2563@Article{ facets-scidac09, 2564 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 2565 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 2566 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 2567 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 2568 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 2569 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 2570 and A. Pigarov and H. Zhang}, 2571 journal = {J. Phys.: Conf. Ser.}, 2572 volume = {180}, 2573 year = {2009}, 2574 pages = {012056}, 2575 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 2576 petsc_uses = {KSP} 2577} 2578 2579@InProceedings{ facets-scidac10, 2580 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 2581 {FACETS} Code}, 2582 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 2583 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 2584 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 2585 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 2586 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 2587 Pigarov and H. Zhang}, 2588 booktitle = {Proceedings of SciDAC 2010 Conference}, 2589 year = {2010}, 2590 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 2591 petsc_uses = {KSP} 2592} 2593 2594@InProceedings{ facets-fec2010, 2595 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 2596 the {FACETS} Framework}, 2597 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 2598 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 2599 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 2600 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 2601 Republic of Korea}, 2602 year = {2010}, 2603 petsc_uses = {KSP} 2604} 2605 2606@InProceedings{ facets-epdp2010, 2607 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 2608 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 2609 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 2610 Groebner and S. Balay and L. McInnes and H. Zhang}, 2611 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 2612 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 2613 year = {2010}, 2614 petsc_uses = {KSP} 2615} 2616 2617@Article{ carlssoncary09, 2618 author = {Johan Carlsson, John R. Cary}, 2619 title = {The hypersecant {J}acobian approximation for quasi-{N}ewton solves of sparse 2620 nonlinear systems}, 2621 journal = {arXiv}, 2622 year = {2009}, 2623 note = {http://arxiv.org/abs/0905.1054}, 2624 url = {http://arxiv.org/pdf/0905.1054v1}, 2625 petsc_uses = {KSP} 2626} 2627 2628@InProceedings{ oshahjs2006, 2629 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 2630 S.J. Janhunen and T.P. Kiviniemi}, 2631 title = {Performance enhancements to {ELMFIRE} gyrokinetic code leading to new ranges of 2632 application}, 2633 booktitle = {33rd EPS Conference on Plasma Phys.}, 2634 year = {2006}, 2635 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 2636 note = {European fusion code}, 2637 petsc_uses = {KSP} 2638} 2639 2640@Article{ zhu2006, 2641 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 2642 title = {Intermediate nonlinear evolution of the {P}arker instability: Formation of 2643 convection-induced discontinuities and absence of finite-time singularities}, 2644 journal = {Phys. Rev. Lett.}, 2645 volume = {96}, 2646 number = {065001}, 2647 year = {2006}, 2648 doi = {10.1103/PhysRevLett.96.065001}, 2649 petsc_uses = {KSP} 2650} 2651 2652@InProceedings{ ppc2005, 2653 author = {B. Philip and M. Pernice and L.Chacon}, 2654 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 2655 Refinement}, 2656 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 2657 methods}, 2658 year = {2005}, 2659 lab = {LANL}, 2660 petsc_uses = {KSP} 2661} 2662 2663@Article{ pp2005, 2664 author = {M. Pernice and B. Philip}, 2665 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 2666 Refinement}, 2667 year = {2005}, 2668 journal = {SIAM J. of Sci. Comput.}, 2669 lab = {LANL}, 2670 petsc_uses = {KSP} 2671} 2672 2673@Article{ gt2004, 2674 author = {A. H. Glasser and X. Z. Tang}, 2675 title = {The {SEL} macroscopic modeling code}, 2676 year = {2004}, 2677 journal = {Computer Physics Communications}, 2678 pages = {237--243}, 2679 volume = {164}, 2680 lab = {LANL}, 2681 petsc_uses = {KSP} 2682} 2683 2684@Article{ nl2006, 2685 author = {Y. Nishimura and Z.Lin}, 2686 title = {A finite element mesh in a tokamak edge geometry}, 2687 year = {2006}, 2688 journal = {Contributions to Plasma Physics}, 2689 volume = {22}, 2690 lab = {PPPL}, 2691 petsc_uses = {KSP} 2692} 2693 2694@Article{ nlle2004, 2695 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 2696 title = {A finite element {P}oisson solver for gyrokinetic particle simulations in a global 2697 field aligned mesh}, 2698 year = {2006}, 2699 journal = {J. Comput. Phys.}, 2700 volume = {214}, 2701 pages = {657}, 2702 lab = {PPPL}, 2703 petsc_uses = {KSP} 2704} 2705 2706@InProceedings{ lnlle2004, 2707 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 2708 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 2709 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2710 year = {2004}, 2711 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 2712 lab = {PPPL}, 2713 petsc_uses = {KSP} 2714} 2715 2716@InProceedings{ nlclew2004, 2717 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 2718 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 2719 model}, 2720 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2721 year = {2004}, 2722 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 2723 lab = {PPPL}, 2724 petsc_uses = {KSP} 2725} 2726 2727@Article{ tb1, 2728 author = {X.~Z.~Tang and A.~H.~Boozer}, 2729 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 2730 plasma}, 2731 journal = {Physics of Plasmas}, 2732 year = {2004}, 2733 pages = {171--185}, 2734 volume = {11}, 2735 lab = {LANL}, 2736 petsc_uses = {KSP} 2737} 2738 2739@Unpublished{ nlcw, 2740 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 2741 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 2742 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 2743 Albuquerque, New Mexico, October 2003}, 2744 year = {2003}, 2745 petsc_uses = {KSP} 2746} 2747 2748@TechReport{ tang2001, 2749 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 2750 Strauss}, 2751 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 2752 year = {2001}, 2753 institution = {Princeton Plasma Physics Laboratory}, 2754 number = {PPPL-3532}, 2755 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 2756 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 2757 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 2758 March 12-14, 2001.}, 2759 lab = {PPPL}, 2760 petsc_uses = {KSP} 2761} 2762 2763% LiteralHTML: 2764% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 2765% LiteralHTML: 2766@Article{ valerathomasgarciacastillo2019, 2767 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 2768 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 2769 Coastal Ocean Model}, 2770 journal = {Journal of Marine Science and Engineering}, 2771 volume = {7}, 2772 number = {6}, 2773 article-number= {185}, 2774 url = {https://www.mdpi.com/2077-1312/7/6/185}, 2775 issn = {2077-1312}, 2776 doi = {10.3390/jmse7060185}, 2777 year = {2019}, 2778 petsc_uses = {KSP} 2779} 2780 2781@Article{ furuichimat2015, 2782 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 2783 thermal convection simulation surrounded by free surface}, 2784 author = {Mikito Furuichi and Dave A May}, 2785 journal = {Computer Physics Communications}, 2786 volume = {192}, 2787 pages = {1--11}, 2788 year = {2015}, 2789 petsc_uses = {KSP} 2790} 2791 2792@Article{ sharplesmoresivelicjadamecmay2016, 2793 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 2794 model}, 2795 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 2796 Dave A May}, 2797 journal = {Physics of the Earth and Planetary Interiors}, 2798 volume = {252}, 2799 pages = {77--90}, 2800 year = {2016}, 2801 petsc_uses = {KSP} 2802} 2803 2804@Article{ spiegelmanmaywilson2016, 2805 title = {On the solvability of incompressible {S}tokes with viscoplastic rheologies in 2806 geodynamics}, 2807 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 2808 journal = {Geochemistry, Geophysics, Geosystems}, 2809 volume = {17}, 2810 number = {6}, 2811 pages = {2213--2238}, 2812 year = {2016}, 2813 petsc_uses = {KSP} 2814} 2815 2816@Article{ buiteretal2016, 2817 title = {Benchmarking numerical models of brittle thrust wedges}, 2818 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 2819 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 2820 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 2821 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 2822 journal = {Journal of structural geology}, 2823 volume = {92}, 2824 pages = {140--177}, 2825 year = {2016}, 2826 petsc_uses = {KSP} 2827} 2828 2829@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 2830 title = {Modular and flexible spectral-element waveform modelling in two and three 2831 dimensions}, 2832 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 2833 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 2834 journal = {Geophysical Journal International}, 2835 volume = {216}, 2836 number = {3}, 2837 pages = {1675--1692}, 2838 doi = {10.1093/gji/ggy469}, 2839 year = {2019}, 2840 petsc_uses = {KSP} 2841} 2842 2843@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 2844 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 2845 Modeling}, 2846 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 2847 Martin van Driel and Lion Krischer and Andreas Fichtner}, 2848 journal = {SIAM Journal on Scientific Computing}, 2849 volume = {43}, 2850 number = {2}, 2851 pages = {C127--C153}, 2852 eprint = {http://arxiv.org/abs/2004.08729}, 2853 doi = {10.1137/20M1332748}, 2854 year = {2021}, 2855 petsc_uses = {KSP} 2856} 2857 2858@Article{ parsani2021, 2859 title = {High-order accurate entropy-stable discontinuous collocated {G}alerkin methods with 2860 the summation-by-parts property for compressible {CFD} frameworks: Scalable {SSDC} 2861 algorithms and flow solver}, 2862 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 2863 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 2864 journal = {Journal of Computational Physics}, 2865 volume = {424}, 2866 pages = {109844}, 2867 issn = {0021-9991}, 2868 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 2869 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 2870 year = {2021}, 2871 petsc_uses = {KSP} 2872} 2873 2874@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 2875 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 2876 governed by {PDEs}}, 2877 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 2878 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 2879 journal = {SIAM Journal of Scientific Computing}, 2880 volume = {42}, 2881 number = {5}, 2882 pages = {A3397--A3426}, 2883 year = {2020} 2884} 2885 2886@Article{ zampinibouakaramturkiyyahkniokeyes2022, 2887 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 2888 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 2889 Keyes}, 2890 journal = {Advances on Computational Mathematics}, 2891 note = {In press}, 2892 year = {2022} 2893} 2894 2895@Article{ dassizampiniscacchi2022, 2896 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 2897 discretizations of elliptic equations in mixed form}, 2898 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 2899 journal = {Computer Methods in Applied Mechanics and Engineering}, 2900 volume = {391}, 2901 pages = {114620}, 2902 year = {2022} 2903} 2904 2905@Article{ youngoppenheimdimant2017, 2906 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 2907 title = {Hybrid simulations of coupled {F}arley-{B}uneman/gradient drift instabilities in the 2908 equatorial E region ionosphere}, 2909 journal = {Journal of Geophysical Research: Space Physics}, 2910 volume = {122}, 2911 number = {5}, 2912 issn = {2169-9402}, 2913 doi = {10.1002/2017JA024161}, 2914 pages = {5768--5781}, 2915 year = {2017}, 2916 petsc_uses = {KSP} 2917} 2918 2919@Article{ rioussetpatylillisfillingimenglandwithershale2013, 2920 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in {M}ars' 2921 dynamo region}, 2922 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 2923 and Scott L England and Paul G Withers and John P M Hale}, 2924 journal = {Journal of Geophysical Research: Space Physics}, 2925 volume = {118}, 2926 number = {6}, 2927 pages = {3647--3659}, 2928 year = {2013}, 2929 publisher = {Wiley Online Library}, 2930 petsc_uses = {KSP} 2931} 2932 2933@Article{ chien2016representation, 2934 title = {Representation of topography by partial steps using the immersed boundary method 2935 in a vector vorticity equation model (VVM)}, 2936 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 2937 journal = {Journal of Advances in Modeling Earth Systems}, 2938 year = {2016}, 2939 publisher = {Wiley Online Library}, 2940 petsc_uses = {KSP} 2941} 2942 2943@Article{ berger2015parallel, 2944 title = {Parallel preconditioners for monolithic solution of shear bands}, 2945 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 2946 journal = {Journal of Computational Physics}, 2947 year = {2015}, 2948 publisher = {Elsevier}, 2949 petsc_uses = {KSP} 2950} 2951 2952@Article{ may2015496, 2953 title = {A scalable, matrix-free multigrid preconditioner for finite element 2954 discretizations of heterogeneous {S}tokes flow }, 2955 journal = {Computer Methods in Applied Mechanics and Engineering }, 2956 volume = {290}, 2957 number = {0}, 2958 pages = {496--523}, 2959 year = {2015}, 2960 issn = {0045-7825}, 2961 doi = {10.1016/j.cma.2015.03.014}, 2962 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 2963 petsc_uses = {KSP} 2964} 2965 2966@Article{ isaacknepley2017, 2967 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 2968 author = {Tobin Isaac and Matthew G. Knepley}, 2969 journal = {ArXiv e-prints}, 2970 eprint = {1508.02470}, 2971 year = {2017}, 2972 note = {\url{http://arxiv.org/abs/1508.02470}}, 2973 petsc_uses = {DMPlex} 2974} 2975 2976@Article{ knepleylangegorman2017, 2977 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 2978 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 2979 journal = {ArXiv e-prints}, 2980 eprint = {1506.06194}, 2981 year = {2017}, 2982 note = {\url{http://arxiv.org/abs/1506.06194}}, 2983 petsc_uses = {DMPlex} 2984} 2985 2986@Article{ langemitchellknepleygorman2015, 2987 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2988 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2989 journal = {SIAM Journal on Scientific Computing}, 2990 volume = {38}, 2991 number = {5}, 2992 pages = {S143--S155}, 2993 eprint = {http://arxiv.org/abs/1506.07749}, 2994 doi = {10.1137/15M1026092}, 2995 year = {2016}, 2996 petsc_uses = {DMPlex} 2997} 2998 2999@InProceedings{ langeknepleygorman2015, 3000 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 3001 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 3002 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 3003 month = apr, 3004 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 3005 year = {2015}, 3006 petsc_uses = {DMPlex} 3007} 3008 3009@InProceedings{ wallworkknepleybarralpiggott2022, 3010 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 3011 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 3012 Piggott}, 3013 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 3014 editor = {Trevor Robinson}, 3015 month = jan, 3016 address = {Seattle, WA}, 3017 pages = {1--5}, 3018 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 3019 year = {2022}, 3020 petsc_uses = {DMPlex} 3021} 3022 3023@InProceedings{ timalsinaknepley2023, 3024 title = {Tetrahedralization of a Hexahedral Mesh}, 3025 author = {Aman Timalsina and Matthew G. Knepley}, 3026 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 3027 year = {2023}, 3028 petsc_uses = {DMPlex} 3029} 3030 3031@Article{ farrellknepleywechsungmitchell2020, 3032 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 3033 methods}, 3034 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 3035 Wechsung}, 3036 journal = {ACM Transaction on Mathematical Software}, 3037 eprint = {http://arxiv.org/abs/1912.08516}, 3038 volume = {47}, 3039 number = {3}, 3040 pages = {1--22}, 3041 issn = {0098-3500}, 3042 doi = {10.1145/3445791}, 3043 publisher = {Association for Computing Machinery}, 3044 issue_date = {September 2021}, 3045 year = {2021}, 3046 petsc_uses = {KSP,DMPlex} 3047} 3048 3049@Article{ laakmann2022augmented, 3050 title = {An augmented Lagrangian preconditioner for the magnetohydrodynamics equations at high Reynolds and coupling numbers}, 3051 author = {Fabian Laakmann and Patrick E Farrell and Lawrence Mitchell}, 3052 journal = {SIAM Journal on Scientific Computing}, 3053 volume = {44}, 3054 number = {4}, 3055 pages = {B1018--B1044}, 3056 year = {2022} 3057} 3058 3059@Article{ papadopoulosfarrellsurowiec2021, 3060 title = {Computing multiple solutions of topology optimization problems}, 3061 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E and Surowiec, Thomas M}, 3062 journal = {SIAM Journal on Scientific Computing}, 3063 volume = {43}, 3064 number = {3}, 3065 pages = {A1555--A1582}, 3066 year = {2021} 3067} 3068 3069@Article{ jiangzhanghuschneiderzorinpanozzo2021, 3070 title = {Bijective and coarse high-order tetrahedral meshes}, 3071 author = {Jiang, Zhongshi and Zhang, Ziyi and Hu, Yixin and Schneider, Teseo and Zorin, Denis and Panozzo, Daniele}, 3072 journal = {ACM Transactions on Graphics (TOG)}, 3073 volume = {40}, 3074 number = {4}, 3075 pages = {1--16}, 3076 year = {2021} 3077} 3078 3079@Article{ abumaclachlanfarrell2023, 3080 title = {Monolithic multigrid for implicit {Runge--Kutta} discretizations of incompressible fluid flow}, 3081 author = {Abu-Labdeh, Razan and MacLachlan, Scott and Farrell, Patrick E}, 3082 journal = {Journal of Computational Physics}, 3083 volume = {478}, 3084 pages = {111961}, 3085 year = {2023} 3086} 3087 3088@Article{ farrellkirbymarchena2021, 3089 title = {{Irksome}: Automating {Runge--Kutta} time-stepping for finite element methods}, 3090 author = {Farrell, Patrick E and Kirby, Robert C and Marchena-Menendez, Jorge}, 3091 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3092 volume = {47}, 3093 number = {4}, 3094 pages = {1--26}, 3095 year = {2021} 3096} 3097 3098@Article{ farrellgazca2020, 3099 title = {An augmented Lagrangian preconditioner for implicitly constituted non-Newtonian incompressible flow}, 3100 author = {Farrell, Patrick E and Gazca-Orozco, Pablo Alexei}, 3101 journal = {SIAM Journal on Scientific Computing}, 3102 volume = {42}, 3103 number = {6}, 3104 pages = {B1329--B1349}, 3105 year = {2020} 3106} 3107 3108@Article{ farrellmitchellscottwechsung2022, 3109 title = {Robust multigrid methods for nearly incompressible elasticity using macro elements}, 3110 author = {Farrell, Patrick E and Mitchell, Lawrence and Scott, L Ridgway and Wechsung, Florian}, 3111 journal = {IMA Journal of Numerical Analysis}, 3112 volume = {42}, 3113 number = {4}, 3114 pages = {3306--3329}, 3115 year = {2022} 3116} 3117 3118@Article{ shihstadlerwechsung2022, 3119 title = {Robust multigrid techniques for augmented Lagrangian preconditioning of incompressible Stokes equations with extreme viscosity variations}, 3120 author = {Shih, Yu-hsuan and Stadler, Georg and Wechsung, Florian}, 3121 journal = {SIAM Journal on Scientific Computing}, 3122 volume = {45}, 3123 number = {3}, 3124 pages = {S27--S53}, 3125 year = {2022} 3126} 3127 3128@Article{ adlerhehumaclachlanohm2022, 3129 title = {Monolithic multigrid for a reduced-quadrature discretization of poroelasticity}, 3130 author = {Adler, James H and He, Yunhui and Hu, Xiaozhe and MacLachlan, Scott and Ohm, Peter}, 3131 journal = {SIAM Journal on Scientific Computing}, 3132 volume = {45}, 3133 number = {3}, 3134 pages = {S54--S81}, 3135 year = {2022} 3136} 3137 3138@Article{ xiafarrellwechsung2021, 3139 title = {Augmented Lagrangian preconditioners for the Oseen--Frank model of nematic and cholesteric liquid crystals}, 3140 author = {Xia, Jingmin and Farrell, Patrick E and Wechsung, Florian}, 3141 journal = {BIT Numerical Mathematics}, 3142 volume = {61}, 3143 pages = {607--644}, 3144 year = {2021} 3145} 3146 3147@Article{ budisahukuchtamardalzikatanov2023, 3148 title = {Algebraic multigrid methods for metric-perturbed coupled problems}, 3149 author = {Budisa, Ana and Hu, Xiaozhe and Kuchta, Miroslav and Mardal, Kent-Andre and Zikatanov, Ludmil Tomov}, 3150 journal = {arXiv preprint arXiv:2305.06073}, 3151 year = {2023} 3152} 3153 3154@Article{ laakmannhufarrell2023, 3155 title = {Structure-preserving and helicity-conserving finite element approximations and preconditioning for the Hall MHD equations}, 3156 author = {Laakmann, Fabian and Hu, Kaibo and Farrell, Patrick E}, 3157 journal = {Journal of Computational Physics}, 3158 volume = {492}, 3159 pages = {112410}, 3160 year = {2023} 3161} 3162 3163@Article{ hongkrauskuchtalymberymardalrognes2022, 3164 title = {Robust approximation of generalized Biot-Brinkman problems}, 3165 author = {Hong, Qingguo and Kraus, Johannes and Kuchta, Miroslav and Lymbery, Maria and Mardal, Kent-Andr{\'e} and Rognes, Marie E}, 3166 journal = {Journal of Scientific Computing}, 3167 volume = {93}, 3168 number = {3}, 3169 pages = {77}, 3170 year = {2022} 3171} 3172 3173@Article{ boonkuchtamardalruiz2021, 3174 title = {Robust preconditioners for perturbed saddle-point problems and conservative discretizations of {Biot's} equations utilizing total pressure}, 3175 author = {Boon, Wietse M and Kuchta, Miroslav and Mardal, Kent-Andre and Ruiz-Baier, Ricardo}, 3176 journal = {SIAM Journal on Scientific Computing}, 3177 volume = {43}, 3178 number = {4}, 3179 pages = {B961--B983}, 3180 year = {2021} 3181} 3182 3183@Article{ papadopoulosfarrell2023, 3184 title = {Preconditioners for computing multiple solutions in three-dimensional fluid topology optimization}, 3185 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E}, 3186 journal = {SIAM Journal on Scientific Computing}, 3187 volume = {45}, 3188 number = {6}, 3189 pages = {B853--B883}, 3190 year = {2023} 3191} 3192 3193@Article{ farrellhamdanmaclachlan2022, 3194 title = {A new mixed finite-element method for H2 elliptic problems}, 3195 author = {Farrell, Patrick E and Hamdan, Abdalaziz and MacLachlan, Scott P}, 3196 journal = {Computers \& Mathematics with Applications}, 3197 volume = {128}, 3198 pages = {300--319}, 3199 year = {2022} 3200} 3201 3202@Article{ harpertuminaro2023, 3203 title = {Compression and Reduced Representation Techniques for Patch-Based Relaxation}, 3204 author = {Harper, Graham and Tuminaro, Ray}, 3205 journal = {arXiv preprint arXiv:2306.10025}, 3206 year = {2023} 3207} 3208 3209@Article{ kirbykernell2021, 3210 title = {Preconditioning mixed finite elements for tide models}, 3211 author = {Kirby, Robert C and Kernell, Tate}, 3212 journal = {Computers \& Mathematics with Applications}, 3213 volume = {82}, 3214 pages = {212--227}, 3215 year = {2021} 3216} 3217 3218@Book{ xia2023, 3219 title = {Computing and Analysing Energy Minimisation Problems in Liquid Crystals: Implementation Using Firedrake}, 3220 author = {Xia, Jingmin}, 3221 year = {2023}, 3222 publisher = {World Scientific} 3223} 3224 3225@PhDThesis{ leveque2022, 3226 title = {Preconditioned iterative methods for optimal control problems with time-dependent PDEs as constraints}, 3227 author = {Leveque, Santolo}, 3228 school = {The University of Edinburgh}, 3229 year = {2022} 3230} 3231 3232@PhDThesis{ brubeck2022, 3233 title = {Optimal-complexity and robust multigrid methods for high-order FEM}, 3234 author = {Pablo D. Brubeck}, 3235 school = {Oxford University}, 3236 year = {2022} 3237} 3238 3239@Misc{ firedrakeproject, 3240 title = {{The {F}iredrake project}}, 3241 author = {David A Ham and Firedrake Team}, 3242 url = {http://firedrakeproject.org}, 3243 year = {2022}, 3244 petsc_uses = {KSP} 3245} 3246 3247@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 3248 title = {Firedrake: automating the finite element method by composing abstractions}, 3249 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 3250 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 3251 and Paul HJ Kelly}, 3252 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3253 volume = {43}, 3254 number = {3}, 3255 pages = {24}, 3256 year = {2016}, 3257 petsc_uses = {KSP} 3258} 3259 3260@Article{ mitchellmuller2016, 3261 title = {High level implementation of geometric multigrid solvers for finite element 3262 problems: Applications in atmospheric modelling}, 3263 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 3264 journal = {Journal of Computational Physics}, 3265 volume = {327}, 3266 pages = {1--18}, 3267 year = {2016}, 3268 petsc_uses = {KSP} 3269} 3270 3271@Article{ mcraeberceamitchellhamcotter2016, 3272 title = {Automated generation and symbolic manipulation of tensor product finite 3273 elements}, 3274 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 3275 and Colin J Cotter}, 3276 journal = {SIAM Journal on Scientific Computing}, 3277 volume = {38}, 3278 number = {5}, 3279 pages = {S25--S47}, 3280 year = {2016}, 3281 petsc_uses = {KSP} 3282} 3283 3284@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 3285 title = {A structure-exploiting numbering algorithm for finite elements on extruded 3286 meshes, and its performance evaluation in {Firedrake}}, 3287 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 3288 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 3289 journal = {Geoscientific Model Development}, 3290 volume = {9}, 3291 number = {10}, 3292 pages = {3803--3815}, 3293 doi = {10.5194/gmd-9-3803-2016}, 3294 year = {2016}, 3295 petsc_uses = {KSP} 3296} 3297 3298@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 3299 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 3300 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 3301 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 3302 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 3303 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 3304 publisher = {Springer Berlin Heidelberg}, 3305 pages = {279--289}, 3306 isbn = {978-3-642-38750-0}, 3307 doi = {10.1007/978-3-642-38750-0_21}, 3308 year = {2013}, 3309 petsc_uses = {KSP} 3310} 3311 3312@Article{ kirbymitchell2017, 3313 title = {Solver composition across the {PDE}/linear algebra barrier}, 3314 author = {Robert C Kirby and Lawrence Mitchell}, 3315 journal = {arXiv preprint arXiv:1706.01346}, 3316 year = {2017}, 3317 petsc_uses = {KSP} 3318} 3319 3320@Article{ saibaba2012application, 3321 title = {Application of hierarchical matrices to linear inverse problems in 3322 geostatistics}, 3323 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 3324 Peter K and Darve, Eric F}, 3325 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 3326 volume = {67}, 3327 number = {5}, 3328 pages = {857}, 3329 year = {2012}, 3330 petsc_uses = {KSP} 3331} 3332 3333@Article{ collignonkausmayfernandez14, 3334 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 3335 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 3336 journal = {Geochem Geophy Geosy}, 3337 year = {2014}, 3338 petsc_uses = {KSP} 3339} 3340 3341@Article{ fernandezkaus14, 3342 author = {Fern\'andez, N. and Kaus, B.}, 3343 title = {Fold interaction and wavelength selection in {3D} models of multilayer detachment 3344 folding}, 3345 journal = {Tectonophysics}, 3346 year = {2014}, 3347 petsc_uses = {KSP} 3348} 3349 3350@Article{ baumannkauspopov14, 3351 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 3352 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 3353 journal = {Tectonophysics}, 3354 year = {2014}, 3355 petsc_uses = {KSP} 3356} 3357 3358@Article{ lechmannschmalholzhetenyimaykaus14, 3359 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 3360 J. P.}, 3361 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 3362 of the modern {India-Asia} collisional system with {3-D} numerical models}, 3363 journal = { Journal of Geophysical Research - Solid Earth}, 3364 year = {2014}, 3365 petsc_uses = {KSP} 3366} 3367 3368@InBook{ fernandezkaus14b, 3369 author = {Fern\'andez N. and Kaus B.J.P.}, 3370 title = {Analytical and numerical investigation of {3D} multilayer detachment}, 3371 booktitle = {Mathematics of Planet Earth}, 3372 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 3373 and Dur\'an J.J. and Vargas-Guzman J.A.}, 3374 publisher = {Springer}, 3375 year = {2014}, 3376 petsc_uses = {KSP} 3377} 3378 3379@Article{ hossein-hsueh-etal-2014a, 3380 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 3381 journal = {J. Mech. Phys. Solids}, 3382 pages = {320--348}, 3383 title = {Effective toughness of heterogeneous media}, 3384 volume = {71}, 3385 year = {2014}, 3386 petsc_uses = {KSP} 3387} 3388 3389@Unpublished{ leon-baldelli-bourdin-2014a, 3390 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 3391 month = aug, 3392 note = {Submitted.}, 3393 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 3394 year = {2014}, 3395 petsc_uses = {KSP} 3396} 3397 3398@Article{ leon-baldelli-babadjian-etal-2013a, 3399 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 3400 Maurini, C.}, 3401 journal = {J. Mech. Phys. Solids}, 3402 pages = {15-32}, 3403 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 3404 volume = {70}, 3405 year = {2014}, 3406 petsc_uses = {KSP} 3407} 3408 3409@Article{ mesgarnejad-bourdin-etal-2014a, 3410 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 3411 journal = {Comp. Methods Appl. Mech. Engng.}, 3412 title = {Validation simulations for the variational approach to fracture}, 3413 volume = {Submitted}, 3414 year = {2014}, 3415 petsc_uses = {KSP} 3416} 3417 3418@InProceedings{ bourdin-chukwudozie-etal-2013a, 3419 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3420 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 3421 University, Stanford, CA}, 3422 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 3423 Fracturing Under In-Situ Stresses}, 3424 year = {2013}, 3425 petsc_uses = {KSP} 3426} 3427 3428@Article{ maurini-bourdin-etal-2012a, 3429 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 3430 journal = {Int. J. Fracture}, 3431 number = {1-2}, 3432 pages = {75-91}, 3433 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 3434 capillary tube: experiments and numerical simulations using a two-dimensional 3435 variational approach}, 3436 volume = {184}, 3437 year = {2013}, 3438 petsc_uses = {KSP} 3439} 3440 3441@Article{ mesgarnejad-bourdin-etal-2013a, 3442 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 3443 journal = {J. Mech. Phys Solids}, 3444 number = {11}, 3445 pages = {2360--2379}, 3446 title = {A variational approach to the fracture of brittle thin films under out of plane 3447 loading}, 3448 volume = {61}, 3449 year = {2013}, 3450 petsc_uses = {KSP} 3451} 3452 3453@InProceedings{ bourdin-chukwudozie-etal-2012a, 3454 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3455 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 3456 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 3457 volume = {SPE 159154}, 3458 year = {2012}, 3459 petsc_uses = {KSP} 3460} 3461 3462@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 3463 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 3464 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 3465 Langtangen}, 3466 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 3467 journal = {Advances in Water Resources}, 3468 volume = {51}, 3469 number = {0}, 3470 pages = {405--437}, 3471 year = {2013}, 3472 note = {35th Year Anniversary Issue}, 3473 issn = {0309-1708}, 3474 doi = {10.1016/j.advwatres.2012.05.008}, 3475 petsc_uses = {KSP} 3476} 3477 3478@Article{ scheltingamyerspietrzak10, 3479 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 3480 title = {A finite element sea ice model of the {C}anadian Arctic Archipelago}, 3481 journal = {Ocean Dynamics}, 3482 volume = {60}, 3483 number = {6}, 3484 pages = {1539-1558}, 3485 year = {2010}, 3486 issn = {1616-7341}, 3487 doi = {10.1007/s10236-010-0356-5}, 3488 publisher = {Springer-Verlag}, 3489 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 3490 Archipelago; Freshwater flux}, 3491 language = {English}, 3492 petsc_uses = {KSP} 3493} 3494 3495@InBook{ destefanoandreasisecchi13, 3496 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 3497 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 3498 inversions}, 3499 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 3500 chapter = {626}, 3501 pages = {3226--3230}, 3502 doi = {10.1190/segam2013-0244.1}, 3503 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 3504 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 3505 petsc_uses = {KSP} 3506} 3507 3508@Article{ pourhiethuetmaylabroussejolivet12, 3509 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 3510 title = {Kinematic interpretation of the {3D} shapes of metamorphic core complexes}, 3511 journal = {Geochem. Geophys. Geosyst.}, 3512 volume = {13}, 3513 pages = {Q09002}, 3514 year = {2012}, 3515 doi = {10.1029/2012GC004271}, 3516 petsc_uses = {KSP} 3517} 3518 3519@Article{ lechmannmaykausschmalholz11, 3520 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 3521 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 3522 collision}, 3523 journal = {Geophysical Journal International}, 3524 volume = {187}, 3525 pages = {10--33}, 3526 year = {2011}, 3527 doi = {10.1111/j.1365-246X.2011.05164.x}, 3528 petsc_uses = {KSP} 3529} 3530 3531@Article{ stefano:r69, 3532 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 3533 Virgilio and Fred F. Snyder}, 3534 collaboration = {}, 3535 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 3536 application to subsalt imaging}, 3537 publisher = {SEG}, 3538 year = {2011}, 3539 journal = {Geophysics}, 3540 volume = {76}, 3541 number = {3}, 3542 pages = {R69-R80}, 3543 keywords = {geophysical image processing; inverse problems; seismology}, 3544 doi = {10.1190/1.3554652}, 3545 petsc_uses = {KSP} 3546} 3547 3548@Article{ stefano:806, 3549 author = {Michele De Stefano}, 3550 collaboration = {}, 3551 title = {Simultaneous joint inversion for susceptibility and velocity}, 3552 publisher = {SEG}, 3553 year = {2011}, 3554 journal = {SEG Technical Program Expanded Abstracts}, 3555 volume = {30}, 3556 number = {1}, 3557 pages = {806-810}, 3558 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 3559 doi = {10.1190/1.3628198}, 3560 petsc_uses = {KSP} 3561} 3562 3563@Article{ mayknepley2011, 3564 author = {Dave A. May and Matthew G. Knepley}, 3565 title = {Optimal, scalable forward models for computing gravity anomalies}, 3566 journal = {Geophysical Journal International}, 3567 volume = {187}, 3568 number = {1}, 3569 pages = {161--177}, 3570 url = {http://arxiv.org/abs/1107.5951}, 3571 note = {\url{http://arxiv.org/abs/1107.5951}}, 3572 year = {2011}, 3573 petsc_uses = {KSP} 3574} 3575 3576@InProceedings{ bourdinknepleymaurini2010, 3577 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3578 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 3579 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 3580 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 3581 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 3582 address = {Stanford, CA}, 3583 year = {2010}, 3584 petsc_uses = {KSP} 3585} 3586 3587@InProceedings{ bourdinknepleymaurini2010b, 3588 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3589 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 3590 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 3591 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 3592 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 3593 address = {Sacramento, CA}, 3594 year = {2010}, 3595 petsc_uses = {KSP} 3596} 3597 3598@Article{ chen2007full, 3599 title = {Full {3D} tomography for the crustal structure of the {Los Angeles} region}, 3600 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 3601 journal = {Bulletin of the Seismological Society of America}, 3602 volume = {97}, 3603 number = {4}, 3604 pages = {1094}, 3605 year = {2007}, 3606 publisher = {Seismol Soc America}, 3607 petsc_uses = {KSP} 3608} 3609 3610@Article{ brown2010ens, 3611 author = {Brown, Jed}, 3612 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 3613 Zürich, Switzerland}, 3614 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 3615 journal = {Journal of Scientific Computing}, 3616 publisher = {Springer Netherlands}, 3617 issn = {0885-7474}, 3618 keyword = {Mathematics and Statistics}, 3619 pages = {48-63}, 3620 volume = {45}, 3621 issue = {1}, 3622 doi = {10.1007/s10915-010-9396-8}, 3623 year = {2010}, 3624 petsc_uses = {KSP} 3625} 3626 3627@PhDThesis{ brown2011, 3628 title = {Computational methods for ice flow simulation}, 3629 author = {Jed Brown}, 3630 school = {ETH Z{\"u}rich}, 3631 year = {2011}, 3632 petsc_uses = {KSP} 3633} 3634 3635@Article{ brown2013tmeice, 3636 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 3637 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 3638 journal = {SIAM Journal on Scientific Computing}, 3639 volume = {35}, 3640 number = {2}, 3641 year = {2013}, 3642 pages = {359--375}, 3643 doi = {10.1137/110834512}, 3644 note = {Also preprint ANL/MCS-P743-1298}, 3645 petsc_uses = {KSP} 3646} 3647 3648@InProceedings{ brown2013quasinewton, 3649 author = {Jed Brown and Peter Brune}, 3650 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 3651 methods}, 3652 year = {2013}, 3653 booktitle = {International Conference on Mathematics and Computational Methods Applied to 3654 Nuclear Science and Engineering}, 3655 pages = {2554--2565}, 3656 petsc_uses = {KSP} 3657} 3658 3659@Misc{ spiegelman-siampp10, 3660 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 3661 Earth Geodynamics}, 3662 author = {Marc Spiegelman}, 3663 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 3664 Computing}, 3665 year = {2010}, 3666 petsc_uses = {KSP} 3667} 3668 3669@Article{ schauer2011a, 3670 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 3671 Quintana-Ort\'{\i}}, 3672 title = {Large scale simulation of wave propagation in soils interacting with structures 3673 using {FEM} and {SBFEM}}, 3674 journal = {Journal of Computational Acoustics}, 3675 volume = {19}, 3676 number = {1}, 3677 pages = {75--93}, 3678 year = {2011}, 3679 doi = {10.1142/S0218396X11004316}, 3680 petsc_uses = {KSP} 3681} 3682 3683@Misc{ bsa2010, 3684 author = {J. Brown and B. Smith and A. Ahmadia}, 3685 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 3686 note = {submitted to SIAM Journal on Scientific Computing}, 3687 year = {2012}, 3688 petsc_uses = {KSP} 3689} 3690 3691@Article{ kellerkatz2016, 3692 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 3693 author = {Tobias Keller and Richard F. Katz}, 3694 journal = {Journal of Petrology}, 3695 doi = {10.1093/petrology/egw030}, 3696 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 3697 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 3698 year = {2016}, 3699 petsc_uses = {KSP} 3700} 3701 3702@Article{ weatherley12, 3703 author = {S. Weatherley and R.F. Katz}, 3704 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 3705 mantle}, 3706 journal = {Geochem.\ Geophys.\ Geosys.}, 3707 year = {2012}, 3708 volume = {13}, 3709 number = {1}, 3710 pages = {Q0AC18}, 3711 doi = {10.1029/2011GC003989}, 3712 petsc_uses = {KSP} 3713} 3714 3715@Article{ katz12, 3716 author = {R.F. Katz and S. Weatherley}, 3717 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 3718 journal = {Earth\ Planet.\ Sci.\ Lett.}, 3719 year = {2012}, 3720 doi = {10.1016/j.epsl.2012.04.042}, 3721 volume = {335-336}, 3722 pages = {226-237}, 3723 petsc_uses = {KSP} 3724} 3725 3726@Article{ katz10b, 3727 author = {R.F. Katz}, 3728 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 3729 journal = {Geochem.\ Geophys.\ Geosys.}, 3730 volume = {10}, 3731 number = {Q0AC07}, 3732 year = {2010}, 3733 doi = {10.1029/2010GC003282}, 3734 petsc_uses = {KSP} 3735} 3736 3737@Article{ england10, 3738 author = {P.C. England and R.F. Katz}, 3739 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 3740 journal = {Nature}, 3741 year = {2010}, 3742 volume = {467}, 3743 pages = {700--703}, 3744 doi = {10.1038/nature09417}, 3745 petsc_uses = {KSP} 3746} 3747 3748@Article{ weatherley10, 3749 author = {S. Weatherley and R.F. Katz}, 3750 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 3751 journal = {Geochem.\ Geophys.\ Geosys.}, 3752 year = {2010}, 3753 volume = {11}, 3754 number = {10}, 3755 doi = {10.1029/2010GC003192}, 3756 petsc_uses = {KSP} 3757} 3758 3759@Article{ katz10, 3760 author = {R.F. Katz and M.G. Worster}, 3761 title = {The stability of ice-sheet grounding lines}, 3762 journal = {Proc.~Roy.~Soc.~A}, 3763 year = {2010}, 3764 volume = {466}, 3765 pages = {1597--1620}, 3766 doi = {10.1098/rspa.2009.0434}, 3767 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 3768 petsc_uses = {KSP} 3769} 3770 3771@Article{ kyrkesmith2013stress, 3772 title = {Stress balances of ice streams in a vertically integrated, higher-order 3773 formulation}, 3774 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 3775 journal = {Journal of Glaciology}, 3776 volume = {59}, 3777 number = {215}, 3778 pages = {449--466}, 3779 year = {2013}, 3780 doi = {10.3189/2013JoG12J140}, 3781 petsc_uses = {KSP} 3782} 3783 3784@Article{ takei2013anisotropy1, 3785 author = {Takei Y. and R.F. Katz}, 3786 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 3787 Governing equations and linearised analysis}}, 3788 journal = {J.\ Fluid\ Mech.}, 3789 year = {2013}, 3790 volume = {734}, 3791 pages = {424-455}, 3792 doi = {10.1017/jfm.2013.482}, 3793 petsc_uses = {KSP} 3794} 3795 3796@Article{ katz2013anisotropy2, 3797 author = {Katz R.F. and Y. Takei}, 3798 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 3799 Numerical solutions of the full equations}}, 3800 journal = {J.\ Fluid\ Mech.}, 3801 year = {2013}, 3802 volume = {734}, 3803 pages = {456-485}, 3804 doi = {10.1017/jfm.2013.483}, 3805 petsc_uses = {KSP} 3806} 3807 3808@Article{ kyrke-smith2014subglacial, 3809 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 3810 title = {Subglacial hydrology and the formation of ice streams}, 3811 journal = {Proc.\ Roy.\ Soc.\ A}, 3812 year = {2014}, 3813 volume = {470}, 3814 number = {2161}, 3815 doi = {10.1098/rspa.2013.0494}, 3816 petsc_uses = {KSP} 3817} 3818 3819@Article{ spiegelmanwilsonvankeken2013, 3820 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 3821 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 3822 multi-physics problems in the solid Earth sciences}}, 3823 journal = {AGU Fall Meeting Abstracts}, 3824 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 3825 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 3826 year = {2013}, 3827 month = dec, 3828 pages = {A2208}, 3829 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 3830 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 3831 petsc_uses = {KSP} 3832} 3833 3834@Article{ bueler2009shallow, 3835 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 3836 ice sheet model}}, 3837 author = {Ed Bueler and Jed Brown}, 3838 journal = {Journal of Geophysical Research-Earth Surface}, 3839 volume = {114}, 3840 number = {F3}, 3841 pages = {F03008}, 3842 year = {2009}, 3843 publisher = {American Geophysical Union}, 3844 petsc_uses = {KSP} 3845} 3846 3847@Article{ bueler2007est, 3848 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 3849 effective tools for verification}}, 3850 author = {Ed Bueler and Jed Brown and Craig Lingle}, 3851 journal = {J. Glaciol}, 3852 volume = {53}, 3853 pages = {499--516}, 3854 year = {2007}, 3855 petsc_uses = {KSP} 3856} 3857 3858@Article{ bueler2007fcv, 3859 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 3860 simulations}}, 3861 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 3862 journal = {Ann. Glaciol}, 3863 volume = {46}, 3864 pages = {97--105}, 3865 year = {2007}, 3866 petsc_uses = {KSP} 3867} 3868 3869@Article{ bueler2005iso, 3870 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 3871 Latrice N. Bowman}, 3872 title = {Exact solutions and numerical verification for isothermal ice sheets}, 3873 journal = {J. Glaciol.}, 3874 volume = {51}, 3875 number = {173}, 3876 pages = {291--306}, 3877 year = {2005}, 3878 petsc_uses = {KSP} 3879} 3880 3881@Article{ chao2008programming, 3882 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 3883 author = {Chao-fan, Z. and Yao-lin, S.}, 3884 journal = {Earthquake}, 3885 year = {2008}, 3886 petsc_uses = {KSP} 3887} 3888 3889@Article{ marti2014, 3890 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 3891 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 3892 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 3893 title = {Full sphere hydrodynamic and dynamo benchmarks}, 3894 journal = {Geophysical Journal International}, 3895 year = {2014}, 3896 doi = {10.1093/gji/ggt518}, 3897 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 3898 petsc_uses = {KSP} 3899} 3900 3901@InProceedings{ ganfulukyangxueyang2013, 3902 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 3903 Guangwen}, 3904 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 3905 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 3906 Field-Programmable Custom Computing Machines}, 3907 series = {FCCM '13}, 3908 pages = {230--}, 3909 year = {2013}, 3910 isbn = {978-0-7695-4969-9}, 3911 doi = {10.1109/FCCM.2013.26}, 3912 acmid = {2495688}, 3913 publisher = {IEEE Computer Society}, 3914 petsc_uses = {KSP} 3915} 3916 3917@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 3918 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 3919 Xiaomeng Huang and Guangwen Yang}, 3920 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 3921 Conference on}, 3922 title = {A highly-efficient and green data flow engine for solving {E}uler atmospheric 3923 equations}, 3924 year = {2014}, 3925 month = sep, 3926 pages = {1-6}, 3927 doi = {10.1109/FPL.2014.6927462}, 3928 petsc_uses = {KSP} 3929} 3930 3931%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 3932%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 3933%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 3934@Article{ aagaardknepleywilliams13, 3935 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 3936 Models of Quasi-static and Dynamic Crustal Deformation}, 3937 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 3938 journal = {Journal of Geophysical Research: Solid Earth}, 3939 volume = {118}, 3940 number = {6}, 3941 pages = {3059--3079}, 3942 issn = {2169-9356}, 3943 doi = {10.1002/jgrb.50217}, 3944 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 3945 year = {2013}, 3946 petsc_uses = {KSP} 3947} 3948 3949@InProceedings{ aagaardknepleywilliams11, 3950 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3951 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3952 Deformation}, 3953 booktitle = {Eos Transactions of the AGU}, 3954 organization = {American Geophysical Union}, 3955 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 3956 year = {2011}, 3957 petsc_uses = {KSP} 3958} 3959 3960@InProceedings{ knepley10b, 3961 author = {Matthew G. {Knepley}}, 3962 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 3963 booktitle = {Eos Transactions of the AGU}, 3964 organization = {American Geophysical Union}, 3965 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 3966 year = {2010}, 3967 petsc_uses = {KSP} 3968} 3969 3970@InProceedings{ mayknepleygurnis09, 3971 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 3972 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 3973 booktitle = {Eos Transactions of the AGU}, 3974 organization = {American Geophysical Union}, 3975 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 3976 year = {2009}, 3977 petsc_uses = {KSP} 3978} 3979 3980@InProceedings{ yuenknepleyerlebacherwright09, 3981 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 3982 title = {The Coming Role of {GPU} in Computational Geodynamics}, 3983 booktitle = {Eos Transactions of the AGU}, 3984 organization = {American Geophysical Union}, 3985 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 3986 year = {2009}, 3987 petsc_uses = {KSP} 3988} 3989 3990@InProceedings{ aagaardknepleywilliams08, 3991 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 3992 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3993 Deformation}, 3994 booktitle = {Eos Transactions of the AGU}, 3995 organization = {American Geophysical Union}, 3996 volume = {89}, 3997 number = {53}, 3998 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 3999 year = {2007}, 4000 petsc_uses = {KSP} 4001} 4002 4003@InProceedings{ aagaardknepleywilliams07, 4004 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 4005 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 4006 Deformation}, 4007 booktitle = {Eos Transactions of the AGU}, 4008 organization = {American Geophysical Union}, 4009 volume = {88}, 4010 number = {52}, 4011 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 4012 year = {2007}, 4013 petsc_uses = {KSP} 4014} 4015 4016@InProceedings{ aagaardknepleywilliams05, 4017 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 4018 title = {Development of software for studying earthquakes across multiple spatial and 4019 temporal scales by coupling quasi-static and dynamic simulations}, 4020 booktitle = {Eos Transactions of the AGU}, 4021 organization = {American Geophysical Union}, 4022 volume = {86}, 4023 number = {52}, 4024 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 4025 year = {2005}, 4026 petsc_uses = {KSP} 4027} 4028 4029@InProceedings{ williamsgablehagermeadeaagaardknepley08, 4030 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 4031 Brad Aagaard and Matthew G. Knepley}, 4032 title = {Modeling of Multiple Earthquake Cycles in {S}outhern {C}alifornia Using the {SCEC} 4033 Community Fault Model}, 4034 booktitle = {Proceedings of Geosciences '08}, 4035 address = {Wellington, NZ}, 4036 month = nov, 4037 year = {2008}, 4038 petsc_uses = {KSP} 4039} 4040 4041@TechReport{ zhang07, 4042 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 4043 Tsunamis}, 4044 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 4045 type = {Preprint}, 4046 number = {ANL/MCS-P1459-0907}, 4047 institution = {ANL}, 4048 month = sep, 4049 year = {2007}, 4050 petsc_uses = {KSP} 4051} 4052 4053@Article{ katz08b, 4054 author = {Richard F. Katz}, 4055 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 4056 focusing at mid-ocean ridges}, 4057 journal = {J. Petrology}, 4058 year = {2008}, 4059 volume = {49}, 4060 pages = {2099--2121}, 4061 doi = {10.1093/petrology/egn058}, 4062 petsc_uses = {KSP} 4063} 4064 4065@Article{ hgrhkjvv2008, 4066 title = {On preconditioning for a parallel solution of the {R}ichards equation}, 4067 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 4068 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 4069 journal = {Computers and Geosciences}, 4070 volume = {34}, 4071 pages = {1958--1963}, 4072 year = {2008}, 4073 petsc_uses = {KSP} 4074} 4075 4076@Article{ maymoresi2008, 4077 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 4078 computational geodynamics}, 4079 journal = {Physics of the Earth and Planetary Interiors}, 4080 volume = {171}, 4081 number = {1-4}, 4082 pages = {33--47}, 4083 year = {2008}, 4084 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 4085 Applications}, 4086 issn = {0031-9201}, 4087 doi = {10.1016/j.pepi.2008.07.036}, 4088 author = {Dave A. May and Louis Moresi}, 4089 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 4090 petsc_uses = {KSP} 4091} 4092 4093@Article{ kausmuhlhausmay2010, 4094 title = {A stabilization algorithm for geodynamic numerical simulations with a free 4095 surface}, 4096 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 4097 journal = {Physics of the Earth and Planetary Interiors}, 4098 volume = {181}, 4099 number = {1}, 4100 pages = {12--20}, 4101 year = {2010}, 4102 petsc_uses = {KSP} 4103} 4104 4105@Article{ duretzmaygeryatackley2011, 4106 title = {Discretization errors and free surface stabilization in the finite difference and 4107 marker-in-cell method for applied geodynamics: A numerical study}, 4108 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 4109 journal = {Geochemistry, Geophysics, Geosystems}, 4110 volume = {12}, 4111 number = {7}, 4112 year = {2011}, 4113 petsc_uses = {KSP} 4114} 4115 4116@Article{ furuichimaytackley2011, 4117 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 4118 {Schur} complement approach with mixed precision arithmetic}, 4119 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 4120 journal = {Journal of Computational Physics}, 4121 volume = {230}, 4122 number = {24}, 4123 pages = {8835--8851}, 4124 year = {2011}, 4125 petsc_uses = {KSP} 4126} 4127 4128@Article{ kellermaykaus2013, 4129 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 4130 lithosphere and crust}, 4131 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 4132 journal = {Geophysical Journal International}, 4133 volume = {195}, 4134 number = {3}, 4135 pages = {1406--1442}, 4136 year = {2013}, 4137 petsc_uses = {KSP} 4138} 4139 4140@Article{ schellartfreemanstegmanmoresimay2007, 4141 title = {Evolution and diversity of subduction zones controlled by slab width}, 4142 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 4143 May}, 4144 journal = {Nature}, 4145 volume = {446}, 4146 number = {7133}, 4147 pages = {308--311}, 4148 year = {2007}, 4149 petsc_uses = {KSP} 4150} 4151 4152@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 4153 title = {A comparison of numerical surface topography calculations in geodynamic 4154 modelling: an evaluation of the sticky air method}, 4155 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 4156 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 4157 journal = {Geophysical Journal International}, 4158 volume = {189}, 4159 number = {1}, 4160 pages = {38--54}, 4161 year = {2012}, 4162 petsc_uses = {KSP} 4163} 4164 4165@Article{ stegmanfreemanschellartmoresimay2006, 4166 title = {Influence of trench width on subduction hinge retreat rates in {3-D} models of slab 4167 rollback}, 4168 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 4169 May}, 4170 journal = {Geochemistry, Geophysics, Geosystems}, 4171 volume = {7}, 4172 number = {3}, 4173 year = {2006}, 4174 petsc_uses = {KSP} 4175} 4176 4177@InProceedings{ may2014ptatin, 4178 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 4179 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 4180 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 4181 Computing, Networking, Storage and Analysis}}, 4182 organization = {ACM}, 4183 pages = {274--284}, 4184 year = {2014}, 4185 doi = {10.1109/SC.2014.28}, 4186 petsc_uses = {KSP} 4187} 4188 4189@Article{ maybrownpourhiet2015, 4190 title = {A scalable, matrix-free multigrid preconditioner for finite element 4191 discretizations of heterogeneous {Stokes} flow}, 4192 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 4193 journal = {Computer Methods in Applied Mechanics and Engineering}, 4194 volume = {290}, 4195 pages = {496--523}, 4196 year = {2015}, 4197 doi = {10.1016/j.cma.2015.03.014}, 4198 petsc_uses = {KSP} 4199} 4200 4201@Article{ duretzmayyamato2016, 4202 title = {A free surface capturing discretization for the staggered grid finite difference 4203 scheme}, 4204 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 4205 journal = {Geophysical Journal International}, 4206 volume = {204}, 4207 number = {3}, 4208 pages = {1518--1530}, 4209 year = {2016}, 4210 petsc_uses = {KSP} 4211} 4212 4213@Article{ rhebergenwellskatzwathen2014, 4214 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 4215 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 4216 journal = {SIAM J. Sci. Comput.}, 4217 volume = {36}, 4218 pages = {A1960--A1977}, 4219 year = {2014}, 4220 petsc_uses = {KSP} 4221} 4222 4223@Article{ katz08a, 4224 author = {R.F. Katz and M.G. Worster}, 4225 title = {Simulation of directional solidification, thermochemical convection, and chimney 4226 formation in a {H}ele-{S}haw cell}, 4227 journal = {J. Comp. Phys.}, 4228 volume = {227}, 4229 pages = {9823-9840}, 4230 year = {2008}, 4231 doi = {10.1016/j.jcp.2008.06.039}, 4232 petsc_uses = {KSP} 4233} 4234 4235@Article{ aabg2007, 4236 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 4237 title = {Full waveform inversion for seismic velocity and anelastic losses in 4238 heterogeneous structures}, 4239 journal = {Bulletin of Seismological Society of America}, 4240 year = {2007}, 4241 volume = {97}, 4242 pages = {1990--2008}, 4243 petsc_uses = {KSP} 4244} 4245 4246@Article{ katz2006, 4247 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 4248 title = {The dynamics of melt and shear localization in partially molten aggregates}, 4249 journal = {Nature}, 4250 year = {2006}, 4251 volume = {442}, 4252 pages = {676--679}, 4253 month = aug, 4254 day = {10}, 4255 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 4256 petsc_uses = {KSP} 4257} 4258 4259@InProceedings{ mqrs2003, 4260 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 4261 year = {2003}, 4262 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 4263 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 4264 Sozopol, Bulgaria, June 4-8, 2003}, 4265 petsc_uses = {KSP} 4266} 4267 4268@InProceedings{ lichtner1, 4269 author = {Chuan Lu and Peter C. Lichtner}, 4270 year = {2005}, 4271 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 4272 Geologic Media}, 4273 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 4274 lab = {LANL}, 4275 petsc_uses = {KSP} 4276} 4277 4278@Article{ hammondlichtnermills2014, 4279 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 4280 Example with {PFLOTRAN}}, 4281 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 4282 journal = {Water Resources Research}, 4283 volume = {50}, 4284 number = {1}, 4285 pages = {208--228}, 4286 doi = {10.1002/2012WR013483}, 4287 year = {2014}, 4288 petsc_uses = {KSP} 4289} 4290 4291@Article{ smw2003, 4292 author = {R. Scheichl and R. Masson and J. Wendebourg}, 4293 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 4294 journal = {Computational Geosciences}, 4295 year = {2003}, 4296 volume = {7}, 4297 pages = {295--318}, 4298 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 4299 petsc_uses = {KSP} 4300} 4301 4302@Article{ kees-miller-03, 4303 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 4304 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 4305 journal = {Computational Geosciences}, 4306 year = {2003}, 4307 volume = {7}, 4308 pages = {91--114}, 4309 petsc_uses = {KSP} 4310} 4311 4312@Article{ bk2003, 4313 author = {JN Buur and T Kuehnel}, 4314 title = {Improving depth imaging by automated model updating}, 4315 journal = {The Leading Edge}, 4316 year = {2003}, 4317 volume = {22}, 4318 pages = {310-318}, 4319 petsc_uses = {KSP} 4320} 4321 4322@Article{ frederickbuffett2016, 4323 title = {Submarine groundwater discharge as a possible formation mechanism for 4324 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 4325 author = {Jennifer M. Frederick and Bruce A. Buffett}, 4326 journal = {Journal of Geophysical Research: Solid Earth}, 4327 volume = {121}, 4328 number = {3}, 4329 pages = {1383--1404}, 4330 issn = {2169-9356}, 4331 doi = {10.1002/2015JB012627}, 4332 year = {2016}, 4333 petsc_uses = {KSP} 4334} 4335 4336% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4337% LiteralHTML:<font color="#FF0000"> 4338% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 4339% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 4340% LiteralHTML:variety of these simulations.</p> 4341% LiteralHTML:</font> 4342% LiteralHTML: 4343@InProceedings{ appelbe1, 4344 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4345 year = {2003}, 4346 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 4347 computational methodology}, 4348 page = {781}, 4349 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 4350 Proceedings}, 4351 publisher = {Springer-Verlag}, 4352 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 4353 petsc_uses = {KSP} 4354} 4355 4356% LiteralHTML:<a name="katz"> 4357@InProceedings{ gd1, 4358 author = {Guillaume Dumont and Michel Kern}, 4359 title = {Parallelization of a {3D} Seismic Migration Code with {PETSc}}, 4360 year = {1999}, 4361 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 4362 Computing}, 4363 petsc_uses = {KSP} 4364} 4365 4366% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 4367% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 4368% LiteralHTML:<font color="#FF0000"> 4369% LiteralHTML: Figures from the work of Richard Katz 4370@PhDThesis{ katzthesis, 4371 author = {R.F. Katz}, 4372 title = {The deep roots of volcanoes: models of magma dynamics with applications to 4373 subduction zones}, 4374 school = {Columbia University}, 4375 year = {2005}, 4376 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 4377 petsc_uses = {KSP} 4378} 4379 4380@InCollection{ knepleykatzsmith06, 4381 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 4382 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 4383 USA}, 4384 title = {Developing a Geodynamics Simulator with {PETSc}}, 4385 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 4386 series = {Lecture Notes in Computational Science and Engineering}, 4387 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 4388 publisher = {Springer Berlin Heidelberg}, 4389 isbn = {978-3-540-31619-0}, 4390 keyword = {Mathematics and Statistics}, 4391 pages = {413-438}, 4392 volume = {51}, 4393 doi = {10.1007/3-540-31619-1_12}, 4394 year = {2006}, 4395 petsc_uses = {KSP} 4396} 4397 4398@Article{ katz04, 4399 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 4400 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 4401 the global mid-ocean ridge system}, 4402 journal = {Geophys.\ Res.\ Letts.}, 4403 year = {2004}, 4404 volume = {31}, 4405 pages = {L15605}, 4406 petsc_uses = {KSP} 4407} 4408 4409@Article{ katz07, 4410 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 4411 Ethan Coon}, 4412 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 4413 Toolkit for Scientific Computation}}, 4414 journal = {Phys. Earth Planet. In.}, 4415 volume = {163}, 4416 pages = {52--68}, 4417 year = {2007}, 4418 petsc_uses = {KSP} 4419} 4420 4421@Article{ williams2006development, 4422 title = {{Development of a package for modeling stress in the lithosphere}}, 4423 author = {Williams, CA}, 4424 journal = {Eos Trans. AGU}, 4425 volume = {87}, 4426 pages = {36}, 4427 year = {2006}, 4428 petsc_uses = {KSP} 4429} 4430 4431@Article{ goverswortel05, 4432 author = {R. Govers and M.J.R. Wortel}, 4433 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 4434 journal = {Earth and Planetary Science Letters}, 4435 volume = {236/1-2}, 4436 pages = {505-523}, 4437 year = {2005}, 4438 petsc_uses = {KSP} 4439} 4440 4441@InProceedings{ snark2, 4442 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4443 year = {2002}, 4444 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 4445 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 4446 petsc_uses = {KSP} 4447} 4448 4449@Article{ snark1, 4450 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 4451 Tan and Feng Wang}, 4452 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 4453 journal = {Submitted to Pure and Applied Geosciences}, 4454 petsc_uses = {KSP} 4455} 4456 4457@InProceedings{ earthquake2003, 4458 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 4459 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 4460 Tiankai Tu}, 4461 year = {2003}, 4462 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 4463 booktitle = {Proceedings of SC2003}, 4464 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 4465 petsc_uses = {KSP} 4466} 4467 4468@InProceedings{ stefano12, 4469 author = {Michele De Stefano}, 4470 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 4471 booktitle = {PIERS Proceedings}, 4472 month = aug, 4473 address = {Moscow, RUSSIA}, 4474 pages = {491--495}, 4475 year = {2012}, 4476 petsc_uses = {KSP} 4477} 4478 4479%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 4480 4481% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4482% LiteralHTML: <center><img alt="" 4483% LiteralHTML: src="images/ocean.jpg"></center></p> 4484@Article{ khatiwala07, 4485 author = {Khatiwala, S.}, 4486 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 4487 journal = {Glob. Biogeochem. Cycles}, 4488 volume = {21}, 4489 doi = {10.1029/2007GB002923}, 4490 year = {2007}, 4491 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 4492} 4493 4494@Article{ dks2004, 4495 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 4496 journal = {Ocean Modelling}, 4497 year = {2004}, 4498 volume = {6(2)}, 4499 pages = {125-150}, 4500 title = {A finite-element Ocean Model: Principles and Evaluation}, 4501 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 4502 petsc_uses = {KSP} 4503} 4504 4505@Article{ danilov1, 4506 author = {S. Danilov and G. Kivman and J. Schroter}, 4507 year = {2004}, 4508 title = {Evaluation of an eddy-permitting finite-element ocean model in the {N}orth 4509 {A}tlantic}, 4510 journal = {Ocean Modelling}, 4511 petsc_uses = {KSP} 4512} 4513 4514@Article{ nerger1, 4515 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 4516 year = {2004}, 4517 title = {Data Assimilation with the Ensemble {K}alman Filter and the {SEIK} Filter applied to 4518 a Finite Element Model of the {N}orth {A}tlantic}, 4519 journal = {Journal of marine systems}, 4520 petsc_uses = {KSP} 4521} 4522 4523@Conference{ rakowsky2003self, 4524 title = {{A self-adaptive finite element model of the atmosphere}}, 4525 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 4526 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 4527 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 4528 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 4529 pages = {279}, 4530 isbn = {981238376X}, 4531 year = {2003}, 4532 organization = {World Scientific Pub Co}, 4533 petsc_uses = {KSP} 4534} 4535 4536@Article{ lauter3, 4537 author = {M. Lauter}, 4538 year = {2004}, 4539 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4540 AtmosphArenmodell}, 4541 journal = {Berichte zur Polar- und Meeresforschung}, 4542 petsc_uses = {KSP} 4543} 4544 4545@Article{ lauter2, 4546 author = {M. Lauter and D. Handorf and K. Dethloff}, 4547 year = {2004}, 4548 title = {Unsteady analytical solutions of the spherical shallow water equations}, 4549 journal = {Journal of computational physics}, 4550 petsc_uses = {KSP} 4551} 4552 4553@PhDThesis{ lauter1, 4554 author = {M. Lauter}, 4555 year = {2004}, 4556 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4557 AtmosphArenmodell}, 4558 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 4559 petsc_uses = {KSP} 4560} 4561 4562@Article{ frickenhaus1, 4563 author = {S. Frickenhaus and W. Hiller and M. Best}, 4564 year = {2005}, 4565 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 4566 parallel numerical atmosphere and ocean models}, 4567 journal = {Ocean Modelling}, 4568 volume = {10}, 4569 pages = {185--191}, 4570 petsc_uses = {KSP} 4571} 4572 4573@Article{ 0266-5611-24-3-034015, 4574 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 4575 title = {A {N}ewton-{CG} method for large-scale three-dimensional elastic full-waveform 4576 seismic inversion}, 4577 journal = {Inverse Problems}, 4578 volume = {24}, 4579 number = {3}, 4580 pages = {034015 (26pp)}, 4581 url = {http://stacks.iop.org/0266-5611/24/034015}, 4582 year = {2008}, 4583 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 4584 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 4585 iterations with inner conjugate gradient linear iterations, globalized by an 4586 Armijo backtracking line search, solved on a sequence of finer grids and higher 4587 frequencies to remain in the vicinity of the global optimum, inexactly terminated 4588 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 4589 variation operator to capture sharp interfaces, finely discretized by finite 4590 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 4591 implemented in matrix-free fashion with adjoint-based computation of reduced 4592 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 4593 waveform storage, and partitioned spatially across processors to parallelize the 4594 solutions of the forward and adjoint wave equations and the evaluation of 4595 gradient-like information. Several numerical examples demonstrate the grid 4596 independence of linear and nonlinear iterations, the effectiveness of the 4597 preconditioner, the ability to solve inverse problems with up to 17 million 4598 inversion parameters on up to 2048 processors, the effectiveness of multiscale 4599 continuation in keeping iterates in the basin of attraction of the global minimum, 4600 and the ability to fit the observational data while reconstructing the model with 4601 reasonable resolution and capturing sharp interfaces.}, 4602 petsc_uses = {KSP} 4603} 4604 4605% LiteralHTML: 4606% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 4607% LiteralHTML: 4608% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4609% LiteralHTML:<font color="#FF0000"> 4610% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 4611% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 4612% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 4613% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 4614% LiteralHTML:for a variety of these simulations.</p> 4615% LiteralHTML:</font> 4616% LiteralHTML: 4617@Article{ mills2009modeling, 4618 title = {Modeling subsurface reactive flows using leadership-class computing}, 4619 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4620 Mahinthakumar, G.K. and Smith, B.F.}, 4621 journal = {Journal of Physics: Conference Series}, 4622 volume = {180}, 4623 pages = {012062}, 4624 year = {2009}, 4625 publisher = {IOP Publishing}, 4626 petsc_uses = {KSP} 4627} 4628 4629@Conference{ mills2007simulating, 4630 title = {{Simulating subsurface flow and transport on ultrascale computers using 4631 PFLOTRAN}}, 4632 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 4633 booktitle = {Journal of Physics: Conference Series}, 4634 volume = {78}, 4635 pages = {012051}, 4636 year = {2007}, 4637 organization = {IOP Publishing}, 4638 petsc_uses = {KSP} 4639} 4640 4641@InProceedings{ mills2009, 4642 title = {Modeling subsurface reactive flows using leadership-class computing}, 4643 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4644 Mahinthakmuar, G. and Smith, B.}, 4645 booktitle = {Journal of Physics: Conference Series}, 4646 volume = {180}, 4647 pages = {102062}, 4648 year = {2009}, 4649 organization = {IOP Publishing}, 4650 petsc_uses = {KSP} 4651} 4652 4653@Article{ guo2013parallel, 4654 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 4655 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 4656 }, 4657 journal = {Advances in Water Resources }, 4658 volume = {53}, 4659 number = {0}, 4660 pages = {101 - 108}, 4661 year = {2013}, 4662 note = {}, 4663 issn = {0309-1708}, 4664 doi = {10.1016/j.advwatres.2012.10.010}, 4665 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 4666 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 4667 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 4668 preconditioner}, 4669 petsc_uses = {KSP} 4670} 4671 4672@Unpublished{ stomp, 4673 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 4674 url = {http://stomp.pnl.gov/}, 4675 petsc_uses = {KSP} 4676} 4677 4678@InProceedings{ htfc2003, 4679 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 4680 title = {Methods and Experiences For Parallelizing Flood Models}, 4681 year = {2003}, 4682 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 4683 European PVM/MPI User's Group Meeting}, 4684 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 4685 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 4686 petsc_uses = {KSP} 4687} 4688 4689@InProceedings{ hulchy-tran-astalos-fmsip, 4690 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 4691 D.Froehlich}, 4692 title = {Flood Modeling System and Its Parallelization}, 4693 year = {2002}, 4694 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 4695 Engineering}, 4696 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 4697 petsc_uses = {KSP} 4698} 4699 4700@InProceedings{ gy1, 4701 author = {J. P. Gwo and G. T. Yeh}, 4702 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 4703 Transport at Watershed Scale}, 4704 year = {2004}, 4705 booktitle = {The International Conference on Computational Methods}, 4706 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 4707 petsc_uses = {KSP} 4708} 4709 4710@Conference{ cheng2009efficient, 4711 title = {{An efficient parallel method for large-scale groundwater flow equation based on 4712 PETSc}}, 4713 author = {Cheng, T. and Ji, X. and Wang, Q.}, 4714 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 4715 Conference on}, 4716 pages = {190--193}, 4717 organization = {IEEE}, 4718 petsc_uses = {KSP} 4719} 4720 4721@Unpublished{ sfrsm, 4722 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 4723 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 4724 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 4725 its linear solves}, 4726 petsc_uses = {KSP} 4727} 4728 4729% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4730@InProceedings{ bart_omar:sc05, 4731 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 4732 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 4733 title = {Dynamic data driven inversion for terascale simulations: real-time 4734 indentification of airborne contaminants}, 4735 booktitle = {Proceedings of SC2005}, 4736 organization = {IEEE/ACM}, 4737 address = {Seattle, WA}, 4738 year = {2005}, 4739 month = nov, 4740 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 4741 lab = {SNL}, 4742 petsc_uses = {KSP} 4743} 4744 4745@InProceedings{ anton-krassimir-lscc, 4746 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 4747 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 4748 Simulations}, 4749 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 4750 volume = {2907}, 4751 year = {2003}, 4752 publisher = {Springer-Verlag}, 4753 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 4754 petsc_uses = {KSP} 4755} 4756 4757@InProceedings{ aa2001, 4758 author = {Anton Antonov}, 4759 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 4760 year = {2001}, 4761 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 4762 Sozopol, Bulgaria}, 4763 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 4764 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 4765 petsc_uses = {KSP} 4766} 4767 4768% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4769@Article{ grassley-simmons-kercher-00, 4770 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 4771 year = {2000}, 4772 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 4773 reactive transport models}, 4774 journal = {Applied Geochemistry}, 4775 volume = {17}, 4776 pages = {699--708}, 4777 lab = {LLNL} 4778} 4779 4780@Article{ glassey-nitao-03, 4781 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 4782 and Carl I. Steefel and James R. Kercher}, 4783 year = {2003}, 4784 title = {The impact of climate change on vadose zone pore waters and its implication for 4785 long-term monitoring}, 4786 journal = {Computers and Geosciences}, 4787 volume = {29}, 4788 pages = {399-411}, 4789 lab = {LLNL}, 4790 petsc_uses = {KSP} 4791} 4792 4793@Article{ steefel-depaolo-lichtner-05, 4794 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 4795 year = {2005}, 4796 title = {Reactive transport modeling: An essential tool and a new research approach for 4797 the Earth sciences}, 4798 journal = {Earth and Planetary Science Letters}, 4799 lab = {LLNL,LANL}, 4800 petsc_uses = {KSP} 4801} 4802 4803% LiteralHTML:<a name="scalinglarge"> 4804% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4805% LiteralHTML: <center><img alt="" 4806% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 4807% LiteralHTML:<font color="#FF0000"> 4808% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 4809@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 4810 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 4811 Strategies for Large-Scale Numerical Simulations}, 4812 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 4813 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 4814 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 4815 Large-Scale Systems (scalA)}, 4816 pages = {65-72}, 4817 doi = {10.1109/ScalA.2018.00012}, 4818 month = nov, 4819 year = {2018}, 4820 petsc_uses = {KSP} 4821} 4822 4823@Article{ km2004, 4824 author = {A. Keese and H. G. Matthies}, 4825 journal = {Computers and Structures}, 4826 year = {2005}, 4827 volume = {83}, 4828 pages = {1033--1047}, 4829 title = {Hierarchical parallelisation for the solution of stochastic finite element 4830 equations}, 4831 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 4832 petsc_uses = {KSP} 4833} 4834 4835@Unpublished{ hvl2002, 4836 title = {Numerical Modeling of {NAPL} Source Zone Treatment}, 4837 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 4838 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 4839 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 4840 year = {2002}, 4841 lab = {LANL}, 4842 petsc_uses = {KSP} 4843} 4844 4845@PhDThesis{ hammond2003, 4846 author = {Glenn E. Hammond}, 4847 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 4848 Transport on Supercomputers}, 4849 school = {University of Illinois at Urbana-Champaign}, 4850 year = {2003}, 4851 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 4852 petsc_uses = {KSP} 4853} 4854 4855@Unpublished{ uk, 4856 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 4857 Scale Environmental Flows and Transport Processes}, 4858 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 4859 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 4860 buildings and in Green Bay. Used PETSc for its linear solvers}, 4861 year = {1999}, 4862 petsc_uses = {KSP} 4863} 4864 4865@InProceedings{ hammond2002, 4866 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 4867 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 4868 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 4869 year = {2002}, 4870 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 4871 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 4872 Resources, Delft, The Netherlands.}, 4873 lab = {LANL}, 4874 petsc_uses = {KSP} 4875} 4876 4877@TechReport{ steefel1, 4878 author = {C. I. Steefel}, 4879 title = {Software for modeling multicomponent, multidimensional reactive transport}, 4880 year = {2001}, 4881 institution = {Lawrence Livermore National Laboratory}, 4882 number = {UCRL-MA-143182}, 4883 lab = {LLNL}, 4884 petsc_uses = {KSP} 4885} 4886 4887@Article{ steefel2, 4888 author = {C. I. Steefel and A. C. Lasaga}, 4889 title = {A coupled model for transport of multiple chemical-species and kinetic 4890 precipitation dissolution reactions with application to reactive flow in 4891 single-phase hydrothermal systems}, 4892 journal = {Americal Journal of Science}, 4893 year = {1994}, 4894 pages = {529-592}, 4895 volume = {294}, 4896 number = {5}, 4897 petsc_uses = {KSP} 4898} 4899 4900@TechReport{ steefel3, 4901 author = {C. I. Steefel and S. B. Yabusaki}, 4902 title = {{OS3D/GIMRT}, Software for Multicomponent-Multidimensional reactive transport: 4903 User's manual and programmer's guide}, 4904 year = {1996}, 4905 institution = {Pacific Northwest National Laboratory}, 4906 number = {PNNL-11166}, 4907 lab = {PNNL}, 4908 petsc_uses = {KSP} 4909} 4910 4911@Article{ 2005hvl, 4912 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 4913 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 4914 preconditioning to biogeochemical transport}, 4915 journal = {Advances in Water Resources}, 4916 year = {2005}, 4917 pages = {359--376}, 4918 volume = {28}, 4919 url = { 4920 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 4921 lab = {LANL}, 4922 petsc_uses = {KSP} 4923} 4924 4925@Article{ wang-zabar-05, 4926 author = {J Wang and N Zabaras}, 4927 journal = {Int. J. Heat and Mass Transfer}, 4928 title = {A Markov random field model of contamination source identification in porous 4929 media flow}, 4930 year = {2005}, 4931 petsc_uses = {KSP} 4932} 4933 4934@InBook{ kp1, 4935 author = {Jong G. Kim and Hyoung W. Park}, 4936 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 4937 Media}, 4938 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 4939 title = {Lecture Notes in Computer Science}, 4940 publisher = {Springer-Verlag}, 4941 volume = {3044}, 4942 year = {2004}, 4943 petsc_uses = {KSP} 4944} 4945 4946@Article{ 2001agusm...h32a06k, 4947 author = {{Kim}, J.~G. and {Kim}, J.}, 4948 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 4949 journal = {AGU Spring Meeting Abstracts}, 4950 year = {2001}, 4951 pages = {32-+}, 4952 petsc_uses = {KSP} 4953} 4954 4955@Article{ lzb2005, 4956 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 4957 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 4958 journal = {Journal of Hydraulic Engineering}, 4959 year = {2005}, 4960 volume = {131}, 4961 number = {4}, 4962 pages = {247--258}, 4963 petsc_uses = {KSP} 4964} 4965 4966@Article{ rao2005, 4967 author = {Prasada Rao}, 4968 title = {A parallel {RMA2} model for simulating large-scale free surface flows}, 4969 journal = {Environmental Modelling and Software}, 4970 year = {2005}, 4971 pages = {47--53}, 4972 petsc_uses = {KSP} 4973} 4974 4975@InProceedings{ pr1, 4976 author = {Prasada Rao}, 4977 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 4978 Hydrodynamic Flows}, 4979 year = {2003}, 4980 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 4981 Conference}, 4982 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 4983 petsc_uses = {KSP} 4984} 4985 4986@InProceedings{ lichtner2004, 4987 author = {Peter C. Lichtner and Andrew Wolfsberg}, 4988 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 4989 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 4990 Challenge Supercomputing Problem}, 4991 year = {2004}, 4992 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 4993 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 4994 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 4995 lab = {LANL}, 4996 petsc_uses = {KSP} 4997} 4998 4999% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 5000@Article{ aba01:petsc-app, 5001 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 5002 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 5003 journal = {Int. J. High Performance Computing Applications}, 5004 year = {2001}, 5005 volume = {15}, 5006 number = {1}, 5007 pages = {13--21}, 5008 petsc_uses = {KSP} 5009} 5010 5011@PhDThesis{ tjb200, 5012 author = {Thomas James Byer}, 5013 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 5014 Facilities}, 5015 school = {Stanford}, 5016 year = {2000}, 5017 petsc_uses = {KSP} 5018} 5019 5020@InProceedings{ puchyr2006, 5021 author = {Peter J. Puchyr}, 5022 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 5023 {Win32} Cluster}, 5024 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 5025 note = {Paper number CIPC2006-207}, 5026 year = {2006}, 5027 petsc_uses = {KSP} 5028} 5029 5030@InProceedings{ texas98, 5031 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 5032 and G. A. Pope}, 5033 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 5034 Simulation}, 5035 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 5036 Symposium}, 5037 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 5038 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 5039 year = {1998}, 5040 petsc_uses = {KSP} 5041} 5042 5043% LiteralHTML: 5044% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 5045% LiteralHTML: 5046@Article{ farrellmitchellscottwechsung2021, 5047 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 5048 stationary incompressible {Navier-Stokes} equations}, 5049 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 5050 Wechsung}, 5051 journal = {The SMAI journal of computational mathematics}, 5052 volume = {7}, 5053 pages = {75--96}, 5054 year = {2021}, 5055 petsc_uses = {KSP} 5056} 5057 5058@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 5059 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 5060 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 5061 P MacLachlan and Ray S Tuminaro}, 5062 journal = {SIAM Journal on Scientific Computing}, 5063 number = {0}, 5064 pages = {S70--S91}, 5065 year = {2021}, 5066 petsc_uses = {KSP} 5067} 5068 5069@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 5070 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 5071 hyperelasticity}, 5072 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 5073 Oyar\'ua and Ricardo Ruiz-Baier}, 5074 journal = {Computer Methods in Applied Mechanics and Engineering}, 5075 volume = {374}, 5076 pages = {113562}, 5077 issn = {0045-7825}, 5078 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 5079 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 5080 year = {2021}, 5081 petsc_uses = {KSP} 5082} 5083 5084@Article{ farrellmitchellwechsung2018, 5085 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 5086 {Navier-Stokes} equations at high {Reynolds} number}, 5087 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 5088 journal = {SIAM Journal on Scientific Computing}, 5089 volume = {41}, 5090 number = {5}, 5091 eprint = {1810.03315}, 5092 pages = {A3073-A3096}, 5093 year = {2019}, 5094 petsc_uses = {KSP} 5095} 5096 5097@Article{ hevuikklaij2017, 5098 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 5099 discretized by a finite volume method}, 5100 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 5101 journal = {Journal of Numerical Mathematics}, 5102 volume = {25}, 5103 number = {2}, 5104 pages = {89--105}, 5105 year = {2017}, 5106 petsc_uses = {KSP} 5107} 5108 5109@InProceedings{ zou2015newton, 5110 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 5111 appearance/disappearance}, 5112 author = {Zou, L and Zhao, H and Zhang, H}, 5113 booktitle = {ANS 2015 Annual Meeting, June}, 5114 volume = {7}, 5115 number = {11}, 5116 year = {2015}, 5117 petsc_uses = {KSP} 5118} 5119 5120@Article{ guermond2009nonlinear, 5121 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 5122 Fourier/finite element technique and an interior penalty method}, 5123 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 5124 journal = {Journal of computational physics}, 5125 volume = {228}, 5126 number = {8}, 5127 pages = {2739--2757}, 5128 year = {2009}, 5129 publisher = {Elsevier}, 5130 petsc_uses = {KSP} 5131} 5132 5133@Article{ erzincanlisahin2015, 5134 title = {The numerical simulation of the wing kinematics effects on near wake topology and 5135 aerodynamic performance in hovering {D}rosophila flight}, 5136 author = {Belkis Erzincanli and Mehmet Sahin}, 5137 journal = {Computers \& Fluids}, 5138 volume = {122}, 5139 pages = {90--110}, 5140 year = {2015}, 5141 publisher = {Elsevier}, 5142 petsc_uses = {KSP} 5143} 5144 5145@Article{ ekensahin2015, 5146 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 5147 structure interaction problems}, 5148 author = {Ali Eken and Mehmet Sahin}, 5149 journal = {International Journal for Numerical Methods in Fluids}, 5150 year = {2015}, 5151 publisher = {Wiley Online Library}, 5152 petsc_uses = {KSP} 5153} 5154 5155@Article{ hwangsucai2015, 5156 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 5157 for transonic full potential equation}, 5158 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 5159 journal = {Computers \& Fluids}, 5160 volume = {110}, 5161 number = {30}, 5162 pages = {96--107}, 5163 year = {2015}, 5164 doi = {10.1016/j.compfluid.2014.04.005}, 5165 petsc_uses = {KSP} 5166} 5167 5168@Article{ yanghwangcai2016, 5169 title = {Nonlinear Preconditioning Techniques for Full-Space {L}agrange--{N}ewton Solution of 5170 {PDE}-Constrained Optimization Problems}, 5171 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 5172 journal = {SIAM Journal on Scientific Computing}, 5173 volume = {38}, 5174 number = {5}, 5175 pages = {A2756--A2778}, 5176 year = {2016}, 5177 petsc_uses = {KSP} 5178} 5179 5180@Article{ khanaidun2011, 5181 author = {Irfan Khan and Cyrus K. Aidun}, 5182 title = {Direct numerical simulation of saturated deformable porous media using parallel 5183 hybrid Lattice-{B}oltzmann and finite element method}, 5184 journal = {Int. J. Numer. Meth. Eng.}, 5185 volume = {86}, 5186 pages = {1379--1395}, 5187 year = {2011}, 5188 petsc_uses = {KSP} 5189} 5190 5191@Article{ khanaidun2014, 5192 author = {Irfan Khan and Cyrus K. Aidun}, 5193 title = {Modeling the deformation of saturate porous media using direct numerical 5194 simulation}, 5195 journal = {Int. J. Multiphase Flow}, 5196 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 5197 year = {2014}, 5198 petsc_uses = {KSP} 5199} 5200 5201@Article{ mofidi2014simulations, 5202 author = {A. Mofidi and P. M. Carrica}, 5203 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 5204 and Propeller}, 5205 journal = {Computers and Fluids}, 5206 pages = {191--203}, 5207 year = {2014}, 5208 petsc_uses = {KSP} 5209} 5210 5211@Article{ paik2014fluidstructure, 5212 author = {K. Paik and P. M. Carrica}, 5213 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 5214 Surface in a Rolling Tank}, 5215 journal = {Ocean Engineering}, 5216 pages = {201--212}, 5217 year = {2014}, 5218 petsc_uses = {KSP} 5219} 5220 5221@Article{ castro2013bubble, 5222 author = {A. M. Castro and P. M. Carrica}, 5223 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 5224 evaluation and numerical issues}, 5225 journal = {International Journal of Multiphase Flow 57}, 5226 pages = {131--150}, 5227 year = {2013}, 5228 petsc_uses = {KSP} 5229} 5230 5231@Article{ carrica2013turn, 5232 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 5233 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 5234 Dynamic Overset Grids}, 5235 journal = {Journal of Marine Science and Technology}, 5236 pages = {166--181}, 5237 year = {2013}, 5238 petsc_uses = {KSP} 5239} 5240 5241@Article{ castro2013eulerian, 5242 author = {A. M. Castro and P. M. Carrica}, 5243 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 5244 {Athena} {R}/V,}, 5245 journal = {International Shipbuilding Progress}, 5246 pages = {403--433}, 5247 year = {2013}, 5248 petsc_uses = {KSP} 5249} 5250 5251@Article{ chase2013overset, 5252 author = {N. Chase and T. Michael and P. M. Carrica}, 5253 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 5254 {Maneuvering} {Conditions}}, 5255 journal = {International Shipbuilding Progress}, 5256 pages = {171--205}, 5257 year = {2013}, 5258 petsc_uses = {KSP} 5259} 5260 5261@Article{ sadathosseini2013wu, 5262 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 5263 Stern}, 5264 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 5265 Free Surge Conditions in Short and Long Head Waves}, 5266 journal = {Ocean Engineering}, 5267 volume = {59}, 5268 pages = {240--273}, 5269 year = {2013}, 5270 petsc_uses = {KSP} 5271} 5272 5273@Article{ chase2013cfd, 5274 author = {N. Chase and P. M. Carrica}, 5275 title = {{CFD} Simulations of a Submarine Propeller and Application to Self-Propulsion of a 5276 Submarine}, 5277 journal = {Ocean Engineering}, 5278 pages = {68--80}, 5279 year = {2013}, 5280 petsc_uses = {KSP} 5281} 5282 5283@Article{ carrica2012cfd, 5284 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 5285 title = {{CFD} Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 5286 of Moving Rudders and Rotating Propellers}, 5287 journal = {Computers and Fluids 53}, 5288 pages = {117--132}, 5289 year = {2012}, 5290 petsc_uses = {KSP} 5291} 5292 5293@Article{ sakamoto2012urans, 5294 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5295 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 5296 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 5297 publisher = {Journal of Marine Science and Technology}, 5298 pages = {422--445}, 5299 year = {2012}, 5300 petsc_uses = {KSP} 5301} 5302 5303@Article{ sakamoto2012uransb, 5304 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5305 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 5306 Analysis and Validation of Local Flow Characteristics}, 5307 journal = {Journal of Marine Science and Technology}, 5308 pages = {446--468}, 5309 year = {2012}, 5310 petsc_uses = {KSP} 5311} 5312 5313@Article{ li2012dynamic, 5314 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 5315 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 5316 journal = {Renewable Energy}, 5317 pages = {285--298}, 5318 year = {2012}, 5319 petsc_uses = {KSP} 5320} 5321 5322@Article{ huang2012a, 5323 author = {J. Huang and P. M. Carrica and F. Stern}, 5324 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 5325 journal = {International Journal for Numerical Methods in Fluids}, 5326 pages = {160--180}, 5327 year = {2012}, 5328 petsc_uses = {KSP} 5329} 5330 5331@Article{ huang2012b, 5332 author = {J. Huang and P. M. Carrica and F. Stern}, 5333 title = {A geometry-based level set method for curvilinear overset grids with application 5334 to ship hydrodynamics}, 5335 journal = {International Journal for Numerical Methods in Fluids}, 5336 pages = {494--521}, 5337 year = {2012}, 5338 petsc_uses = {KSP} 5339} 5340 5341@Article{ carrica2011computations, 5342 author = {P. M. Carrica and H. Fu and F. Stern}, 5343 title = {Computations of self-propulsion free to sink and trim and of motions in head 5344 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 5345 journal = {Applied Ocean Research}, 5346 pages = {309--320}, 5347 year = {2011}, 5348 petsc_uses = {KSP} 5349} 5350 5351@Article{ bhushan2011scalability, 5352 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 5353 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 5354 Using {CFDShip}-Iowa}, 5355 journal = {International Journal of High Performance Computing Applications}, 5356 pages = {466--487}, 5357 year = {2011}, 5358 petsc_uses = {KSP} 5359} 5360 5361@Article{ castro2011full, 5362 author = {A. M. Castro and P. M. Carrica and F. Stern}, 5363 title = {Full scale self-propulsion computations using discretized propeller for the 5364 {KRISO} container ship {KCS}}, 5365 journal = {Computers and Fluids}, 5366 pages = {35--47}, 5367 year = {2011}, 5368 petsc_uses = {KSP} 5369} 5370 5371@Article{ kandasamy2011multifidelity, 5372 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5373 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5374 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing {C}atamaran 5375 for Low Wake}, 5376 journal = {Journal of Marine Science and Technology}, 5377 pages = {143--156}, 5378 year = {2011}, 5379 petsc_uses = {KSP} 5380} 5381 5382@Article{ kandasamy2011cfd, 5383 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5384 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5385 title = {{CFD} Validation Studies for a High-speed Foil-assisted Semi-planing {C}atamaran}, 5386 journal = {Journal of Marine Science and Technology}, 5387 pages = {157--167}, 5388 year = {2011}, 5389 petsc_uses = {KSP} 5390} 5391 5392@Article{ sadathosseini2011cfd, 5393 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 5394 and S. Yamamura and A. Mastuda}, 5395 title = {{CFD} System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 5396 Periodic Motion and Broaching}, 5397 journal = {Ocean Engineering}, 5398 pages = {88--110}, 5399 year = {2011}, 5400 petsc_uses = {KSP} 5401} 5402 5403@Article{ mosaviraad2010development, 5404 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 5405 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 5406 with Comparison to Regular Wave and Transient Wave Group Procedures Using 5407 {URANS}}, 5408 journal = {Ocean Engineering}, 5409 pages = {653--666}, 5410 year = {2010}, 5411 petsc_uses = {KSP} 5412} 5413 5414@Article{ carrica2010largescale, 5415 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5416 Stern}, 5417 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5418 Heave Problems for a Surface Combatant}, 5419 journal = {Computers and Fluids}, 5420 pages = {1095--1111}, 5421 year = {2010}, 5422 petsc_uses = {KSP} 5423} 5424 5425@Article{ carrica2010selfpropulsion, 5426 author = {P. M. Carrica and A. M. Castro and F. Stern}, 5427 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 5428 with Dynamic Overset Grids}, 5429 journal = {Journal of Marine Science and Technology}, 5430 pages = {316--330}, 5431 year = {2010}, 5432 petsc_uses = {KSP} 5433} 5434 5435@Article{ ismail2010evaluation, 5436 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 5437 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 5438 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 5439 journal = {International Journal of Numerical Methods in Fluids}, 5440 pages = {850--886}, 5441 year = {2010}, 5442 petsc_uses = {KSP} 5443} 5444 5445@Article{ kandasamy2010integral, 5446 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 5447 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 5448 journal = {Journal of Fluids Engineering}, 5449 pages = {101103}, 5450 year = {2010}, 5451 petsc_uses = {KSP} 5452} 5453 5454@Article{ kirk:2014de, 5455 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 5456 title = {{Modeling hypersonic entry with the fully-implicit {N}avier--{S}tokes (FIN-S) 5457 stabilized finite element flow solver}}, 5458 journal = {Computers {\&} Fluids}, 5459 year = {2014}, 5460 volume = {92}, 5461 number = {0}, 5462 pages = {281--292}, 5463 month = mar, 5464 petsc_uses = {KSP} 5465} 5466 5467@Article{ carracciuolo20111382, 5468 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 5469 in high performance computing environment}, 5470 journal = {Journal of Non-Newtonian Fluid Mechanics }, 5471 volume = {166}, 5472 number = {23--24}, 5473 pages = {1382--1395}, 5474 year = {2011}, 5475 issn = {0377-0257}, 5476 doi = {10.1016/j.jnnfm.2011.08.014}, 5477 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 5478 Maffettone and A. Murli}, 5479 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 5480 method, High performance computing}, 5481 petsc_uses = {KSP} 5482} 5483 5484@Article{ bungartzgatzhammerliebmehlneckel11, 5485 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 5486 Miriam and Neckel, Tobias}, 5487 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 5488 journal = {Computational Mechanics}, 5489 volume = {48}, 5490 number = {3}, 5491 pages = {365-376}, 5492 year = {2011}, 5493 issn = {0178-7675}, 5494 doi = {10.1007/s00466-011-0626-1}, 5495 publisher = {Springer-Verlag}, 5496 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 5497 Thermohydraulics; Two-phase flow}, 5498 language = {English}, 5499 petsc_uses = {KSP} 5500} 5501 5502@Article{ bpr:cfl, 5503 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 5504 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 5505 Equations}}, 5506 journal = {International Journal for Numerical Methods in Fluids}, 5507 year = {2009}, 5508 volume = {59}, 5509 number = {1}, 5510 pages = {1--18}, 5511 doi = {10.1002/fld.1798}, 5512 petsc_uses = {KSP} 5513} 5514 5515@InBook{ bonfiglioli_campobasso_carpentieri_2010, 5516 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 5517 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 5518 preconditioned newton-krylov solver}, 5519 publisher = {Curran Associates}, 5520 year = {2010}, 5521 url = {http://www.proceedings.com/05932.html}, 5522 petsc_uses = {KSP} 5523} 5524 5525@Article{ bonfiglioli_rans_2005, 5526 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 5527 Bernardo}, 5528 title = {RANS simulations of a junction flow}, 5529 journal = {International Journal of Computational Fluid Dynamics}, 5530 volume = {19}, 5531 number = {2}, 5532 pages = {179-189}, 5533 year = {2005}, 5534 doi = {10.1080/10618560410001729126}, 5535 petsc_uses = {KSP} 5536} 5537 5538@InCollection{ bonfiglioli__carpentieri_rans_2008, 5539 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 5540 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 5541 Italy}, 5542 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 5543 Equations Using Fluctuation Splitting Schemes}, 5544 booktitle = {Numerical Mathematics and Advanced Applications}, 5545 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 5546 publisher = {Springer Berlin Heidelberg}, 5547 isbn = {978-3-540-69777-0}, 5548 pages = {151-158}, 5549 doi = {10.1007/978-3-540-69777-0_17}, 5550 year = {2008}, 5551 petsc_uses = {KSP} 5552} 5553 5554@InCollection{ bonfiglioli__carpentieri_ens_2007, 5555 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 5556 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 5557 Italy}, 5558 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 5559 Problems on Unstructured Grids}, 5560 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 5561 series = {Lecture Notes in Computer Science}, 5562 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 5563 publisher = {Springer Berlin / Heidelberg}, 5564 isbn = {978-3-540-75754-2}, 5565 pages = {676-685}, 5566 volume = {4699}, 5567 doi = {10.1007/978-3-540-75755-9_83}, 5568 year = {2007}, 5569 petsc_uses = {KSP} 5570} 5571 5572@Article{ terrelscottknepleykirby08, 5573 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 5574 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 5575 journal = {BIT}, 5576 volume = {48}, 5577 number = {2}, 5578 year = {2008}, 5579 petsc_uses = {KSP} 5580} 5581 5582@Article{ martamadermartinsweidealonso07, 5583 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 5584 J. Alonso}, 5585 title = {A methodology for the development of discrete adjoint solvers using automatic 5586 differentiation tools}, 5587 journal = {Computational Fluid Dyanmics}, 5588 volume = {21}, 5589 pages = {307--327}, 5590 year = {2007}, 5591 petsc_uses = {KSP} 5592} 5593 5594@TechReport{ avb2008, 5595 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 5596 title = {Variational Space-time (Dis)continuous {G}alerkin Method for Linear Free Surface 5597 Waves}, 5598 year = {2008}, 5599 institution = {University of Twente, the Netherlands}, 5600 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 5601 petsc_uses = {KSP} 5602} 5603 5604@InProceedings{ bdsm2005, 5605 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 5606 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 5607 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 5608 year = {2005}, 5609 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 5610 petsc_uses = {KSP} 5611} 5612 5613@InProceedings{ ms2006, 5614 author = {S. Muller and Y. Stiriba}, 5615 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 5616 STEADY COMPRESSIBLE FLOWS}, 5617 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 5618 year = {2006}, 5619 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 5620 petsc_uses = {KSP} 5621} 5622 5623@Article{ araujoteixeiracunhagroth08, 5624 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 5625 title = {Parallel three-dimensional simulation of the injection molding process}, 5626 journal = {International Journal for Numerical Methods in Fluids}, 5627 year = {2008}, 5628 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 5629 petsc_uses = {KSP} 5630} 5631 5632@PhDThesis{ a2008, 5633 author = {A. Cubero}, 5634 title = {a parallel coupled algorithm for collocated grids and its application to Large 5635 Eddy Simulation of a turbulent wake}, 5636 school = {University of Zaragoza (Spain)}, 5637 year = {2008}, 5638 petsc_uses = {KSP} 5639} 5640 5641@Article{ afa2007, 5642 author = {A. Cubero and N. Fueyo}, 5643 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 5644 journal = {Numerical Heat Transfer, part B-Fundamentals}, 5645 volume = {56}, 5646 number = {6}, 5647 pages = {507--529}, 5648 year = {2007}, 5649 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 5650 petsc_uses = {KSP} 5651} 5652 5653@TechReport{ af2007, 5654 title = {Preconditioning based on a partially implicit implementation of Momentum 5655 Interpolation for coupled solvers}, 5656 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 5657 year = {2007}, 5658 author = {A. Cubero and N. Fueyo}, 5659 petsc_uses = {KSP} 5660} 5661 5662@InCollection{ dwight2004, 5663 author = {Richard Dwight}, 5664 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 5665 booktitle = {Computational Fluid Dynamics 2006}, 5666 editor = {H. Deconinck and E. Dick}, 5667 publisher = {Springer}, 5668 year = {2006}, 5669 url = {http://www.maths.man.ac.uk/\~{ 5670 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 5671 petsc_uses = {KSP} 5672} 5673 5674@InProceedings{ dwight2006, 5675 author = {Richard Dwight and Joel Brezillon}, 5676 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 5677 Optimization}, 5678 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 5679 AIAA-2006-0690}, 5680 year = {2006}, 5681 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 5682 petsc_uses = {KSP} 5683} 5684 5685@PhDThesis{ dwight2006a, 5686 author = {Richard Dwight}, 5687 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 5688 and Adjoint Methods on Unstructured Grids}, 5689 school = {School of Mathematics, University of Manchester}, 5690 year = {2006}, 5691 url = {http://www.maths.man.ac.uk/\~{ 5692 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 5693 petsc_uses = {KSP} 5694} 5695 5696@InProceedings{ lhdfrh, 5697 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 5698 W. Hiller}, 5699 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 5700 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 5701 March, 10-14, 2003, Munich University of Technology, German}, 5702 year = {2003}, 5703 petsc_uses = {KSP} 5704} 5705 5706@InProceedings{ brios-ying-2002, 5707 author = {George Biros and Lexing Ying and Denis Zorin}, 5708 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 5709 {Navier-Stokes} equations}, 5710 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 5711 year = {2002}, 5712 petsc_uses = {KSP} 5713} 5714 5715@InProceedings{ mohsen-straatman-ins, 5716 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 5717 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 5718 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 5719 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 5720 Systems and Applications}, 5721 pages = {11--16}, 5722 year = {2005}, 5723 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 5724 petsc_uses = {KSP} 5725} 5726 5727@TechReport{ bonglioli-icnmfd98, 5728 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 5729 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 5730 institution = {Universita della Basilicata via della Tecnica 3}, 5731 year = {1996}, 5732 author = {A. Bonglioli}, 5733 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 5734 petsc_uses = {KSP} 5735} 5736 5737@Article{ deng-piquet-ctf, 5738 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 5739 title = {A new fully coupled method for computing turbulent flows}, 5740 journal = {Computers and Fluids}, 5741 volume = {30}, 5742 pages = {445--472}, 5743 year = {2001}, 5744 petsc_uses = {KSP} 5745} 5746 5747@InProceedings{ knepleysarinsameh99b, 5748 title = {Multilevel Preconditioning for Parallel {CFD}}, 5749 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 5750 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 5751 Problems In Industrial Applications}, 5752 address = {Minneapolis, MN}, 5753 year = {1999}, 5754 petsc_uses = {KSP} 5755} 5756 5757@InProceedings{ garbey1, 5758 author = {M. Garbey and B. Hadri and W. Shyy.}, 5759 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 5760 Problems on the Grid}, 5761 booktitle = {Aerospace Sciences Meeting and Exhibit}, 5762 note = {Paper No. 2005-1386}, 5763 year = {2005}, 5764 petsc_uses = {KSP} 5765} 5766 5767@Article{ carrica2007unsteady, 5768 title = {An unsteady single-phase level set method for viscous free surface flows}, 5769 author = {Carrica, PM and Wilson, RV and Stern, F.}, 5770 journal = {International Journal for Numerical Methods in Fluids}, 5771 volume = {53}, 5772 number = {2}, 5773 pages = {229--256}, 5774 year = {2007}, 5775 publisher = {Chichester; New York: Wiley, c1981-}, 5776 petsc_uses = {KSP} 5777} 5778 5779@Article{ pctw2004, 5780 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 5781 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 5782 Spillways}, 5783 journal = {Journal of Hydraulic Research}, 5784 note = {accepted for publication}, 5785 year = {2004}, 5786 petsc_uses = {KSP} 5787} 5788 5789@Article{ wcs2004, 5790 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 5791 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 5792 Combatant}, 5793 journal = {Computers and Fluids}, 5794 note = {in press}, 5795 year = {2004}, 5796 petsc_uses = {KSP} 5797} 5798 5799@Article{ cws2005, 5800 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 5801 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 5802 journal = {Computers and Fluids}, 5803 note = {accepted for publication}, 5804 year = {2005}, 5805 petsc_uses = {KSP} 5806} 5807 5808@Article{ chndss2010, 5809 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5810 Stern}, 5811 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5812 Heave Problems for a Surface Combatant}, 5813 journal = {Computers and Fluids}, 5814 year = {2010}, 5815 volume = {39}, 5816 number = {7}, 5817 pages = {1095--1111}, 5818 petsc_uses = {KSP} 5819} 5820 5821@InProceedings{ chnkss2008, 5822 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5823 Stern}, 5824 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 5825 Grids}, 5826 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 5827 year = {2008}, 5828 petsc_uses = {KSP} 5829} 5830 5831@MastersThesis{ mtj, 5832 author = {M. T. Jozkowski}, 5833 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 5834 About Submerged Bodies}, 5835 school = {The Pennsylvania State University}, 5836 year = {2005}, 5837 petsc_uses = {KSP} 5838} 5839 5840@Article{ pp, 5841 author = {E. G. Paterson and L. J. Peltier}, 5842 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 5843 Wakes}, 5844 journal = {ASME Journal of Fluids Engineering}, 5845 note = {In press}, 5846 year = {2005}, 5847 petsc_uses = {KSP} 5848} 5849 5850@Article{ eps, 5851 author = {B. A. Edge and E. G. Paterson and G. Settles}, 5852 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 5853 journal = {ASME Journal of Fluids Engineering}, 5854 note = {In press}, 5855 year = {2005}, 5856 petsc_uses = {KSP} 5857} 5858 5859@InProceedings{ rp, 5860 author = {B. Racine and E. G. Paterson}, 5861 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 5862 Using Unsteady {RANS} {CFD}}, 5863 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 5864 year = {2005}, 5865 petsc_uses = {KSP} 5866} 5867 5868@InProceedings{ etpp, 5869 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 5870 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 5871 and DES}, 5872 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5873 year = {2004}, 5874 petsc_uses = {KSP} 5875} 5876 5877@InProceedings{ pp8, 5878 author = {E. G. Paterson and L. J. Peltier}, 5879 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 5880 refinement grids and detached-eddy simulation}, 5881 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5882 year = {2004}, 5883 petsc_uses = {KSP} 5884} 5885 5886@InProceedings{ mzwp, 5887 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 5888 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 5889 booktitle = {25th Symposium on Naval Hydrodynamics}, 5890 year = {2004}, 5891 petsc_uses = {KSP} 5892} 5893 5894@InProceedings{ ppph, 5895 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 5896 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 5897 booktitle = {25th Symposium on Naval Hydrodynamics}, 5898 year = {2004}, 5899 petsc_uses = {KSP} 5900} 5901 5902@InProceedings{ ppd, 5903 author = {E. G. Paterson and L. J. Peltier}, 5904 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 5905 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 5906 year = {2004}, 5907 petsc_uses = {KSP} 5908} 5909 5910@InProceedings{ bp, 5911 author = {W. J. Baker and E. G. and Paterson}, 5912 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 5913 Control Wing}, 5914 booktitle = {NASA/ONR Workshop on Circulation Control}, 5915 year = {2004}, 5916 petsc_uses = {KSP} 5917} 5918 5919@InProceedings{ pb, 5920 author = {E. G. Paterson and W. J. Baker}, 5921 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 5922 booktitle = {NASA/ONR Workshop on Circulation Control}, 5923 year = {2004}, 5924 petsc_uses = {KSP} 5925} 5926 5927@InProceedings{ pb3, 5928 author = {E. G. Paterson and W. J. Baker}, 5929 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 5930 Surfaces}, 5931 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 5932 year = {2004}, 5933 petsc_uses = {KSP} 5934} 5935 5936@InProceedings{ gid1, 5937 author = {G. Frank and J. D'Elia}, 5938 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 5939 year = {2004}, 5940 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 5941 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 5942 petsc_uses = {KSP} 5943} 5944 5945@InBook{ b1, 5946 author = {A.Bonfiglioli}, 5947 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 5948 year = {2001}, 5949 title = {Science and Supercomputing at CINECA}, 5950 pages = {397--400}, 5951 petsc_uses = {KSP} 5952} 5953 5954@InProceedings{ b2004, 5955 author = {L. A. Barba}, 5956 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 5957 fully meshless formulation}, 5958 year = {2004}, 5959 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 5960 note = {Submitted}, 5961 petsc_uses = {KSP} 5962} 5963 5964@InProceedings{ bl2004, 5965 author = {L. A. Barba and A. Leonard}, 5966 title = {Computation of Viscous Vortices with Fully Meshless Method}, 5967 year = {2004}, 5968 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 5969 note = {Submitted}, 5970 petsc_uses = {KSP} 5971} 5972 5973@Article{ vws1, 5974 author = {B. G. M. Van Wachem and J. C. Schouten}, 5975 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 5976 Velocity}, 5977 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 5978 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 5979 Netherlands}, 5980 journal = {AIChE}, 5981 volumne = {48}, 5982 number = {12}, 5983 month = dec, 5984 year = {2002}, 5985 petsc_uses = {KSP} 5986} 5987 5988@TechReport{ lbam1, 5989 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 5990 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 5991 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 5992 di Bari Italy}, 5993 year = {2002}, 5994 number = {25/02}, 5995 petsc_uses = {KSP} 5996} 5997 5998@Article{ kees_miller_02, 5999 author = {C. E. Kees and C. T. Miller}, 6000 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 6001 journal = {Advances in Water Resources}, 6002 year = {2002}, 6003 volume = {25}, 6004 number = {2}, 6005 pages = {159-177.}, 6006 petsc_uses = {KSP} 6007} 6008 6009@InProceedings{ lepotmeersessers2001, 6010 author = {I. Lepot and F. Meers and J.A. Essers}, 6011 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 6012 Unstructured Meshes}, 6013 year = {2001}, 6014 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 6015 url = {http://www.ulg.ac.be/aerodyn}, 6016 petsc_uses = {KSP} 6017} 6018 6019@InProceedings{ knepley98, 6020 author = {Matthew Knepley and Denis Vanderstraeten}, 6021 title = {Parallel Building Blocks for Finite Element Simulations: Application to 6022 Solid-Liquid Mixture Flows}, 6023 booktitle = {Proceedings of Parallel CFD'97}, 6024 publisher = {Elsevier}, 6025 pages = {281--287}, 6026 year = {1998}, 6027 petsc_uses = {KSP} 6028} 6029 6030@InProceedings{ pcfd97, 6031 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6032 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 6033 publisher = {Elsevier}, 6034 year = {1998}, 6035 booktitle = {Proceedings of Parallel CFD'97}, 6036 pages = {333-344}, 6037 petsc_uses = {KSP} 6038} 6039 6040@InProceedings{ knepleysamehsari98, 6041 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6042 title = {Parallel Simulation of Particulate Flows}, 6043 booktitle = {Solving Irregularly Structured Problems in Parallel}, 6044 editors = {A. Ferreira et al}, 6045 year = {1998}, 6046 series = {Lecture Notes in Computer Science}, 6047 volume = {1457}, 6048 pages = {226--237}, 6049 petsc_uses = {KSP} 6050} 6051 6052@Article{ gkmt98, 6053 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6054 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 6055 Implicit {CFD}}, 6056 journal = {Int. J. High Performance Computing Applications}, 6057 year = {2000}, 6058 volume = {14}, 6059 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 6060 pages = {102-136}, 6061 petsc_uses = {KSP} 6062} 6063 6064@InProceedings{ agkks-sc99, 6065 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 6066 Smith}, 6067 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 6068 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 6069 editor = {}, 6070 publisher = {}, 6071 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 6072 year = {1999}, 6073 note = {Winner of Gordon Bell Special Prize at SC 99}, 6074 petsc_uses = {KSP} 6075} 6076 6077@Article{ gkks01, 6078 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6079 title = {High Performance Parallel Implicit {CFD}}, 6080 journal = {Journal of Parallel Computing}, 6081 year = {2001}, 6082 volume = {27}, 6083 pages = {337-362}, 6084 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 6085 petsc_uses = {KSP} 6086} 6087 6088@Article{ cristea-sofonea-02, 6089 author = {Artur Cristea and Victor Sofonea}, 6090 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 6091 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6092 Sciences, Information Sciences}, 6093 volume = {3}, 6094 number = {3}, 6095 year = {2002}, 6096 petsc_uses = {KSP} 6097} 6098 6099@Article{ cristea2, 6100 author = {Artur Cristea and Victor Sofonea}, 6101 title = {Two component lattice Boltzmann model with flux limiter techniques}, 6102 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6103 Sciences, Information Sciences}, 6104 volume = {4}, 6105 number = {1}, 6106 year = {2003}, 6107 pages = {59--64}, 6108 petsc_uses = {KSP} 6109} 6110 6111@Article{ cristea1, 6112 author = {Artur Cristea and Victor Sofonea}, 6113 title = {Two component lattice Boltzmann model with flux limiters}, 6114 journal = {Central European Journal of Physics}, 6115 volume = {2}, 6116 number = {2}, 6117 year = {2004}, 6118 pages = {382--396}, 6119 petsc_uses = {KSP} 6120} 6121 6122@Article{ sofnea-lamura1, 6123 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 6124 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 6125 systems}, 6126 journal = {Physical Review E}, 6127 volume = {70}, 6128 number = {4}, 6129 year = {2004}, 6130 pages = {046702-1 / 046702-9}, 6131 petsc_uses = {KSP} 6132} 6133 6134@InProceedings{ gkks01b, 6135 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6136 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 6137 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 6138 Mechanics}, 6139 editor = {}, 6140 location = {Cambridge, MA}, 6141 year = {2001}, 6142 month = jun, 6143 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 6144 petsc_uses = {KSP} 6145} 6146 6147@InProceedings{ gkks00, 6148 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6149 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 6150 Code}, 6151 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 6152 (HiPC '2000)}, 6153 editor = {}, 6154 location = {Bangalore, India}, 6155 year = {2000}, 6156 pages = {395--404}, 6157 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 6158 petsc_uses = {KSP} 6159} 6160 6161@InProceedings{ gkks-sc00, 6162 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6163 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 6164 booktitle = {Proceedings of SC2000}, 6165 editor = {}, 6166 publisher = {IEEE Computer Society}, 6167 year = {2000}, 6168 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 6169 petsc_uses = {KSP} 6170} 6171 6172@InProceedings{ knepleysamehsarin99, 6173 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6174 title = {Design of Large Scale Parallel Simulations}, 6175 booktitle = {Proceedings of Parallel CFD'99}, 6176 editors = {A. {Ecer et al.}}, 6177 publisher = {Elsevier}, 6178 year = {1999}, 6179 petsc_uses = {KSP} 6180} 6181 6182@InProceedings{ gkks-pcfd99, 6183 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 6184 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 6185 booktitle = {Proceedings of Parallel CFD'99}, 6186 editors = {A. {Ecer et al.}}, 6187 publisher = {Elsevier}, 6188 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 6189 year = {1999}, 6190 petsc_uses = {KSP} 6191} 6192 6193@InProceedings{ kks97, 6194 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6195 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 6196 Parallelization of an Unstructured Grid Incompressible Flow Code}, 6197 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 6198 Methods}, 6199 editor = {J. Mandel et al.}, 6200 pages = {311--319}, 6201 publisher = {Wiley}, 6202 note = {}, 6203 year = {1997}, 6204 petsc_uses = {KSP} 6205} 6206 6207@InProceedings{ kks99, 6208 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6209 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 6210 Incompressible Flows on Unstructured Grids}, 6211 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6212 Methods}, 6213 editors = {C.-H. {Lai et al.}}, 6214 publisher = {Domain Decomposition Press, Bergen}, 6215 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 6216 year = {1999}, 6217 petsc_uses = {KSP} 6218} 6219 6220@InCollection{ kks97_cfd, 6221 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 6222 title = {Perspectives for {CFD} on Petaflops Systems}, 6223 booktitle = {CFD Review 1998}, 6224 editor = {M. Hafez and K. Oshima}, 6225 publisher = {World Scientific, Singapore}, 6226 pages = {1079--1096}, 6227 note = {}, 6228 year = {1998}, 6229 petsc_uses = {KSP} 6230} 6231 6232@Article{ hm99, 6233 author = {P. D. Hovland and L. C. McInnes}, 6234 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 6235 {PETSc}}, 6236 year = {2000}, 6237 journal = {Parallel Computing}, 6238 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 6239 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 6240 petsc_uses = {KSP} 6241} 6242 6243@InProceedings{ cruzbarbaknepley08, 6244 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 6245 title = {Fast Multipole Method for particle interactions: an open source parallel library 6246 component}, 6247 booktitle = {Proceedings of ParCFD2008}, 6248 year = {2008}, 6249 editor = {Tromeur-Dervout et. al.}, 6250 publisher = {Elsevier}, 6251 petsc_uses = {KSP} 6252} 6253 6254@Article{ hwangcai05, 6255 author = {F.-N. Hwang and X.-C. Cai}, 6256 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 6257 for incompressible {Navier-Stokes} equations}, 6258 journal = {J. Comput. Phys.}, 6259 volume = {204}, 6260 year = {2005}, 6261 pages = {666--691}, 6262 petsc_uses = {KSP} 6263} 6264 6265@Article{ barbaleonard07, 6266 author = {Lorena A Barba and Anthony Leonard}, 6267 title = {Emergence and evolution of tripole vortices from net-circulation initial 6268 conditions}, 6269 journal = {Phys. Fluids}, 6270 volume = {19}, 6271 pages = {017101}, 6272 year = {2007}, 6273 doi = {10.1063/1.2409734}, 6274 petsc_uses = {KSP} 6275} 6276 6277@Article{ barba07, 6278 author = {Lorena A Barba}, 6279 title = {Non-shielded multipolar vortices at high Reynolds number}, 6280 journal = {Phys. Rev. E}, 6281 volume = {73}, 6282 pages = {065303}, 6283 year = {2006}, 6284 doi = {10.1103/PhysRevE.73.065303}, 6285 petsc_uses = {KSP} 6286} 6287 6288@Article{ schofield2010multi, 6289 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 6290 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 6291 Lowrie, R.B. and Swartz, B.K.}, 6292 journal = {International Journal for Numerical Methods in Fluids}, 6293 volume = {63}, 6294 number = {8}, 6295 pages = {931--952}, 6296 year = {2010}, 6297 publisher = {Wiley Online Library}, 6298 petsc_uses = {KSP} 6299} 6300 6301% LiteralHTML: 6302% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 6303% LiteralHTML: 6304% LiteralHTML: article{DeGersem99, 6305% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 6306% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 6307% LiteralHTML: } 6308@Article{ nagler2014, 6309 title = {Sound transmission through a poroelastic layered panel}, 6310 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 6311 journal = {Computational Mechanics}, 6312 volume = {53}, 6313 number = {4}, 6314 pages = {549--560}, 6315 issn = {1432-0924}, 6316 doi = {10.1007/s00466-013-0916-x}, 6317 year = {2014}, 6318 petsc_uses = {KSP} 6319} 6320 6321@Article{ sheikh2013, 6322 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 6323 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 6324 deflation}, 6325 journal = {Numerical Linear Algebra with Applications}, 6326 volume = {20}, 6327 number = {4}, 6328 issn = {1099-1506}, 6329 doi = {10.1002/nla.1882}, 6330 pages = {645--662}, 6331 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 6332 analysis}, 6333 year = {2013}, 6334 petsc_uses = {KSP} 6335} 6336 6337@InProceedings{ silence, 6338 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 6339 Fuenmayor}, 6340 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 6341 Application to the study of acoustic behaviour of silencers}, 6342 year = {2004}, 6343 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 6344 (ECCOMAS)}, 6345 petsc_uses = {KSP} 6346} 6347 6348@Article{ degersem99, 6349 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 6350 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 6351 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 6352 journal = {COMPEL}, 6353 year = {1999}, 6354 volume = {18}, 6355 number = {3}, 6356 pages = {298--310}, 6357 bibdate = {}, 6358 petsc_uses = {KSP} 6359} 6360 6361@InProceedings{ widlund-wave-98, 6362 author = {Olof B. Widlund}, 6363 title = {Schwarz Methods for {H}elmholtz's Equation}, 6364 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6365 editor = {John A. DeSanto}, 6366 year = {1998}, 6367 publisher = {SIAM}, 6368 pages = {620--622}, 6369 address = {Philadelphia}, 6370 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6371 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6372 petsc_uses = {KSP} 6373} 6374 6375@InProceedings{ toselli-wave-98, 6376 author = {Andrea Toselli}, 6377 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 6378 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6379 editor = {John A. DeSanto}, 6380 year = {1998}, 6381 publisher = {SIAM}, 6382 address = {Philadelphia}, 6383 pages = {540--542}, 6384 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6385 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6386 petsc_uses = {KSP} 6387} 6388 6389@InProceedings{ mcinnes-wave-98, 6390 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 6391 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 6392 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6393 editor = {John A. DeSanto}, 6394 year = {1998}, 6395 publisher = {SIAM}, 6396 address = {Philadelphia}, 6397 pages = {623--625}, 6398 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6399 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6400 petsc_uses = {KSP} 6401} 6402 6403@InProceedings{ mska98, 6404 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 6405 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 6406 Parallel Computation of {H}elmholtz Problems}, 6407 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6408 editor = {J. Mandel et al.}, 6409 publisher = {AMS}, 6410 pages = {349--357}, 6411 year = {1998}, 6412 petsc_uses = {KSP} 6413} 6414 6415@InProceedings{ ccew98, 6416 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 6417 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 6418 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6419 editor = {J. Mandel et al.}, 6420 publisher = {AMS}, 6421 pages = {437-445}, 6422 year = {1998}, 6423 petsc_uses = {KSP} 6424} 6425 6426@InProceedings{ ra98a, 6427 author = {R. Susan-Resiga and H. M. Atassi}, 6428 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 6429 Problems}, 6430 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 6431 publisher = {AIAA}, 6432 pages = {86-96}, 6433 note = {AIAA paper 98-2218}, 6434 year = {1998}, 6435 petsc_uses = {KSP} 6436} 6437 6438@InProceedings{ ar98c, 6439 author = {H. M. Atassi and R. Susan-Resiga}, 6440 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 6441 General Formulation}, 6442 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6443 publisher = {ASME}, 6444 note = {NCA-25}, 6445 pages = {375-379}, 6446 year = {1998}, 6447 petsc_uses = {KSP} 6448} 6449 6450@InProceedings{ ra98b, 6451 author = {R. Susan-Resiga and H. M. Atassi}, 6452 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 6453 Numerical Implementation and Applications}, 6454 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6455 publisher = {ASME}, 6456 note = {NCA-25}, 6457 pages = {381 -388}, 6458 year = {1998}, 6459 petsc_uses = {KSP} 6460} 6461 6462@InProceedings{ cai-dd10-98, 6463 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 6464 Widlund}, 6465 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 6466 booktitle = {Domain Decomposition Methods 10}, 6467 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 6468 series = {Contemporary Mathematics}, 6469 volume = {218}, 6470 publisher = {American Mathematical Society}, 6471 address = {Providence, Rhode Island}, 6472 year = {1998}, 6473 pages = {437--445}, 6474 petsc_uses = {KSP} 6475} 6476 6477@InProceedings{ alghamdi2011petclaw, 6478 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 6479 booktitle = {Proceedings of SpringSim 2011}, 6480 publisher = {ACM}, 6481 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 6482 Kyle T. Mandli and Lisandro Dalcin}, 6483 year = {2011}, 6484 petsc_uses = {KSP} 6485} 6486 6487@Article{ pyclaw2012, 6488 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 6489 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 6490 Emmett}, 6491 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 6492 journal = {SIAM Journal on Scientific Computing}, 6493 volume = {34}, 6494 number = {4}, 6495 pages = {C210--C231}, 6496 note = {\url{http://arxiv.org/abs/1111.6583}}, 6497 year = {2012}, 6498 petsc_uses = {KSP} 6499} 6500 6501% LiteralHTML: 6502% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 6503% LiteralHTML: 6504@Article{ sojkahorakhaplacermak2018, 6505 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 6506 decomposition method}, 6507 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 6508 journal = {Applied Mathematics and Computation}, 6509 volume = {319}, 6510 pages = {586--597}, 6511 year = {2018}, 6512 petsc_uses = {KSP} 6513} 6514 6515@Article{ chencai2014, 6516 title = {A parallel two-level domain decomposition based one-shot method for shape 6517 optimization problems}, 6518 author = {Rongliang Chen and Xiao‐Chuan Cai}, 6519 journal = {International Journal for Numerical Methods in Engineering}, 6520 volume = {99}, 6521 number = {13}, 6522 year = {2014}, 6523 doi = {10.1002/nme.4711}, 6524 petsc_uses = {KSP} 6525} 6526 6527@PhDThesis{ prudencio2005, 6528 author = {Ernesto Prudencio}, 6529 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 6530 for Optimization Problems Constrained by Partial Differential Equations}, 6531 school = {University of Colorado, Boulder}, 6532 year = {2005}, 6533 petsc_uses = {KSP} 6534} 6535 6536@Article{ prudenciocai2007, 6537 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 6538 for {PDE}-constrained optimization}, 6539 author = {Ernesto Prudencio and X. C. Cai}, 6540 journal = {SIAM J. Sci. Comp.}, 6541 volume = {29}, 6542 number = {3}, 6543 pages = {964--985}, 6544 year = {2007}, 6545 petsc_uses = {KSP} 6546} 6547 6548@Article{ prudenciobyrdcai2006, 6549 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6550 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 6551 {PDE}-constrained Optimization Problems}, 6552 journal = {SIAM J. Sci. Comp.}, 6553 volume = {27}, 6554 pages = {1305--1328}, 6555 year = {2006}, 6556 petsc_uses = {KSP} 6557} 6558 6559@InProceedings{ prudenciobyrdcai2004, 6560 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 6561 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6562 booktitle = {VECPAR 2004}, 6563 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 6564 publisher = {Springer}, 6565 pages = {569--582}, 6566 year = {2004}, 6567 petsc_uses = {KSP} 6568} 6569 6570@Article{ belhamadia-fortin-pcp, 6571 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 6572 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 6573 journal = {Journal of Computational Physics}, 6574 volume = {201}, 6575 pages = {753-770}, 6576 year = {2004}, 6577 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 6578 petsc_uses = {KSP} 6579} 6580 6581@Article{ biros00, 6582 author = {George Biros and Omar Ghattas}, 6583 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 6584 journal = {SIAG-Opt Views and News}, 6585 volume = {11}, 6586 number = {2}, 6587 year = {2000}, 6588 month = aug, 6589 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 6590 petsc_uses = {KSP} 6591} 6592 6593@Article{ bmm01, 6594 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 6595 journal = {ACM Transactions on Mathematical Software}, 6596 title = {A case study in the performance and scalability of optimization algorithms}, 6597 year = {2001}, 6598 volume = {27}, 6599 number = {3}, 6600 pages = {361--376}, 6601 petsc_uses = {KSP} 6602} 6603 6604@InProceedings{ oghattas1999, 6605 author = {George Biros and Omar Ghattas}, 6606 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 6607 incompressible flows}, 6608 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 6609 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 6610 year = {1999}, 6611 petsc_uses = {KSP} 6612} 6613 6614@InProceedings{ hkms00, 6615 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 6616 PDE-constrained Optimization}, 6617 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 6618 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 6619 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 6620 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 6621 Hasco\"{e}t and Uwe Naumann}, 6622 publisher = {Springer}, 6623 year = {2002}, 6624 petsc_uses = {KSP} 6625} 6626 6627% old version: replace with biros2005pln1 6628@TechReport{ bg011, 6629 author = {George Biros and Omar Ghattas}, 6630 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 6631 Part I: The Krylov-Schur Solver}, 6632 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6633 year = {2001}, 6634 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 6635 petsc_uses = {KSP} 6636} 6637 6638% old version: replace with biros2005pln2 6639@TechReport{ bg012, 6640 author = {George Biros and Omar Ghattas}, 6641 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 6642 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 6643 Optimal Control of Steady Viscous Flows}, 6644 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6645 year = {2001}, 6646 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 6647 petsc_uses = {KSP} 6648} 6649 6650% LiteralHTML: 6651% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 6652% LiteralHTML: 6653@InProceedings{ ly2003, 6654 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 6655 title = {A New Parallel Kernel-independent Fast Multipole Method}, 6656 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 6657 year = {2003}, 6658 note = {Winner of the Best Student Paper at SC2003}, 6659 petsc_uses = {KSP} 6660} 6661 6662@Article{ yokotabarbaknepley10, 6663 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 6664 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 6665 journal = {Computer Methods in Applied Mechanics and Engineering}, 6666 volume = {199}, 6667 number = {25-28}, 6668 pages = {1793--1804}, 6669 url = {http://arxiv.org/abs/0909.5413v1}, 6670 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 6671 year = {2010}, 6672 petsc_uses = {KSP} 6673} 6674 6675@Article{ cruzknepleybarba10, 6676 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 6677 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 6678 journal = {International Journal of Numerical Methods in Engineering}, 6679 volume = {85}, 6680 number = {4}, 6681 pages = {403--428}, 6682 url = {http://arxiv.org/abs/0905.2637}, 6683 note = {\url{http://arxiv.org/abs/0905.2637}}, 6684 year = {2010}, 6685 petsc_uses = {KSP} 6686} 6687 6688% LiteralHTML: 6689% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 6690% LiteralHTML: 6691@Article{ buchanpainumplebysmedleystevenson2012, 6692 title = {A sub-grid scale finite element agglomeration multigrid method with application 6693 to the Boltzmann transport equation}, 6694 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 6695 journal = {International Journal for Numerical Methods in Engineering}, 6696 volume = {92}, 6697 number = {3}, 6698 pages = {318--342}, 6699 year = {2012}, 6700 publisher = {Wiley Online Library}, 6701 petsc_uses = {KSP} 6702} 6703 6704@Article{ magoulesahamedsuzuki2015, 6705 title = {Green computing on graphics processing units}, 6706 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 6707 journal = {Concurrency and Computation: Practice and Experience}, 6708 year = {2015}, 6709 publisher = {Wiley Online Library}, 6710 petsc_uses = {KSP} 6711} 6712 6713@InProceedings{ yanrhodes11, 6714 author = {Yan, Baoqiang and Rhodes, Philip J.}, 6715 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 6716 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 6717 series = {ICPP '11}, 6718 pages = {355--364}, 6719 year = {2011}, 6720 isbn = {978-0-7695-4510-3}, 6721 numpages = {10}, 6722 doi = {10.1109/ICPP.2011.70}, 6723 acmid = {2066965}, 6724 publisher = {IEEE Computer Society}, 6725 address = {Washington, DC, USA}, 6726 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 6727 petsc_uses = {KSP} 6728} 6729 6730@Article{ hakansson2013mdstochasticliouville, 6731 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 6732 Stulz, Eugen}, 6733 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 6734 equation study}, 6735 journal = {Phys. Chem. Chem. Phys.}, 6736 year = {2013}, 6737 volume = {15}, 6738 issue = {26}, 6739 pages = {10930-10941}, 6740 publisher = {The Royal Society of Chemistry}, 6741 doi = {10.1039/C3CP50788B}, 6742 petsc_uses = {KSP} 6743} 6744 6745@Article{ hakansson2011stochasticliouville, 6746 author = {Hakansson, Par and Nair, Prasanth B.}, 6747 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 6748 form}, 6749 journal = {Phys. Chem. Chem. Phys.}, 6750 year = {2011}, 6751 volume = {13}, 6752 issue = {20}, 6753 pages = {9578-9589}, 6754 publisher = {The Royal Society of Chemistry}, 6755 doi = {10.1039/C1CP20400A}, 6756 petsc_uses = {KSP} 6757} 6758 6759@InProceedings{ wang:lee:scidac2011, 6760 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 6761 McInnes and Todd Munson and Barry Smith}, 6762 title = {A Differential Variational Inequality Approach for the Simulation of 6763 Heterogeneous Materials}, 6764 booktitle = {Proceedings of SciDAC 2011 Conference}, 6765 year = {2011}, 6766 petsc_uses = {KSP} 6767} 6768 6769@Article{ bourdinlarsenrichardson2011, 6770 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 6771 title = {A time-discrete model for dynamic fracture based on crack regularization}, 6772 journal = {International Journal of Fracture}, 6773 volume = {168}, 6774 issue = {2}, 6775 pages = {133--143}, 6776 doi = {10.1007/s10704-010-9562-x}, 6777 year = {2011}, 6778 petsc_uses = {KSP} 6779} 6780 6781@Article{ bourdinfrancfortmarigo2008, 6782 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 6783 title = {The Variational Approach to Fracture}, 6784 journal = {J. Elasticity}, 6785 volume = {91}, 6786 issue = {1}, 6787 pages = {1--148}, 6788 doi = {10.1007/s10659-007-9107-3}, 6789 year = {2008}, 6790 petsc_uses = {KSP} 6791} 6792 6793@Article{ lahtinen2008spectrum, 6794 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 6795 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 6796 J.K.}, 6797 journal = {Annals of Physics}, 6798 volume = {323}, 6799 number = {9}, 6800 pages = {2286--2310}, 6801 year = {2008}, 6802 publisher = {Elsevier}, 6803 petsc_uses = {KSP} 6804} 6805 6806@InProceedings{ roark2004discriminative, 6807 title = {Discriminative language modeling with conditional random fields and the 6808 perceptron algorithm}, 6809 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 6810 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 6811 Linguistics}, 6812 pages = {47}, 6813 year = {2004}, 6814 organization = {Association for Computational Linguistics}, 6815 petsc_uses = {KSP} 6816} 6817 6818@Article{ roark2007discriminative, 6819 title = {Discriminative n-gram language modeling}, 6820 author = {Roark, B. and Saraclar, M. and Collins, M.}, 6821 journal = {Computer Speech \& Language}, 6822 volume = {21}, 6823 number = {2}, 6824 pages = {373--392}, 6825 year = {2007}, 6826 publisher = {Elsevier}, 6827 petsc_uses = {KSP} 6828} 6829 6830@Conference{ garcia2011parallel, 6831 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 6832 nanodevice simulators}}, 6833 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 6834 Aldegunde, M.}, 6835 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 6836 pages = {1--4}, 6837 organization = {IEEE}, 6838 petsc_uses = {KSP} 6839} 6840 6841@Conference{ wesley2006parallel, 6842 title = {{A parallel artificial neural network implementation}}, 6843 author = {Wesley-Smith, I.}, 6844 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 6845 year = {2006}, 6846 petsc_uses = {KSP} 6847} 6848 6849@Article{ hcsw1, 6850 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 6851 title = {Parallel {N}ewton--{K}rylov--{S}chwarz algorithms for the three-dimensional 6852 {P}oisson--{B}oltzmann equation in numerical simulation of colloidal particle 6853 interactions}, 6854 journal = {Computer Physics Communications}, 6855 volumne = {181}, 6856 year = {2010}, 6857 pages = {1529--1537}, 6858 petsc_uses = {KSP} 6859} 6860 6861@Article{ hh1, 6862 author = {C.-Y. Huang and F.-N. Hwang}, 6863 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 6864 bifurcation analysis of incompressible sudden expansion flows}, 6865 journal = {Applied Numerical Mathematics}, 6866 volume = {60}, 6867 year = {2010}, 6868 pages = {738--751}, 6869 petsc_uses = {KSP} 6870} 6871 6872@Article{ hwhw1, 6873 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 6874 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 6875 polynomial eigenvalue problems in quantum dot simulation}, 6876 journal = {Journal of Computational Physics}, 6877 volume = {229}, 6878 year = {2010}, 6879 pages = {2932--2947}, 6880 petsc_uses = {KSP} 6881} 6882 6883@Article{ wei2011parallel, 6884 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 6885 Application in Quantum Dot Simulation}}, 6886 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 6887 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 6888 pages = {157--164}, 6889 year = {2011}, 6890 publisher = {Springer}, 6891 petsc_uses = {KSP} 6892} 6893 6894@Article{ flores2007sequential, 6895 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 6896 equation using second-degree iterative methods}}, 6897 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 6898 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 6899 pages = {426--438}, 6900 year = {2007}, 6901 publisher = {Springer}, 6902 petsc_uses = {KSP} 6903} 6904 6905@InProceedings{ gordonbell09, 6906 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 6907 Siegel and Won Sik Yang}, 6908 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 6909 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 6910 note = {{SC'09 Gordon Bell} Prize Finalist}, 6911 year = {2009}, 6912 petsc_uses = {KSP} 6913} 6914 6915@Article{ knepleykarpeevdavidovitseisenberggillespie10, 6916 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 6917 Eisenberg and Dirk Gillespie}, 6918 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 6919 Dimensions: Ionic Solutions}, 6920 journal = {Journal of Physical Chemistry}, 6921 volume = {132}, 6922 number = {12}, 6923 pages = {124101--124111}, 6924 url = {http://arxiv.org/abs/0910.1531}, 6925 year = {2010}, 6926 petsc_uses = {KSP} 6927} 6928 6929@Article{ knepleykarpeeveisenberggillespie09, 6930 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 6931 D.}, 6932 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 6933 Functional Theory Approach}}, 6934 journal = {Biophysical Journal}, 6935 month = feb, 6936 volume = {96}, 6937 pages = {661}, 6938 doi = {10.1016/j.bpj.2008.12.3494}, 6939 year = {2009}, 6940 petsc_uses = {KSP} 6941} 6942 6943@Article{ scx2008, 6944 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 6945 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 6946 CONCRETE}, 6947 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 6948 volume = {3}, 6949 number = {4}, 6950 year = {2006}, 6951 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 6952 petsc_uses = {KSP} 6953} 6954 6955@TechReport{ kdgs2008, 6956 year = {2008}, 6957 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 6958 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 6959 Chips}, 6960 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 6961 Stortia}, 6962 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 6963 petsc_uses = {KSP} 6964} 6965 6966@Article{ springerlink:10.1007/s10915-011-9551-x, 6967 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 6968 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 6969 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 6970 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 6971 Coupled FEM/SBFEM Approach}, 6972 journal = {Journal of Scientific Computing}, 6973 publisher = {Springer Netherlands}, 6974 issn = {0885-7474}, 6975 keyword = {Mathematics and Statistics}, 6976 pages = {1-22}, 6977 doi = {10.1007/s10915-011-9551-x}, 6978 petsc_uses = {KSP} 6979} 6980 6981@TechReport{ jj2007, 6982 author = {Boris Jeremic and Guanzhou Jie}, 6983 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 6984 Problems Report}, 6985 institution = {UCD CompGeoMech 02--2007}, 6986 year = {2007}, 6987 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 6988 petsc_uses = {KSP} 6989} 6990 6991@Unpublished{ kuiper08, 6992 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 6993 author = {Rolf Kuiper}, 6994 institution = {Max-Planck-Institute for Astronomy}, 6995 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 6996 year = {2008}, 6997 petsc_uses = {KSP} 6998} 6999 7000@Article{ williamson2012multidimensional, 7001 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 7002 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 7003 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 7004 journal = {Journal of Nuclear Materials}, 7005 volume = {423}, 7006 number = {1}, 7007 pages = {149--163}, 7008 year = {2012}, 7009 publisher = {Elsevier}, 7010 petsc_uses = {KSP} 7011} 7012 7013@InProceedings{ kucukboyaci2015cobra, 7014 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 7015 analysis}, 7016 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 7017 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 7018 Nuclear Applications and the Monte Carlo Method}, 7019 pages = {1--18}, 7020 year = {2015}, 7021 petsc_uses = {KSP} 7022} 7023 7024@Article{ hales2012solving, 7025 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 7026 {K}rylov Method}, 7027 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 7028 M.R.}, 7029 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 7030 volume = {84}, 7031 number = {2}, 7032 pages = {123--153}, 7033 year = {2012}, 7034 publisher = {Tech Science Press}, 7035 petsc_uses = {KSP} 7036} 7037 7038@InProceedings{ srksyp2008, 7039 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 7040 Palmiotti}, 7041 title = {Fast reactor core simulations using the {UNIC} code}, 7042 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 7043 Power: A Sustainable Resource}, 7044 year = {2008}, 7045 petsc_uses = {KSP} 7046} 7047 7048@InProceedings{ psrlkssl2007, 7049 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 7050 Siegel and B. Smith and E. E. Lewis}, 7051 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 7052 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7053 Supercomputing in Nuclear Applications}, 7054 year = {2007}, 7055 petsc_uses = {KSP} 7056} 7057 7058@InProceedings{ sprkssl2007, 7059 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 7060 Smith and E. E. Lewis}, 7061 title = {{PNFE} Component of the {UNIC} Code}, 7062 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7063 Supercomputing in Nuclear Applications}, 7064 year = {2007}, 7065 petsc_uses = {KSP} 7066} 7067 7068@InProceedings{ dc-oop-03, 7069 author = {H. Digonnet and T. Coupez}, 7070 title = {Object-oriented programming for fast-and-easy development of parallel 7071 applications in forming processes simulation}, 7072 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 7073 Mechanics}, 7074 year = {2003}, 7075 petsc_uses = {KSP} 7076} 7077 7078@InProceedings{ dc-cfm-03, 7079 author = {H. Digonnet and T. Coupez}, 7080 title = {Calcul parallele en mise en forme des materiaux}, 7081 booktitle = {XVIeme Congres Francais de Mecanique}, 7082 year = {2003}, 7083 petsc_uses = {KSP} 7084} 7085 7086@InProceedings{ dsc-pcsev-04, 7087 author = {H. Digonnet and L. Silva and T. Coupez}, 7088 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 7089 booktitle = {Proceedings of ECCOMAS 2004}, 7090 year = {2004}, 7091 petsc_uses = {KSP} 7092} 7093 7094@InProceedings{ dsc-pca3fs-04, 7095 author = {H. Digonnet and L. Silva and T. Coupez}, 7096 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 7097 booktitle = {Proceedings of WCCM VI}, 7098 year = {2004}, 7099 petsc_uses = {KSP} 7100} 7101 7102@InProceedings{ dbcs-cpaac-05, 7103 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 7104 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 7105 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 7106 year = {2005}, 7107 petsc_uses = {KSP} 7108} 7109 7110@Article{ sz2010, 7111 author = {B. Smith and H. Zhang}, 7112 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 7113 Performance}, 7114 journal = {International Journal of High Performance Computing Applications}, 7115 volume = {25}, 7116 number = {4}, 7117 pages = {386--391}, 7118 year = {2011}, 7119 petsc_uses = {KSP} 7120} 7121 7122@Article{ zssz2006, 7123 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 7124 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 7125 journal = {TOMS}, 7126 url = {http://math.nist.gov/toms/Current.html#v33n2}, 7127 volumne = {33}, 7128 number = {2}, 7129 year = {2007}, 7130 petsc_uses = {KSP} 7131} 7132 7133@Article{ gs2006, 7134 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 7135 title = {The detachment of a viscous drop in a viscous solution in the presence of a 7136 soluble surfactant}, 7137 journal = {Phys. Fluids}, 7138 volume = {18}, 7139 year = {2006}, 7140 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 7141 petsc_uses = {KSP} 7142} 7143 7144@Article{ jmemsci, 7145 author = {Bo Zhou and Adam Powell}, 7146 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 7147 of Polymeric Membranes in 2D and 3D}, 7148 journal = {J. Membrane Sci.}, 7149 volume = {268}, 7150 number = {2}, 7151 pages = {150--164}, 7152 year = {2006}, 7153 month = jan, 7154 day = {15}, 7155 doi = {10.1016/j.memsci.2005.05.030}, 7156 petsc_uses = {KSP} 7157} 7158 7159@InProceedings{ vbde2002, 7160 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 7161 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 7162 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 7163 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7164 year = {2002}, 7165 petsc_uses = {KSP} 7166} 7167 7168@InProceedings{ wid2005, 7169 author = {Alexander I. Bobenko and Peter Schrader}, 7170 title = {Discrete Willmore Flow}, 7171 booktitle = {Eurographics Symposium on Geometry Processing}, 7172 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 7173 year = {2005}, 7174 editor = {M. Desbrun and H. Pottmann}, 7175 petsc_uses = {KSP} 7176} 7177 7178@Article{ stj2003, 7179 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 7180 journal = {International Journal for Numerical Methods in Fluids}, 7181 volume = {41}, 7182 issue = {4}, 7183 title = {A numerical method for inverse design based on the inverse Euler equations}, 7184 year = {2003}, 7185 pages = {339--355}, 7186 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 7187 petsc_uses = {KSP} 7188} 7189 7190@PhDThesis{ as2001, 7191 author = {ANDREA SCASCIGHINI}, 7192 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 7193 Inverse Euler Equations}, 7194 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 7195 year = {2001}, 7196 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 7197 petsc_uses = {KSP} 7198} 7199 7200@Article{ hb2005, 7201 author = {E. McKay Hyde and Oscar P. Bruno}, 7202 journal = {Journal of Computational Physics}, 7203 volume = {202}, 7204 title = {A fast, higher-order solver for scattering by penetrable bodies in three 7205 dimensions}, 7206 year = {2005}, 7207 pages = {236--261}, 7208 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 7209 petsc_uses = {KSP} 7210} 7211 7212@MastersThesis{ d2002, 7213 author = {Matthew F Dixon}, 7214 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 7215 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 7216 school = {READING UNIVERSITY}, 7217 year = {2002}, 7218 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 7219 petsc_uses = {KSP} 7220} 7221 7222@TechReport{ gzb, 7223 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 7224 title = {Fast Parallel PageRank: A Linear System Approach}, 7225 institution = {Stanford University}, 7226 year = {2004}, 7227 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 7228 petsc_uses = {KSP} 7229} 7230 7231@PhDThesis{ yergeau-99, 7232 author = {Daniel W. Yergeau}, 7233 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 7234 SEMICONDUCTORS}, 7235 school = {Stanford}, 7236 year = {1999}, 7237 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 7238 petsc_uses = {KSP} 7239} 7240 7241@InProceedings{ rathkopf-miller-00, 7242 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 7243 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 7244 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 7245 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 7246 year = {2000}, 7247 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 7248 Physics and Mathematics and Computation into the Next Millennium}, 7249 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 7250 lab = {LLNL}, 7251 petsc_uses = {KSP} 7252} 7253 7254@Article{ bonfi-palma-pas-05, 7255 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 7256 journal = {Journal of Turbomachinery}, 7257 volume = {127}, 7258 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 7259 year = {2005}, 7260 pages = {395-401}, 7261 petsc_uses = {KSP} 7262} 7263 7264@InProceedings{ fettig-sobh-05, 7265 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 7266 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 7267 year = {2005}, 7268 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 7269 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 7270 petsc_uses = {KSP} 7271} 7272 7273@TechReport{ melnikov-matagne-05, 7274 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 7275 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 7276 title = {Spin configurations in circular and rectangular vertical quantum dots in a 7277 magnetic field: Three-dimensional self-consistent simulation}, 7278 year = {2005}, 7279 number = {Arxiv preprint cond-mat/0506585}, 7280 url = {http://arxiv.org/pdf/cond-mat/0506585}, 7281 petsc_uses = {KSP} 7282} 7283 7284@InProceedings{ richard-smedley-03, 7285 author = {Richard P. Smedley-Stevenson}, 7286 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 7287 year = {2003}, 7288 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 7289 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 7290 petsc_uses = {KSP} 7291} 7292 7293@Article{ guan-godoy-ravaioli-03, 7294 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 7295 journal = {Journal of Computational Electronics}, 7296 volume = {2}, 7297 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 7298 for Transport in a Silicon Quantum Wire Structure}, 7299 year = {2003}, 7300 pages = {335--339}, 7301 petsc_uses = {KSP} 7302} 7303 7304@Article{ ovtchinnikovcai04, 7305 author = {S. Ovtchinnikov and X.-C. Cai}, 7306 journal = {Numer. Lin. Alg. Applics}, 7307 volume = {11}, 7308 title = {One-level {N}ewton--{K}rylov--{S}chwarz algorithm for unsteady nonlinear radiation 7309 diffusion problem}, 7310 year = {2004}, 7311 pages = {867--881}, 7312 petsc_uses = {KSP} 7313} 7314 7315@Article{ mixedstress, 7316 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 7317 author = {Adam Powell and David Dussault}, 7318 journal = {Appl. Numer. Anal. Comp. Math.}, 7319 volume = {2}, 7320 number = {1}, 7321 year = {2005}, 7322 pages = {157--166}, 7323 petsc_uses = {KSP} 7324} 7325 7326@Article{ dhh2005, 7327 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 7328 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 7329 journal = {International Journal for Computation and Mathematics in Electrical and 7330 Electronic Engineering (COMPEL)}, 7331 year = {2005}, 7332 petsc_uses = {KSP} 7333} 7334 7335@Article{ dhh2004, 7336 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 7337 title = {Finite element modelling of ion convection by electrostatic forces}, 7338 journal = {IEE Proceedings Science, Measurement and Technology}, 7339 year = {2004}, 7340 volume = {151}, 7341 number = {6}, 7342 petsc_uses = {KSP} 7343} 7344 7345@Article{ adams-07b, 7346 author = {Adams M.F.}, 7347 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 7348 Frequency Response Analysis in Solid Mechanics}, 7349 journal = {Computional Mechanics}, 7350 year = {2007}, 7351 volume = {39}, 7352 number = {4}, 7353 pages = {497-507}, 7354 petsc_uses = {KSP} 7355} 7356 7357@InProceedings{ wc2004, 7358 author = {A. Wheelock and D. Cooke}, 7359 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 7360 Dimensions}, 7361 year = {2004}, 7362 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 7363 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 7364 petsc_uses = {KSP} 7365} 7366 7367@InProceedings{ allard-gouranton-ipts2002, 7368 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 7369 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 7370 year = {2002}, 7371 booktitle = {Immersive Projection Technology Symposium}, 7372 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 7373 petsc_uses = {KSP} 7374} 7375 7376@Article{ icc, 7377 author = {D Ioan and G Ciuprina and C Ciobotaru}, 7378 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 7379 journal = {IEEE Transactions on Magnetics}, 7380 year = {2000}, 7381 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 7382 petsc_uses = {KSP} 7383} 7384 7385@InProceedings{ hs1, 7386 author = {Brian J. Henz and Dale R. Shires}, 7387 title = {Development and Performance Analysis of a Parallel Finite Element Application 7388 Implemented in an Object-Oriented Programming Framework}, 7389 year = {2003}, 7390 booktitle = {PDPTA 2003}, 7391 pages = {1286-1292}, 7392 note = {Resin Transfer Modeling}, 7393 petsc_uses = {KSP} 7394} 7395 7396@TechReport{ b2000, 7397 author = {Rickard Bergstrom}, 7398 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 7399 year = {2000}, 7400 institution = {Chalmers}, 7401 number = {2000-05}, 7402 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 7403 petsc_uses = {KSP} 7404} 7405 7406@Article{ fs2004, 7407 author = {Petri Fast and Michael J. Shelley}, 7408 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 7409 Shaw Flow}, 7410 journal = {Journal of Computational Physics}, 7411 year = {2004}, 7412 volume = {195}, 7413 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 7414 pages = {117-142}, 7415 petsc_uses = {KSP} 7416} 7417 7418@MastersThesis{ wallach, 7419 author = {Hanna Wallach}, 7420 title = {Efficient Training of Conditional Random Fields}, 7421 school = {University of Edinburgh}, 7422 year = {2002}, 7423 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 7424 }osborne/msc-projects/wallach.ps.gz}, 7425 petsc_uses = {KSP} 7426} 7427 7428@Article{ something, 7429 author = {T Rylander and A Bondeson}, 7430 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 7431 equations}, 7432 journal = {Journal of Computational Physics}, 7433 year = {2002}, 7434 volume = {179}, 7435 pages = {426-438}, 7436 petsc_uses = {KSP} 7437} 7438 7439@TechReport{ uf1, 7440 author = {Uwe Fabricius}, 7441 title = {Comparison of two implementations of {AMG}-preconditioned {CG} considering an 7442 electrostatic problem}, 7443 year = {2004}, 7444 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 7445 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 7446 number = {04-1}, 7447 petsc_uses = {KSP} 7448} 7449 7450@InBook{ sg1, 7451 author = {Natalia Seoane and A.J.Garca-Loureiro}, 7452 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 7453 Equation}, 7454 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 7455 title = {Lecture Notes in Computer Science}, 7456 publisher = {Springer-Verlag}, 7457 volume = {3037}, 7458 year = {2004}, 7459 petsc_uses = {KSP} 7460} 7461 7462@Article{ nikyilmazgivisheikhipope10, 7463 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 7464 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 7465 journal = {AIAA Journal}, 7466 volume = {48}, 7467 number = {7}, 7468 pages = {1513--1522}, 7469 year = {2010}, 7470 petsc_uses = {KSP} 7471} 7472 7473@Article{ nikyilmazsheikhigivi10, 7474 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 7475 title = {Grid Resolution Effects on VSFMDF/LES}, 7476 journal = {Flow, Turbulence and Combustion}, 7477 doi = {10.1007/s10494-010-9272-5}, 7478 year = {2010}, 7479 petsc_uses = {KSP} 7480} 7481 7482@Article{ idema2013towards, 7483 title = {Towards faster solution of large power flow problems}, 7484 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 7485 and van der Sluis, Lou}, 7486 journal = {Power Systems, IEEE Transactions on}, 7487 volume = {28}, 7488 number = {4}, 7489 pages = {4918--4925}, 7490 year = {2013}, 7491 publisher = {IEEE}, 7492 petsc_uses = {KSP} 7493} 7494 7495@Article{ 6026245, 7496 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 7497 journal = {Power Systems, IEEE Transactions on}, 7498 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 7499 year = {2012}, 7500 month = feb, 7501 volume = {27}, 7502 number = {1}, 7503 pages = {390-396}, 7504 doi = {10.1109/TPWRS.2011.2165860}, 7505 issn = {0885-8950}, 7506 petsc_uses = {KSP} 7507} 7508 7509@Book{ idema2014computational, 7510 title = {Computational Methods in Power System Analysis}, 7511 author = {Idema, Reijer and Lahaye, Domenico JP}, 7512 year = {2014}, 7513 publisher = {Springer}, 7514 petsc_uses = {KSP} 7515} 7516 7517@PhDThesis{ abhyankar2011thesis, 7518 author = {Shrirang Abhyankar}, 7519 title = {Development of an implicitly coupled electromechanical and electromagnetic 7520 transients simulator for power systems}, 7521 school = {Illinois Institute of Technology}, 7522 year = {2011}, 7523 petsc_uses = {KSP} 7524} 7525 7526@InProceedings{ abhyankarhipcna11-1, 7527 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 7528 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 7529 year = {2011}, 7530 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7531 Networking and Analytics for the Power Grid}, 7532 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 7533 publisher = {ACM}, 7534 petsc_uses = {KSP} 7535} 7536 7537@InProceedings{ abhyankarhipcna11-2, 7538 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 7539 title = {Development of a parallel three-phase transient stability simulator for power 7540 systems}, 7541 year = {2011}, 7542 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7543 Networking and Analytics for the Power Grid}, 7544 publisher = {ACM}, 7545 petsc_uses = {KSP} 7546} 7547 7548@InProceedings{ abhyankarpesgeneral2012, 7549 author = {Shrirang Abhyankar and A. Flueck}, 7550 title = {An implicitly-coupled solution approach for combined electromechanical and 7551 electromagnetic transients simulation}, 7552 year = {2012}, 7553 booktitle = {Proceedings of the IEEE PES General Meeting}, 7554 publisher = {IEEE}, 7555 petsc_uses = {KSP} 7556} 7557 7558@Article{ idemalahayevuiksluis2012, 7559 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 7560 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 7561 journal = {IEEE Transactions on Power Systems}, 7562 year = {2012}, 7563 volume = {27}, 7564 pages = {390-396}, 7565 petsc_uses = {KSP} 7566} 7567 7568@Article{ korrestzavellasgalinas2013, 7569 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 7570 title = {A distributed implementation of multi-area power system state estimation on a 7571 cluster of computers }, 7572 journal = {Electric Power Systems Research }, 7573 volume = {102}, 7574 number = {0}, 7575 pages = {20 - 32}, 7576 year = {2013}, 7577 issn = {0378-7796}, 7578 doi = {10.1016/j.epsr.2013.04.002}, 7579 petsc_uses = {KSP} 7580} 7581 7582% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7583% LiteralHTML:<font color="#FF0000"> 7584% LiteralHTML: Material failure, for example, cracking of steel beams resulting 7585% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 7586% LiteralHTML: are important for prediction and prevention. PETSc has been used 7587% LiteralHTML: in a variety of studies of material failure.</p> 7588% LiteralHTML:</font> 7589% LiteralHTML: 7590@InProceedings{ gray2, 7591 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 7592 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 7593 year = {2004}, 7594 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 7595 petsc_uses = {KSP} 7596} 7597 7598@InProceedings{ gray1, 7599 author = {J. Gray and C. Homescu and L. Petzold and Richard Alkire}, 7600 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 7601 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 7602 year = {2003}, 7603 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 7604 petsc_uses = {KSP} 7605} 7606 7607@InProceedings{ crack2, 7608 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 7609 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 7610 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 7611 Conference}, 7612 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 7613 year = {2003}, 7614 petsc_uses = {KSP} 7615} 7616 7617@TechReport{ hdams1, 7618 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 7619 Lynd Stringer}, 7620 title = {Fracture Mechanics on the Intel Itanium Architecture}, 7621 year = {2001}, 7622 institution = {Intel Corporation}, 7623 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 7624 petsc_uses = {KSP} 7625} 7626 7627@InProceedings{ ihwi, 7628 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 7629 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 7630 booktitle = {International Conference ON Computational Engineering and Sciences}, 7631 year = {2002}, 7632 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 7633 petsc_uses = {KSP} 7634} 7635 7636@InProceedings{ crack, 7637 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 7638 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 7639 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 7640 and Paul A. Wawrzynek}, 7641 title = {Parallel FEM Simulation of Crack Propagation}, 7642 booktitle = {Proceedings of Irregular 2000}, 7643 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 7644 year = {2000}, 7645 petsc_uses = {KSP} 7646} 7647 7648@InProceedings{ beaudoin98, 7649 author = {A. J. Beaudoin}, 7650 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 7651 booktitle = {Simulation of materials processing: Theory, methods, and applications - 7652 Proceedings of the Sixth International Conference, NUMIFORM'98}, 7653 editor = {J. Hu\'etink and F. P. T. Baaijens}, 7654 optvolume = {}, 7655 optnumber = {}, 7656 optseries = {}, 7657 year = {1998}, 7658 optorganization={}, 7659 publisher = {A. A. Balkema Publishers}, 7660 address = {Rotterdam, Netherlands}, 7661 month = jun, 7662 optpages = {}, 7663 petsc_uses = {KSP} 7664} 7665 7666% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7667@TechReport{ defordheld1, 7668 author = {JF DeFord and BL Held}, 7669 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 7670 year = {2002}, 7671 institution = {Simulation Technology and Applied Research}, 7672 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 7673 note = {Discusses their parallel commercial solver that uses PETSc}, 7674 petsc_uses = {KSP} 7675} 7676 7677@PhDThesis{ sande2003, 7678 author = {Hans Vande Sande}, 7679 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 7680 Quasi-Static Electromagnetic Systems}, 7681 school = {Katholieke Universiteit Leuven, Belgium}, 7682 year = {2003}, 7683 petsc_uses = {KSP} 7684} 7685 7686@Article{ sdchh2004, 7687 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 7688 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 7689 Tolerance}, 7690 journal = {IEEE Transactions on Magnetics}, 7691 year = {2004}, 7692 volume = {40}, 7693 pages = {1306--1309}, 7694 petsc_uses = {KSP} 7695} 7696 7697@Article{ holst-lindblom-etal:2004, 7698 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 7699 Scheel and Lawrence E. Kidder}, 7700 title = {Optimal constraint projection for hyperbolic evolution systems, }, 7701 journal = {Phys. Rev. D}, 7702 year = {2004}, 7703 volume = {70}, 7704 pages = {084017}, 7705 petsc_uses = {KSP} 7706} 7707 7708@Article{ marm2005, 7709 author = {Matthew Anderson and Richard A. Matzner}, 7710 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 7711 journal = {Foundations of Physics}, 7712 volume = {35}, 7713 pages = {1572--9516}, 7714 year = {2005}, 7715 petsc_uses = {KSP} 7716} 7717 7718@Article{ cook-pfeiffer:2004, 7719 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 7720 title = {Excision boundary conditions for black hole initial data}, 7721 journal = {Phys. Rev. D}, 7722 volume = {70}, 7723 pages = {104016--24}, 7724 year = {2004}, 7725 petsc_uses = {KSP} 7726} 7727 7728@Article{ pfeiffer-kidder-etal:2005, 7729 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 7730 Shoemaker}, 7731 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 7732 journal = {Phys. Rev. D}, 7733 year = {2005}, 7734 volume = {71}, 7735 pages = {024020}, 7736 petsc_uses = {KSP} 7737} 7738 7739@Article{ pfeiffer-kidder-etal:2003, 7740 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 7741 Saul A.}, 7742 title = {A multidomain spectral method for solving elliptic equations}, 7743 journal = {CPC}, 7744 year = {2003}, 7745 volume = {152}, 7746 pages = {253--273}, 7747 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 7748 For a related online version, see arXiv:gr-qc/0202096}, 7749 petsc_uses = {KSP} 7750} 7751 7752@Article{ pfeiffer-cook-teukolsky:2002, 7753 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 7754 title = {Comparing initial-data sets for binary black hole}, 7755 journal = {PRD}, 7756 year = {2002}, 7757 volume = {66}, 7758 pages = {024047}, 7759 note = {for a related online version, seearXiv:gr-qc/0203085}, 7760 petsc_uses = {KSP} 7761} 7762 7763@PhDThesis{ pfeiffer:2003, 7764 author = {Pfeiffer, Harald P.}, 7765 title = {Initial Data for Black Hole Evolutions}, 7766 school = {Cornell University}, 7767 year = {2003}, 7768 petsc_uses = {KSP} 7769} 7770 7771@TechReport{ h1, 7772 author = {Erik Schnetter}, 7773 title = {A fast apparent horizon algorithm}, 7774 year = {2002}, 7775 number = {Arxiv preprint gr-qc/0206003}, 7776 url = {http://arxiv.org/pdf/gr-qc/0206003}, 7777 petsc_uses = {KSP} 7778} 7779 7780@Article{ h2, 7781 author = {Erik Schnetter}, 7782 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 7783 year = {2003}, 7784 journal = {Class. Quantum Grav.}, 7785 pages = {4719-4737}, 7786 volume = {20}, 7787 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 7788 petsc_uses = {KSP} 7789} 7790 7791@Article{ adams-03a, 7792 author = {Adams, M.~F.}, 7793 journal = {Numerical Linear Algebra with Applications}, 7794 number = {2-3}, 7795 pages = {141-153}, 7796 title = {Algebraic multigrid methods for constrained linear systems with applications to 7797 contact problems in solid mechanics}, 7798 volume = {11}, 7799 year = {2004}, 7800 petsc_uses = {KSP} 7801} 7802 7803@Article{ vandesande1, 7804 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 7805 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 7806 year = {2003}, 7807 volume = {39}, 7808 pages = {1709--1712}, 7809 title = {Solving Nonlinear Magnetic Problems Using {N}ewton Trust Region Methods}, 7810 petsc_uses = {KSP} 7811} 7812 7813@InProceedings{ vbde1, 7814 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 7815 year = {2002}, 7816 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 7817 Uintah PSE}, 7818 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 7819 2002}, 7820 pages = {49-55}, 7821 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7822 note = {Extended abstract}, 7823 petsc_uses = {KSP} 7824} 7825 7826@Unpublished{ ep1, 7827 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 7828 author = {Bradley R. Eccleston and Todd S. Palmer}, 7829 institution = {Department of Nuclear Engineering, Oregon State University}, 7830 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 7831 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 7832 Parallel Simulations}, 7833 year = {1999}, 7834 petsc_uses = {KSP} 7835} 7836 7837@InProceedings{ teo2007scalable, 7838 title = {A scalable modular convex solver for regularized risk minimization}, 7839 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 7840 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 7841 discovery and data mining}, 7842 pages = {727--736}, 7843 year = {2007}, 7844 organization = {ACM}, 7845 petsc_uses = {KSP} 7846} 7847 7848@InProceedings{ rm02, 7849 author = {Robert Malouf}, 7850 year = {2002}, 7851 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 7852 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 7853 (CoNLL-2002)}, 7854 pages = {49-55}, 7855 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 7856 petsc_uses = {KSP} 7857} 7858 7859@Unpublished{ hrv02, 7860 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 7861 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7862 note = {Submitted to CMMSE}, 7863 petsc_uses = {KSP} 7864} 7865 7866@Article{ tmh2001, 7867 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 7868 journal = {Journal of Economic Dynamics and Control}, 7869 year = {2002}, 7870 volume = {26}, 7871 pages = {1499-1515}, 7872 title = {Solving finite difference schemes arising in trivariate option pricing}, 7873 petsc_uses = {KSP} 7874} 7875 7876@InProceedings{ a2, 7877 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 7878 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 7879 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 7880 Methods}, 7881 editor = {C.-H. Lai et al.}, 7882 publisher = {Domain Decomposition Press, Bergen}, 7883 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 7884 year = {1999}, 7885 petsc_uses = {KSP} 7886} 7887 7888@Unpublished{ mmmdcmaa-web-page, 7889 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 7890 {A}coustics {W}eb Page}, 7891 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 7892 author = {David E. Keyes}, 7893 institution = {Old Dominion University}, 7894 petsc_uses = {KSP} 7895} 7896 7897@Conference{ liu2010parallelization, 7898 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 7899 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 7900 booktitle = {International Symposium on Parallel and Distributed Processing with 7901 Applications}, 7902 pages = {528--535}, 7903 year = {2010}, 7904 organization = {IEEE}, 7905 petsc_uses = {KSP} 7906} 7907 7908@Unpublished{ oil-reservoir-sim-web-page, 7909 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 7910 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 7911 institution = {University of Texas at Austin and Argonne National Laboratory}, 7912 key = {University of Texas at Austin and Argonne National Laboratory}, 7913 petsc_uses = {KSP} 7914} 7915 7916@Article{ tmh2001b, 7917 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 7918 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 7919 year = {2001}, 7920 volume = {37}, 7921 pages = {143--146}, 7922 title = {Adapting EMAP3D to parallel processing}, 7923 petsc_uses = {KSP} 7924} 7925 7926@Article{ harbury98, 7927 author = {HK Harbury and W Porod}, 7928 journal = {VLSI Design}, 7929 year = {1998}, 7930 volume = {6}, 7931 pages = {47--51}, 7932 title = {Parallel computation for electronic waves in quantum corrals}, 7933 petsc_uses = {KSP} 7934} 7935 7936@Article{ bludszuwei98, 7937 author = {Mark Bludszuweit}, 7938 journal = {Journal of Lightwave Technology}, 7939 year = {1998}, 7940 volume = {16}, 7941 number = {7}, 7942 pages = {1336--42}, 7943 title = {Mixed Finite Element Beam Propagation Method}, 7944 petsc_uses = {KSP} 7945} 7946 7947@Article{ s1, 7948 author = {J. L. Friedman and N. Stergioulas}, 7949 journal = {Astrophysics Journal}, 7950 year = {1998}, 7951 volume = {492}, 7952 number = {301}, 7953 pages = {}, 7954 title = {}, 7955 petsc_uses = {KSP} 7956} 7957 7958@Article{ s1a, 7959 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 7960 journal = {Astrophysics Journal}, 7961 year = {1999}, 7962 volume = {510}, 7963 number = {854}, 7964 pages = {}, 7965 title = {}, 7966 petsc_uses = {KSP} 7967} 7968 7969@PhDThesis{ s2, 7970 author = {N. Stergioulas}, 7971 title = {Ph. D. thesis}, 7972 year = {1996}, 7973 institution = {University of Wisconsin-Milwaukee}, 7974 petsc_uses = {KSP} 7975} 7976 7977@InProceedings{ coral1, 7978 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7979 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 7980 Parallel Computing Environment}, 7981 booktitle = {Proceedings of the Miami TEAM Workshop}, 7982 location = {Florida International University, Department of Electrical Engineering and 7983 Computing Science}, 7984 month = nov, 7985 year = {1993}, 7986 petsc_uses = {KSP} 7987} 7988 7989@InProceedings{ coral2, 7990 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7991 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 7992 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 7993 month = dec, 7994 year = {1994}, 7995 petsc_uses = {KSP} 7996} 7997 7998@InProceedings{ coral3, 7999 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 8000 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 8001 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 8002 location = {Florida International University, Department of Electrical Engineering and 8003 Computing Science}, 8004 year = {1995}, 8005 petsc_uses = {KSP} 8006} 8007 8008@InProceedings{ mijalkovic, 8009 author = {Slobodan Mijalkovi\'{c}}, 8010 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 8011 Process Simulation}, 8012 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 8013 Gent, Belgium, September 27--30, 1999.}, 8014 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 8015 optvolume = {14}, 8016 optseries = {Lecture Notes in Computational Science and Engineering}, 8017 year = {2000}, 8018 publisher = {Springer}, 8019 address = {Berlin}, 8020 optpages = {179--184}, 8021 petsc_uses = {KSP} 8022} 8023 8024@Article{ bludszuwei98a, 8025 author = {Mark Bludszuweit}, 8026 journal = {Journal of Lightwave Technology}, 8027 year = {1998}, 8028 volume = {16}, 8029 number = {7}, 8030 pages = {1336--42}, 8031 title = {Mixed Finite Element Beam Propagation Method}, 8032 petsc_uses = {KSP} 8033} 8034 8035@Article{ gilli-pauletto-1998, 8036 author = {Manfred Gilli and Giorgio Pauletto}, 8037 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 8038 journal = {Computational Economics}, 8039 year = {2000}, 8040 volume = {16}, 8041 pages = {173--186}, 8042 petsc_uses = {KSP} 8043} 8044 8045% LiteralHTML: 8046% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 8047% LiteralHTML: 8048@Article{ collierdalcincalo2013, 8049 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 8050 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 8051 journal = {arxiv}, 8052 year = {2013}, 8053 number = {1305.4452}, 8054 note = {\url{http://arxiv.org/abs/1305.4452}}, 8055 petsc_uses = {KSP} 8056} 8057 8058@Article{ collierdalcinvignalcortescalo2016, 8059 title = {PetIGA: A framework for high-performance isogeometric analysis}, 8060 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 8061 Victor M. Calo}, 8062 journal = {Computer Methods in Applied Mechanics and Engineering}, 8063 year = {2016}, 8064 petsc_uses = {KSP} 8065} 8066 8067@Misc{ petiga-web-page, 8068 author = {N. Collier and L. Dalcin and V.M. Calo}, 8069 title = {{PetIGA} {W}eb page}, 8070 url = {https://bitbucket.org/dalcinl/petiga/}, 8071 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 8072 year = {2014}, 8073 petsc_uses = {KSP} 8074} 8075 8076@Article{ logg07, 8077 author = {Logg, Anders}, 8078 title = {Automating the Finite Element Method}, 8079 journal = {Archives of Computational Methods in Engineering}, 8080 volume = {14}, 8081 number = {2}, 8082 pages = {93-138}, 8083 year = {2007}, 8084 doi = {10.1007/s11831-007-9003-9}, 8085 publisher = {Kluwer Academic Publishers}, 8086 issn = {1134-3060}, 8087 language = {English}, 8088 petsc_uses = {KSP} 8089} 8090 8091@Article{ jezequelcouturierdenis12, 8092 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 8093 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 8094 versus the PETSc library}, 8095 journal = {The Journal of Supercomputing}, 8096 volume = {59}, 8097 number = {3}, 8098 pages = {1517-1532}, 8099 year = {2012}, 8100 issn = {0920-8542}, 8101 doi = {10.1007/s11227-011-0563-y}, 8102 publisher = {Springer US}, 8103 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 8104 Sparse linear solver}, 8105 language = {English}, 8106 petsc_uses = {KSP} 8107} 8108 8109@Unpublished{ feap-web-page, 8110 title = {FEAP: A Finite Element Analysis Program}, 8111 url = {http://www.ce.berkeley.edu/projects/feap/}, 8112 author = {FEAP Team}, 8113 note = {Uses PETSc linear solvers - iterative and direct}, 8114 petsc_uses = {KSP} 8115} 8116 8117@Unpublished{ parpre-web-page, 8118 title = {{ParPre} {W}eb {P}age}, 8119 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 8120 institution = {University of Tennessee}, 8121 author = {Victor Eijkhout}, 8122 note = {This is no longer supported. A set of preconditioners built on PETSc}, 8123 petsc_uses = {KSP} 8124} 8125 8126@Unpublished{ pism, 8127 title = {{PISM}: a Parallel Ice Sheet Model}, 8128 author = {{PISM Team}}, 8129 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 8130 Sheet Model). The thickness, temperature, velocity and age of the ice are all 8131 simulated, as is the deformation of the earth underneath the ice. New techniques 8132 for fast ice dynamics, earth deformation, and verification have are included.}, 8133 note = {\url{http://www.pism-docs.org/}}, 8134 petsc_uses = {KSP} 8135} 8136 8137@Unpublished{ oofem, 8138 title = {OOFEM - an object oriented finite element package}, 8139 author = {Borek Patzak}, 8140 url = {http://www.oofem.org}, 8141 petsc_uses = {KSP} 8142} 8143 8144@Unpublished{ dks2openfvm, 8145 title = {OpenFVM - a finite volume based general purpose CFD solver}, 8146 author = {Open source development}, 8147 url = {http://openfvm.sourceforge.net/}, 8148 petsc_uses = {KSP} 8149} 8150 8151@Unpublished{ sundar-2008w, 8152 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 8153 octree meshes}, 8154 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 8155 institution = {University of Pennsylvania}, 8156 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 8157 petsc_uses = {KSP} 8158} 8159 8160@Unpublished{ khatiwala07-software, 8161 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 8162 author = {Khatiwala, S.}, 8163 institution = {Columbia University}, 8164 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 8165 petsc_uses = {KSP} 8166} 8167 8168@InBook{ jiaolima99, 8169 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 8170 chapter = {{SIFFEA}:Scalable Integrated Framework for Finite Element Analysis}, 8171 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 8172 title = {Lecture Notes in Computer Science}, 8173 publisher = {Springer-Verlag}, 8174 volume = {1732}, 8175 year = {1999}, 8176 petsc_uses = {KSP} 8177} 8178 8179@Article{ crow1, 8180 author = {C. S. Crow IV}, 8181 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 8182 journal = {Hopkins Undergraduate Research Journal}, 8183 year = {2003}, 8184 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 8185 petsc_uses = {KSP} 8186} 8187 8188@Unpublished{ petsc-python, 8189 title = {PETSc for Python}, 8190 author = {L. Dalcin}, 8191 url = {https://petsc.org/main/petsc4py}, 8192 note = {Provides Python bindings for PETSc}, 8193} 8194 8195@Unpublished{ cfdship, 8196 title = {{CFDShip-Iowa}}, 8197 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 8198 institution = {University of Iowa}, 8199 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 8200 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 8201 structured grids, designed for ship applications}, 8202 petsc_uses = {KSP} 8203} 8204 8205@Unpublished{ bvw, 8206 title = {Multiflow}, 8207 author = {Berend van Wachem}, 8208 institution = {Mechanical Engineering - Chalmers University of Technology}, 8209 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 8210 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 8211 flows.}, 8212 petsc_uses = {KSP} 8213} 8214 8215@Unpublished{ dks2, 8216 title = {FENA - A Finite Element Model for the North Atlantic}, 8217 author = {Jens Schroeter}, 8218 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 8219 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 8220 petsc_uses = {KSP} 8221} 8222 8223@TechReport{ piwonski2010idea, 8224 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 8225 and Simulation in {3-D}}, 8226 author = {Piwonski, J. and Slawig, T.}, 8227 year = {2010}, 8228 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8229 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 8230 petsc_uses = {KSP} 8231} 8232 8233@Unpublished{ metos3d-web, 8234 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 8235 author = {Piwonski, J. and Slawig, T.}, 8236 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8237 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 8238 petsc_uses = {KSP} 8239} 8240 8241@Unpublished{ magpar, 8242 author = {W. Scholz}, 8243 title = {Magpar: Parallel Micromagnetics Code}, 8244 institution = {Vienna University of Technology}, 8245 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 8246 petsc_uses = {KSP} 8247} 8248 8249@Misc{ libmesh:sourceforge, 8250 author = {}, 8251 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 8252 equations on serial and parallel platforms}, 8253 note = {[Online]}, 8254 url = {http://libmesh.github.io}, 8255 petsc_uses = {KSP} 8256} 8257 8258@Misc{ moose-web-page, 8259 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 8260 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 8261 Gaston and John Peterson and Jason Miller}, 8262 institution = {Idaho National Laboratory}, 8263 howpublished = {\url{http://mooseframework.org}}, 8264 petsc_uses = {KSP} 8265} 8266 8267@Article{ gaston2009moose, 8268 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 8269 equations}, 8270 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 8271 journal = {Nuclear Engineering and Design}, 8272 volume = {239}, 8273 number = {10}, 8274 pages = {1768--1778}, 8275 year = {2009}, 8276 publisher = {Elsevier}, 8277 petsc_uses = {KSP} 8278} 8279 8280@Article{ tonks2012object, 8281 title = {An object-oriented finite element framework for multiphysics phase field 8282 simulations}, 8283 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 8284 journal = {Computational Materials Science}, 8285 volume = {51}, 8286 number = {1}, 8287 pages = {20--29}, 8288 year = {2012}, 8289 publisher = {Elsevier}, 8290 petsc_uses = {KSP} 8291} 8292 8293@Misc{ pylithmanual, 8294 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 8295 Strand and Charles Williams}, 8296 title = {{PyLith} User Manual Version 2.0.0}, 8297 year = {2014}, 8298 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 8299 petsc_uses = {KSP} 8300} 8301 8302@Misc{ pylith-web-page, 8303 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 8304 title = {{PyLith}}, 8305 year = {2012}, 8306 url = {http://geodynamics.org/resources/pylith/}, 8307 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 8308 petsc_uses = {KSP} 8309} 8310 8311@Misc{ galemanual, 8312 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 8313 title = {Gale User Manual Version 2.0.0}, 8314 year = {2011}, 8315 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 8316 petsc_uses = {KSP} 8317} 8318 8319@Unpublished{ underworld, 8320 author = {Louis Moresi}, 8321 title = {{UnderWorld}: A Geodynamics Modelling Code}, 8322 institution = {Monash University}, 8323 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 8324 petsc_uses = {KSP} 8325} 8326 8327@Article{ moresi2007computational, 8328 title = {Computational approaches to studying non-linear dynamics of the crust and 8329 mantle}, 8330 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 8331 M{\"u}hlhaus, H.B.}, 8332 journal = {Physics of the Earth and Planetary Interiors}, 8333 volume = {163}, 8334 number = {1-4}, 8335 pages = {69--82}, 8336 year = {2007}, 8337 publisher = {Elsevier}, 8338 petsc_uses = {KSP} 8339} 8340 8341@Article{ pitt2009chaste, 8342 title = {Chaste: a test-driven approach to software development for biological modelling}, 8343 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 8344 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 8345 and Walter, A. and others}, 8346 journal = {Computer Physics Communications}, 8347 volume = {180}, 8348 number = {12}, 8349 pages = {2452--2471}, 8350 year = {2009}, 8351 publisher = {Elsevier}, 8352 petsc_uses = {KSP} 8353} 8354 8355@Misc{ fenicsproject, 8356 title = {{The FEniCS project}}, 8357 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 8358 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 8359 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 8360 url = {http://fenicsproject.org}, 8361 year = {2011}, 8362 petsc_uses = {KSP} 8363} 8364 8365@Unpublished{ snark, 8366 title = {Snark: A suite of software for geoscientific applications and a philosophy of 8367 scientific software development}, 8368 institution = {Victorian Partnership for Advanced Computing}, 8369 url = {http://vpac.org/Snark}, 8370 petsc_uses = {KSP} 8371} 8372 8373@Misc{ imoose:sourceforge, 8374 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 8375 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 8376 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 8377 note = {[Online]}, 8378 url = {http://imoose.sourceforge.net}, 8379 petsc_uses = {KSP} 8380} 8381 8382@Unpublished{ fossi, 8383 author = {Stephan Frickenhaus}, 8384 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 8385 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 8386 codes}, 8387 institution = {AWI-Bremerhaven, Germanny}, 8388 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 8389 petsc_uses = {KSP} 8390} 8391 8392@Unpublished{ fun3dweb, 8393 author = {Dinesh Kaushik}, 8394 title = {PETSC-FUN3D Benchmark Page}, 8395 institution = {ODU/ANL}, 8396 url = {http://www.mcs.anl.gov/petsc-fun3d}, 8397 note = {CFD Benchmark of some solvers in PETSc}, 8398 petsc_uses = {KSP} 8399} 8400 8401@Unpublished{ scirun, 8402 author = {SCIRun Development Team}, 8403 title = {SCIRun}, 8404 institution = {University of Utah}, 8405 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 8406 note = {SCIRun now uses PETSc linear solvers}, 8407 petsc_uses = {KSP} 8408} 8409 8410@Misc{ prometheus, 8411 author = {Mark F. Adams}, 8412 title = {Prometheus - A scalable unstructured finite element solver}, 8413 institution = {Berkeley}, 8414 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 8415 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 8416 petsc_uses = {KSP} 8417} 8418 8419@Unpublished{ illuminator, 8420 author = {Adam C. Powell, IV}, 8421 title = {Illuminator Distributed Visualization Library}, 8422 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 8423 petsc_uses = {KSP} 8424} 8425 8426@Unpublished{ rheoplast, 8427 title = {RheoPlast Phase Field Multi-Physics Code}, 8428 author = {Adam Powell and David Dussault and Bo Zhou}, 8429 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 8430 petsc_uses = {KSP} 8431} 8432 8433@Misc{ tao-web-page, 8434 title = {{Toolkit for Advanced Optimization ({TAO})} {W}eb Page}, 8435 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8436 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 8437 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8438 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 8439 petsc_uses = {KSP} 8440} 8441 8442@TechReport{ tao-user-ref, 8443 title = {{Toolkit for Advanced Optimization ({TAO}) users manual}}, 8444 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8445 and Steve Benson and Lois Curfman McInnes}, 8446 institution = {Argonne National Laboratory}, 8447 year = {2019}, 8448 number = {ANL/MCS-TM-322 - Rev 3.12}, 8449 petsc_uses = {KSP} 8450} 8451 8452% url = "http://www.mcs.anl.gov/tao", 8453@Unpublished{ mefpp-web-page, 8454 title = {{MEF++} {W}eb {P}age}, 8455 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 8456 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 8457 author = {Eric Chamberland}, 8458 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 8459 multiphysics}, 8460 petsc_uses = {KSP} 8461} 8462 8463@Unpublished{ tipetsc-titanium, 8464 title = {Ti-PETSc - an interface to PETSc from Titanium}, 8465 institution = {Berkeley}, 8466 author = {He, Yun and Liblit, Bun and Lin, Chang}, 8467 url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, 8468 year = {1999}, 8469 petsc_uses = {KSP}, 8470} 8471 8472@Unpublished{ ptatin-web-page, 8473 title = {ptatin3d}, 8474 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 8475 url = {https://bitbucket.org/jedbrown/ptatin3d}, 8476 year = {2018}, 8477 petsc_uses = {KSP} 8478} 8479 8480@Misc{ multiphase-web-page, 8481 author = {Q. Zou}, 8482 title = {Multiphase flow with {PETSc}}, 8483 institution = {LANL}, 8484 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 8485 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 8486 lab = {LANL}, 8487 petsc_uses = {KSP} 8488} 8489 8490@Misc{ electromag-web-page, 8491 title = {{EMSolve Web} page}, 8492 institution = {LLNL}, 8493 howpublished = {http://www.llnl.gov/casc/emsolve}, 8494 url = {http://www.Llnl.gov/casc/emsolve}, 8495 author = {Daniel {White et al.}}, 8496 lab = {LLNL}, 8497 petsc_uses = {KSP} 8498} 8499 8500@Unpublished{ fe-software-web-page, 8501 institution = {Kuleuven}, 8502 title = {Finite element software}, 8503 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 8504 petsc_uses = {KSP} 8505} 8506 8507@Misc{ petsc-web-page, 8508 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8509 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 8510 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8511 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8512 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8513 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8514 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8515 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8516 Zhang}, 8517 title = {{PETS}c {W}eb page}, 8518 url = {https://petsc.org/}, 8519 howpublished = {\url{https://petsc.org/}}, 8520 year = {2025} 8521} 8522 8523@Unpublished{ petsc-debian-package, 8524 author = {Adam C. Powell, IV}, 8525 title = {Debian package for PETSc}, 8526 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 8527 petsc_uses = {KSP} 8528} 8529 8530@Unpublished{ cactus, 8531 title = {Cactus Website}, 8532 url = {http://www.cactuscode.org/}, 8533 note = {Provides two interface to the PETSc solvers}, 8534 petsc_uses = {KSP} 8535} 8536 8537@Unpublished{ petsc-fem, 8538 author = {Mario Storti and Norberto Nigro}, 8539 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 8540 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 8541 url = {http://www.cimec.org.ar/petscfem}, 8542 petsc_uses = {KSP} 8543} 8544 8545@Misc{ fidap, 8546 title = {FIDAP 8.5}, 8547 howpublished = {\url{http://www.fluent.com}}, 8548 url = {http://www.fluent.com}, 8549 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 8550 solves.}, 8551 key = {FIDAP 8.5}, 8552 petsc_uses = {KSP} 8553} 8554 8555@Unpublished{ slepc, 8556 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8557 Vicente Hern\'andez and Vicent Vidal}, 8558 title = {{SLEPc} Website}, 8559 url = {http://slepc.upv.es/}, 8560 note = {Scalable Library for Eigenvalue Problem Computations}, 8561 petsc_uses = {KSP} 8562} 8563 8564@TechReport{ slepc-users-manual, 8565 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8566 Vicente Hern\'andez and Vicent Vidal}, 8567 title = {{SLEPc} Users Manual}, 8568 number = {DISC-II/24/02}, 8569 url = {http://slepc.upv.es/}, 8570 note = {Scalable Library for Eigenvalue Problem Computations}, 8571 petsc_uses = {KSP} 8572} 8573 8574@Misc{ deal.ii, 8575 title = {deal.II}, 8576 howpublished = {\url{http://www.dealii.org}}, 8577 url = {http://www.dealii.org}, 8578 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 8579 It allows PETSc linear algebra and solvers to be used underneath.}, 8580 key = {deal.II 5.0}, 8581 petsc_uses = {KSP} 8582} 8583 8584@Article{ bangerth2007deal, 8585 title = {{deal.II---A general-purpose object-oriented finite element library}}, 8586 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 8587 journal = {ACM Transactions on Mathematical Software (TOMS)}, 8588 volume = {33}, 8589 number = {4}, 8590 pages = {24--es}, 8591 issn = {0098-3500}, 8592 year = {2007}, 8593 publisher = {ACM}, 8594 petsc_uses = {KSP} 8595} 8596 8597@Misc{ globalarrays, 8598 author = {Jarek {Nieplocha et al.}}, 8599 title = {Global Arrays}, 8600 institution = {Pacific Northwest National Laboratories}, 8601 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 8602 url = {http://www.emsl.pnl.gov/docs/global}, 8603 note = {Global arrays can use PETSc linear solvers}, 8604 lab = {PNNL}, 8605 petsc_uses = {KSP} 8606} 8607 8608% LiteralHTML: 8609% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 8610% LiteralHTML: 8611@Article{ petsccommunity2022, 8612 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 8613 Community}, 8614 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 8615 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 8616 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 8617 and Hong Zhang and Junchao Zhang}, 8618 journal = {Computing in Science and Engineering}, 8619 volume = {24}, 8620 number = {03}, 8621 pages = {6--15}, 8622 issn = {1558-366X}, 8623 doi = {10.1109/MCSE.2022.3169974}, 8624 publisher = {IEEE Computer Society}, 8625 address = {Los Alamitos, CA, USA}, 8626 month = may, 8627 year = {2022}, 8628 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 8629 petsc_uses = {KSP} 8630} 8631 8632@Article{ brownknepleysmith14, 8633 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 8634 title = {Run-time extensibility and librarization of simulation software}, 8635 journal = {IEEE Computing in Science and Engineering}, 8636 month = jan, 8637 volume = {17}, 8638 number = {1}, 8639 pages = {38--45}, 8640 doi = {10.1109/MCSE.2014.95}, 8641 year = {2015}, 8642 petsc_uses = {KSP} 8643} 8644 8645@TechReport{ ass2012, 8646 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 8647 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 8648 institution = {Argonne National Laboratory}, 8649 type = {Preprint}, 8650 year = {2012}, 8651 number = {ANL/MCS-P2011-0112}, 8652 petsc_uses = {KSP} 8653} 8654 8655@TechReport{ clearyknepley99, 8656 author = {Andrew Cleary and Matthew G. Knepley}, 8657 title = {Solvers as Operators}, 8658 institution = {Lawrence Livermore National Laboratory}, 8659 type = {Technical Report}, 8660 number = {UCRL-ID-135342}, 8661 year = {1999}, 8662 petsc_uses = {KSP} 8663} 8664 8665@TechReport{ smcabbkz2012, 8666 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 8667 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 8668 title = {{PETSc's} software strategy for the design space of composable extreme-scale 8669 solvers}, 8670 institution = {Argonne National Laboratory}, 8671 type = {Preprint}, 8672 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 8673 year = {2012}, 8674 number = {ANL/MCS-P2059-0312}, 8675 petsc_uses = {KSP} 8676} 8677 8678@InProceedings{ mhwpmhs2009, 8679 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 8680 and G. E. Hammond and B. Smith}, 8681 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 8682 Toolkit {MPI} at Scale}, 8683 booktitle = {Cray Users Group Conference}, 8684 year = {2009}, 8685 petsc_uses = {KSP} 8686} 8687 8688@InProceedings{ msmhls2010, 8689 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 8690 Lichtner and B. F. Smith}, 8691 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 8692 {BlueGene} Architectures}, 8693 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 8694 year = {2010}, 8695 petsc_uses = {KSP} 8696} 8697 8698@InCollection{ msk2013, 8699 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 8700 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 8701 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8702 series = {Lecture Notes in Earth System Sciences}, 8703 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8704 Yaolin Shi}, 8705 doi = {10.1007/978-3-642-16405-7_7}, 8706 publisher = {Springer Berlin Heidelberg}, 8707 pages = {131--140}, 8708 year = {2013}, 8709 isbn = {978-3-642-16404-0}, 8710 petsc_uses = {KSP} 8711} 8712 8713@InCollection{ knepleyyuen13, 8714 author = {Matthew G. Knepley and David A. Yuen}, 8715 title = {Why Scientists and Engineers need {GPU}s today}, 8716 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8717 series = {Lecture Notes in Earth System Sciences}, 8718 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8719 Yaolin Shi}, 8720 doi = {10.1007/978-3-642-16405-7_1}, 8721 publisher = {Springer Berlin Heidelberg}, 8722 pages = {131--140}, 8723 year = {2013}, 8724 isbn = {978-3-642-16404-0}, 8725 petsc_uses = {KSP} 8726} 8727 8728@InCollection{ karpeevknepleybrune13, 8729 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 8730 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 8731 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8732 series = {Lecture Notes in Earth System Sciences}, 8733 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8734 Yaolin Shi}, 8735 doi = {10.1007/978-3-642-16405-7_30}, 8736 publisher = {Springer Berlin Heidelberg}, 8737 pages = {487--501}, 8738 year = {2013}, 8739 isbn = {978-3-642-16404-0}, 8740 petsc_uses = {KSP} 8741} 8742 8743@InCollection{ zhengetal13, 8744 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 8745 Variable Viscosity}, 8746 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8747 Zhang and Yaolin Shi}, 8748 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8749 series = {Lecture Notes in Earth System Sciences}, 8750 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8751 Yaolin Shi}, 8752 doi = {10.1007/978-3-642-16405-7_21}, 8753 publisher = {Springer Berlin Heidelberg}, 8754 pages = {321--333}, 8755 year = {2013}, 8756 isbn = {978-3-642-16404-0}, 8757 petsc_uses = {KSP} 8758} 8759 8760@Article{ zhengetal13b, 8761 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 8762 strongly variable viscosity based on {M}atlab and {CUDA}}, 8763 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8764 Zhang and Yaolin Shi}, 8765 journal = {IJHPCA}, 8766 volume = {28}, 8767 number = {1}, 8768 pages = {50--60}, 8769 doi = {10.1177/1094342013478640}, 8770 year = {2013}, 8771 petsc_uses = {KSP} 8772} 8773 8774@InBook{ s2011, 8775 author = {B. Smith}, 8776 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 8777 title = {Encyclopedia of Parallel Computing}, 8778 bookeditor = {D. Padua}, 8779 publisher = {Springer}, 8780 year = {2011}, 8781 petsc_uses = {KSP} 8782} 8783 8784@Article{ acostamejia06, 8785 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 8786 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 8787 journal = {Lecturas Matem\'aticas}, 8788 volume = {27}, 8789 year = {2006}, 8790 pages = {213--224}, 8791 petsc_uses = {KSP} 8792} 8793 8794@InProceedings{ quenettemoresisunterappelbe07, 8795 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 8796 title = {Explaining StGermain: An aspect oriented environment for building extensible 8797 computational mechanics modeling software}, 8798 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 8799 publisher = {IEEE}, 8800 pages = {1--8}, 8801 yerar = {2007}, 8802 petsc_uses = {KSP} 8803} 8804 8805@Article{ dfm1, 8806 title = {Vectorized sparse matrix multiply for compressed row storage format}, 8807 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 8808 journal = {Lecture Notes in Computer Science}, 8809 year = {2005}, 8810 pages = {99--106}, 8811 volume = {3514}, 8812 lab = {ORNL}, 8813 petsc_uses = {KSP} 8814} 8815 8816@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 8817 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 8818 Vandewalle and Stefaan Poedts}, 8819 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 8820 Scientific Computing Software}, 8821 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 8822 year = {2005}, 8823 note = {Lecture Notes in Computer Science}, 8824 volume = {3514}, 8825 publisher = {Springer-Verlag GmbH}, 8826 petsc_uses = {KSP} 8827} 8828 8829@InProceedings{ dalcin-paz-storti, 8830 author = {L. Dalcin and R. Paz and M. Storti}, 8831 title = {Desarrollo de Aplicaciones Paralelas en Python}, 8832 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 8833 Bariloche, Argentina}, 8834 year = {2004}, 8835 petsc_uses = {KSP} 8836} 8837 8838@Article{ mpi-python, 8839 author = {L. Dalcin and R. Paz and M. Storti}, 8840 title = {MPI for Python}, 8841 journal = {Journal of Parallel and Distributed Computing}, 8842 year = {2005}, 8843 petsc_uses = {KSP} 8844} 8845 8846@Unpublished{ hrv02a, 8847 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 8848 author = {V. Hernandex and J. E. Roman and V. Vidal}, 8849 note = {Submited to VecPar 2002}, 8850 year = {2002}, 8851 petsc_uses = {KSP} 8852} 8853 8854@Article{ knyazev2007block, 8855 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 8856 {PETSc}}, 8857 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 8858 journal = {SIAM Journal on Scientific Computing}, 8859 volume = {29}, 8860 pages = {2224-2239}, 8861 doi = {10.1137/060661624}, 8862 year = {2007}, 8863 petsc_uses = {KSP} 8864} 8865 8866@MastersThesis{ aarrestad-master, 8867 author = {Asbjorn Hoiland Aarrestad}, 8868 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 8869 school = {University of Bergen}, 8870 month = aug, 8871 year = {2003}, 8872 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 8873 note = {Implemented Runge-Kutta methods using PETSc}, 8874 petsc_uses = {KSP} 8875} 8876 8877@PhDThesis{ kaushik-phd, 8878 author = {D. K. Kaushik}, 8879 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 8880 Differential Equations on Unstructured Grids}, 8881 school = {Old Dominion University}, 8882 month = dec, 8883 year = {2002}, 8884 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 8885 petsc_uses = {KSP} 8886} 8887 8888@TechReport{ rb1, 8889 author = {Rickard Bergstrom}, 8890 title = {Object Oriented Implementation of a General Finite Element Code}, 8891 number = {2002-13}, 8892 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 8893 year = {2002}, 8894 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 8895 note = {Discribes a finite element software package that uses PETSc for its solvers}, 8896 petsc_uses = {KSP} 8897} 8898 8899@InProceedings{ dbl1, 8900 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 8901 title = {A Parallel General Purpose Finite Element System}, 8902 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 8903 publisher = {SIAM}, 8904 year = {1999}, 8905 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 8906 note = {Describes software that uses PETSc for its parallel linear solves}, 8907 petsc_uses = {KSP} 8908} 8909 8910@Article{ p1, 8911 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 8912 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 8913 and B. Smith}, 8914 journal = {Parallel Computing}, 8915 year = {2002}, 8916 pages = {1811--1831}, 8917 volume = {28 (12)}, 8918 petsc_uses = {KSP} 8919} 8920 8921@Article{ automatic-ad, 8922 author = {Paul Hovland and Boyana Norris and Barry Smith}, 8923 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 8924 year = {2005}, 8925 journal = {Future Generation Computer Systems}, 8926 volume = {21}, 8927 number = {8}, 8928 pages = {1426--1438}, 8929 petsc_uses = {KSP} 8930} 8931 8932@TechReport{ remote-math, 8933 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 8934 Smith}, 8935 title = {Remote Access to Mathematical Software}, 8936 number = {ANL/MCS-P889-0601}, 8937 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8938 month = jun, 8939 year = {2001}, 8940 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 8941 petsc_uses = {KSP} 8942} 8943 8944@InProceedings{ gropp98, 8945 author = {William D. Gropp}, 8946 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 8947 publisher = {SIAM}, 8948 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8949 Scientific and Engineering Computing}, 8950 year = {1999}, 8951 pages = {21-29}, 8952 petsc_uses = {KSP} 8953} 8954 8955@InProceedings{ knepleysarin99, 8956 author = {Matthew Knepley and Vivek Sarin}, 8957 title = {Algorithm Development for Large Scale Computing}, 8958 publisher = {SIAM}, 8959 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8960 Scientific and Engineering Computing}, 8961 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 8962 year = {1999}, 8963 petsc_uses = {KSP} 8964} 8965 8966@InBook{ bgms00, 8967 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8968 chapter = {Software for the Scalable Solution of {PDEs}}, 8969 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 8970 title = {CRPC Handbook of Parallel Computing}, 8971 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 8972 and A. White}, 8973 publisher = {Morgan Kaufmann Publishers}, 8974 year = {2002}, 8975 petsc_uses = {KSP} 8976} 8977 8978@InProceedings{ hovland_norris_smith98, 8979 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 8980 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 8981 Computations}, 8982 publisher = {SIAM}, 8983 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8984 Scientific and Engineering Computing}, 8985 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 8986 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 8987 year = {1999}, 8988 pages = {129-137}, 8989 petsc_uses = {KSP} 8990} 8991 8992@InProceedings{ efficient, 8993 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8994 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 8995 Libraries}, 8996 booktitle = {Modern Software Tools in Scientific Computing}, 8997 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 8998 publisher = {Birkhauser Press}, 8999 pages = {163--202}, 9000 year = {1997}, 9001 petsc_uses = {KSP} 9002} 9003 9004% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 9005@TechReport{ petsc-user-ref, 9006 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 9007 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 9008 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 9009 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 9010 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 9011 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 9012 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 9013 and Barry~F. Smith and Hansol Suh and Stefano Zampini and Hong Zhang and Hong Zhang 9014 and Junchao Zhang}, 9015 title = {{PETSc/TAO} Users Manual}, 9016 institution = {Argonne National Laboratory}, 9017 number = {ANL-21/39 - Revision 3.23}, 9018 doi = {10.2172/2476320}, 9019 year = {2025} 9020} 9021 9022% url = {https://petsc.org/release} 9023@TechReport{ petsc-developers, 9024 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 9025 title = {{PETS}c Developers Guide}, 9026 institution = {Argonne National Laboratory}, 9027 number = {ANL-18/18}, 9028 year = {2018}, 9029 url = {https://petsc.org/release/developers}, 9030 petsc_uses = {KSP} 9031} 9032 9033@Unpublished{ alice-memory-snooper, 9034 author = {Ibrahima Ba and Barry~F. Smith}, 9035 title = {The {ALICE} Memory Snooper}, 9036 year = {1999}, 9037 petsc_uses = {KSP} 9038} 9039 9040@TechReport{ petsc-user-ref-polish, 9041 author = {Marcin Bojko and Piotr Krzyzanowski}, 9042 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 9043 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 9044 year = {1998}, 9045 note = {An introduction to PETSc in Polish}, 9046 petsc_uses = {KSP} 9047} 9048 9049@InProceedings{ abghmn00, 9050 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 9051 High-Performance Scientific Computing}, 9052 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 9053 Norris}, 9054 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 9055 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 9056 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 9057 Hasco\"{e}t and Uwe Naumann}, 9058 publisher = {Springer}, 9059 year = {2002}, 9060 petsc_uses = {KSP} 9061} 9062 9063@Unpublished{ petsc-mpi-paper, 9064 author = {Lois Curfman McInnes and Barry F. Smith}, 9065 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 9066 Libraries}, 9067 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 9068 month = jun, 9069 year = {1995}, 9070 petsc_uses = {KSP} 9071} 9072 9073@InProceedings{ miss-paper, 9074 author = {William D. Gropp and Barry F. Smith}, 9075 title = {Scalable, Extensible, and Portable Numerical Libraries}, 9076 publisher = {IEEE}, 9077 year = {1994}, 9078 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9079 address = {Mississippi State University}, 9080 pages = {87--93}, 9081 keyword = {numerical libraries, scientific computing, parallel computing}, 9082 petsc_uses = {KSP} 9083} 9084 9085@InProceedings{ snes-paper, 9086 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9087 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 9088 Minimization Problems}, 9089 publisher = {IEEE}, 9090 year = {1995}, 9091 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9092 address = {Mississippi State University}, 9093 pages = {60-67}, 9094 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 9095 petsc_uses = {KSP} 9096} 9097 9098@Article{ dsneutral, 9099 author = {Barry F. Smith and William D. Gropp}, 9100 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 9101 Sparse Linear Systems}, 9102 journal = {Scientific Programming}, 9103 volume = {5}, 9104 pages = {329--336}, 9105 key = {GroppSmith96 ! KSP design}, 9106 year = {1996}, 9107 petsc_uses = {KSP} 9108} 9109 9110@InProceedings{ bgms98, 9111 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9112 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 9113 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 9114 Scientific and Engineering Computing}, 9115 publisher = {SIAM}, 9116 pages = {58-67}, 9117 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 9118 year = {1998}, 9119 petsc_uses = {KSP} 9120} 9121 9122@Article{ hkm98, 9123 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 9124 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 9125 {PDE} Computation}, 9126 journal = {Advances in Engineering Software}, 9127 volume = {29}, 9128 pages = {415-424}, 9129 year = {1998}, 9130 petsc_uses = {KSP} 9131} 9132 9133@TechReport{ pdpta99, 9134 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 9135 Smith}, 9136 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 9137 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 9138 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 9139 Vegas, Nevada}, 9140 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9141 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 9142 number = {ANL/MCS-P751-0599}, 9143 year = {1999}, 9144 petsc_uses = {KSP} 9145} 9146 9147@InProceedings{ bbh:com, 9148 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 9149 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 9150 Computing}}, 9151 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 9152 Euro-Par Conference, Munich, Germany, August/September 2000}, 9153 year = {2000}, 9154 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 9155 volume = {1900}, 9156 series = {Lecture Notes in Computer Science}, 9157 pages = {86--94}, 9158 address = {Berlin}, 9159 publisher = {Springer}, 9160 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 9161 petsc_uses = {KSP} 9162} 9163 9164@InProceedings{ overture00, 9165 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 9166 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 9167 Components}, 9168 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 9169 booktitle = {Proceedings of the International Federation for Information Processing Working 9170 Conference on Software Architectures for Scientific Computing, Kluwer}, 9171 year = {2000}, 9172 pages = {57--68}, 9173 petsc_uses = {KSP} 9174} 9175 9176@TechReport{ smith97, 9177 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 9178 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 9179 number = {ANL/MCS-P701}, 9180 author = {Barry F. Smith}, 9181 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9182 petsc_uses = {KSP} 9183} 9184 9185@Article{ smith98, 9186 author = {Barry Smith}, 9187 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 9188 journal = {SIGNUM Newsletter}, 9189 year = {1998}, 9190 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 9191 petsc_uses = {KSP} 9192} 9193 9194@TechReport{ ad-petsc-tm, 9195 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 9196 {PETSc}}, 9197 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 9198 year = {1997}, 9199 type = {Technical Memorandum}, 9200 institution = {ANL}, 9201 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 9202 number = {ANL/MCS-TM-233}, 9203 petsc_uses = {KSP} 9204} 9205 9206% LiteralHTML: 9207% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 9208% LiteralHTML: 9209@PhDThesis{ klotzthesis2019, 9210 author = {Thomas S. Klotz}, 9211 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 9212 Biology}, 9213 school = {Rice University}, 9214 year = {2019}, 9215 petsc_uses = {KSP} 9216} 9217 9218@Article{ klotzbardhanknepley2018, 9219 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 9220 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 9221 journal = {arXiv e-prints}, 9222 eprint = {1708.06028}, 9223 archiveprefix = {arXiv}, 9224 primaryclass = {math.na}, 9225 year = {2018}, 9226 note = {\url{http://arxiv.org/abs/1708.06028}}, 9227 petsc_uses = {KSP} 9228} 9229 9230@Misc{ brown2016, 9231 title = {Threading Tradeoffs in Domain Decomposition}, 9232 author = {Jed Brown}, 9233 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 9234 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 9235 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 9236 year = {2016}, 9237 petsc_uses = {KSP} 9238} 9239 9240@Article{ changnakshatralaknepleyjohnsson2017, 9241 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 9242 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 9243 Johnsson}, 9244 journal = {Concurency: Practice and Experience}, 9245 volume = {30}, 9246 number = {11}, 9247 eprint = {1705.03625}, 9248 doi = {10.1002/cpe.4401}, 9249 year = {2017}, 9250 petsc_uses = {KSP} 9251} 9252 9253@Article{ changfabienknepleymills2018, 9254 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 9255 spectrum analysis}, 9256 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 9257 journal = {SIAM Journal on Scientific Computing}, 9258 volume = {40}, 9259 number = {6}, 9260 pages = {C779--C802}, 9261 eprint = {1802.07832}, 9262 doi = {10.1137/18M1172260}, 9263 year = {2018}, 9264 petsc_uses = {KSP} 9265} 9266 9267@Article{ joshaghanichangnakshatralaknepley2019, 9268 title = {Composable solvers for the four-field double porosity/permeability model}, 9269 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 9270 Knepley}, 9271 journal = {Journal of Computational Physics}, 9272 volume = {386}, 9273 pages = {428--466}, 9274 doi = {10.1016/j.jcp.2019.02.020}, 9275 year = {2019}, 9276 petsc_uses = {KSP} 9277} 9278 9279@InProceedings{ barralknepleylangepiggottgorman2016, 9280 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 9281 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 9282 and Gerard J. Gorman}, 9283 booktitle = {25th International Meshing Roundtable}, 9284 editor = {Steve Owen and Hang Si}, 9285 month = sep, 9286 address = {Washington, DC}, 9287 pages = {1--5}, 9288 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 9289 year = {2016}, 9290 petsc_uses = {KSP} 9291} 9292 9293@Article{ adamsbrownknepleysamtaney2016, 9294 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 9295 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 9296 journal = {SIAM Journal on Scientific Computing}, 9297 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 9298 epub = {http://arxiv.org/abs/1406.7808}, 9299 volume = {8}, 9300 number = {4}, 9301 pages = {C426--C440}, 9302 doi = {10.1137/140975127}, 9303 year = {2016}, 9304 petsc_uses = {KSP} 9305} 9306 9307@InProceedings{ maysananruppknepleysmith2016, 9308 title = {Extreme-Scale Multigrid Components within {PETSc}}, 9309 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 9310 Smith}, 9311 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 9312 series = {PASC '16}, 9313 isbn = {978-1-4503-4126-4}, 9314 location = {Lausanne, Switzerland}, 9315 pages = {5:1--5:12}, 9316 articleno = {5}, 9317 numpages = {12}, 9318 doi = {10.1145/2929908.2929913}, 9319 acmid = {2929913}, 9320 publisher = {ACM}, 9321 address = {New York, NY, USA}, 9322 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 9323 preconditioning}, 9324 year = {2016}, 9325 petsc_uses = {KSP} 9326} 9327 9328@Article{ liu2015field, 9329 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 9330 author = {Lulu Liu and David E Keyes}, 9331 journal = {SIAM Journal on Scientific Computing}, 9332 volume = {37}, 9333 number = {3}, 9334 pages = {A1388--A1409}, 9335 year = {2015}, 9336 publisher = {SIAM}, 9337 petsc_uses = {KSP} 9338} 9339 9340@Article{ lujiaomissirlis2014, 9341 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 9342 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 9343 journal = {Numerical Linear Algebra with Applications}, 9344 volume = {21}, 9345 number = {2}, 9346 pages = {221--238}, 9347 year = {2014}, 9348 publisher = {Wiley Online Library}, 9349 petsc_uses = {KSP} 9350} 9351 9352@Article{ badiamartinprincipe2013, 9353 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 9354 solid mechanics}, 9355 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 9356 journal = {International Journal for Numerical Methods in Engineering}, 9357 volume = {96}, 9358 number = {4}, 9359 pages = {203--230}, 9360 year = {2013}, 9361 petsc_uses = {KSP} 9362} 9363 9364@Article{ morganknepleysananscott2016, 9365 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 9366 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 9367 journal = {Concurrency and Computation: Practice and Experience}, 9368 volume = {28}, 9369 pages = {4532--4542}, 9370 year = {2016}, 9371 url = {http://arxiv.org/abs/1602.04873}, 9372 doi = {10.1002/cpe.3820}, 9373 petsc_uses = {KSP} 9374} 9375 9376@Article{ morgansananknepleymills2020, 9377 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 9378 solvers}, 9379 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 9380 journal = {The International Journal of High Performance Computing Applications}, 9381 volume = {35}, 9382 issue = {1}, 9383 doi = {10.1177/1094342020966835}, 9384 url = {https://doi.org/10.1177/1094342020966835}, 9385 eprint = {https://doi.org/10.1177/1094342020966835}, 9386 year = {2020}, 9387 petsc_uses = {KSP} 9388} 9389 9390@Article{ msz2013, 9391 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 9392 author = {M. McCourt and B. F. Smith and H. Zhang}, 9393 journal = {SIAM Journal on Matrix Analysis and Applications}, 9394 year = {2015}, 9395 note = {To appear}, 9396 petsc_uses = {KSP} 9397} 9398 9399@Article{ bassi2014agglomeration, 9400 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 9401 free}, 9402 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 9403 journal = {Mathematical Models and Methods in Applied Sciences}, 9404 volume = {24}, 9405 number = {08}, 9406 pages = {1495--1539}, 9407 year = {2014}, 9408 publisher = {World Scientific}, 9409 petsc_uses = {KSP} 9410} 9411 9412@Article{ jhuranidemkowicz12, 9413 author = {{Jhurani}, C. and {Demkowicz}, L.}, 9414 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 9415 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 9416 journal = {Computer Methods in Applied Mechanics and Engineering}, 9417 volume = {213}, 9418 pages = {418-426}, 9419 year = {2012}, 9420 month = mar, 9421 doi = {10.1016/j.cma.2011.06.003}, 9422 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 9423 petsc_uses = {KSP} 9424} 9425 9426@Article{ yangcai11, 9427 author = {Yang, Haijian and Cai, Xiao-Chuan}, 9428 title = {Parallel Two-Grid Semismooth {N}ewton--{K}rylov--{S}chwarz Method for Nonlinear 9429 Complementarity Problems}, 9430 journal = {J. Sci. Comput.}, 9431 issue_date = {May 2011}, 9432 volume = {47}, 9433 number = {2}, 9434 month = may, 9435 pages = {258--280}, 9436 year = {2011}, 9437 issn = {0885-7474}, 9438 numpages = {23}, 9439 doi = {10.1007/s10915-010-9436-4}, 9440 acmid = {1971246}, 9441 publisher = {Plenum Press}, 9442 address = {New York, NY, USA}, 9443 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 9444 preconditioners, Semismooth Newton, Two-level methods}, 9445 petsc_uses = {KSP} 9446} 9447 9448@Article{ rheinbach09, 9449 author = {Rheinbach, Oliver}, 9450 title = {Parallel Iterative Substructuring in Structural Mechanics}, 9451 journal = {Archives of Computational Methods in Engineering}, 9452 volume = {16}, 9453 number = {4}, 9454 pages = {425-463}, 9455 year = {2009}, 9456 issn = {1134-3060}, 9457 doi = {10.1007/s11831-009-9035-4}, 9458 publisher = {Springer Netherlands}, 9459 language = {English}, 9460 petsc_uses = {KSP} 9461} 9462 9463@Article{ knepleyterrel2013, 9464 author = {Matthew G. Knepley and Andy R. Terrel}, 9465 title = {Finite Element Integration on {GPUs}}, 9466 journal = {{ACM} Transactions on Mathematical Software}, 9467 volume = {39}, 9468 number = {2}, 9469 accepted = {17 April 2012}, 9470 year = {2013}, 9471 abstract = {We present a novel finite element integration method for low order elements on 9472 GPUs. We achieve more than 100GF for element integration on first order 9473 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 9474 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 9475 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 9476 url = {http://arxiv.org/abs/1103.0066}, 9477 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 9478 petsc_uses = {KSP} 9479} 9480 9481@Article{ knepleyruppterrel2016, 9482 title = {Finite Element Integration with Quadrature on the GPU}, 9483 journal = {ArXiv e-prints}, 9484 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 9485 version = {1}, 9486 date = {2016-07-14}, 9487 eprinttype = {arxiv}, 9488 eprintclass = {cs.MS}, 9489 eprint = {1607.04245v1}, 9490 petsc_uses = {KSP} 9491} 9492 9493@Article{ klawonnlanserrheinbach2014, 9494 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 9495 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 9496 journal = {SIAM Journal on Scientific Computing}, 9497 volume = {36}, 9498 number = {2}, 9499 pages = {A737--A765}, 9500 year = {2014}, 9501 petsc_uses = {KSP} 9502} 9503 9504@Article{ bruneknepleysmithtu15, 9505 title = {Composing Scalable Nonlinear Algebraic Solvers}, 9506 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 9507 journal = {SIAM Review}, 9508 volume = {57}, 9509 number = {4}, 9510 pages = {535--565}, 9511 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 9512 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 9513 doi = {10.1137/130936725}, 9514 year = {2015}, 9515 petsc_uses = {KSP} 9516} 9517 9518@Article{ mszm2014, 9519 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 9520 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9521 volume = {40}, 9522 pages = {17--31}, 9523 year = {2014}, 9524 journal = {Parallel Computing}, 9525 doi = {10.1016/j.parco.2013.10.001}, 9526 petsc_uses = {KSP} 9527} 9528 9529@TechReport{ mszm2012, 9530 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 9531 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9532 year = {2012}, 9533 number = {ANL/MCS-P2097-0512}, 9534 institution = {Argonne National Laboratory}, 9535 petsc_uses = {KSP} 9536} 9537 9538@InProceedings{ bkmms2012, 9539 author = {Jed Brown and Matthew Knepley and David A. May and Lois C. McInnes and Barry 9540 F. Smith}, 9541 title = {Composable linear solvers for multiphysics}, 9542 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 9543 Computing} ({ISPDC} 2012)}, 9544 year = {2012}, 9545 doi = {10.1109/ISPDC.2012.16}, 9546 publisher = {IEEE Computer Society}, 9547 pages = {55--62}, 9548 petsc_uses = {KSP} 9549} 9550 9551@Article{ bourdinbucuroudet2009, 9552 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 9553 title = {Optimal Partitions for Eigenvalues}, 9554 journal = {SIAM J. Sci. Comput.}, 9555 volume = {31}, 9556 number = {6}, 9557 pages = {4100--4114}, 9558 year = {2009}, 9559 petsc_uses = {KSP} 9560} 9561 9562@InBook{ kimnbourdin2007, 9563 author = {J.-H. Kimn and Blaise Bourdin}, 9564 title = {Numerical implementation of overlapping balancing domain decomposition methods on 9565 unstructured meshes}, 9566 editor = {O. B. Widlund and D. E. Keyes}, 9567 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 9568 series = {Lecture Notes in Computational Science and Engineering}, 9569 number = {55}, 9570 publisher = {Springer-Verlag}, 9571 pages = {309--315}, 9572 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 9573 year = {2007}, 9574 petsc_uses = {KSP} 9575} 9576 9577@Article{ bjm2005, 9578 author = {AH Baker and ER Jessup and T Manteuffel}, 9579 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 9580 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 9581 year = {2005}, 9582 petsc_uses = {KSP} 9583} 9584 9585@Unpublished{ sundar-2008a, 9586 author = {R.S. Sampath and G. Biros}, 9587 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 9588 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9589 petsc_uses = {KSP} 9590} 9591 9592@Article{ sundar-2008, 9593 author = {H. Sundar and R.S. Sampath and G. Biros}, 9594 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 9595 journal = {SIAM Journal on Scientific Computing}, 9596 year = {2008}, 9597 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9598 petsc_uses = {KSP} 9599} 9600 9601@InProceedings{ sundar-2007, 9602 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 9603 title = {Low-constant parallel algorithms for finite element simulations using linear 9604 octrees}, 9605 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 9606 year = {2007}, 9607 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9608 petsc_uses = {KSP} 9609} 9610 9611@InProceedings{ adams-98a, 9612 author = {Adams, Mark ~F.}, 9613 title = {A Parallel Maximal Independent Set Algorithm}, 9614 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 9615 year = {1998}, 9616 petsc_uses = {KSP} 9617} 9618 9619@Article{ akcelik2005ddd, 9620 title = {{Dynamic data-driven inversion for terascale simulations: real-time 9621 identification of airborne contaminants}}, 9622 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 9623 van Bloemen Waanders, B.}, 9624 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 9625 year = {2005}, 9626 publisher = {IEEE Computer Society Washington, DC, USA}, 9627 petsc_uses = {KSP} 9628} 9629 9630@InBook{ akcelik-2006, 9631 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 9632 Bloemen Waanders}, 9633 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 9634 title = {Frontiers of Parallel Computing}, 9635 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 9636 publisher = {SIAM}, 9637 year = {2006}, 9638 petsc_uses = {KSP} 9639} 9640 9641@Article{ dt, 9642 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 9643 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 9644 Convection Diffusion Equations}, 9645 journal = {The Journal of Supercomputing}, 9646 year = {2004}, 9647 pages = {235--253}, 9648 volume = {28}, 9649 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 9650 petsc_uses = {KSP} 9651} 9652 9653@PhDThesis{ hwang2004, 9654 author = {Feng-Nan Hwang}, 9655 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 9656 Computational Fluid Dynamics}, 9657 school = {University of Colorado at Boulder}, 9658 year = {2004}, 9659 petsc_uses = {KSP} 9660} 9661 9662@PhDThesis{ baker, 9663 author = {{A. H.} Baker}, 9664 title = {On improving the performance of the linear solver restarted {GMRES}}, 9665 school = {University of Colorado at Boulder}, 9666 year = {2003}, 9667 petsc_uses = {KSP} 9668} 9669 9670@TechReport{ klawonnrheinbach601, 9671 author = {Axel Klawonn and Oliver Rheinbach}, 9672 title = {A Parallel Implementation of Dual-Primal {FETI-DP} Methods for Three Dimensional 9673 Linear Elasticity Using a Transformation of Basis}, 9674 institution = {Universit\"at Duisburg-Essen}, 9675 year = {2005}, 9676 type = {Technical Report}, 9677 number = {SM-E-601}, 9678 petsc_uses = {KSP} 9679} 9680 9681@TechReport{ klawonnrheinbach609, 9682 author = {Axel Klawonn and Oliver Rheinbach}, 9683 title = {Inexact FETI-DP Methods}, 9684 institution = {Universit\"at Duisburg-Essen}, 9685 year = {2005}, 9686 type = {Technical Report}, 9687 number = {SM-E-609}, 9688 petsc_uses = {KSP} 9689} 9690 9691@TechReport{ klawonnrheinbach607, 9692 author = {Axel Klawonn and Oliver Rheinbach}, 9693 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 9694 institution = {Universit\"at Duisburg-Essen}, 9695 year = {2005}, 9696 type = {Technical Report}, 9697 number = {SM-E-607}, 9698 petsc_uses = {KSP} 9699} 9700 9701@Article{ kul-natraj-pbp, 9702 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 9703 title = {Performance of a parallel mixed finite element implementation for fourth order 9704 clamped anisotropic plate bending problems in distributed memory environments}, 9705 journal = {Applied Mathematics and Computation}, 9706 volume = {155}, 9707 year = {2004}, 9708 number = {3}, 9709 pages = {753--777}, 9710 petsc_uses = {KSP} 9711} 9712 9713@Article{ bramkamp2006uej, 9714 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 9715 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 9716 journal = {Computers \& Fluids}, 9717 volume = {35}, 9718 number = {10}, 9719 pages = {1063--1073}, 9720 doi = {10.1016/j.compfluid.2005.10.003}, 9721 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 9722 derivation of the analytic flux Jacobian can become quite complicated depending on 9723 the complexity of the numerical flux calculation. Practically, the derivation of 9724 the exact Jacobian by hand is an unrealistic option because of the enormous 9725 man-hour investment needed. In this work, automatic differentiation is used to 9726 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 9727 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 9728 approximated by first-order forward differences. For a two-dimensional airfoil 9729 under three different flight conditions (quasi-incompressible flow, compressible 9730 subsonic flow, and transonic flow), we show that the robustness and performance of 9731 the present finite volume scheme is significantly improved by using exact 9732 Jacobians.}, 9733 year = {2006}, 9734 petsc_uses = {KSP} 9735} 9736 9737@Article{ shahbazi1, 9738 author = {Khosro Shahbazi}, 9739 title = {An explicit expression for the penalty parameter of the interior penalty method}, 9740 journal = {Journal of Computational Physics}, 9741 volume = {205}, 9742 year = {2005}, 9743 pages = {401--407}, 9744 petsc_uses = {KSP} 9745} 9746 9747@TechReport{ kk, 9748 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 9749 author = {Hans-Peter Kersken and Uwe Kuster}, 9750 year = {1999}, 9751 institution = {University of Stuttgart}, 9752 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 9753 number = {310}, 9754 petsc_uses = {KSP} 9755} 9756 9757@Article{ miha-mija, 9758 author = {M. D. Mihajlovi and S. Mijalkovi}, 9759 title = {A component decomposition preconditioning for 3D stress analysis problems}, 9760 journal = {Numerical Linear Algebra with Applications}, 9761 volume = {9}, 9762 year = {2002}, 9763 pages = {567--583}, 9764 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 9765 petsc_uses = {KSP} 9766} 9767 9768@Article{ bjm, 9769 author = {M Benzi and W Joubert and G Mateescu}, 9770 journal = {Electronic Transactions on Numerical Analysis}, 9771 year = {1999}, 9772 volume = {8}, 9773 pages = {88--114}, 9774 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 9775 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 9776 petsc_uses = {KSP} 9777} 9778 9779@PhDThesis{ hyde, 9780 author = {EMK Hyde}, 9781 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 9782 school = {Caltech}, 9783 year = {2003}, 9784 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 9785 petsc_uses = {KSP} 9786} 9787 9788@Article{ km2003, 9789 author = {A. Keese and H. G. Matthies}, 9790 journal = {Proceedings in Applied Mathematics and Mechanics}, 9791 year = {2003}, 9792 volume = {2}, 9793 pages = {485--486}, 9794 title = {Parallel Solution of Stochastic PDEs}, 9795 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 9796 petsc_uses = {KSP} 9797} 9798 9799@Article{ whszss, 9800 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 9801 and Otmar Scherzer and H. Siegfried Stiehl}, 9802 journal = {Real Time Imaging}, 9803 year = {2001}, 9804 volume = {7}, 9805 pages = {31--45}, 9806 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 9807 approaches}, 9808 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 9809 petsc_uses = {KSP} 9810} 9811 9812@TechReport{ baker1, 9813 title = {An Efficient Block Variant of GMRES}, 9814 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 9815 year = {2003}, 9816 type = {Technical Report}, 9817 institution = {University of Colorado, Boulder}, 9818 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 9819 number = {CU-CS-957-03}, 9820 petsc_uses = {KSP} 9821} 9822 9823@InProceedings{ mc2003, 9824 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 9825 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 9826 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9827 Methods}, 9828 pages = {639--646}, 9829 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9830 note = {}, 9831 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9832 year = {2003}, 9833 petsc_uses = {KSP} 9834} 9835 9836@InProceedings{ kt2003, 9837 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 9838 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 9839 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9840 Methods}, 9841 pages = {615--622}, 9842 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9843 note = {}, 9844 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9845 year = {2003}, 9846 petsc_uses = {KSP} 9847} 9848 9849@InProceedings{ krw2003, 9850 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 9851 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 9852 3D}, 9853 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9854 Methods}, 9855 pages = {361--368}, 9856 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9857 note = {}, 9858 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9859 year = {2003}, 9860 petsc_uses = {KSP} 9861} 9862 9863@InProceedings{ hc2003, 9864 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 9865 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 9866 Nonlinear Preconditioning}, 9867 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9868 Methods}, 9869 pages = {201--208}, 9870 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9871 note = {}, 9872 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9873 year = {2003}, 9874 petsc_uses = {KSP} 9875} 9876 9877@InProceedings{ g2003, 9878 author = {P. Goldfeld}, 9879 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 9880 (Generalized) {Stokes} and Parallel Implementation}, 9881 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9882 Methods}, 9883 pages = {209--216}, 9884 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9885 publisher = {National Autonomous University of Mexico (UNAM)}, 9886 note = {}, 9887 url = {http://www.ddm.org/DD14}, 9888 year = {2003}, 9889 petsc_uses = {KSP} 9890} 9891 9892@InProceedings{ dhv2003, 9893 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 9894 title = {Toward scalable {FETI} algorithm for variational inequalities with applications to 9895 composites}, 9896 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9897 Methods}, 9898 pages = {395--401}, 9899 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9900 publisher = {National Autonomous University of Mexico (UNAM)}, 9901 note = {}, 9902 url = {http://www.ddm.org/DD14}, 9903 year = {2003}, 9904 petsc_uses = {KSP} 9905} 9906 9907@InProceedings{ dhsv2002, 9908 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9909 title = {Scalabilities of {FETI} for variational inequalities and contact shape 9910 optimization}, 9911 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9912 Methods}, 9913 pages = {359--367}, 9914 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9915 publisher = {CIMNE, Barcelona, Spain}, 9916 note = {}, 9917 url = {http://www.ddm.org/DD13}, 9918 year = {2002}, 9919 petsc_uses = {KSP} 9920} 9921 9922@InProceedings{ cky2002, 9923 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 9924 title = {A Nonlinear Additive {S}chwarz Preconditioned Inexact {N}ewton Method for Shocked 9925 Duct Flows}, 9926 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9927 Methods}, 9928 pages = {343--350}, 9929 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9930 publisher = {CIMNE, Barcelona, Spain}, 9931 note = {}, 9932 url = {http://www.ddm.org/DD13}, 9933 year = {2002}, 9934 petsc_uses = {KSP} 9935} 9936 9937@Conference{ li-etal:03, 9938 author = {Li, Z. and Lanteri S. and Saad, Y.}, 9939 title = {Multiplicative-additive preconditioning combination for general sparse linear 9940 systems}, 9941 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 9942 Matrix Problems in Scientific and Industrial Applications}, 9943 address = {Napa, California, USA}, 9944 date = {october 27-29}, 9945 year = {2003}, 9946 petsc_uses = {KSP} 9947} 9948 9949@Article{ bashir2008hessian, 9950 title = {Hessian-based model reduction for large-scale systems with initial-condition 9951 inputs}, 9952 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 9953 J.}, 9954 journal = {International journal for numerical methods in engineering}, 9955 volume = {73}, 9956 number = {6}, 9957 pages = {844--868}, 9958 year = {2008}, 9959 publisher = {Wiley Online Library}, 9960 petsc_uses = {KSP} 9961} 9962 9963@Article{ bashir2007hessian, 9964 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 9965 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 9966 K.}, 9967 journal = {Computational Science--ICCS 2007}, 9968 pages = {1010--1017}, 9969 year = {2007}, 9970 publisher = {Springer}, 9971 petsc_uses = {KSP} 9972} 9973 9974@Article{ akcelik2011fast, 9975 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 9976 inverse problems based on low-rank partial {H}essian approximations}, 9977 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 9978 Waanders, B. and Wilcox, L.}, 9979 journal = {SIAM Journal on Scientific Computing}, 9980 volume = {33}, 9981 number = {1}, 9982 year = {2011}, 9983 petsc_uses = {KSP} 9984} 9985 9986@InProceedings{ ff2003, 9987 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 9988 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 9989 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 9990 year = {2003}, 9991 petsc_uses = {KSP} 9992} 9993 9994@InProceedings{ d2b2004, 9995 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 9996 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 9997 Ordering Strategies}, 9998 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 9999 year = {2004}, 10000 petsc_uses = {KSP} 10001} 10002 10003@InProceedings{ d2v2005, 10004 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 10005 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 10006 Flow Equations}, 10007 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 10008 year = {2005}, 10009 petsc_uses = {KSP} 10010} 10011 10012@InProceedings{ dvs2006, 10013 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 10014 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 10015 Mixed Convection Equations}, 10016 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 10017 year = {2006}, 10018 petsc_uses = {KSP} 10019} 10020 10021@Article{ dsv2006, 10022 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 10023 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 10024 Flow Equations}, 10025 journal = {Computational Fluid Dynamics}, 10026 year = {2006}, 10027 volume = {15}, 10028 number = {1}, 10029 petsc_uses = {KSP} 10030} 10031 10032@Article{ lahaye03, 10033 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 10034 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10035 journal = {J. Comput. Appl. Math.}, 10036 year = {2004}, 10037 pages = {267--275}, 10038 volume = {168}, 10039 petsc_uses = {KSP} 10040} 10041 10042@TechReport{ brmn, 10043 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 10044 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 10045 year = {2002}, 10046 type = {Technical Report}, 10047 institution = {ANL}, 10048 number = {ANL/MCS-P993-0902}, 10049 note = {To appear in Future Generation Computer Systems}, 10050 petsc_uses = {KSP} 10051} 10052 10053@InProceedings{ mnbr, 10054 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 10055 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 10056 Algorithms}, 10057 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 10058 Mechanics}, 10059 year = {2003}, 10060 petsc_uses = {KSP} 10061} 10062 10063@InProceedings{ bmnr, 10064 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 10065 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 10066 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 10067 Applications, Lecture notes in Computer Science 2677}, 10068 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 10069 pages = {828--839}, 10070 year = {2003}, 10071 petsc_uses = {KSP} 10072} 10073 10074@Article{ ph03, 10075 author = {M. Pernice and R. D. Hornung}, 10076 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 10077 journal = {Computing and Visualization in Science}, 10078 year = {2003}, 10079 lab = {LANL}, 10080 petsc_uses = {KSP} 10081} 10082 10083@Article{ adams-02, 10084 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 10085 journal = {J. Comp. Phys.}, 10086 number = {2}, 10087 pages = {593-610}, 10088 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 10089 volume = {188}, 10090 year = {2003}, 10091 petsc_uses = {KSP} 10092} 10093 10094@InProceedings{ adams2001distributed, 10095 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 10096 smoothers}, 10097 author = {Adams, M.F.}, 10098 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 10099 pages = {14--14}, 10100 year = {2001}, 10101 organization = {IEEE}, 10102 petsc_uses = {KSP} 10103} 10104 10105@PhDThesis{ els01, 10106 author = {Ulrich Elsner}, 10107 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 10108 algorithms}, 10109 school = {Technical University Chemnitz}, 10110 year = {2002}, 10111 publisher = {Logos Verlag, Berlin}, 10112 isbn = {3-89722-923-4}, 10113 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 10114 different graph partitioning algorithms}, 10115 petsc_uses = {KSP} 10116} 10117 10118@TechReport{ ckk02, 10119 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 10120 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 10121 year = {2002}, 10122 type = {Technical Report}, 10123 institution = {ODU}, 10124 url = {http://www.math.odu.edu/\~{ }keyes}, 10125 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 10126 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 10127 Methods}, 10128 petsc_uses = {KSP} 10129} 10130 10131@Article{ gpw2002, 10132 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 10133 Heterogeneous Problems in Linear Elasticity}, 10134 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 10135 year = {2003}, 10136 pages = {283--324}, 10137 volume = {95}, 10138 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 10139 journal = {Numerische Mathematik}, 10140 petsc_uses = {KSP} 10141} 10142 10143@Article{ dh1, 10144 title = {Scalability and FETI based algorithm for large discretized variational 10145 inequalities}, 10146 author = {Z Dostal and D Horak}, 10147 year = {2003}, 10148 pages = {347--357}, 10149 volume = {61}, 10150 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 10151 journal = {Mathematics and Computers in Simulation}, 10152 petsc_uses = {KSP} 10153} 10154 10155@InProceedings{ dhsv1, 10156 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 10157 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 10158 title = {36 Scalabilities of {FETI} for Variational Inequalities and Contact Shape 10159 Optimization}, 10160 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10161 Methods}, 10162 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10163 Kuznetsov}, 10164 petsc_uses = {KSP} 10165} 10166 10167@Article{ lahaye02, 10168 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 10169 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10170 journal = {IEEEMAGN}, 10171 year = {2002}, 10172 volume = {38}, 10173 number = {2}, 10174 pages = {413-416}, 10175 petsc_uses = {KSP} 10176} 10177 10178@Article{ ckm01, 10179 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 10180 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 10181 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 10182 fluid dynamics}, 10183 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 10184 year = {2002}, 10185 volume = {40}, 10186 pages = {1463--1470}, 10187 petsc_uses = {KSP} 10188} 10189 10190@InProceedings{ cky01, 10191 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 10192 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 10193 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 10194 duct flow}, 10195 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10196 Methods}, 10197 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10198 Kuznetsov}, 10199 year = {2002}, 10200 petsc_uses = {KSP} 10201} 10202 10203@Article{ ck02, 10204 author = {X.-C. Cai and D. E. Keyes}, 10205 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 10206 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 10207 journal = {SIAM J. Sci. Comput.}, 10208 year = {2002}, 10209 pages = {183--200}, 10210 volume = {24}, 10211 petsc_uses = {KSP} 10212} 10213 10214@Article{ c04, 10215 author = {Feng-Nan Hwang and X.-C. Cai}, 10216 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 10217 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 10218 for incompressible {Navier-Stokes} equations}, 10219 journal = {Journal of Computational Physics}, 10220 year = {2005}, 10221 volume = {204}, 10222 pages = {666--691}, 10223 petsc_uses = {KSP} 10224} 10225 10226@Article{ hc06, 10227 author = {Feng-Nan Hwang and X.-C. Cai}, 10228 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 10229 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 10230 Algorithms}, 10231 journal = {Computer Methods in Applied Mechanics and Engineering}, 10232 year = {2006}, 10233 volume = {196}, 10234 pages = {1603--1611}, 10235 petsc_uses = {KSP} 10236} 10237 10238@InProceedings{ adams-01, 10239 author = {Mark F. Adams}, 10240 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 10241 Smoothers}, 10242 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 10243 address = {Denver, Colorado}, 10244 month = nov, 10245 year = {2001}, 10246 petsc_uses = {KSP} 10247} 10248 10249@Book{ 1dl, 10250 author = {Domenico Lahaye}, 10251 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 10252 Computations}, 10253 year = {2001}, 10254 publisher = {Katholieke Universiteit Leuven}, 10255 notes = {Thesis}, 10256 petsc_uses = {KSP} 10257} 10258 10259@Article{ adams-00, 10260 author = {Adams, M.~F.}, 10261 journal = {International Journal for Numerical Methods in Engineering}, 10262 number = {8}, 10263 pages = {1241-1262}, 10264 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 10265 Deformation Elasticity and Plasticity}, 10266 volume = {48}, 10267 year = {2000}, 10268 petsc_uses = {KSP} 10269} 10270 10271@Article{ adams2002evaluation, 10272 author = {Adams, M.~F.}, 10273 journal = {International Journal for Numerical Methods in Engineering}, 10274 number = {1}, 10275 pages = {519-534}, 10276 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 10277 Problems in Solid Mechanics}, 10278 volume = {55}, 10279 year = {2002}, 10280 petsc_uses = {KSP} 10281} 10282 10283@Article{ lahaye00, 10284 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 10285 title = {Algebraic Multigrid for Complex Symmetric Systems}, 10286 journal = {IEEEMAGN}, 10287 year = {2000}, 10288 volume = {36}, 10289 number = {4}, 10290 pages = {1535--1538}, 10291 petsc_uses = {KSP} 10292} 10293 10294@InProceedings{ adams-99c, 10295 author = {Mark F. Adams and J. Demmel}, 10296 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 10297 Finite Element Problems}, 10298 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 10299 address = {Portland, Oregon}, 10300 month = nov, 10301 year = {1999}, 10302 petsc_uses = {KSP} 10303} 10304 10305@Article{ chan95, 10306 author = {T. Chan and B. Smith and J. Zou}, 10307 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 10308 Grids}, 10309 journal = {Numer. Math.}, 10310 year = {1995}, 10311 volume = {73}, 10312 pages = {149--167}, 10313 petsc_uses = {KSP} 10314} 10315 10316@TechReport{ adams-csd-98-993, 10317 pages = {11}, 10318 year = {1998}, 10319 type = {Technical Report}, 10320 number = {CSD-98-993}, 10321 institution = {University of California, Berkeley}, 10322 title = {A Parallel Maximal Independent Set Algorithm}, 10323 bibdate = {March 11, 1998}, 10324 author = {Mark F. Adams and James Demmel}, 10325 abstract = {The parallel construction of maximal independent sets is a useful building block 10326 for many algorithms in the computational sciences, including graph coloring and 10327 multigrid coarse grid creation on unstructured meshes. We present an efficient 10328 asynchronous maximal independent set algorithm for use on parallel computers, for 10329 ``well partitioned'' graphs, that arise from finite element (FE) models. For 10330 appropriately partitioned bounded degree graphs, it is shown that the running time 10331 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 10332 improvement over the previous best P-RAM complexity for this class of graphs. We 10333 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 10334 model is indicative of the performance one can expect with practical partitions on 10335 graphs from FE problems.}, 10336 month = mar, 10337 petsc_uses = {KSP} 10338} 10339 10340@Article{ benzigolubliesen2005, 10341 title = {Numerical solution of saddle point problems}, 10342 author = {Michele Benzi and Gene H. Golub and J\"org Liesen}, 10343 volume = {14}, 10344 journal = {Acta Numerica}, 10345 pages = {1-–137}, 10346 doi = {10.1017/S0962492904000212}, 10347 year = {2005} 10348} 10349 10350@Article{ mardal2011preconditioning, 10351 title = {Preconditioning discretizations of systems of partial differential equations}, 10352 author = {Kent-Andre Mardal and Ragnar Winther}, 10353 journal = {Numerical Linear Algebra with Applications}, 10354 volume = {18}, 10355 number = {1}, 10356 pages = {1--40}, 10357 year = {2011} 10358} 10359 10360@TechReport{ k676, 10361 year = {1994}, 10362 type = {Technical Report}, 10363 number = {TR1994-676}, 10364 institution = {New York University}, 10365 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 10366 Term}, 10367 author = {Axel Klawonn}, 10368 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 10369 petsc_uses = {KSP} 10370} 10371 10372@Book{ ak1, 10373 author = {Axel Klawonn}, 10374 title = {Preconditioners for Indefinite Problems}, 10375 year = {1995}, 10376 publisher = {Westfalishen Wilhelms-Universitat Munster}, 10377 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 10378 notes = {Thesis}, 10379 petsc_uses = {KSP} 10380} 10381 10382@TechReport{ knepleykarpeev05, 10383 pages = {41}, 10384 year = {2005}, 10385 type = {Technical Report}, 10386 number = {ANL/MCS-P1295-1005}, 10387 institution = {Argonne National Laboratory}, 10388 title = {Flexible Representation of Computational Meshes}, 10389 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10390 abstract = {}, 10391 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 10392 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 10393 month = oct, 10394 petsc_uses = {DMPlex} 10395} 10396 10397@TechReport{ knepleykarpeev07a, 10398 pages = {14}, 10399 year = {2007}, 10400 type = {Technical Report}, 10401 number = {ANL/MCS-P1455-0907}, 10402 institution = {Argonne National Laboratory}, 10403 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10404 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10405 abstract = {}, 10406 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 10407 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 10408 month = feb, 10409 petsc_uses = {DMPlex} 10410} 10411 10412@Article{ knepleykarpeev09, 10413 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10414 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10415 journal = {Scientific Programming}, 10416 volume = {17}, 10417 number = {3}, 10418 pages = {215--230}, 10419 year = {2009}, 10420 doi = {10.3233/SPR-2009-0249}, 10421 url = {http://arxiv.org/abs/0908.4427}, 10422 note = {\url{http://arxiv.org/abs/0908.4427}}, 10423 petsc_uses = {DMPlex} 10424} 10425 10426@Article{ biezuner2012computing, 10427 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 10428 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 10429 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 10430 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 10431 Sublinear Supersolutions}, 10432 journal = {Journal of Scientific Computing}, 10433 publisher = {Springer Netherlands}, 10434 issn = {0885-7474}, 10435 keyword = {Mathematics and Statistics}, 10436 pages = {180--201}, 10437 volume = {52}, 10438 issue = {1}, 10439 year = {2012}, 10440 doi = {10.1007/s10915-011-9540-0}, 10441 petsc_uses = {KSP} 10442} 10443 10444% LiteralHTML: 10445% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 10446% LiteralHTML: 10447@Book{ knepley2017, 10448 title = {Computational Science I}, 10449 author = {Matthew G. Knepley}, 10450 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 10451 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 10452 publisher = {PETSc}, 10453 year = {2017}, 10454 petsc_uses = {KSP} 10455} 10456 10457@Article{ verleyeuser, 10458 title = {{User friendly permeability predicting software for technical textiles}}, 10459 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 10460 Roose, D.}, 10461 journal = {status: published}, 10462 issn = {1560-6074}, 10463 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 10464 petsc_uses = {KSP} 10465} 10466 10467@Book{ pacheco, 10468 author = {Peter Pacheco}, 10469 title = {Parallel Programming with MPI}, 10470 year = {1997}, 10471 publisher = {Morgan-Kaufmann}, 10472 note = {Devotes a couple of sections to PETSc}, 10473 petsc_uses = {KSP} 10474} 10475 10476@Book{ 1sbg, 10477 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 10478 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 10479 Differential Equations}, 10480 year = {1996}, 10481 publisher = {Cambridge University Press}, 10482 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 10483 petsc_uses = {KSP} 10484} 10485 10486@Misc{ petsc-fem:homepage, 10487 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 10488 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 10489 G. Rodriguez and G. Filippini}, 10490 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 10491 petsc_uses = {KSP} 10492} 10493 10494@Misc{ petsc4py-web-page, 10495 author = {Lisandro Dalcin}, 10496 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 10497 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 10498 note = {http://code.google.com/p/petsc4py/}, 10499 petsc_uses = {KSP} 10500} 10501 10502@Article{ libmeshpaper06, 10503 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 10504 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 10505 Simulations}}, 10506 journal = {Engineering with Computers}, 10507 volume = {22}, 10508 number = {3--4}, 10509 pages = {237--254}, 10510 year = {2006}, 10511 doi = {10.1007/s00366-006-0049-3}, 10512 petsc_uses = {KSP} 10513} 10514 10515@Misc{ sisiphus:homepage, 10516 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 10517 High-Resolution, Unstructured Simulations}, 10518 author = {T. {Tautges et al.}}, 10519 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 10520 petsc_uses = {KSP} 10521} 10522 10523@Misc{ pflotran:homepage, 10524 title = {{PFLOTRAN} project}, 10525 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 10526 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 10527 howpublished = {\url{http://pflotran.org/}}, 10528 petsc_uses = {KSP} 10529} 10530 10531@Misc{ pism:homepage, 10532 title = {{PISM}: A Parallel Ice Sheet Model}, 10533 author = {E. {Bueler et al.}}, 10534 howpublished = {\url{http://pism-docs.org}}, 10535 petsc_uses = {KSP} 10536} 10537 10538@Misc{ dohp:homepage, 10539 title = {Dohp: Dual order $hp$-finite elements}, 10540 author = {J. Brown}, 10541 howpublished = {\url{http://dohp.org}}, 10542 petsc_uses = {KSP} 10543} 10544 10545@Article{ mccourtrognlienetal12, 10546 title = {Improving parallel scalability for edge plasma transport simulations with neutral 10547 gas species}, 10548 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 10549 journal = {Computational Science and Discovery}, 10550 year = {2012}, 10551 volume = {5}, 10552 number = {014012}, 10553 doi = {10.1088/1749-4699/5/1/014012}, 10554 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 10555 2011)}, 10556 petsc_uses = {KSP} 10557} 10558 10559@Misc{ petclaw-github, 10560 title = {Pet{C}law Software}, 10561 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 10562 year = {2011}, 10563 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 10564 petsc_uses = {KSP} 10565} 10566 10567@Misc{ pyclaw-web-page, 10568 author = {Kyle T. Mandli and David I. Ketcheson and others}, 10569 title = {{PyClaw} software}, 10570 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 10571 url = {http://clawpack.github.io/doc/pyclaw/}, 10572 year = {2012}, 10573 petsc_uses = {KSP} 10574} 10575 10576@Article{ ketcheson2011highorder, 10577 title = {High-order wave propagation algorithms for general hyperbolic systems}, 10578 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 10579 year = {2011}, 10580 note = {submitted}, 10581 petsc_uses = {KSP} 10582} 10583 10584@Article{ biros2005pln1, 10585 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 10586 optimization. Part I: The {Krylov-Schur} solver}}, 10587 author = {Biros, G. and Ghattas, O.}, 10588 journal = {SIAM Journal on Scientific Computing}, 10589 volume = {27}, 10590 number = {2}, 10591 pages = {687--713}, 10592 year = {2005}, 10593 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10594 petsc_uses = {KSP} 10595} 10596 10597@Article{ biros2005pln2, 10598 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 10599 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 10600 optimal control of steady viscous flows}, 10601 author = {Biros, G. and Ghattas, O.}, 10602 journal = {SIAM Journal on Scientific Computing}, 10603 volume = {27}, 10604 number = {2}, 10605 pages = {714--739}, 10606 year = {2005}, 10607 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10608 petsc_uses = {KSP} 10609} 10610 10611@Misc{ issm:homepage, 10612 title = {{I}ce {S}heet {S}ystem {M}odel}, 10613 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 10614 year = {2010}, 10615 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 10616 petsc_uses = {KSP} 10617} 10618 10619@Article{ morlighem2010spatial, 10620 title = {Spatial patterns of basal drag inferred using control methods from a 10621 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 10622 {A}ntarctica}, 10623 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 10624 Aubry, D.}, 10625 journal = {Geophysical Research Letters}, 10626 volume = {37}, 10627 number = {14}, 10628 pages = {L14502}, 10629 year = {2010}, 10630 publisher = {American Geophysical Union}, 10631 petsc_uses = {KSP} 10632} 10633 10634@Article{ jardin2012plasmas, 10635 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 10636 of tokamak plasmas}, 10637 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 10638 journal = {Computational Science \& Discovery}, 10639 volume = {5}, 10640 number = {1}, 10641 url = {http://stacks.iop.org/1749-4699/5/014002}, 10642 year = {2012}, 10643 petsc_uses = {KSP} 10644} 10645 10646@Article{ cmz2016, 10647 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10648 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 10649 journal = {Journal of Scientific Computing}, 10650 publisher = {Springer}, 10651 pages = {803--825}, 10652 volume = {68}, 10653 issue = {2}, 10654 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 10655 doi = {10.1007/s10915-015-0159-4}, 10656 year = {2016}, 10657 note = {Also preprint ANL/MCS-P3039-0912}, 10658 petsc_uses = {KSP} 10659} 10660 10661@Article{ knepleybrownruppsmith13, 10662 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 10663 title = {Achieving High Performance with Unified Residual Evaluation}, 10664 journal = {ArXiv e-prints}, 10665 eprint = {1309.1204}, 10666 archiveprefix = {arXiv}, 10667 primaryclass = {cs.MS}, 10668 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 10669 Engineering, Finance, and Science}, 10670 year = {2013}, 10671 month = sep, 10672 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 10673 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10674 petsc_uses = {KSP} 10675} 10676 10677@Book{ fenicsbook, 10678 title = {Automated Solution of Differential Equations by the Finite Element Method: The 10679 FEniCS Book}, 10680 series = {Lecture Notes in Computational Science and Engineering}, 10681 volume = {84}, 10682 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 10683 publisher = {Springer}, 10684 isbn = {978-3-642-23098-1}, 10685 year = {2012}, 10686 petsc_uses = {KSP} 10687} 10688 10689@Article{ demidovahnertruppgottschling12, 10690 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 10691 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 10692 journal = {ArXiv e-prints}, 10693 archiveprefix = {arXiv}, 10694 eprint = {1212.6326}, 10695 primaryclass = {cs.MS}, 10696 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 10697 Parallel, and Cluster Computing, Physics - Computational Physics}, 10698 year = {2012}, 10699 month = dec, 10700 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 10701 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10702 petsc_uses = {KSP} 10703} 10704 10705@InProceedings{ viennacl, 10706 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 10707 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 10708 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 10709 year = {2010}, 10710 pages = {51-56}, 10711 petsc_uses = {KSP} 10712} 10713 10714@Article{ knepleybrownmcinnessmithruppadams2015, 10715 title = {Exascale Computing without Threads}, 10716 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10717 Karl Rupp and Mark Adams}, 10718 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 10719 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10720 Scientific Software Architecture for Portability and Performance}, 10721 doi = {10.6084/m9.figshare.5824950.v1}, 10722 year = {2015}, 10723 petsc_uses = {KSP} 10724} 10725 10726@Article{ knepleybrownmcinnessmithruppadams2015b, 10727 title = {Overview of the {PETSc} Library}, 10728 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10729 Karl Rupp and Mark Adams}, 10730 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 10731 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10732 Scientific Software Architecture for Portability and Performance}, 10733 year = {2015}, 10734 petsc_uses = {KSP} 10735} 10736 10737@InCollection{ balaybrownknepleymcinnessmith2015, 10738 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 10739 Smith}, 10740 title = {Providing Mixed Language and Legacy Support within a Library}, 10741 editor = {J. Carver}, 10742 booktitle = {Software Engineering for Science}, 10743 publisher = {Taylor \& Francis}, 10744 year = {2015}, 10745 petsc_uses = {KSP} 10746} 10747 10748@Article{ ruppbalaybrownknepleymcinnessmith2015, 10749 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 10750 Software}, 10751 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 10752 McInnes and Barry F. Smith}, 10753 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 10754 Productivity Challenges}, 10755 journal = {ArXiv e-prints}, 10756 archiveprefix = {arXiv}, 10757 eprint = {1510.01122}, 10758 year = {2015}, 10759 petsc_uses = {KSP} 10760} 10761 10762@InProceedings{ knepley2013accurately, 10763 title = {Accurately Citing Software and Algorithms Used in Publications}, 10764 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 10765 F.}, 10766 year = {2013}, 10767 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10768 (WSSSPE), held at SC13}, 10769 doi = {10.6084/m9.figshare.785731}, 10770 petsc_uses = {KSP} 10771} 10772 10773@InProceedings{ milleretal2013, 10774 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 10775 Strategies Developed for {FASTMath}}, 10776 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 10777 Barry Smith}, 10778 year = {2013}, 10779 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10780 (WSSSPE), held at SC13}, 10781 doi = {10.6084/m9.figshare.789055}, 10782 petsc_uses = {KSP} 10783} 10784 10785@TechReport{ dudsonetal2012, 10786 title = {Improved Nonlinear Solvers in {BOUT++}}, 10787 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 10788 institution = {Argonne National Laboratory}, 10789 number = {ANL/MCS-P3025-0812}, 10790 year = {2012}, 10791 petsc_uses = {KSP} 10792} 10793 10794@Misc{ brown13, 10795 author = {J. Brown}, 10796 title = {Scalable Repository Workflows}, 10797 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10798 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10799 year = {2013}, 10800 petsc_uses = {KSP} 10801} 10802 10803@Misc{ starforest11, 10804 title = {Star forests as a parallel communication model}, 10805 author = {Jed Brown}, 10806 url = {https://jedbrown.org/files/StarForest.pdf}, 10807 year = {2011}, 10808 petsc_uses = {KSP} 10809} 10810 10811@Misc{ brownknepleysmith13, 10812 author = {J. Brown and M. Knepley and B. Smith}, 10813 title = {Run-time Extensibility: Anything Less is Unsustainable}, 10814 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10815 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10816 year = {2013}, 10817 petsc_uses = {KSP} 10818} 10819 10820@Article{ jzhaoyliwkliu15, 10821 author = {J. Zhao and Y. Li and W.K. Liu}, 10822 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 10823 via {XFEM}}, 10824 journal = {Computational Mechanics}, 10825 year = {2015}, 10826 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 10827 petsc_uses = {KSP} 10828} 10829 10830@Article{ alisic14, 10831 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 10832 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 10833 journal = {J. Geophys. Res.}, 10834 year = {2014}, 10835 volume = {119}, 10836 number = {7}, 10837 pages = {5903-5920}, 10838 doi = {10.1002/2013JB010906}, 10839 petsc_uses = {KSP} 10840} 10841 10842@Article{ rhebergen14, 10843 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 10844 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 10845 journal = {SIAM J. Sci. Comp.}, 10846 year = {2014}, 10847 volume = {36}, 10848 number = {4}, 10849 pages = {1960-1977}, 10850 doi = {10.1137/130946678}, 10851 petsc_uses = {KSP} 10852} 10853 10854@Article{ allwright14, 10855 author = {J. Allwright and R.F. Katz}, 10856 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 10857 journal = {Geophys. J. Int.}, 10858 year = {2014}, 10859 volume = {199}, 10860 number = {3}, 10861 pages = {1608--1624}, 10862 doi = {10.1093/gji/ggu345}, 10863 petsc_uses = {KSP} 10864} 10865 10866@Misc{ gropp10, 10867 author = {William D. Gropp}, 10868 title = {Update on libraries for {B}lue {W}aters}, 10869 address = {Bordeaux, France}, 10870 year = {2010}, 10871 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 10872 petsc_uses = {KSP} 10873} 10874 10875@InProceedings{ mayknepley2017, 10876 title = {{DMSwarm}: Particles in {PETSc}}, 10877 author = {Dave A May and Matthew G Knepley}, 10878 booktitle = {EGU General Assembly Conference Abstracts}, 10879 volume = {19}, 10880 pages = {10133}, 10881 year = {2017}, 10882 petsc_uses = {KSP} 10883} 10884 10885@InProceedings{ adamsbrownknepley2013, 10886 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 10887 title = {Low-communication techniques for extreme-scale multilevel solvers}, 10888 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 10889 organization = {DOE Office of Advanced Scientific Computing Research}, 10890 year = {2013}, 10891 petsc_uses = {KSP} 10892} 10893 10894@Article{ bhallagriffithknepleyadamsguy2017, 10895 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 10896 boundary equations}, 10897 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 10898 Adams and Robert D. Guy}, 10899 journal = {arXiv e-prints}, 10900 eprint = {1612.02208}, 10901 year = {2017}, 10902 note = {\url{http://arxiv.org/abs/1612.02208}}, 10903 petsc_uses = {KSP} 10904} 10905 10906@Article{ zampini2016pcbddc, 10907 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 10908 author = {Zampini, Stefano}, 10909 journal = {SIAM Journal on Scientific Computing}, 10910 volume = {38}, 10911 number = {5}, 10912 pages = {S282--S306}, 10913 year = {2016}, 10914 publisher = {SIAM}, 10915 petsc_uses = {KSP} 10916} 10917 10918@Article{ jolivetromanzampini2020, 10919 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 10920 robust multilevel overlapping {Schwarz} preconditioners}, 10921 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 10922 journal = {Computers and Mathematics with Applications}, 10923 volume = {84}, 10924 pages = {277--295}, 10925 year = {2021} 10926} 10927 10928@Article{ zampinitu2017, 10929 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 10930 porous media}, 10931 author = {Stefano Zampini and Xuemin Tu}, 10932 journal = {SIAM Journal of Scientific Computing}, 10933 volume = {39}, 10934 number = {4}, 10935 pages = {A1389--A1415}, 10936 year = {2017} 10937} 10938 10939@Article{ ohwidlundzampinidohrmann2017, 10940 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 10941 constraints for {Raviart-Thomas} vector fields}, 10942 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 10943 journal = {Mathematics of Computation}, 10944 volume = {87}, 10945 number = {310}, 10946 pages = {659--692}, 10947 year = {2017} 10948} 10949 10950@Article{ veigapavarinoscacchiwidlundzampini2016, 10951 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 10952 preconditioners}, 10953 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 10954 Stefano Zampini}, 10955 journal = {SIAM Journal of Scientific Computing}, 10956 volume = {39}, 10957 number = {1}, 10958 pages = {A281--A302}, 10959 year = {2016} 10960} 10961 10962@Article{ pavarinoscacchiwidlundzampini2018, 10963 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 10964 analysis}, 10965 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 10966 journal = {Mathematical Models and Methods in Applied Sciences}, 10967 volume = {28}, 10968 number = {7}, 10969 pages = {1337--1370}, 10970 year = {2018} 10971} 10972 10973@Article{ bergervergiatwaisman2017, 10974 title = {An overlapping Domain Decomposition preconditioning method for monolithic 10975 solution of shear bands}, 10976 author = {Luc Berger-Vergiat and Haim Waisman}, 10977 journal = {Computer Methods in Applied Mechanics and Engineering}, 10978 volume = {318}, 10979 pages = {33--60}, 10980 year = {2017}, 10981 petsc_uses = {KSP} 10982} 10983 10984@Article{ abhyankarmaldonadosmithzhang2020, 10985 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 10986 Simulations}, 10987 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 10988 H. Zhang}, 10989 journal = {ACM Transactions on Mathematical Software}, 10990 volume = {46}, 10991 number = {1}, 10992 year = {2020}, 10993 doi = {10.1145/3344587}, 10994 petsc_uses = {KSP} 10995} 10996 10997@InProceedings{ zhangellpack2018, 10998 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 10999 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 11000 {AVX-512}}, 11001 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 11002 year = {2018}, 11003 petsc_uses = {KSP} 11004} 11005 11006@Misc{ petsc-user-meetings:website, 11007 title = {{PETSc User Meetings}}, 11008 key = {PETSc User Meetings}, 11009 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 11010 petsc_uses = {KSP} 11011} 11012 11013@Article{ flexible-bicgstab-chen16, 11014 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 11015 author = {J. Chen and L.C. McInnes and H. Zhang}, 11016 journal = {Journal of Scientific Computing}, 11017 volume = {68}, 11018 number = {2}, 11019 month = jul, 11020 year = {2016}, 11021 pages = {803--825}, 11022 doi = {10.1007/s10915-015-0159-4}, 11023 petsc_uses = {KSP} 11024} 11025 11026@Misc{ petsc-extensibility2016, 11027 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 11028 title = {{Extensibility in PETSc}}, 11029 note = {SIAM News, available via 11030 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 11031 year = {2016}, 11032 petsc_uses = {KSP} 11033} 11034 11035@Misc{ error-estimation-whitepaper2017, 11036 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 11037 title = {End-to-end error estimation and control}, 11038 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 11039 doi = {10.6084/m9.figshare.5339866}, 11040 year = {2017}, 11041 petsc_uses = {KSP} 11042} 11043 11044@Misc{ petsc-user-support15, 11045 title = {On the Evolution of User Support Topics in Computational Science and Engineering 11046 Software}, 11047 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 11048 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 11049 15-16, 2015}, 11050 year = {2015}, 11051 petsc_uses = {KSP} 11052} 11053 11054@InBook{ petsc-mixed-language-support2016, 11055 title = {Numerical Library Support for High-Performance Mixed Language Applications and 11056 Legacy Code}, 11057 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 11058 booktitle = {Software Engineering for Science}, 11059 editors = {J. Carver et al.}, 11060 publisher = {CRC Press}, 11061 pages = {201--214}, 11062 year = {2016}, 11063 petsc_uses = {KSP} 11064} 11065 11066@InProceedings{ konolige2018parallel, 11067 title = {A Parallel Solver for Graph {L}aplacians}, 11068 author = {Tristan Konolige and Jed Brown}, 11069 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 11070 doi = {10.1145/3218176.3218227}, 11071 note = {Best Paper Award}, 11072 archiveprefix = {arXiv}, 11073 eprint = {1705.06266}, 11074 year = {2018}, 11075 petsc_uses = {KSP} 11076} 11077 11078@InProceedings{ werner-kimn2019, 11079 title = {Parallel implementation of {AC} optimal power flow and time-constrained optimal 11080 power flow using high-performance computing}, 11081 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 11082 Jung-Han Kimn}, 11083 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 11084 note = {Best Paper in Track}, 11085 year = {2019}, 11086 petsc_uses = {KSP} 11087} 11088 11089@MastersThesis{ rinaldo-ceresoli18, 11090 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 11091 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 11092 Applications}, 11093 school = {Politecnico di Milano}, 11094 year = {2018}, 11095 month = apr, 11096 petsc_uses = {KSP} 11097} 11098 11099@Article{ sananschneppmay2016, 11100 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 11101 author = {P. Sanan and S. M. Schnepp and D. A. May}, 11102 journal = {SIAM Journal on Scientific Computing}, 11103 volume = {38}, 11104 number = {5}, 11105 pages = {C441-C470}, 11106 year = {2016}, 11107 doi = {10.1137/15M1049130}, 11108 petsc_uses = {KSP} 11109} 11110 11111@Article{ petscsf2022, 11112 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 11113 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 11114 Smith, Barry F. and Zampini, Stefano}, 11115 journal = {IEEE Transactions on Parallel and Distributed Systems}, 11116 title = {The {PetscSF} Scalable Communication Layer}, 11117 year = {2022}, 11118 volume = {33}, 11119 number = {4}, 11120 pages = {842-853}, 11121 doi = {10.1109/TPDS.2021.3084070} 11122} 11123 11124@Article{ brandt2000, 11125 title = {General highly accurate algebraic coarsening}, 11126 author = {Achi Brandt}, 11127 journal = {Electronic Transactions on Numerical Analysis}, 11128 volume = {10}, 11129 number = {9680}, 11130 pages = {1--20}, 11131 issn = {10689613}, 11132 year = {2000} 11133} 11134 11135@Article{ dalcinpazklercosimo2011, 11136 title = {Parallel distributed computing using Python}, 11137 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 11138 journal = {Advances in Water Resources}, 11139 volume = {34}, 11140 number = {9}, 11141 pages = {1124 - 1139}, 11142 note = {New Computational Methods and Software Tools}, 11143 issn = {0309-1708}, 11144 doi = {10.1016/j.advwatres.2011.04.013}, 11145 year = {2011} 11146} 11147 11148@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 11149 title = {Cython: The Best of Both Worlds}, 11150 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 11151 Seljebotn,Dag Sverre and Smith,Kurt }, 11152 journal = {Computing in Science \& Engineering}, 11153 volume = {13}, 11154 number = {2}, 11155 pages = {31-39}, 11156 doi = {10.1109/MCSE.2010.118}, 11157 year = {2011} 11158} 11159 11160@Article{ dalcinpazstorti2005, 11161 title = {MPI for Python}, 11162 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 11163 journal = {Journal of Parallel and Distributed Computing}, 11164 volume = {65}, 11165 number = {9}, 11166 pages = {1108 - 1115}, 11167 issn = {0743-7315}, 11168 doi = {10.1016/j.jpdc.2005.03.010}, 11169 year = {2005} 11170} 11171 11172@Article{ dalcincolliervignalcortescalo2016, 11173 title = {PetIGA: A framework for high-performance isogeometric analysis}, 11174 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 11175 Calo}, 11176 journal = {Computer Methods in Applied Mechanics and Engineering}, 11177 volume = {308}, 11178 pages = {151 - 181}, 11179 issn = {0045-7825}, 11180 doi = {10.1016/j.cma.2016.05.011}, 11181 year = {2016} 11182} 11183 11184@Article{ collierpardodalcinpaszynskicalo2012, 11185 title = {The cost of continuity: A study of the performance of isogeometric finite 11186 elements using direct solvers}, 11187 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 11188 Calo}, 11189 journal = {Computer Methods in Applied Mechanics and Engineering}, 11190 volume = {213-216}, 11191 pages = {353 - 361}, 11192 issn = {0045-7825}, 11193 doi = {10.1016/j.cma.2011.11.002}, 11194 year = {2012} 11195} 11196 11197@Article{ collierdalcinpardocalo2013, 11198 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 11199 Elements}, 11200 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 11201 journal = {SIAM Journal on Scientific Computing}, 11202 volume = {35}, 11203 number = {2}, 11204 pages = {A767-A784}, 11205 doi = {10.1137/120881038}, 11206 year = {2013} 11207} 11208 11209@Article{ dunning2017jump, 11210 title = {{JuMP}: a modeling language for mathematical optimization}, 11211 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 11212 journal = {SIAM Review}, 11213 volume = {59}, 11214 number = {2}, 11215 pages = {295--320}, 11216 year = {2017}, 11217 publisher = {SIAM} 11218} 11219 11220@InProceedings{ prudencioschulz2011, 11221 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 11222 Estimation, Simulation and Optimization}, 11223 author = {Ernesto E Prudencio and Karl W Schulz}, 11224 booktitle = {European Conference on Parallel Processing}, 11225 pages = {398--407}, 11226 year = {2011} 11227} 11228 11229@Misc{ rol-website, 11230 key = {ROL}, 11231 title = {{Rapid Optimization Library} Website}, 11232 howpublished = {\url{https://trilinos.org/packages/rol}}, 11233 year = {2018} 11234} 11235 11236@Article{ more1994line, 11237 title = {Line search algorithms with guaranteed sufficient decrease}, 11238 author = {Mor{\'e}, Jorge J and Thuente, David J}, 11239 journal = {ACM Transactions on Mathematical Software}, 11240 volume = {20}, 11241 number = {3}, 11242 pages = {286--307}, 11243 year = {1994}, 11244 publisher = {ACM} 11245} 11246 11247@Article{ griewank2000algorithm, 11248 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 11249 adjoint mode of computational differentiation}, 11250 author = {Griewank, Andreas and Walther, Andrea}, 11251 journal = {ACM Transactions on Mathematical Software}, 11252 volume = {26}, 11253 number = {1}, 11254 pages = {19--45}, 11255 year = {2000}, 11256 publisher = {ACM} 11257} 11258 11259@Article{ metcalf2011seven, 11260 title = {The seven ages of fortran}, 11261 author = {Metcalf, Michael}, 11262 journal = {Journal of Computer Science \& Technology}, 11263 volume = {11}, 11264 year = {2011} 11265} 11266 11267@Article{ giraldo_2013, 11268 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 11269 model of the atmosphere {(NUMA)}}, 11270 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 11271 journal = {SIAM Journal on Scientific Computing}, 11272 year = {2013}, 11273 number = {5}, 11274 pages = {B1162-B1194}, 11275 volume = {35}, 11276 doi = {10.1137/120876034} 11277} 11278 11279@Article{ constantinescu_tr2016b, 11280 author = {Constantinescu, E.M.}, 11281 title = {Estimating Global Errors in Time Stepping}, 11282 journal = {ArXiv e-prints}, 11283 archiveprefix = {arXiv}, 11284 eprint = {1503.05166}, 11285 primaryclass = {math.NA}, 11286 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 11287 year = {2016}, 11288 month = mar, 11289 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 11290 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 11291} 11292 11293@Article{ pareschi_2005, 11294 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 11295 with Relaxation}, 11296 author = {L. Pareschi and G. Russo}, 11297 journal = {Journal of Scientific Computing}, 11298 year = {2005}, 11299 number = {1}, 11300 pages = {129--155}, 11301 volume = {25} 11302} 11303 11304@Article{ kennedy_2003, 11305 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 11306 author = {C.A. Kennedy and M.H. Carpenter}, 11307 journal = {Appl. Numer. Math.}, 11308 year = {2003}, 11309 number = {1-2}, 11310 pages = {139--181}, 11311 volume = {44}, 11312 doi = {10.1016/S0168-9274(02)00138-1}, 11313 publisher = {Elsevier Science Publishers B. V.} 11314} 11315 11316@Unpublished{ boscarino_tr2011, 11317 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 11318 equations in the diffusion limit}, 11319 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 11320 note = {Arxiv preprint arXiv:1110.4375}, 11321 year = {2011} 11322} 11323 11324@Article{ ascher_1997, 11325 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 11326 equations}, 11327 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 11328 journal = {Applied Numerical Mathematics}, 11329 year = {1997}, 11330 pages = {151--167}, 11331 volume = {25} 11332} 11333 11334@Book{ ascherpetzold1998, 11335 title = {Computer methods for ordinary differential equations and differential-algebraic 11336 equations}, 11337 author = {Uri M Ascher and Linda R Petzold}, 11338 volume = {61}, 11339 publisher = {SIAM}, 11340 year = {1998} 11341} 11342 11343@Article{ colomesbadia2016, 11344 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 11345 equations}, 11346 author = {Oriol Colom{\'e}s and Santiago Badia}, 11347 journal = {International Journal for Numerical Methods in Engineering}, 11348 volume = {105}, 11349 number = {5}, 11350 pages = {372--400}, 11351 year = {2016} 11352} 11353 11354@Article{ sandu_1997, 11355 title = {Benchmarking stiff {ODE} solvers for atmospheric chemistry problems {II}: 11356 {R}osenbrock solvers}, 11357 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 11358 Potra}, 11359 journal = {Atmospheric Environment}, 11360 year = {1997}, 11361 number = {20}, 11362 pages = {3459--3472}, 11363 volume = {31}, 11364 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 11365 task is the integration of the stiff systems of ordinary differential equations 11366 describing the chemical transformations. It is therefore of interest to 11367 systematically search for stiff solvers which can be identified as close to 11368 optimal for atmospheric applications. In this paper we continue our investigation 11369 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 11370 and compare eight solvers on a set of seven box-models used in present day models. 11371 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 11372 application when they are provided with highly efficient sparse matrix techniques 11373 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 11374 the literature, viz. and 4, and two are new and specially developed for air 11375 quality applications, viz. 3 and 3. } 11376} 11377 11378@Article{ rang_2005, 11379 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 11380 equations of index 1}, 11381 author = {Rang, J. and Angermann, L.}, 11382 journal = {BIT Numerical Mathematics}, 11383 year = {2005}, 11384 number = {4}, 11385 pages = {761--787}, 11386 volume = {45}, 11387 publisher = {Springer}, 11388 doi = {10.1007/s10543-005-0035-y} 11389} 11390 11391@article{rang2015improved, 11392 title = {Improved traditional {R}osenbrock--{W}anner methods for stiff {ODE}s and {DAE}s}, 11393 author = {Rang, Joachim}, 11394 journal = {Journal of Computational and Applied Mathematics}, 11395 volume = {286}, 11396 pages = {128--144}, 11397 year = {2015}, 11398 publisher = {Elsevier}, 11399 doi = {10.1016/j.cam.2015.03.010} 11400} 11401 11402@Article{ gottliebketchesonshu2009, 11403 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 11404 title = {{High order strong stability preserving time discretizations}}, 11405 journal = {Journal of Scientific Computing}, 11406 volume = {38}, 11407 number = {3}, 11408 pages = {251--289}, 11409 doi = {10.1007/s10915-008-9239-z}, 11410 year = {2009} 11411} 11412 11413@Article{ ZhouGuoShu2001, 11414 title = {Numerical study on Landau damping}, 11415 author = {Tie Zhou and Yan Guo and Chi Wang Shu}, 11416 journal = {Physica D: Nonlinear Phenomena}, 11417 volume = {157}, 11418 issue = {4}, 11419 pages = {322-333}, 11420 doi = {10.1016/S0167-2789(01)00289-5}, 11421 issn = {01672789}, 11422 year = {2001} 11423} 11424 11425@Article{ ketcheson_2008, 11426 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 11427 Low-Storage Implementations}, 11428 author = {D.I. Ketcheson}, 11429 journal = {SIAM Journal on Scientific Computing}, 11430 year = {2008}, 11431 number = {4}, 11432 pages = {2113--2136}, 11433 volume = {30}, 11434 doi = {10.1137/07070485X}, 11435 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 11436 RungeKutta methods}, 11437 publisher = {SIAM} 11438} 11439 11440@Article{ jansen_2000, 11441 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 11442 equations with a stabilized finite element method}, 11443 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 11444 journal = {Computer Methods in Applied Mechanics and Engineering}, 11445 year = {2000}, 11446 number = {3}, 11447 pages = {305--319}, 11448 volume = {190}, 11449 publisher = {Elsevier} 11450} 11451 11452@Article{ butcher_2007, 11453 title = {Error propagation of general linear methods for ordinary differential equations}, 11454 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 11455 journal = {Journal of Complexity}, 11456 year = {2007}, 11457 number = {4-6}, 11458 pages = {560--580}, 11459 volume = {23}, 11460 abstract = {We discuss error propagation for general linear methods for ordinary differential 11461 equations up to terms of order p+2, where p is the order of the method. These 11462 results are then applied to the estimation of local discretization errors for 11463 methods of order p and for the adjacent order p+1. The results of numerical 11464 experiments confirm the reliability of these estimates. This research has 11465 applications in the design of robust stepsize and order changing strategies for 11466 algorithms based on general linear methods.}, 11467 doi = {10.1016/j.jco.2007.01.009}, 11468 issn = {0885-064X} 11469} 11470 11471@Article{ constantinescu_a2010a, 11472 title = {Extrapolated implicit-explicit time stepping}, 11473 author = {E.M. Constantinescu and A. Sandu}, 11474 journal = {SIAM Journal on Scientific Computing}, 11475 year = {2010}, 11476 number = {6}, 11477 pages = {4452-4477}, 11478 volume = {31}, 11479 comment = {Preprint \# ANL/MCS-P1612-0409}, 11480 doi = {10.1137/080732833} 11481} 11482 11483@InProceedings{ devito2011liszt, 11484 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 11485 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 11486 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 11487 Aiken, Alex and Duraisamy, Karthik and others}, 11488 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 11489 Networking, Storage and Analysis}, 11490 pages = {9}, 11491 year = {2011}, 11492 organization = {ACM} 11493} 11494 11495@Article{ devito2011designing, 11496 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 11497 author = {DeVito, Zachary and Hanrahan, Pat}, 11498 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 11499 year = {2011} 11500} 11501 11502@Misc{ pgasintro, 11503 author = {Tim Stitt}, 11504 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 11505 Model}, 11506 note = {\url{http://cnx.org/content/m20649/latest/}} 11507} 11508 11509@InProceedings{ el2006upc, 11510 title = {UPC: unified parallel C}, 11511 author = {El-Ghazawi, Tarek and Smith, Lauren}, 11512 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 11513 pages = {27}, 11514 year = {2006}, 11515 organization = {ACM} 11516} 11517 11518@InProceedings{ numrich1998co, 11519 title = {Co-Array Fortran for parallel programming}, 11520 author = {Numrich, Robert W and Reid, John}, 11521 booktitle = {ACM Sigplan Fortran Forum}, 11522 volume = {17}, 11523 number = {2}, 11524 pages = {1--31}, 11525 year = {1998}, 11526 organization = {ACM} 11527} 11528 11529@Article{ aiken1997titanium, 11530 title = {Titanium: A high-performance Java dialect}, 11531 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 11532 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 11533 Geoff and Semenzato, Luigi and others}, 11534 year = {1997} 11535} 11536 11537@Article{ charles2005x10, 11538 title = {X10: an object-oriented approach to non-uniform cluster computing}, 11539 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 11540 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 11541 Sarkar, Vivek}, 11542 journal = {Acm Sigplan Notices}, 11543 volume = {40}, 11544 number = {10}, 11545 pages = {519--538}, 11546 year = {2005}, 11547 publisher = {ACM} 11548} 11549 11550@Article{ chamberlain2007parallel, 11551 title = {Parallel programmability and the chapel language}, 11552 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 11553 journal = {International Journal of High Performance Computing Applications}, 11554 volume = {21}, 11555 number = {3}, 11556 pages = {291--312}, 11557 year = {2007}, 11558 publisher = {SAGE Publications} 11559} 11560 11561@InProceedings{ charmppoopsla93, 11562 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 11563 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 11564 editor = {Paepcke, A.}, 11565 fulleditor = {Paepcke, Andreas}, 11566 pages = {91--108}, 11567 month = sep, 11568 year = {1993}, 11569 booktitle = {{Proceedings of OOPSLA'93}}, 11570 publisher = {{ACM Press}} 11571} 11572 11573@InProceedings{ hewitt1973universal, 11574 title = {A universal modular actor formalism for artificial intelligence}, 11575 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 11576 booktitle = {Proceedings of the 3rd international joint conference on Artificial 11577 intelligence}, 11578 pages = {235--245}, 11579 year = {1973}, 11580 organization = {Morgan Kaufmann Publishers Inc.} 11581} 11582 11583@Book{ yonezawa1990abcl, 11584 title = {ABCL: an object-oriented concurrent system}, 11585 author = {Yonezawa, Akinori}, 11586 year = {1990}, 11587 publisher = {MIT press} 11588} 11589 11590@InProceedings{ dally1988object, 11591 title = {Object-oriented concurrent programming in CST}, 11592 author = {Dally, William J and Chien, Andrew A}, 11593 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 11594 applications: Architecture, software, computer systems, and general issues-Volume 11595 1}, 11596 pages = {434--439}, 11597 year = {1988}, 11598 organization = {ACM} 11599} 11600 11601@Article{ grimshaw1993easy, 11602 title = {Easy-to-use object-oriented parallel processing with Mentat}, 11603 author = {Grimshaw, Andrew S.}, 11604 journal = {Computer}, 11605 volume = {26}, 11606 number = {5}, 11607 pages = {39--51}, 11608 year = {1993}, 11609 publisher = {IEEE} 11610} 11611 11612@InProceedings{ gannon1991object, 11613 title = {Object oriented parallelism: pC++ ideas and experiments}, 11614 author = {Gannon, Dennis and Lee, JK}, 11615 booktitle = {Proceedings of}, 11616 pages = {13--23}, 11617 year = {1991} 11618} 11619 11620@InProceedings{ lau1992object, 11621 title = {An object-oriented class library for scalable parallel heuristic search}, 11622 author = {Lau, Wing-cheong and Singh, Vineet}, 11623 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 11624 pages = {252--267}, 11625 year = {1992}, 11626 organization = {Springer} 11627} 11628 11629@Book{ chase1989amber, 11630 title = {The Amber system: Parallel programming on a network of multiprocessors}, 11631 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 11632 Littlefield, Richard}, 11633 volume = {23}, 11634 number = {5}, 11635 year = {1989}, 11636 publisher = {ACM} 11637} 11638 11639@InProceedings{ kaiser2009parallex, 11640 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 11641 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 11642 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 11643 pages = {394--401}, 11644 year = {2009}, 11645 organization = {IEEE} 11646} 11647 11648@TechReport{ ipm, 11649 author = {Barry F. Smith}, 11650 title = {A New Parallel Programming Model for Computer Simulation}, 11651 institution = {Argonne National Laboratory}, 11652 year = {2014}, 11653 number = {ANL/MCS-P5135-0414} 11654} 11655 11656@Article{ groppsnir, 11657 author = {William Gropp and Marc Snir}, 11658 title = {Programming for Exascale Computers}, 11659 journal = {Computing in Science and Engineering}, 11660 volume = {15}, 11661 number = {6}, 11662 issn = {1521-9615}, 11663 year = {2013}, 11664 pages = {27-35}, 11665 doi = {10.1109/MCSE.2013.96}, 11666 publisher = {IEEE Computer Society}, 11667 address = {Los Alamitos, CA} 11668} 11669 11670@Book{ mpi3, 11671 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 11672 author = {Message Passing Interface Forum}, 11673 year = {2012}, 11674 publisher = {High Performance Computing Center Stuttgart (HLRS)} 11675} 11676 11677@Book{ openmp4, 11678 title = {OpenMP Application Program Interface, Version 4.0}, 11679 year = {2013}, 11680 publisher = {OpenMP Architecture Review Board} 11681} 11682 11683@InProceedings{ hartono2009annotation, 11684 title = {Annotation-based empirical performance tuning using {Orio}}, 11685 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 11686 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 11687 Symposium on}, 11688 pages = {1--11}, 11689 year = {2009}, 11690 organization = {IEEE} 11691} 11692 11693@Book{ toselli2005domain, 11694 title = {Domain Decomposition Methods: Algorithms and Theory}, 11695 author = {Toselli, Andrea and Widlund, Olof B}, 11696 volume = {34}, 11697 year = {2005}, 11698 publisher = {Springer} 11699} 11700 11701@InBook{ st2016, 11702 author = {Barry F. Smith and Xumin Tu}, 11703 chapter = {Domain Decomposition}, 11704 title = {Encyclopedia of Applied and Computational Mathematics}, 11705 bookeditor = {B. Engquist}, 11706 publisher = {Springer}, 11707 pages = {375--381}, 11708 year = {2016} 11709} 11710 11711@TechReport{ saws, 11712 author = {Matt Otten and Jed Brown and Barry F. Smith}, 11713 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 11714 institution = {Argonne National Laboratory}, 11715 year = {2013} 11716} 11717 11718@Article{ smith1997domain, 11719 title = {Domain Decomposition Methods for Partial Differential Equations}, 11720 author = {Smith, B.F.}, 11721 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 11722 volume = {4}, 11723 pages = {225--244}, 11724 year = {1997}, 11725 publisher = {Citeseer} 11726} 11727 11728@Article{ spillane2011abstract, 11729 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 11730 in the overlaps}, 11731 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 11732 Scheichl, R}, 11733 journal = {NuMa-Report}, 11734 volume = {7}, 11735 pages = {2007}, 11736 year = {2011} 11737} 11738 11739@InProceedings{ jolivet2013scalabledd, 11740 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 11741 problems}, 11742 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 11743 Prud'homme, Christophe}, 11744 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 11745 Networking, Storage and Analysis}, 11746 pages = {80}, 11747 year = {2013}, 11748 organization = {ACM} 11749} 11750 11751@Book{ ks2000, 11752 author = {D. Kinderlehrer and G. Stampacchia}, 11753 publisher = {Society for Industrial Mathematics}, 11754 title = {An Introduction to Variational Inequalities and Their Applications}, 11755 year = {2000} 11756} 11757 11758@Article{ wan2000energy, 11759 title = {An energy-minimizing interpolation for robust multigrid methods}, 11760 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 11761 journal = {SIAM Journal on Scientific Computing}, 11762 volume = {21}, 11763 number = {4}, 11764 pages = {1632--1649}, 11765 year = {2000}, 11766 publisher = {Philadelphia, PA: SIAM, c1993-} 11767} 11768 11769@Article{ chansmith1994, 11770 title = {Domain decomposition and multigrid algorithms for elliptic problems on 11771 unstructured meshes}, 11772 author = {Chan, T.F. and Smith, B.F.}, 11773 journal = {Electronic Transactions on Numerical Analysis}, 11774 volume = {2}, 11775 pages = {171--182}, 11776 year = {1994} 11777} 11778 11779@TechReport{ proto-fsp, 11780 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 11781 and Michael Zarnstorff and Michael Zika}, 11782 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 11783 institution = {Princeton Plasma Physics Laboratory}, 11784 year = {2010}, 11785 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 11786} 11787 11788@Article{ hirvijoki2021, 11789 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 11790 particle-in-cell codes}, 11791 journal = {Plasma Phys. Control. Fusion}, 11792 author = {Eero Hirvijoki}, 11793 note = {in press}, 11794 doi = {10.1088/1361-6587/abe884}, 11795 year = {2021} 11796} 11797 11798@Article{ ipsen2001, 11799 author = {Ilse C. F. Ipsen}, 11800 journal = {SIAM J. Sci. Comput.}, 11801 pages = {1050--1051}, 11802 volume = {23}, 11803 publisher = {SIAM}, 11804 title = {A Note on Preconditioning Nonsymmetric Matrices}, 11805 year = {2001} 11806} 11807 11808% Random papers on solvers for GPUs 11809@InProceedings{ gpus-suck, 11810 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 11811 title = { On the Limits of {GPU} Acceleration}, 11812 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 11813 year = {2010}, 11814 publisher = {USENIX} 11815} 11816 11817@InProceedings{ 882364, 11818 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 11819 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11820 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 11821 year = {2003}, 11822 isbn = {1-58113-709-5}, 11823 pages = {917--924}, 11824 location = {San Diego, California}, 11825 doi = {10.1145/1201775.882364}, 11826 publisher = {ACM}, 11827 address = {New York, NY} 11828} 11829 11830@Conference{ feng2008multigrid, 11831 author = {Feng, Z. and Li, P.}, 11832 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 11833 date-added = {2010-08-19 15:57:06 -0500}, 11834 date-modified = {2010-08-19 15:57:06 -0500}, 11835 pages = {647--654}, 11836 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 11837 year = {2008} 11838} 11839 11840@Conference{ goodnight2003multigrid, 11841 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 11842 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 11843 date-added = {2010-08-19 15:45:20 -0500}, 11844 date-modified = {2010-08-19 15:45:20 -0500}, 11845 organization = {Eurographics Association}, 11846 pages = {102--111}, 11847 title = {A multigrid solver for boundary value problems using programmable graphics 11848 hardware}, 11849 year = {2003} 11850} 11851 11852@Article{ buatois2007concurrent, 11853 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 11854 date-added = {2010-08-19 15:45:02 -0500}, 11855 date-modified = {2010-08-19 15:45:02 -0500}, 11856 journal = {High Performance Computing and Communications}, 11857 pages = {358--371}, 11858 publisher = {Citeseer}, 11859 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 11860 year = {2007} 11861} 11862 11863@Article{ joldes2010real, 11864 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 11865 date-added = {2010-08-19 15:44:41 -0500}, 11866 date-modified = {2010-08-19 15:44:41 -0500}, 11867 journal = {Computer Methods in Applied Mechanics and Engineering}, 11868 publisher = {Elsevier}, 11869 title = {Real-time nonlinear finite element computations on {GPU}-application to 11870 neurosurgical simulation}, 11871 year = {2010} 11872} 11873 11874@Misc{ aharon2005gpu, 11875 author = {Aharon, S.}, 11876 date-added = {2010-08-19 15:44:32 -0500}, 11877 date-modified = {2010-08-19 15:44:32 -0500}, 11878 month = apr, 11879 note = {US Patent App. 11/115,642}, 11880 publisher = {Google Patents}, 11881 title = {{GPU}-based Finite Element}, 11882 year = {2005} 11883} 11884 11885@Article{ cevahir2009fast, 11886 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 11887 date-added = {2010-08-19 15:44:01 -0500}, 11888 date-modified = {2010-08-19 15:44:01 -0500}, 11889 journal = {Computational Science--ICCS 2009}, 11890 pages = {893--903}, 11891 publisher = {Springer}, 11892 title = {Fast conjugate gradients with multiple {GPU}s}, 11893 year = {2009} 11894} 11895 11896@Article{ maier1995symmetric, 11897 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 11898 date-added = {2010-08-19 15:43:57 -0500}, 11899 date-modified = {2010-08-19 15:43:57 -0500}, 11900 journal = {Computational Mechanics}, 11901 number = {1}, 11902 pages = {115--129}, 11903 publisher = {Springer}, 11904 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 11905 plasticity}, 11906 volume = {17}, 11907 year = {1995} 11908} 11909 11910@Article{ corrigan-running, 11911 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 11912 date-added = {2010-08-19 15:43:47 -0500}, 11913 date-modified = {2010-08-19 15:43:47 -0500}, 11914 journal = {International Journal for Numerical Methods in Fluids}, 11915 publisher = {John Wiley \& Sons}, 11916 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 11917} 11918 11919@InProceedings{ volkov08, 11920 author = {Vasily Volkov and James W. Demmel}, 11921 title = {Benchmarking GPUs to tune dense linear algebra}, 11922 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 11923 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 11924 year = {2008} 11925} 11926 11927@TechReport{ cray-mvmult, 11928 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 11929 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 11930 institution = {School of Computer Science, Carnegie Mellon University}, 11931 number = {CMU-CS-93-173}, 11932 month = aug, 11933 year = {1993} 11934} 11935 11936@Conference{ bell2009implementing, 11937 author = {Bell, N. and Garland, M.}, 11938 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 11939 and Analysis}, 11940 date-added = {2010-08-19 15:43:42 -0500}, 11941 date-modified = {2010-08-19 15:43:42 -0500}, 11942 organization = {ACM}, 11943 pages = {1--11}, 11944 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 11945 processors}, 11946 year = {2009} 11947} 11948 11949@Article{ bell2008efficient, 11950 author = {Bell, N. and Garland, M.}, 11951 date-added = {2010-08-19 15:43:36 -0500}, 11952 date-modified = {2010-08-19 15:43:36 -0500}, 11953 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 11954 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 11955 year = {2008} 11956} 11957 11958@Article{ cohen-fast, 11959 author = {Cohen, J. and Molemaker, M.J.}, 11960 date-added = {2010-08-19 15:43:34 -0500}, 11961 date-modified = {2010-08-19 15:43:34 -0500}, 11962 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 11963 pages = {414}, 11964 publisher = {DEStech Publications}, 11965 title = {A fast double precision CFD code using CUDA} 11966} 11967 11968@Article{ kazhdan2008streaming, 11969 author = {Kazhdan, M. and Hoppe, H.}, 11970 date-added = {2010-08-19 15:43:32 -0500}, 11971 date-modified = {2010-08-19 15:43:32 -0500}, 11972 journal = {ACM Transactions on Graphics (TOG)}, 11973 number = {3}, 11974 pages = {21}, 11975 publisher = {ACM}, 11976 title = {Streaming multigrid for gradient-domain operations on large images}, 11977 volume = {27}, 11978 year = {2008} 11979} 11980 11981@Article{ bonnet1998symmetric, 11982 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 11983 date-added = {2010-08-19 15:43:18 -0500}, 11984 date-modified = {2010-08-19 15:43:18 -0500}, 11985 journal = {Appl. Mech. Rev}, 11986 pages = {669--704}, 11987 title = {Symmetric {G}alerkin boundary element method.}, 11988 volume = {51}, 11989 year = {1998} 11990} 11991 11992@Conference{ zamith2007gpu, 11993 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 11994 Valente, L.}, 11995 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 11996 Entertainment}, 11997 date-added = {2010-08-19 15:43:14 -0500}, 11998 date-modified = {2010-08-19 15:43:14 -0500}, 11999 pages = {37--43}, 12000 title = {The {GPU} used as a math co-processor in real time applications}, 12001 year = {2007} 12002} 12003 12004@Article{ baskaran2009optimizing, 12005 author = {Baskaran, M.M. and Bordawekar, R.}, 12006 date-added = {2010-08-19 15:42:56 -0500}, 12007 date-modified = {2010-08-19 15:42:56 -0500}, 12008 journal = {IBM Research Report RC24704, IBM}, 12009 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 12010 year = {2009} 12011} 12012 12013@Misc{ szeliski2006locally, 12014 author = {Szeliski, R.}, 12015 date-added = {2010-08-19 15:42:45 -0500}, 12016 date-modified = {2010-08-19 15:42:45 -0500}, 12017 month = jul, 12018 note = {US Patent App. 11/459,724}, 12019 publisher = {Google Patents}, 12020 title = {Locally adapted hierarchical basis preconditioning}, 12021 year = {2006} 12022} 12023 12024@Article{ jung2006cholesky, 12025 author = {Jung, J.H. and O'Leary, D.P.}, 12026 date-added = {2010-08-19 15:42:34 -0500}, 12027 date-modified = {2010-08-19 15:42:34 -0500}, 12028 journal = {Scholarly Paper, University of Maryland}, 12029 publisher = {Citeseer}, 12030 title = {Cholesky decomposition and linear programming on a {GPU}}, 12031 year = {2006} 12032} 12033 12034@Conference{ filipovic2009gpu, 12035 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 12036 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 12037 date-added = {2010-08-19 15:42:33 -0500}, 12038 date-modified = {2010-08-19 15:42:33 -0500}, 12039 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 12040 Results}, 12041 year = {2009} 12042} 12043 12044@Article{ taylor2009modelling, 12045 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 12046 Atkinson, D. and Ourselin, S.}, 12047 date-added = {2010-08-19 15:42:23 -0500}, 12048 date-modified = {2010-08-19 15:42:23 -0500}, 12049 journal = {Medical Image Analysis}, 12050 number = {2}, 12051 pages = {234--244}, 12052 publisher = {Elsevier}, 12053 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 12054 solution and {GPU} execution}, 12055 volume = {13}, 12056 year = {2009} 12057} 12058 12059@Conference{ owens2007survey, 12060 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 12061 and Lefohn, A.E. and Purcell, T.J.}, 12062 booktitle = {Computer Graphics Forum}, 12063 date-added = {2010-08-19 15:42:21 -0500}, 12064 date-modified = {2010-08-19 15:42:21 -0500}, 12065 number = {1}, 12066 organization = {John Wiley \& Sons}, 12067 pages = {80--113}, 12068 title = {A survey of general-purpose computation on graphics hardware}, 12069 volume = {26}, 12070 year = {2007} 12071} 12072 12073@Article{ strzodka2005scientific, 12074 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 12075 date-added = {2010-08-19 15:42:18 -0500}, 12076 date-modified = {2010-08-19 15:42:18 -0500}, 12077 journal = {Simulation Modelling Practice and Theory}, 12078 number = {8}, 12079 pages = {667--680}, 12080 publisher = {Elsevier}, 12081 title = {Scientific computation for simulations on programmable graphics hardware}, 12082 volume = {13}, 12083 year = {2005} 12084} 12085 12086@Conference{ rumpf2001using, 12087 author = {Rumpf, M. and Strzodka, R.}, 12088 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 12089 (VIIP-01)}, 12090 date-added = {2010-08-19 15:42:15 -0500}, 12091 date-modified = {2010-08-19 15:42:15 -0500}, 12092 organization = {Citeseer}, 12093 pages = {193--202}, 12094 title = {Using graphics cards for quantized FEM computations}, 12095 year = {2001} 12096} 12097 12098@Article{ sirtori1992galerkin, 12099 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 12100 date-added = {2010-08-19 15:42:14 -0500}, 12101 date-modified = {2010-08-19 15:42:14 -0500}, 12102 journal = {International Journal for Numerical Methods in Engineering}, 12103 number = {2}, 12104 pages = {255--282}, 12105 publisher = {John Wiley \& Sons}, 12106 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 12107 implementation}, 12108 volume = {35}, 12109 year = {1992} 12110} 12111 12112@Article{ tejada2005large, 12113 author = {Tejada, E. and Ertl, T.}, 12114 date-added = {2010-08-19 15:42:09 -0500}, 12115 date-modified = {2010-08-19 15:42:09 -0500}, 12116 journal = {Simulation Modelling Practice and Theory}, 12117 number = {8}, 12118 pages = {703--715}, 12119 publisher = {Elsevier}, 12120 title = {Large steps in {GPU}-based deformable bodies simulation}, 12121 volume = {13}, 12122 year = {2005} 12123} 12124 12125@Article{ goddeke2008using, 12126 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 12127 and Becker, C. and Turek, S.}, 12128 date-added = {2010-08-19 15:42:06 -0500}, 12129 date-modified = {2010-08-19 15:42:06 -0500}, 12130 journal = {International Journal of Computational Science and Engineering}, 12131 number = {1}, 12132 pages = {36--55}, 12133 publisher = {Inderscience}, 12134 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 12135 volume = {4}, 12136 year = {2008} 12137} 12138 12139@Article{ garland2008parallel, 12140 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 12141 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 12142 date-added = {2010-08-19 15:41:51 -0500}, 12143 date-modified = {2010-08-19 15:41:51 -0500}, 12144 journal = {IEEE Micro}, 12145 number = {4}, 12146 pages = {13--27}, 12147 title = {Parallel computing experiences with CUDA}, 12148 volume = {28}, 12149 year = {2008} 12150} 12151 12152@Article{ wong1985method, 12153 author = {Wong, SH and Ciric, IR}, 12154 date-added = {2010-08-19 15:41:48 -0500}, 12155 date-modified = {2010-08-19 15:41:48 -0500}, 12156 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 12157 and Electronic Engineering}, 12158 publisher = {MCB UP Ltd}, 12159 title = {Method of conformal transformation for the finite-element solution of 12160 axisymmetric exterior-field problems}, 12161 volume = {4}, 12162 year = {1985} 12163} 12164 12165@Article{ turek-feast, 12166 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 12167 H.}, 12168 date-added = {2010-08-19 15:41:47 -0500}, 12169 date-modified = {2010-08-19 15:41:47 -0500}, 12170 journal = {Concurrency and Computation: Practice and Experience}, 12171 publisher = {John Wiley \& Sons}, 12172 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 12173 elements} 12174} 12175 12176@Article{ abedi2006space, 12177 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 12178 date-added = {2010-08-19 15:41:46 -0500}, 12179 date-modified = {2010-08-19 15:41:46 -0500}, 12180 journal = {Computer Methods in Applied Mechanics and Engineering}, 12181 number = {25-28}, 12182 pages = {3247--3273}, 12183 publisher = {Elsevier}, 12184 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 12185 element-wise momentum balance}, 12186 volume = {195}, 12187 year = {2006} 12188} 12189 12190@Conference{ georgii2005interactiveb, 12191 author = {Georgii, J. and Westermann, R.}, 12192 booktitle = {Proceedings of VMV}, 12193 date-added = {2010-08-19 15:41:36 -0500}, 12194 date-modified = {2010-08-19 15:41:36 -0500}, 12195 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 12196 year = {2005} 12197} 12198 12199@Article{ mosegaard2005gpu, 12200 author = {Mosegaard, J. and others}, 12201 date-added = {2010-08-19 15:41:35 -0500}, 12202 date-modified = {2010-08-19 15:41:35 -0500}, 12203 publisher = {IEEE Computer Society}, 12204 title = {{GPU} accelerated surgical simulators for complex morphology}, 12205 year = {2005} 12206} 12207 12208@Article{ meyer2007particle, 12209 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 12210 date-added = {2010-08-19 15:41:33 -0500}, 12211 date-modified = {2010-08-19 15:41:33 -0500}, 12212 journal = {IEEE Transactions on Visualization and Computer Graphics}, 12213 pages = {1015--1026}, 12214 publisher = {Published by the IEEE Computer Society}, 12215 title = {Particle systems for efficient and accurate high-order finite element 12216 visualization}, 12217 year = {2007} 12218} 12219 12220@Conference{ rumpf2001nonlinear, 12221 author = {Rumpf, M. and Strzodka, R.}, 12222 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 12223 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 12224 date-added = {2010-08-19 15:41:29 -0500}, 12225 date-modified = {2010-08-19 15:41:29 -0500}, 12226 organization = {Springer Verlag Wien}, 12227 pages = {75}, 12228 title = {Nonlinear diffusion in graphics hardware}, 12229 year = {2001} 12230} 12231 12232@Article{ georgii2005interactive, 12233 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 12234 date-added = {2010-08-19 15:41:28 -0500}, 12235 date-modified = {2010-08-19 15:41:28 -0500}, 12236 journal = {Simulation and Visualisation}, 12237 pages = {247--258}, 12238 publisher = {Citeseer}, 12239 title = {Interactive simulation of deformable bodies on {GPU}s}, 12240 volume = {2005}, 12241 year = {2005} 12242} 12243 12244@Article{ harish2007accelerating, 12245 author = {Harish, P. and Narayanan, P.}, 12246 date-added = {2010-08-19 15:41:27 -0500}, 12247 date-modified = {2010-08-19 15:41:27 -0500}, 12248 journal = {High Performance Computing--HiPC 2007}, 12249 pages = {197--208}, 12250 publisher = {Springer}, 12251 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 12252 year = {2007} 12253} 12254 12255@Article{ keunings1995parallel, 12256 author = {Keunings, R.}, 12257 date-added = {2010-08-19 15:41:19 -0500}, 12258 date-modified = {2010-08-19 15:41:19 -0500}, 12259 journal = {Computers and Chemical Engineering}, 12260 number = {6}, 12261 pages = {647--670}, 12262 publisher = {Oxford; New York: Pergamon Press, 1977-}, 12263 title = {Parallel finite element algorithms applied to computational rheology}, 12264 volume = {19}, 12265 year = {1995} 12266} 12267 12268@Conference{ taylor2007real, 12269 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12270 booktitle = {Proceedings of the 10th international conference on Medical image computing and 12271 computer-assisted intervention-Volume Part I}, 12272 date-added = {2010-08-19 15:41:17 -0500}, 12273 date-modified = {2010-08-19 15:41:17 -0500}, 12274 organization = {Springer-Verlag}, 12275 pages = {701--708}, 12276 title = {Real-time nonlinear finite element analysis for surgical simulation using 12277 graphics processing units}, 12278 year = {2007} 12279} 12280 12281@Article{ liu2000finite, 12282 author = {Liu, R. and Li, DY}, 12283 date-added = {2010-08-19 15:41:16 -0500}, 12284 date-modified = {2010-08-19 15:41:16 -0500}, 12285 journal = {Materials Science and Engineering A}, 12286 number = {1-2}, 12287 pages = {169--175}, 12288 publisher = {Elsevier}, 12289 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 12290 volume = {277}, 12291 year = {2000} 12292} 12293 12294@Conference{ kakadiaris1994active, 12295 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 12296 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 12297 date-added = {2010-08-19 15:41:15 -0500}, 12298 date-modified = {2010-08-19 15:41:15 -0500}, 12299 organization = {Citeseer}, 12300 pages = {980--980}, 12301 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 12302 physics-based approach}, 12303 year = {1994} 12304} 12305 12306@Conference{ de2004gpu, 12307 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 12308 booktitle = {Proceedings of Eurohaptics}, 12309 date-added = {2010-08-19 15:41:14 -0500}, 12310 date-modified = {2010-08-19 15:41:14 -0500}, 12311 organization = {Citeseer}, 12312 pages = {44--51}, 12313 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 12314 volume = {2004}, 12315 year = {2004} 12316} 12317 12318@Book{ taflove1995computational, 12319 author = {Taflove, A. and Hagness, S.C.}, 12320 date-added = {2010-08-19 15:41:14 -0500}, 12321 date-modified = {2010-08-19 15:41:14 -0500}, 12322 publisher = {Artech House Norwood, MA}, 12323 title = {Computational electrodynamics}, 12324 year = {1995} 12325} 12326 12327@Conference{ galoppo2005lu, 12328 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 12329 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 12330 date-added = {2010-08-19 15:41:13 -0500}, 12331 date-modified = {2010-08-19 15:41:13 -0500}, 12332 organization = {IEEE Computer Society}, 12333 pages = {3}, 12334 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 12335 hardware}, 12336 year = {2005} 12337} 12338 12339@Conference{ ryoo2008optimization, 12340 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 12341 and Hwu, W.W.}, 12342 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 12343 parallel programming}, 12344 date-added = {2010-08-19 15:41:12 -0500}, 12345 date-modified = {2010-08-19 15:41:12 -0500}, 12346 organization = {ACM}, 12347 pages = {73--82}, 12348 title = {Optimization principles and application performance evaluation of a multithreaded 12349 {GPU} using CUDA}, 12350 year = {2008} 12351} 12352 12353@Conference{ micikevicius20093d, 12354 author = {Micikevicius, P.}, 12355 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 12356 Units}, 12357 date-added = {2010-08-19 15:41:11 -0500}, 12358 date-modified = {2010-08-19 15:41:11 -0500}, 12359 organization = {ACM}, 12360 pages = {79--84}, 12361 title = {3D finite difference computation on {GPU}s using {CUDA}}, 12362 year = {2009} 12363} 12364 12365@Conference{ zhou2004pixel, 12366 author = {Zhou, Y. and Garland, M. and Haber, R.}, 12367 booktitle = {IEEE Visualization, 2004}, 12368 date-added = {2010-08-19 15:41:03 -0500}, 12369 date-modified = {2010-08-19 15:41:03 -0500}, 12370 pages = {425--432}, 12371 title = {Pixel-exact rendering of spacetime finite element solutions}, 12372 year = {2004} 12373} 12374 12375@Article{ komatitsch2009porting, 12376 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 12377 date-added = {2010-08-19 15:41:01 -0500}, 12378 date-modified = {2010-08-19 15:41:01 -0500}, 12379 journal = {Journal of Parallel and Distributed Computing}, 12380 number = {5}, 12381 pages = {451--460}, 12382 publisher = {Elsevier}, 12383 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 12384 graphics cards using CUDA}, 12385 volume = {69}, 12386 year = {2009} 12387} 12388 12389@Article{ komatitsch1998spectral, 12390 author = {Komatitsch, D. and Vilotte, J.P.}, 12391 date-added = {2010-08-19 15:40:59 -0500}, 12392 date-modified = {2010-08-19 15:40:59 -0500}, 12393 journal = {Bulletin of the Seismological Society of America}, 12394 number = {2}, 12395 pages = {368--392}, 12396 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 12397 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 12398 of 2D and 3D geological structures}, 12399 volume = {88}, 12400 year = {1998} 12401} 12402 12403@Article{ wu2005improved, 12404 author = {Wu, W. and Heng, P.A.}, 12405 date-added = {2010-08-19 15:40:59 -0500}, 12406 date-modified = {2010-08-19 15:40:59 -0500}, 12407 journal = {The Visual Computer}, 12408 number = {8}, 12409 pages = {707--716}, 12410 publisher = {Springer}, 12411 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 12412 cutting and deformation}, 12413 volume = {21}, 12414 year = {2005} 12415} 12416 12417@Article{ taylor2008high, 12418 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12419 date-added = {2010-08-19 15:40:57 -0500}, 12420 date-modified = {2010-08-19 15:40:57 -0500}, 12421 journal = {IEEE transactions on medical imaging}, 12422 number = {5}, 12423 pages = {650}, 12424 title = {High-speed nonlinear finite element analysis for surgical simulation using 12425 graphics processing units.}, 12426 volume = {27}, 12427 year = {2008} 12428} 12429 12430@Conference{ bolz2003sparse, 12431 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 12432 booktitle = {ACM SIGGRAPH 2003 Papers}, 12433 date-added = {2010-08-19 15:40:55 -0500}, 12434 date-modified = {2010-08-19 15:40:55 -0500}, 12435 organization = {ACM}, 12436 pages = {924}, 12437 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 12438 year = {2003} 12439} 12440 12441@Article{ wu2004hybrid, 12442 author = {Wu, W. and Heng, P.A.}, 12443 date-added = {2010-08-19 15:40:54 -0500}, 12444 date-modified = {2010-08-19 15:40:54 -0500}, 12445 journal = {Computer Animation and Virtual Worlds}, 12446 number = {3-4}, 12447 pages = {219--227}, 12448 publisher = {John Wiley \& Sons}, 12449 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 12450 3D soft tissue cutting}, 12451 volume = {15}, 12452 year = {2004} 12453} 12454 12455% ---------------------------------------------------------------------------------------------------------------- 12456@TechReport{ davis97, 12457 author = {T. Davis}, 12458 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 12459 institution = {University of Florida}, 12460 year = {1997} 12461} 12462 12463@Article{ davis2011, 12464 author = {Davis, T. A. and Hu, Y.}, 12465 title = {The {U}niversity of {F}lorida sparse matrix collection}, 12466 journal = {ACM Transactions on Mathematical Software}, 12467 volume = {38}, 12468 issue = {1}, 12469 year = {2011}, 12470 pages = {1--25} 12471} 12472 12473@Article{ davis2004algorithm, 12474 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 12475 author = {Davis, Timothy A}, 12476 journal = {ACM Transactions on Mathematical Software}, 12477 volume = {30}, 12478 number = {2}, 12479 pages = {196--199}, 12480 year = {2004}, 12481 publisher = {ACM} 12482} 12483 12484@TechReport{ streams, 12485 author = {J. D. McCalpin}, 12486 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 12487 institution = {University of Virginia}, 12488 url = {http://www.cs.virginia.edu/stream}, 12489 year = {1995} 12490} 12491 12492@Article{ areusken_1988b, 12493 author = {A. Reusken}, 12494 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 12495 mildly nonlinear boundary value problems}, 12496 journal = {Numer. Math.}, 12497 volume = {52}, 12498 year = {1988}, 12499 pages = {251--277} 12500} 12501 12502@Article{ areusken_1988c, 12503 author = {A. Reusken}, 12504 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 12505 journal = {Numer. Math.}, 12506 volume = {53}, 12507 year = {1988}, 12508 pages = {663--686} 12509} 12510 12511@Unpublished{ mgnet, 12512 title = {Multigrid Net; http://www.mgnet.org/}, 12513 author = {Craig Douglas}, 12514 note = {Contains enormous bibliography on multigrid publications}, 12515 year = {2009} 12516} 12517 12518@Unpublished{ copper, 12519 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 12520 author = {}, 12521 note = {Held bi-annually}, 12522 year = {2009} 12523} 12524 12525@Book{ wessling1992, 12526 author = {Pieter Wesseling}, 12527 title = {An Introduction to Multigrid Methods}, 12528 year = {2004}, 12529 publisher = {R. T. Edwards} 12530} 12531 12532@Book{ bhm2000, 12533 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 12534 title = {A Multigrid Tutorial}, 12535 year = {2000}, 12536 publisher = {SIAM} 12537} 12538 12539@Book{ trottenberg2001multigrid, 12540 title = {{Multigrid}}, 12541 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 12542 isbn = {012701070X}, 12543 year = {2001}, 12544 publisher = {Academic Press} 12545} 12546 12547@TechReport{ brandt1984, 12548 author = {Achi Brandt}, 12549 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 12550 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 12551 number = {GMD-Studien Nr. 85}, 12552 year = {1984} 12553} 12554 12555@Article{ yavneh1998coarse, 12556 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 12557 author = {Yavneh, I.}, 12558 journal = {SIAM Journal on Scientific Computing}, 12559 volume = {19}, 12560 number = {5}, 12561 pages = {1682--1699}, 12562 year = {1998}, 12563 publisher = {Society for Industrial and Applied Mathematics} 12564} 12565 12566@Article{ wan2003phase, 12567 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 12568 author = {Wan, WL and Chan, T.F.}, 12569 journal = {SIAM Journal on Scientific Computing}, 12570 volume = {25}, 12571 pages = {857}, 12572 year = {2003} 12573} 12574 12575@Article{ imex, 12576 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 12577 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 12578 journal = {SIAM Journel on Numerical Analysis}, 12579 volume = {32}, 12580 number = {3}, 12581 pages = {797--823}, 12582 year = {1995} 12583} 12584 12585@Article{ ow1, 12586 author = {T. Washio and C. W. Oosterlee}, 12587 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 12588 Recirculating Flow}, 12589 journal = {SIAM Journal on Scientific Computing}, 12590 volume = {21}, 12591 number = {5}, 12592 pages = {1670--1690}, 12593 year = {2000} 12594} 12595 12596@Article{ vm1, 12597 author = {V. A. Mousseau}, 12598 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 12599 Heat Conduction}, 12600 journal = {Journal Of Computational Physics}, 12601 volume = {200}, 12602 pages = {104--132}, 12603 year = {2004} 12604} 12605 12606@Article{ vm2, 12607 author = {V. A. Mousseau}, 12608 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 12609 journal = {Journal Of Heat Transfer}, 12610 volume = {127}, 12611 pages = {531--539}, 12612 year = {2005} 12613} 12614 12615@Misc{ salome1, 12616 author = {Laurent Dada and Daniel Caruge}, 12617 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 12618 Simulation}, 12619 year = {2005}, 12620 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 12621 note = {Presentation at an ESA/ESTEC conference} 12622} 12623 12624@InProceedings{ downar1, 12625 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 12626 A. Mousseau and D. E. Ebert}, 12627 title = {Application of a generalized interface module to the coupling of {PARCS} with 12628 both {RELAP5} and {TRAC-M}}, 12629 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 12630 year = {1999} 12631} 12632 12633@Article{ lopez1, 12634 author = {A. P. Lopez and J. B. Sandova}, 12635 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 12636 thermal-hydraulics}, 12637 journal = {Annals of Nuclear Energy}, 12638 volume = {32(6)}, 12639 pages = {621--634}, 12640 year = {2005} 12641} 12642 12643@InProceedings{ og-1996, 12644 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 12645 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 12646 Transport Code}, 12647 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 12648 Transport Codes}, 12649 editor = {}, 12650 publisher = {}, 12651 pages = {}, 12652 note = {Paris, France}, 12653 month = dec, 12654 year = {1996} 12655} 12656 12657@Article{ wo-2000, 12658 author = {P. Warner and C. R. E. de Oliveira}, 12659 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 12660 {EVENT} for Shielding Applications}, 12661 journal = {J. Nucl. Sci. and Tech.}, 12662 volume = {Supplement 1}, 12663 pages = {466--470}, 12664 year = {2000} 12665} 12666 12667@Unpublished{ gnep-web, 12668 author = {{U.S. Department of Energy}}, 12669 title = {Global Nuclear Energy Partnership ({GNEP})}, 12670 note = {\url{ http://www.gnep.energy.gov}}, 12671 year = {2007} 12672} 12673 12674@Book{ lewis-miller-1984, 12675 author = {E. E. Lewis and W. F. Miller, Jr.}, 12676 title = {Computational Methods of Neutron Transport}, 12677 address = {}, 12678 publisher = {Wiley}, 12679 year = {1984} 12680} 12681 12682@Article{ couple1, 12683 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 12684 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 12685 THE {IBM-704}}, 12686 journal = {Nuclear Sci. and Eng.}, 12687 year = {1959}, 12688 pages = {113--115}, 12689 volume = {2(1)} 12690} 12691 12692@InProceedings{ weber1, 12693 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 12694 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 12695 and component design}, 12696 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 12697 year = {2000} 12698} 12699 12700@Misc{ gnep:report, 12701 author = {Phillip Finck and David Keyes and Rick Stevens}, 12702 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 12703 Nuclear Energy Systems}}, 12704 year = {2006} 12705} 12706 12707@Misc{ subsurface-workshop-ref, 12708 author = {D. {Zachman (Chair)}}, 12709 title = {{Computational Subsurface Sciences Workshop}}, 12710 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 12711} 12712 12713@Misc{ fusion:report, 12714 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 12715 Panel}}, 12716 author = {{Fusion Energy Sciences Advisory Committee}}, 12717 year = {2002}, 12718 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 12719} 12720 12721@Misc{ hecrtf:report, 12722 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 12723 key = {HECRTF}, 12724 year = {2004}, 12725 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 12726} 12727 12728@Misc{ doesc20years, 12729 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 12730 key = {Office of Science, U.S. Department of Energy}, 12731 year = {2003}, 12732 howpublished = {Office of Science, U.S. Department of Energy, see 12733 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 12734} 12735 12736@PhDThesis{ karpeev-thesis, 12737 author = {D. A. Karpeyev}, 12738 title = {Geometric Integrators for Hamiltonian PDEs}, 12739 school = {Old Dominion University}, 12740 year = {2002} 12741} 12742 12743@InCollection{ fjp:ima, 12744 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12745 title = {The Scalability of Mesh Improvement Algorithms}, 12746 booktitle = {Algorithms for Parallel Processing}, 12747 publisher = {Springer-Verlag}, 12748 volume = {105}, 12749 series = {The IMA Volumes in Mathematics and Its Applications}, 12750 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 12751 year = {1998}, 12752 pages = {185--212} 12753} 12754 12755@InProceedings{ poet, 12756 author = {Rob Armstrong and Alex Cheung}, 12757 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 12758 for Scientific Distributed Computing}, 12759 booktitle = {Proceedings of {HICSS97}}, 12760 year = {1997} 12761} 12762 12763@Misc{ pseware-web-page, 12764 author = {}, 12765 title = {{PSEware} {Web} page}, 12766 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 12767 key = {{PSEware} {Web} page} 12768} 12769 12770@Article{ epperly2011high, 12771 title = {High-performance language interoperability for scientific computing through 12772 {B}abel}, 12773 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 12774 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 12775 journal = {International Journal of High Performance Computing Applications}, 12776 pages = {1094342011414036}, 12777 year = {2011}, 12778 publisher = {SAGE Publications} 12779} 12780 12781@Misc{ babel-web-page, 12782 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 12783 title = {{Babel} {Web} page}, 12784 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 12785} 12786 12787@Misc{ infospheres-web-page, 12788 author = {K.~M. {Chandy et al.}}, 12789 title = {{Infospheres} {W}eb page}, 12790 note = {\url{http://www.infospheres.caltech.edu}}, 12791 key = {{Infospheres} {Web} page} 12792} 12793 12794@Misc{ hammond, 12795 author = {Glenn Hammond}, 12796 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 12797 communication} 12798} 12799 12800@Misc{ ornl, 12801 author = {Oak Ridge National Laboratory}, 12802 title = {Private communication via petsc-maint email support} 12803} 12804 12805@Unpublished{ cumulvs-web-page, 12806 author = {}, 12807 title = {{Cumulvs} {W}eb page}, 12808 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 12809 key = {{Cumulvs} {W}eb page} 12810} 12811 12812@Article{ nonlineargmres, 12813 author = {T. Washio and C. W. Oosterlee}, 12814 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 12815 journal = {ETNA}, 12816 year = {1997}, 12817 pages = {271--290}, 12818 volume = {6} 12819} 12820 12821@Article{ pcice, 12822 author = {Richard C. Martineau and Ray A. Berry}, 12823 title = {The pressure-corrected ICE finite element method for compressible flows on 12824 unstructured meshes}, 12825 journal = {Journal of Computational Physics}, 12826 year = {2004}, 12827 pages = {659--685}, 12828 volume = {198(2)} 12829} 12830 12831@Article{ cumulvs97, 12832 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 12833 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 12834 Applications}, 12835 journal = {International Journal of Supercomputing Applications}, 12836 year = {1997} 12837} 12838 12839@TechReport{ daly2012interagency, 12840 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 12841 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 12842 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 12843 Paul Woodward}, 12844 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 12845 year = {2012}, 12846 publisher = {US Department of Defense} 12847} 12848 12849@Article{ karpeev1, 12850 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 12851 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 12852 journal = {J. Comp. Phys.}, 12853 year = {2001}, 12854 pages = {116--148}, 12855 volume = {173} 12856} 12857 12858@InProceedings{ scirun97, 12859 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 12860 title = {The {SCIRun} Computational Steering System}, 12861 booktitle = {Modern Software Tools in Scientific Computing}, 12862 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 12863 publisher = {Birkhauser Press}, 12864 year = {1997} 12865} 12866 12867@TechReport{ szyld, 12868 author = {Valeria Simoncini and Daniel B. Szyld}, 12869 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 12870 Computing}, 12871 year = {2002}, 12872 institution = {Department of Mathematics, Temple University}, 12873 number = {02-4-12} 12874} 12875 12876@TechReport{ pdelab, 12877 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 12878 and C. C. Chui and S. Markus}, 12879 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 12880 for {PDE} Based Applications}, 12881 year = {1994}, 12882 institution = {Department of Computer Sciences, Purdue University}, 12883 number = {CSD-TR-94-021} 12884} 12885 12886@Unpublished{ ilu-web-page, 12887 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 12888 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 12889 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 12890} 12891 12892@Unpublished{ doe2k-web-page, 12893 title = {{DOE2000 Initiative} {W}eb page}, 12894 note = {http://www.mcs.anl.gov/DOE2000}, 12895 key = {DOE2000 Initiative} 12896} 12897 12898@Misc{ pvode-web-page, 12899 title = {{PVODE} {W}eb Page}, 12900 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 12901 author = {A. {Hindmarsh et al.}} 12902} 12903 12904@Book{ szyperski97, 12905 author = {Clemens Szyperski}, 12906 title = {Component Software: Beyond Object-Oriented Programming}, 12907 publisher = {ACM Press}, 12908 address = {New York}, 12909 year = {1997} 12910} 12911 12912@Unpublished{ petsc:coloringuse, 12913 title = {Code for computing sparse {J}acobians}, 12914 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12915 institution = {Argonne National Laboratory} 12916} 12917 12918@Unpublished{ petsc:external, 12919 author = {B. F. {Smith et al.}}, 12920 title = {{External Software Used by PETSc}}, 12921 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12922 institution = {Argonne National Laboratory} 12923} 12924 12925@Unpublished{ petsc:use-by-external-packages, 12926 author = {B. F. {Smith et al.}}, 12927 title = {{Software Packages that Use or Interface to PETSc}}, 12928 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 12929 institution = {Argonne National Laboratory} 12930} 12931 12932@Unpublished{ petsc:prizes, 12933 author = {B. F. {Smith et al.}}, 12934 title = {{Prizes Won Using PETSc}}, 12935 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12936 institution = {Argonne National Laboratory} 12937} 12938 12939@Unpublished{ petsc:csgf, 12940 author = {B. F. {Smith et al.}}, 12941 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 12942 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12943 institution = {Argonne National Laboratory} 12944} 12945 12946@Unpublished{ flash-web-page, 12947 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 12948 {W}eb Page}, 12949 note = {http://www.asci.uchicago.edu}, 12950 author = {R. {Rosner et al.}}, 12951 institution = {University of Chicago} 12952} 12953 12954@Unpublished{ esi-web-page, 12955 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 12956 note = {http://z.ca.sandia.gov/esi}, 12957 author = {R. {Clay et al.}} 12958} 12959 12960@Unpublished{ infobus-web-page, 12961 title = {{I}nfo{B}us {W}eb Page}, 12962 note = {http://www.java.sun.com/beans/infobus}, 12963 key = {infobus} 12964} 12965 12966@Unpublished{ xray-web-page, 12967 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 12968 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 12969 note = {http://www.mcs.anl.gov/xray/}, 12970 institution = {Argonne National Laboratory} 12971} 12972 12973@InProceedings{ kohn98, 12974 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 12975 title = {Language Interoperability Mechanisms for High-Performance Scientific 12976 Applications}, 12977 publisher = {SIAM}, 12978 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12979 Scientific and Engineering Computing}, 12980 year = {1999}, 12981 pages = {30-39} 12982} 12983 12984@InProceedings{ kohn01, 12985 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 12986 title = {Divorcing Language Dependencies from a Scientific Software Library}, 12987 publisher = {SIAM}, 12988 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 12989 year = {2001} 12990} 12991 12992@InProceedings{ freitag_jones_plassmann98, 12993 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12994 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 12995 publisher = {SIAM}, 12996 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12997 Scientific and Engineering Computing}, 12998 year = {1999}, 12999 pages = {215-224} 13000} 13001 13002@Book{ templates, 13003 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 13004 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 13005 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 13006 Methods}, 13007 publisher = {SIAM}, 13008 year = {1994}, 13009 address = {Philadelphia, PA} 13010} 13011 13012@InProceedings{ parasha2, 13013 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 13014 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 13015 {PDE} Solutions}, 13016 booktitle = {SC97 Proceedings}, 13017 publisher = {IEEE Computer Society Press}, 13018 year = {1997} 13019} 13020 13021@TechReport{ parasha, 13022 author = {M. Parashar and J. C. Browne}, 13023 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 13024 Techniques}, 13025 institution = {Department of Computer Science, University of Texas at Austin}, 13026 year = {1995} 13027} 13028 13029@Article{ parti, 13030 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 13031 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 13032 Memory Architectures}, 13033 journal = {Journal of Parallel and Distributed Computing}, 13034 year = {1994}, 13035 volume = {22}, 13036 pages = {462--478} 13037} 13038 13039@Article{ mparti, 13040 author = {G. Agrawal and A. Sussman and J. Saltz}, 13041 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 13042 Block Structured Applications}, 13043 journal = {IEEE Trans. on Parallel and Distributed Systems}, 13044 volume = {6}, 13045 number = {7}, 13046 year = {1995} 13047} 13048 13049@Article{ gropp-lusk-doss-skjellum, 13050 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 13051 title = {A high-performance, portable implementation of the {MPI} Message Passing 13052 Interface standard}, 13053 journal = {Parallel Computing}, 13054 year = {1996}, 13055 volume = {22}, 13056 pages = {789--828} 13057} 13058 13059@InProceedings{ lam, 13060 author = {Greg Burns and Raja Daoud and James Vaigl}, 13061 title = {{LAM}: An Open Cluster Environment for {MPI}}, 13062 booktitle = {Proceedings of Supercomputing Symposium '94}, 13063 editor = {John W. Ross}, 13064 publisher = {University of Toronto}, 13065 pages = {379--386}, 13066 year = {1994} 13067} 13068 13069@Article{ cs99, 13070 author = {X.-C. Cai and M. Sarkis}, 13071 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 13072 systems}, 13073 journal = {SIAM J. Scientific Computing}, 13074 year = {1999}, 13075 volume = {21}, 13076 pages = {792-797} 13077} 13078 13079@Article{ cai2003restricted, 13080 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 13081 positive definite linear systems}, 13082 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 13083 journal = {SIAM Journal on Numerical Analysis}, 13084 volume = {41}, 13085 issue = {1}, 13086 pages = {1209--1231}, 13087 year = {2003}, 13088 doi = {10.1137/S0036142901389621} 13089} 13090 13091@TechReport{ caisaad, 13092 author = {Xiao-Chuan Cai and Youcef Saad}, 13093 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 13094 institution = {Army High Performance Computing Research Center, University of Minnesota }, 13095 year = {1993}, 13096 number = {Preprint 93-027 }, 13097 note = {SIAM J. Sci. Comp. (submitted)} 13098} 13099 13100@Book{ ruminations, 13101 author = {Andrew Koenig and Barbara Moo}, 13102 title = {Ruminations on C++}, 13103 year = {1996}, 13104 publisher = {Addison-Wesley} 13105} 13106 13107@Book{ mpi-complete, 13108 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 13109 Dongarra}, 13110 title = {{MPI}: The Complete Reference}, 13111 year = {1995}, 13112 publisher = {MIT Press} 13113} 13114 13115@Unpublished{ tcl-tk-web-page, 13116 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 13117 note = {http://www.sunlabs.com/research/tcl/}, 13118 year = {1996}, 13119 month = aug 13120} 13121 13122@Misc{ mpich-web-page, 13123 author = {William Gropp and {et. al.}}, 13124 title = {{MPICH} {W}eb page}, 13125 key = {MPICH}, 13126 url = {http://www.mpich.org}, 13127 howpublished = {\url{http://www.mpich.org}} 13128} 13129 13130@Article{ mpi-final, 13131 author = {MPI Forum}, 13132 title = {{MPI}: A Message-Passing Interface Standard}, 13133 journal = {International J. Supercomputing Applications}, 13134 volume = {8}, 13135 number = {3/4}, 13136 year = {1994}, 13137 key = {MPI Standard - final} 13138} 13139 13140@Unpublished{ npb-web-page, 13141 key = {NAS Parallel Benchmarks}, 13142 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 13143 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 13144 year = {1996}, 13145 month = dec 13146} 13147 13148@Book{ george81, 13149 title = {Computer Solution of Large Sparse Positive Definite Systems}, 13150 author = {Alan George and Joseph W. Liu}, 13151 publisher = {Prentice-Hall}, 13152 year = {1981}, 13153 key = {SparseDirect} 13154} 13155 13156@Book{ p4-book, 13157 title = {Portable Programs for Parallel Processors}, 13158 publisher = {Holt, Rinehart, {and} Winston}, 13159 year = {1987}, 13160 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 13161 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 13162 key = {P4Book} 13163} 13164 13165@Article{ stones, 13166 author = {H. L. Stone}, 13167 title = {Iterative solution of implicit approximations of multidimensional partial 13168 differential equations}, 13169 journal = {SIAM J. Numerical Analysis}, 13170 pages = {87--113}, 13171 volumne = {5}, 13172 year = {1968} 13173} 13174 13175@Article{ parallelstones, 13176 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 13177 title = {Parallel versions of {S}tones strongly implicit algorithm}, 13178 journal = {Concurrency and Computation: Practice and Experience}, 13179 pages = {1049--1062}, 13180 volumne = {13}, 13181 year = {2001} 13182} 13183 13184@Article{ p4-paper, 13185 author = {Ralph Butler and Ewing Lusk}, 13186 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 13187 journal = {Journal of Parallel Computing}, 13188 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 13189 Division preprint P362-0493)}, 13190 year = {1993} 13191} 13192 13193@TechReport{ picl, 13194 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 13195 title = {{PICL}: A portable instrumented communications library}, 13196 institution = {Oak Ridge National Laboratory}, 13197 number = {TM-11130}, 13198 year = {1990}, 13199 key = {PICL} 13200} 13201 13202@TechReport{ upshot, 13203 author = {Virginia Herrarte and Ewing Lusk}, 13204 title = {Studying Parallel Program Behavior with {U}pshot}, 13205 institution = {Argonne National Laboratory}, 13206 number = {ANL-91/15}, 13207 month = aug, 13208 year = {1991}, 13209 key = {Upshot} 13210} 13211 13212@TechReport{ p4-manual, 13213 author = {Ralph Butler and Ewing Lusk}, 13214 title = {User's Guide to the p4 Parallel Programming System}, 13215 institution = {Argonne National Laboratory}, 13216 number = {ANL-92/17}, 13217 month = oct, 13218 year = {1992}, 13219 key = {p4-Manual} 13220} 13221 13222@InProceedings{ oldparti, 13223 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 13224 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 13225 booktitle = {Proceedings of Supercomputing '93}, 13226 pages = {578--587}, 13227 year = {1993} 13228} 13229 13230@Article{ parti2, 13231 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 13232 and J. Saltz}, 13233 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 13234 journal = {ACM SIGPLAN Notices}, 13235 year = {1995}, 13236 pages = {68-79}, 13237 volume = {30}, 13238 number = {8} 13239} 13240 13241@Article{ parti3, 13242 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 13243 title = {Run-Time Parallelization and Scheduling of Loops}, 13244 journal = {IEEE Trans. Computers}, 13245 year = {1991}, 13246 pages = {604-612}, 13247 volume = {40}, 13248 number = {5} 13249} 13250 13251@InProceedings{ disz-lusk:wamtrace, 13252 author = {Terrence Disz and Ewing Lusk}, 13253 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 13254 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13255 year = {1987}, 13256 pages = {46--53} 13257} 13258 13259@InProceedings{ gorlick-kesselman:gauge, 13260 author = {Michael Gorlick and Carl Kesselman}, 13261 title = {Timing {Prolog} programs without Clocks}, 13262 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13263 year = {1996}, 13264 publisher = {Birkhauser} 13265} 13266 13267@TechReport{ aztec, 13268 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 13269 title = {Aztec User's Guide Version 1.1}, 13270 institution = {Sandia National Laboratories}, 13271 month = oct, 13272 year = {1995}, 13273 number = {SAND95/1559} 13274} 13275 13276@TechReport{ aztec2, 13277 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 13278 title = {Official {Aztec} User's Guide Version 2.1}, 13279 institution = {Sandia National Laboratories}, 13280 year = {1999} 13281} 13282 13283@Book{ taylor-chandy:pcn, 13284 author = {Chandy, M. and Taylor, S.}, 13285 title = {An Introduction to Parallel Programming}, 13286 year = {1991}, 13287 publisher = {Jones and Bartlett} 13288} 13289 13290@Book{ foster-taylor:strand, 13291 title = {Strand: New Concepts in Parallel Programming}, 13292 author = {Ian Foster and Stephen Taylor}, 13293 publisher = {Prentice-Hall}, 13294 adress = { Englewood Cliffs, New Jersey}, 13295 year = {1990} 13296} 13297 13298@Article{ aurora, 13299 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 13300 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 13301 Carlsson and A. Ciepielewski and B. Hausman}, 13302 title = {The Aurora OR-Parallel Prolog System}, 13303 journal = {New Generation Computing}, 13304 volume = {7}, 13305 number = {3}, 13306 year = {1990}, 13307 pages = {243--271} 13308} 13309 13310@TechReport{ roo, 13311 author = {E. Lusk and W. McCune and J. Slaney}, 13312 title = {Roo---a Parallel Theorem Prover}, 13313 institution = {Argonne National Laboratory}, 13314 number = {MCS--TM--149}, 13315 year = {1991} 13316} 13317 13318@TechReport{ heath-etheridge:vppp, 13319 author = {M. T. Heath and J. A. Etheridge}, 13320 title = {Visualizing the Performance of Parallel Programs}, 13321 institution = {Oak Ridge National Laboratory}, 13322 number = {ORNL TM-11813}, 13323 year = {1991} 13324} 13325 13326@TechReport{ chem:vis, 13327 author = {Ewing L. Lusk}, 13328 title = {Performance Visualization for Parallel Programs}, 13329 institution = {Argonne National Laboratory}, 13330 number = {ANL/MCS--P287--0192}, 13331 year = {1991}, 13332 note = {(to appear in {\em Theoretica Chimica Acta})} 13333} 13334 13335@TechReport{ picltrace, 13336 author = {P.~H.~Worley}, 13337 title = {A new {PICL} trace file format}, 13338 institution = {Oak Ridge National Laboratory}, 13339 number = {ORNL TM-12125}, 13340 month = jun, 13341 year = {1992} 13342} 13343 13344@InProceedings{ hideo, 13345 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 13346 title = {Inference of Phylogenetic trees using maximum likelihood}, 13347 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 13348 year = {1992}, 13349 pages = {247--262} 13350} 13351 13352@InProceedings{ dw90, 13353 author = {M. Dryja and O. Widlund}, 13354 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 13355 Problems}, 13356 booktitle = {Third International Symposium on Domain Decomposition Methods}, 13357 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 13358 year = {1990}, 13359 pages = {3-21}, 13360 publisher = {SIAM}, 13361 address = {Philadelphia}, 13362 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 13363 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 13364 references, good introduction to the theory. No computations}, 13365 key = {DryjaWidlund90 !AS} 13366} 13367 13368@Unpublished{ rosing, 13369 author = {Matt Rosing and Joel Saltz}, 13370 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 13371 key = {LowLatency}, 13372 note = {manuscript, 1992} 13373} 13374 13375@TechReport{ jp:incomplete, 13376 author = {Mark T. Jones and Paul E. Plassmann}, 13377 title = {An Improved Incomplete {C}holesky Factorization}, 13378 institution = {Argonne National Laboratory}, 13379 address = {Argonne, IL}, 13380 type = {Preprint}, 13381 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 13382 number = {MCS-P206-0191}, 13383 year = {1991}, 13384 key = {jones} 13385} 13386 13387@InCollection{ jp:ima, 13388 author = {Mark Jones and Paul Plassmann}, 13389 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 13390 booktitle = {Graph Theory and Sparse Matrix Computation}, 13391 publisher = {Springer-Verlag}, 13392 series = {The IMA Volumes in Mathematics and Its Applications}, 13393 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 13394 volume = {56}, 13395 year = {1993}, 13396 pages = {229--245} 13397} 13398 13399@Article{ pw98, 13400 author = {M. Pernice and H. F. Walker}, 13401 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 13402 journal = {SIAM J. Sci. Stat. Comput.}, 13403 year = {1998}, 13404 volume = {19}, 13405 pages = {302--318} 13406} 13407 13408@TechReport{ ysmp83, 13409 key = {Eisenstat}, 13410 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13411 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13412 institution = {Department of Computer Science, Yale University}, 13413 number = {YALE/DCS/RR-265}, 13414 month = apr, 13415 year = {1983} 13416} 13417 13418@InBook{ ysmp84, 13419 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13420 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13421 title = {Elliptic Problem Solvers II}, 13422 publisher = {Academic Press}, 13423 pages = {45--52}, 13424 editors = {G. Birkhoff and A. Schoenstadt}, 13425 year = {1984} 13426} 13427 13428@TechReport{ sparsekit, 13429 key = {Saad}, 13430 author = {Youcef Saad}, 13431 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 13432 institution = {Center for Supercomputing Research and Development, University of Illinois at 13433 Urbana-Champaign}, 13434 number = {1029}, 13435 year = {1990} 13436} 13437 13438@TechReport{ pde-user-ref, 13439 author = {Barry F. Smith}, 13440 title = {Extensible {PDE} Solvers Package Users Manual}, 13441 institution = {Argonne National Laboratory}, 13442 month = sep, 13443 year = {1994}, 13444 number = {ANL-93/40}, 13445 key = {Smith94 ! PDE} 13446} 13447 13448@TechReport{ bs-user-ref, 13449 author = {Mark T. Jones and Paul E. Plassmann}, 13450 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 13451 of Sparse Linear Systems}, 13452 institution = {Argonne National Laboratory}, 13453 month = dec, 13454 year = {1995}, 13455 number = {ANL-95/48} 13456} 13457 13458@TechReport{ snes-user-ref, 13459 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 13460 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 13461 institution = {Argonne National Laboratory}, 13462 month = feb, 13463 year = {1995}, 13464 number = {ANL/MCS-TM-193}, 13465 key = {GroppMcInnesSmith95 ! SNES} 13466} 13467 13468@TechReport{ sles-user-ref, 13469 author = {William D. Gropp and Barry F. Smith}, 13470 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 13471 institution = {Argonne National Laboratory}, 13472 month = mar, 13473 year = {1993}, 13474 number = {ANL-93/8}, 13475 key = {GroppSmith93 ! SLES} 13476} 13477 13478@TechReport{ chameleon-user-ref, 13479 author = {William D. Gropp and Barry F. Smith}, 13480 title = {Chameleon Parallel programming tools Users Manual}, 13481 institution = {Argonne National Laboratory}, 13482 month = mar, 13483 year = {1993}, 13484 number = {ANL-93/23}, 13485 key = {GroppSmith93 ! Chameleon} 13486} 13487 13488@Article{ euclid2, 13489 author = {D. Hysom and A. Pothen}, 13490 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 13491 journal = {SIAM J. Sci. Comput.}, 13492 volume = {22}, 13493 number = {6}, 13494 pages = {2194--2215} 13495} 13496 13497@TechReport{ euclid1, 13498 author = {D. Hysom and A. Pothen}, 13499 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 13500 Solution of Sparse Linear Systems)}, 13501 institution = {Old Dominion University}, 13502 year = {2001} 13503} 13504 13505@TechReport{ ksp-user-ref, 13506 author = {William D. Gropp and Barry F. Smith}, 13507 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 13508 Methods}, 13509 institution = {Argonne National Laboratory}, 13510 month = aug, 13511 year = {1993}, 13512 number = {ANL-93/30}, 13513 key = {GroppSmith93 ! KSP} 13514} 13515 13516@TechReport{ mpi-chameleon, 13517 author = {William D. Gropp and Ewing Lusk}, 13518 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 13519 institution = {Argonne National Laboratory}, 13520 month = dec, 13521 year = {1992}, 13522 number = {ANL-92/47}, 13523 key = {GroppLusk92 ! MPI} 13524} 13525 13526@TechReport{ blockcomm-fortran, 13527 author = {William D. Gropp}, 13528 title = {Block{C}omm for {F}ortran}, 13529 institution = {Argonne National Laboratory}, 13530 month = may, 13531 year = {1993}, 13532 number = {ANL-93/00 (to appear)}, 13533 key = {Gropp93 ! BlockComm} 13534} 13535 13536@TechReport{ autodocument, 13537 author = {William D. Gropp}, 13538 title = {Automatic documentation of {C} programs}, 13539 institution = {Argonne National Laboratory}, 13540 month = may, 13541 year = {1993}, 13542 number = {ANL-93/00}, 13543 key = {Gropp93 ! Autodoc} 13544} 13545 13546@TechReport{ zipcode, 13547 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 13548 Manfred Morari}, 13549 title = {The {Z}ipcode message-passing system}, 13550 institution = {Lawrence Livermore National Laboratory}, 13551 month = sep, 13552 year = {1992}, 13553 number = {Unpublished}, 13554 key = {Skjellum92 ! Zipcode} 13555} 13556 13557@Article{ paragraph, 13558 author = {Michael T. Heath and Jennifer Etheridge Finger}, 13559 title = {Visualizing performance of parallel programs}, 13560 journal = {IEEE Software}, 13561 volume = {8}, 13562 number = {5}, 13563 month = sep, 13564 year = {1991}, 13565 pages = {29--39}, 13566 key = {Heath91 ! Paragraph} 13567} 13568 13569@Article{ gropp90, 13570 author = {William Gropp and Edward Smith}, 13571 title = {Computational Fluid Dynamics on Parallel Processors}, 13572 journal = {Computers and Fluids}, 13573 volume = {18}, 13574 year = {1990}, 13575 pages = {289--304}, 13576 key = {Gropp90 ! performance} 13577} 13578 13579@Article{ foster92, 13580 author = {Ian Foster and William Gropp and Rick Stevens}, 13581 title = {The parallel scalability of the spectral transform method}, 13582 journal = {Monthly Weather Review}, 13583 volume = {120}, 13584 year = {1992}, 13585 pages = {835--850}, 13586 key = {Foster92 ! performance} 13587} 13588 13589@InBook{ fgn, 13590 author = {R. Freund and G. H. Golub and N. Nachtigal}, 13591 title = {Iterative Solution of Linear Systems}, 13592 series = {Acta Numerica}, 13593 year = {1992}, 13594 publisher = {Cambridge University Press}, 13595 pages = {57--100} 13596} 13597 13598@TechReport{ nachtigal90, 13599 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 13600 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13601 institution = {Massachusetts Institute of Technology}, 13602 month = mar, 13603 year = {1990}, 13604 number = {90-2}, 13605 key = {Nachtigal | Krylov} 13606} 13607 13608@Article{ nachtigal1992fnm, 13609 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13610 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 13611 journal = {SIAM Journal on Matrix Analysis and Applications}, 13612 volume = {13}, 13613 pages = {778}, 13614 year = {1992}, 13615 publisher = {SIAM} 13616} 13617 13618@TechReport{ embree1999descriptive, 13619 title = {How descriptive are {GMRES} convergence bounds}, 13620 author = {Embree, M.}, 13621 year = {1999}, 13622 number = {08}, 13623 institution = {Oxford University Computing Laboratory} 13624} 13625 13626@Article{ vorst92, 13627 author = {H. van der Vorst}, 13628 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 13629 of nonsymmetric linear systems}, 13630 journal = {SIAM J. Sci. Stat. Comput.}, 13631 year = {1992}, 13632 volume = {13}, 13633 pages = {631--644} 13634} 13635 13636@Article{ eisenstat81, 13637 author = {S. Eisenstat}, 13638 title = {Efficient Implementation of a Class of {CG} Methods}, 13639 journal = {SIAM J. Sci. Stat. Comput.}, 13640 year = {1981}, 13641 volume = {2}, 13642 pages = {1--4} 13643} 13644 13645@Manual{ ibm-essl, 13646 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 13647 Reference}, 13648 organization = {IBM}, 13649 year = {1992}, 13650 key = {IBM-ESSL} 13651} 13652 13653@Manual{ ibm-eui, 13654 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 13655 Release 2.0}, 13656 organization = {IBM}, 13657 month = jun, 13658 year = {1994}, 13659 key = {IBM-EUI} 13660} 13661 13662@Manual{ ibm-euih, 13663 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 13664 organization = {IBM}, 13665 author = {Peter Hochschild}, 13666 year = {1993}, 13667 key = {IBM-EUIH} 13668} 13669 13670@TechReport{ mpi, 13671 title = {Document for a Standard Message-Passing Interface}, 13672 author = {Message Passing Interface Forum}, 13673 institution = {University of Tennessee}, 13674 number = {CS-93-214}, 13675 month = nov, 13676 year = {1993}, 13677 key = {MPI Standard} 13678} 13679 13680@Unpublished{ mpi-final-web, 13681 author = {Message Passing Interface Forum}, 13682 title = {{MPI}: A Message-Passing Interface Standard}, 13683 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 13684 year = {1994}, 13685 month = may 13686} 13687 13688@Book{ hockney-jesshope, 13689 author = {R. W. Hockney and C. R. Jesshope}, 13690 title = {Parallel Computers 2}, 13691 publisher = {Adam Hilger}, 13692 year = {1988} 13693} 13694 13695@Book{ cm-fortran, 13696 author = {{Thinking Machines Corporation}}, 13697 title = {Users Manual for CM-Fortran}, 13698 publisher = {Thinking Machines Corporation}, 13699 year = {1993} 13700} 13701 13702@TechReport{ chang93, 13703 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 13704 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 13705 institution = {Yale Department of Computer Science}, 13706 number = {YALEU/DCS/RR-994}, 13707 month = nov, 13708 year = {1993}, 13709 key = {BDD|diag} 13710} 13711 13712@InProceedings{ gropplevine93, 13713 author = {N. Galbreath and W. Gropp and D. Levine}, 13714 title = {Applications-Driven Parallel {I/O}}, 13715 booktitle = {Proceedings of Supercomputing '93}, 13716 year = {1993}, 13717 pages = {462--471} 13718} 13719 13720@Book{ siegle85, 13721 author = {H. J. Siegel}, 13722 title = {Interconnection Networks for Large Scale Parallel Processing}, 13723 publisher = {Lexington Books}, 13724 year = {1985}, 13725 key = {Network Comparison} 13726} 13727 13728@Article{ lawrie75, 13729 author = {D. H. Lawrie}, 13730 title = {Access and alignment of data in an array processor}, 13731 journal = {IEEE Transactions on Computers}, 13732 volume = {C-24}, 13733 number = {12}, 13734 month = dec, 13735 year = {1975}, 13736 pages = {1145--1155}, 13737 key = {Omega Network} 13738} 13739 13740@Book{ knuth1986, 13741 title = {The {\TeX}{Book}}, 13742 author = {Donald Ervin Knuth and Duane Bibby}, 13743 volume = {1993}, 13744 year = {1986}, 13745 publisher = {Addison-Wesley Reading, Massachusetts} 13746} 13747 13748@Book{ lamport86, 13749 author = {Leslie Lamport}, 13750 title = {{LaTeX}: A document preparation system}, 13751 publisher = {Addison-Wesley}, 13752 year = {1986}, 13753 key = {Latex Manual} 13754} 13755 13756@InProceedings{ gropp-lusk:unix-tools, 13757 author = {William Gropp and Ewing Lusk}, 13758 title = {Scalable {U}nix Tools on Parallel Processors}, 13759 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 13760 publisher = {IEEE}, 13761 pages = {56--62} 13762} 13763 13764@InProceedings{ jp:bell_prize, 13765 author = {Mark Jones and Paul Plassmann}, 13766 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 13767 Applications}, 13768 booktitle = {Proceedings of Supercomputing '92}, 13769 publisher = {IEEE Computer Society Press}, 13770 year = {1992}, 13771 pages = {551--560} 13772} 13773 13774@COMMENT{WEB, CWEB references (for doctext)} 13775@TechReport{ web, 13776 author = {Donald E. Knuth}, 13777 title = {The {\tt WEB} system of structured documentation}, 13778 institution = {Computer Science Department, Stanford University}, 13779 year = {1983}, 13780 number = {980}, 13781 month = sep 13782} 13783 13784@Article{ literatepgm, 13785 author = {Donald E. Knuth}, 13786 title = {Literate Programming}, 13787 journal = {Computer Journal}, 13788 year = {1984}, 13789 volume = {27}, 13790 number = {2}, 13791 pages = {91--111} 13792} 13793 13794@Unpublished{ cweb-code, 13795 author = {Silvio Levy and Donald E. Knuth}, 13796 title = {CWEB}, 13797 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 13798} 13799 13800@Article{ jp:scalable, 13801 author = {Mark Jones and Paul Plassmann}, 13802 title = {Scalable Iterative Solution of Sparse Linear Systems}, 13803 journal = {Parallel Computing}, 13804 volume = {20}, 13805 number = {5}, 13806 month = may, 13807 year = {1994}, 13808 pages = {753--773} 13809} 13810 13811@Article{ jp:pcolor, 13812 author = {Mark T. Jones and Paul E. Plassmann}, 13813 title = {A Parallel Graph Coloring Heuristic}, 13814 journal = {SIAM J. Sci. Comput.}, 13815 volume = {14}, 13816 number = {3}, 13817 pages = {654-669}, 13818 year = {1993} 13819} 13820 13821@TechReport{ block_solve, 13822 author = {Mark T. Jones and Paul E. Plassmann}, 13823 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 13824 Sparse Linear Systems}, 13825 institution = {Argonne National Laboratory}, 13826 year = {1992}, 13827 number = {ANL-92/46}, 13828 key = {JonesPlassmann92 ! block_solve} 13829} 13830 13831@InProceedings{ supercond, 13832 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 13833 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 13834 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 13835 Conference}, 13836 month = feb, 13837 year = {1994}, 13838 key = {McInnesPalumbo94 ! superconductivity } 13839} 13840 13841@Unpublished{ preosti:93, 13842 author = {Gianfranco Preosti}, 13843 title = { }, 13844 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 13845 year = {1993}, 13846 key = {preosti93 ! GL-tilt3d} 13847} 13848 13849@Unpublished{ more:93, 13850 author = {Jorge J. Mor\'{e}}, 13851 title = { }, 13852 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 13853 {A}rgonne {N}ational {L}aboratory}, 13854 year = {1993}, 13855 key = {more93 ! MINPACK-2} 13856} 13857 13858@Article{ brownsaad:90, 13859 author = {Peter N. Brown and Youcef Saad}, 13860 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 13861 journal = {SIAM J. Sci. Stat. Comput.}, 13862 year = {1990}, 13863 volume = {11}, 13864 pages = {450-481} 13865} 13866 13867@Book{ using-mpi, 13868 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 13869 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 13870 publisher = {MIT Press}, 13871 year = {1994} 13872} 13873 13874@Book{ using-mpi2, 13875 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 13876 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 13877 publisher = {MIT Press}, 13878 year = {1999} 13879} 13880 13881@Article{ hs:52, 13882 author = {Magnus R. Hestenes and Eduard Steifel}, 13883 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 13884 journal = {J. Research of the National Bureau of Standards}, 13885 year = {1952}, 13886 volume = {49}, 13887 pages = {409-436} 13888} 13889 13890@Article{ so:89, 13891 author = {Peter Sonneveld}, 13892 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 13893 journal = {SIAM J. Sci. Stat. Comput.}, 13894 year = {1989}, 13895 volume = {10}, 13896 pages = {36-52} 13897} 13898 13899@Article{ v:92, 13900 author = {{H. A.} {van der Vorst}}, 13901 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 13902 of nonsymmetric linear systems}, 13903 journal = {SIAM J. Sci. Stat. Comput.}, 13904 volume = {13}, 13905 year = {1992}, 13906 pages = {631-644} 13907} 13908 13909@Article{ f:93, 13910 author = {Roland W. Freund}, 13911 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 13912 Systems}, 13913 journal = {SIAM J. Sci. Stat. Comput.}, 13914 volume = {14}, 13915 year = {1993}, 13916 pages = {470-482} 13917} 13918 13919@Article{ ish:89, 13920 author = {S. Ishizuka}, 13921 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 13922 journal = {Combustion and Flame}, 13923 volume = {75}, 13924 year = {1989}, 13925 pages = {367-379} 13926} 13927 13928@Book{ williams89, 13929 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 13930 author = {F.A. Williams}, 13931 publisher = {Addison-Wesley}, 13932 year = {1989}, 13933 pages = {367-379} 13934} 13935 13936@Book{ ra75, 13937 author = {R. Aris}, 13938 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 13939 publisher = {Oxford}, 13940 year = {1975} 13941} 13942 13943@Book{ bebernes89, 13944 author = {J. Bebernes and D. Eberly}, 13945 title = {Mathematical Problems from Combustion Theory}, 13946 publisher = {Springer-Verlag}, 13947 series = {Applied Mathematical Sciences 83}, 13948 year = {1989} 13949} 13950 13951@InProceedings{ kikuchi89, 13952 author = {F. Kikuchi}, 13953 booktitle = { Computing Methods in Applied Sciences and Engineering}, 13954 editor = {R. Glowinski and J. L. Lions}, 13955 publisher = {Springer-Verlag}, 13956 series = {Lecture Notes in Mathematics}, 13957 title = {Finite element approximations to bifurcation problems of turning point type}, 13958 year = {1977} 13959} 13960 13961@Article{ rg85, 13962 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 13963 title = {Continuation-conjugate Gradient Methods for the Least Squares Solution of 13964 Nonlinear Boundary Problems}, 13965 journal = {SIAM J. Sci. Stat. Comput.}, 13966 volume = {6}, 13967 year = {1985}, 13968 pages = {793-832} 13969} 13970 13971@InProceedings{ whitfield91, 13972 author = {D. Whitfield and L. Taylor}, 13973 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13974 Schemes}, 13975 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 13976 misc = {AIAA-91-1539}, 13977 pages = {134-145}, 13978 year = {1991} 13979} 13980 13981@InProceedings{ quinlan1, 13982 author = {M. Lemke and D. Quinlan}, 13983 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 13984 Architecture-Independent Development of Structured Grid Applications}, 13985 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 13986 publisher = {Springer Verlag}, 13987 year = {1992} 13988} 13989 13990@InProceedings{ quinlan2, 13991 author = {R. Parsons and D. Quinlan}, 13992 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 13993 Computations}, 13994 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 13995 year = {1994} 13996} 13997 13998% ***** Overview of functionality in Diffpack 13999@InBook{ dpoverview, 14000 author = {Bruaset, A. M. and Langtangen, H. P.}, 14001 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14002 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 14003 {Diffpack}}, 14004 publisher = {Birkh{\"{a}}user}, 14005 pages = {61--90}, 14006 year = {1997} 14007} 14008 14009% ***** Short overview of Diffpack 14010@InCollection{ dpoverview2, 14011 author = {Bruaset, A. M. and Langtangen, H. P.}, 14012 editor = {A. Sydow}, 14013 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 14014 and Applied Mathematics}, 14015 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 14016 pages = {553--558}, 14017 volume = {4}, 14018 year = {1997} 14019} 14020 14021% ***** Comprehensive documentation of Diffpack and 14022% associated numerical methods: 14023@Book{ dpbook, 14024 author = {H. P. Langtangen}, 14025 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 14026 Software. Part I}, 14027 series = {Lecture Notes in Computational Science and Engineering}, 14028 publisher = {Springer-Verlag}, 14029 year = {1998} 14030} 14031 14032% ***** Design issues of the linear solvers in Diffpack, serves also as a 14033% collection of examples on O-O in numerical computing 14034@Article{ ambhpl97a, 14035 author = {A. M. Bruaset and H. P. Langtangen }, 14036 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 14037 journal = {Transactions on Mathematical Software}, 14038 volume = {23 }, 14039 pages = {50--80}, 14040 year = {1997} 14041} 14042 14043@Misc{ dpurl, 14044 author = {{Diffpack Web page}}, 14045 howpublished = {\url{http://www.diffpack.com}} 14046} 14047 14048% ***** General intro to object-oriented numerics for "FORTRAN programmers" 14049@InCollection{ oonintro, 14050 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 14051 editor = {D{\ae}hlen, M. and Tveito, A.}, 14052 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14053 title = {Object-Oriented Numerics}, 14054 publisher = {Birkh{\"{a}}user}, 14055 year = {1997} 14056} 14057 14058% ***** Efficiency comparison: BLAS 1, Diffpack, C, 14059% and finite element applications (F77 vs Diffpack) 14060@InCollection{ dpefficiency, 14061 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 14062 H. P. and Miller, C. T.}, 14063 editor = {D{\ae}hlen, M. and Tveito, A.}, 14064 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14065 title = {On the Efficiency of {C++} in Scientific Computing}, 14066 publisher = {Birkh{\"{a}}user}, 14067 pages = {91--118}, 14068 year = {1997} 14069} 14070 14071% ***** Parallel concept in Diffpack: 14072@InCollection{ dpparallel, 14073 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 14074 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 14075 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 14076 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 14077 Simulators}, 14078 publisher = {Springer--Verlag}, 14079 series = {Lecture Notes in Computer Science}, 14080 pages = {161--168}, 14081 year = {1997} 14082} 14083 14084% ***** DD and ML methods in Diffpack: 14085@InCollection{ dpddml, 14086 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 14087 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 14088 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 14089 title = {Domain decomposition and multilevel methods in Diffpack}, 14090 year = {1997} 14091} 14092 14093@InProceedings{ bsca98, 14094 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 14095 Alexander}, 14096 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 14097 Optimization}, 14098 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14099 Scientific and Engineering Computing}, 14100 editor = {Mike Henderson et al.}, 14101 pages = {165-173}, 14102 year = {1998} 14103} 14104 14105@Book{ scalapack-user-guide, 14106 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 14107 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 14108 Stanley and D. Walker and R. C. Whaley}, 14109 title = {Sca{LAPACK} Users' Guide}, 14110 publisher = {SIAM}, 14111 address = {Philadelphia, PA}, 14112 year = {1997} 14113} 14114 14115@InProceedings{ keyes99, 14116 author = {D. E. Keyes}, 14117 title = {How Scalable is Domain Decomposition in Practice?}, 14118 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 14119 Methods}, 14120 editor = {C.-H. Lai et al.}, 14121 publisher = {Domain Decomposition Press, Bergen}, 14122 note = {To appear}, 14123 year = {1999} 14124} 14125 14126@Article{ fun3d, 14127 author = {W. K. Anderson and D. L. Bonhaus}, 14128 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 14129 grids}, 14130 journal = {Computers and Fluids}, 14131 year = {1994}, 14132 volume = {23}, 14133 pages = {1--21} 14134} 14135 14136% ------------------------------------------------------------------------- 14137% ------------------------------------------------------------------------- 14138@Article{ torczon, 14139 author = {Dennis, Jr., J. E. and V.~Torczon}, 14140 title = {Direct Search Methods on Parallel Machines}, 14141 journal = {SIAM J. Optimization}, 14142 volume = {1}, 14143 pages = {448--474}, 14144 year = {1991}, 14145 key = {Torczon !PDS} 14146} 14147 14148@InProceedings{ wt91, 14149 author = {D. L. Whitfield and L. K. Taylor}, 14150 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 14151 Schemes}, 14152 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 14153 misc = {AIAA-91-1539}, 14154 pages = {134-145}, 14155 year = {1991} 14156} 14157 14158@Article{ ew96, 14159 author = {S. C. Eisenstat and H. F. Walker}, 14160 title = {Choosing the forcing terms in an inexact {N}ewton method}, 14161 journal = {SIAM J. Scientific Computing}, 14162 volume = {17}, 14163 year = {1996}, 14164 pages = {16--32} 14165} 14166 14167@Book{ thi93, 14168 author = {{Thinking Machines Corporation}}, 14169 title = {Users Manual for CM-Fortran}, 14170 publisher = {Thinking Machines Corporation}, 14171 year = {1993} 14172} 14173 14174@Book{ mortonmayers94, 14175 author = {K. W. Morton and D. F. Mayers}, 14176 title = {Numerical Solution of Partial Differential Equations}, 14177 publisher = {Press Syndicate of the University of Cambridge}, 14178 year = {1994} 14179} 14180 14181@Book{ heath97, 14182 author = {Michael T. Heath}, 14183 title = {Scientific Computing: An Introductory Survey}, 14184 publisher = {McGraw Hill}, 14185 year = {1997} 14186} 14187 14188@Article{ captools96, 14189 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 14190 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 14191 Performance on the Parallelization of Structured Mesh Codes}, 14192 journal = {Parallel Computing}, 14193 volume = {22}, 14194 pages = {197-226}, 14195 year = {1996} 14196} 14197 14198@Misc{ nastran-web-page, 14199 author = {{MSC Software Corporation}}, 14200 title = {{NASTRAN} {W}eb page}, 14201 howpublished = {\url{http://www.mechsolutions.com/products/nastran/}}, 14202 year = {2024} 14203} 14204 14205@Book{ hpf, 14206 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 14207 Zosel}, 14208 title = {The High Performance Fotran Handbook}, 14209 publisher = {MIT Press}, 14210 year = {1994} 14211} 14212 14213@InProceedings{ keyes98, 14214 author = {D. E. Keyes}, 14215 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 14216 Architectures}, 14217 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 14218 editors = {M. D. Salas and W. K. Anderson}, 14219 ppublisher = {Elsevier}, 14220 year = {1998} 14221} 14222 14223@InProceedings{ pooma-atlas, 14224 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 14225 J. V. W. Reynders and M. Tholburn}, 14226 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 14227 Applications}, 14228 year = {1995}, 14229 month = dec, 14230 booktitle = {Supercomputing '95 Proceedings} 14231} 14232 14233% --------------------------------------------------------------------------------- 14234% New bib entries for CRPC paper 14235@Misc{ mgnet-web-page, 14236 author = {Craig C. Douglas}, 14237 title = {{MGNet Web page}}, 14238 note = {See {\tt http://\-www.mgnet.org}} 14239} 14240 14241@Misc{ dagh-web-page, 14242 author = {M. Parashar and J. C. Browne}, 14243 title = {{DAGH Web page}}, 14244 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 14245} 14246 14247@Misc{ parasol-web-page, 14248 key = {PARASOL}, 14249 title = {{PARASOL Web page}}, 14250 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 14251} 14252 14253@Misc{ pooma-web-page, 14254 author = {{POOMA Web page}}, 14255 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 14256} 14257 14258@Misc{ mudpack-web-page, 14259 author = {John C. Adams}, 14260 title = {{MUDPACK Web page}}, 14261 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 14262} 14263 14264@Misc{ pellpack-web-page, 14265 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 14266 title = {{Parallel ELLPACK Web page}}, 14267 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 14268} 14269 14270@InProceedings{ pellpack95, 14271 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 14272 Catlin and S. Weerawarana and T.S. Papatheodorou}, 14273 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 14274 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 14275 address = {Albuquerque, NM}, 14276 year = {1995} 14277} 14278 14279@Misc{ nhse-web-page, 14280 author = {{National High-Performance Software Exchange Web page}}, 14281 note = {See {\tt http://\-www.nhse.org}} 14282} 14283 14284@Misc{ doug-web-page, 14285 author = {Mark J. Hagger and Linda Stals}, 14286 title = {{DOUG Web Page}}, 14287 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 14288} 14289 14290@TechReport{ doug97, 14291 author = {Mark J. Hagger}, 14292 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 14293 institution = {Mathematical Sciences, University of Bath}, 14294 year = {1997}, 14295 number = {9706}, 14296 note = {Advances in Computational Mathematics (to appear)} 14297} 14298 14299@Misc{ ug-web-page, 14300 author = {{UG Web Page}}, 14301 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 14302} 14303 14304@Article{ ug97, 14305 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 14306 Rentz-Reichert and C. Wieners}, 14307 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 14308 journal = {Computing and Visualization in Science}, 14309 year = {1997}, 14310 volume = {}, 14311 pages = {} 14312} 14313 14314@Misc{ vecfem-web-page, 14315 author = {Lutz Grosz}, 14316 title = {{VECFEM Web Page}}, 14317 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 14318} 14319 14320@Misc{ atlas-web-page, 14321 author = {R. Clint {Whaley et al.}}, 14322 title = {{ATLAS Web Page}}, 14323 howpublished = {\url{http://math-atlas.sourceforge.net}} 14324} 14325 14326@Misc{ fenics-web-page, 14327 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 14328 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 14329 title = {{FEniCS Web Page}}, 14330 note = {\url{http://www.fenicsproject.org}}, 14331 year = {2005} 14332} 14333 14334@Misc{ matlab-web-page, 14335 author = {{The} {MathWorks}}, 14336 title = {{Matlab} {Web} page}, 14337 url = {http://www.mathworks.com} 14338} 14339 14340@Misc{ phipac-web-page, 14341 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 14342 and D. Lam}, 14343 title = {{PHiPAC Web Page}}, 14344 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 14345} 14346 14347@InProceedings{ kelp, 14348 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 14349 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 14350 booktitle = {Irregular '96}, 14351 year = {1996} 14352} 14353 14354@Unpublished{ kelp-web-page, 14355 author = {Scott Baden}, 14356 title = {{KeLP} {W}eb page}, 14357 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 14358} 14359 14360@InProceedings{ hk99, 14361 author = {R. Hornung and S. Kohn}, 14362 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 14363 Framework}, 14364 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 14365 Scientific and Engineering Computing}, 14366 pages = {235-244}, 14367 year = {1999}, 14368 note = {See \url{http://www.llnl.gov/CASC/samrai}} 14369} 14370 14371@Unpublished{ samrai-web-page, 14372 title = {{SAMRAI} {W}eb Page}, 14373 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 14374 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 14375} 14376 14377@Misc{ overture-web-page, 14378 author = {William Henshaw and Kyle Chand}, 14379 title = {{Overture} {W}eb page}, 14380 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 14381} 14382 14383@InProceedings{ overture99, 14384 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 14385 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 14386 on Overlapping Grids}, 14387 publisher = {SIAM}, 14388 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14389 Scientific and Engineering Computing}, 14390 year = {1999}, 14391 pages = {215-224}, 14392 note = {See \url{http://www.llnl.gov/CASC/Overture}} 14393} 14394 14395@InProceedings{ diffpack, 14396 author = {A.M. Bruaset and H.P. Langtangen}, 14397 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 14398 {D}iffpack}, 14399 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 14400 year = {1997}, 14401 pages = {61--90}, 14402 publisher = {Birkhauser Press} 14403} 14404 14405@Article{ dongarra:1984:ila, 14406 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 14407 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 14408 Machine}, 14409 journal = {SIAM Review}, 14410 volume = {26}, 14411 number = {1}, 14412 pages = {91--112}, 14413 month = jan, 14414 year = {1984}, 14415 coden = {SIREAD}, 14416 issn = {0036-1445 (print), 1095-7200 (electronic)}, 14417 mrclass = {65F10 (65F30)}, 14418 mrnumber = {85c:65032}, 14419 bibdate = {Mon Jan 20 1997}, 14420 abstract = {The authors examine common implementations of linear algebra algorithms, such as 14421 matrix-vector multiplication, matrix-matrix multiplication and the solution of 14422 linear equations. The different versions are examined for efficiency on a computer 14423 architecture which uses vector processing and has pipelined instruction execution. 14424 By using the advanced architectural features of such machines, one can usually 14425 achieve maximum performance, and tremendous improvements in terms of execution 14426 speed can be seen over conventional computers.}, 14427 classification= {723; 921}, 14428 journalabr = {SIAM Rev}, 14429 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 14430 mathematical programming; vector pipeline machine} 14431} 14432 14433@Book{ qv99, 14434 author = {Alfio Quarteroni and Alberto Valli}, 14435 title = {Domain Decomposition Methods for Partial Differential Equations}, 14436 publisher = {Oxford Science Publications}, 14437 address = {Oxford}, 14438 year = {1999} 14439} 14440 14441@Book{ ksv97, 14442 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 14443 title = {Parallel Numerical Algorithms}, 14444 publisher = {Kluwer Academic Publishers}, 14445 address = {the Netherlands}, 14446 year = {1997} 14447} 14448 14449@Book{ hackbusch94, 14450 author = {Wolfgang Hackbusch}, 14451 title = {Iterative Solution of Large Sparse Systems of Equations}, 14452 publisher = {Springer-Verlag}, 14453 address = {New York}, 14454 year = {1994} 14455} 14456 14457@Article{ hackbusch1980fast, 14458 title = {Fast solution of elliptic control problems}, 14459 author = {Hackbusch, W.}, 14460 journal = {Journal of Optimization Theory and Applications}, 14461 volume = {31}, 14462 number = {4}, 14463 pages = {565--581}, 14464 year = {1980}, 14465 publisher = {Springer} 14466} 14467 14468@Book{ hackbusch1985multi, 14469 title = {{Multi-grid methods and applications}}, 14470 author = {Hackbusch, W.}, 14471 isbn = {3540127615}, 14472 issn = {0179-3632}, 14473 year = {1985}, 14474 publisher = {Springer Verlag} 14475} 14476 14477@Book{ axelsson94, 14478 author = {Owe Axelsson}, 14479 title = {Iterative Solution Methods}, 14480 publisher = {Cambridge University Press}, 14481 address = {Cambridge}, 14482 year = {1994} 14483} 14484 14485@Book{ saad96, 14486 author = {Yousef Saad}, 14487 title = {Iterative Methods for Sparse Linear Systems}, 14488 publisher = {PWS Publishing Company}, 14489 address = {Boston}, 14490 year = {1996} 14491} 14492 14493@Book{ saad2003, 14494 title = {Iterative Methods for Sparse Linear Systems}, 14495 author = {Saad, Yousef}, 14496 doi = {10.1016/S1570-579X(01)80025-2}, 14497 edition = {2nd}, 14498 publisher = {SIAM}, 14499 year = {2003} 14500} 14501 14502@Book{ vandervorst03, 14503 author = {Henk A. {van der Vorst}}, 14504 title = {Iterative Krylov Methods for Large Linear Systems}, 14505 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 14506 year = {2003} 14507} 14508 14509@Book{ koniges00, 14510 editor = {Alice E. Koniges}, 14511 title = {Industrial Strength Parallel Computing}, 14512 publisher = {Morgan Kaufmann Publishers}, 14513 address = {San Francisco}, 14514 year = {2000} 14515} 14516 14517@Misc{ fftw-web-page, 14518 key = {Fftw}, 14519 title = {{FFTW} {Web} page}, 14520 note = {\texttt{http://www.fftw.org/}}, 14521 annote = {fast FFT. Parallel versions with MPI and Cilk} 14522} 14523 14524@InProceedings{ frigojohnson93, 14525 author = {Matteo Frigo and Steven G. Johnson}, 14526 title = {The Design and Implementation of {FFTW3}}, 14527 booktitle = {Proceedings of the IEEE}, 14528 volume = {93}, 14529 number = {2}, 14530 pages = {216--231}, 14531 year = {2005} 14532} 14533 14534@Book{ kelley95, 14535 author = {C. T. Kelley}, 14536 title = {Iterative Methods for Linear and Nonlinear Equations}, 14537 year = {1995}, 14538 publisher = {SIAM}, 14539 address = {Philadelphia} 14540} 14541 14542@Unpublished{ spai-web-page, 14543 title = {{SPAI} {W}eb {P}age}, 14544 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 14545 author = {Steven Bernard and Marcus Grote}, 14546 institution = {NASA Ames Research Center and ETH Zurich} 14547} 14548 14549@Article{ gh97, 14550 author = {M. J. Grote and T. Huckle}, 14551 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 14552 year = {1997}, 14553 journal = {SIAM J. of Scient. Comput.}, 14554 volume = {18}, 14555 pages = {838-853} 14556} 14557 14558@Article{ zhang96, 14559 author = {Wen Zhang}, 14560 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 14561 simulation of a sintering process}, 14562 year = {1996}, 14563 journal = {Appl. Numer. Math.}, 14564 volume = {20}, 14565 pages = {235-244} 14566} 14567 14568@Article{ zhang98, 14569 author = {Wen Zhang and Ian Gladwell}, 14570 title = {The sintering of two particles by surface and grain boundary diffusion - a 14571 three-dimensional numerical study}, 14572 journal = {Comp. Mater. Sci.}, 14573 year = {1998}, 14574 volume = {12} 14575} 14576 14577@InProceedings{ mollerschwartzbach01, 14578 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 14579 title = {The Pointer Assertion Logic Engine}, 14580 booktitle = {ACM Proceedings of PLDI'01}, 14581 year = {2001} 14582} 14583 14584@InProceedings{ klarlandschwartzbach97, 14585 author = {Nils Klarland and Michael I. Schwartzbach}, 14586 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 14587 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 14588 publisher = {USENIX}, 14589 month = oct, 14590 year = {1997}, 14591 address = {Santa Barbara, CA} 14592} 14593 14594@InProceedings{ conselmarlet98, 14595 author = {C. Consel and R. Marlet}, 14596 title = {Architecturing software using a methodology for language development}, 14597 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 14598 Implementations, Logics and Programs}, 14599 year = {1998}, 14600 pages = {170-174}, 14601 month = sep, 14602 address = {Pisa, Italy} 14603} 14604 14605@Misc{ sundials:homepage, 14606 author = {C. {Woodward et al.}}, 14607 title = {{SUNDIALS {W}eb page}}, 14608 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 14609} 14610 14611@article{gardner2022sundials, 14612 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 14613 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 14614 journal = {ACM Transactions on Mathematical Software (TOMS)}, 14615 publisher = {ACM}, 14616 year = {2022}, 14617 doi = {10.1145/3539801} 14618} 14619 14620@Misc{ sundials-user-ref, 14621 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14622 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 14623 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 14624 and Dan Shumaker and Carol Woodward}, 14625 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14626 number = {UCRL-JP-200037}, 14627 year = {2003} 14628} 14629 14630@Article{ sundials05, 14631 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 14632 and C. Woodward}, 14633 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14634 journal = {ACM Transactions on Mathematical Software}, 14635 volume = {31}, 14636 number = {3}, 14637 pages = {363--396}, 14638 year = {2005} 14639} 14640 14641@InProceedings{ serban2005cvodes, 14642 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 14643 author = {Serban, Radu and Hindmarsh, Alan C}, 14644 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 14645 Dynamics and Control, Long Beach, CA}, 14646 year = {2005} 14647} 14648 14649@Article{ pvode99, 14650 author = {G. Byrne and A. Hindmarsh}, 14651 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 14652 journal = {Int. J. High Perf. Comput. Apps.}, 14653 volume = {13}, 14654 number = {4}, 14655 year = {1999}, 14656 pages = {354 -- 365} 14657} 14658 14659@Article{ cvode95, 14660 author = {S. Cohen and A. Hindmarsh}, 14661 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 14662 journal = {Computers in Physics}, 14663 volume = {10}, 14664 number = {2}, 14665 year = {1996}, 14666 pages = {138 -- 143} 14667} 14668 14669@TechReport{ ifpack, 14670 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 14671 author = {Marzio Sala and Michael Heroux}, 14672 institution = {Sandia National Laboratories}, 14673 number = {SAND2005-0662}, 14674 year = {2005} 14675} 14676 14677@TechReport{ kinsol-user-ref, 14678 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 14679 Computers}, 14680 author = {Allan Taylor and Alan Hindmarsh}, 14681 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14682 number = {UCRL-ID-131185}, 14683 year = {1998} 14684} 14685 14686@Article{ fiardmanteuffelmccormick98, 14687 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 14688 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 14689 numerical results}, 14690 journal = {SIAM J. Sci. Comp.}, 14691 year = {1998}, 14692 volume = {19}, 14693 pages = {1958--1979} 14694} 14695 14696@InProceedings{ vuduc02, 14697 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 14698 Rajesh Nishtala and Benjamin Lee}, 14699 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 14700 booktitle = {Proceedings of Supercomputing}, 14701 year = {2002}, 14702 month = nov, 14703 address = {Baltimore} 14704} 14705 14706@Article{ beckerbraackrannacher1999, 14707 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 14708 elements}, 14709 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 14710 journal = {Combustion Theory and Modelling}, 14711 volume = {3}, 14712 pages = {503--534}, 14713 year = {1999} 14714} 14715 14716@Article{ beckerrannacher01, 14717 author = {R. Becker and R. Rannacher}, 14718 title = {An optimal control approach to a posteriori error estimation in finite element 14719 methods}, 14720 journal = {Acta Numerica}, 14721 year = {2001}, 14722 volume = {10}, 14723 pages = {1--102} 14724} 14725 14726@Article{ babuskamiller84a, 14727 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14728 title = {The post-processing approach in the finite element method, {I}: Calculations of 14729 displacements, stresses, and other higher derivatives of the displacements}, 14730 journal = {Int. J. Numer. Meth. Eng.}, 14731 year = {1984}, 14732 volume = {20}, 14733 pages = {1085--1109} 14734} 14735 14736@Article{ babuskamiller84b, 14737 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14738 title = {The post-processing approach in the finite element method, {II}: The calculation 14739 of stress intensity factors}, 14740 journal = {Int. J. Numer. Meth. Eng.}, 14741 year = {1984}, 14742 volume = {20}, 14743 pages = {1111--1129} 14744} 14745 14746@Article{ babuskamiller84c, 14747 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14748 title = {The post-processing approach in the finite element method, {III}: A posteriori 14749 error estimation and adaptive mesh refinement}, 14750 journal = {Int. J. Numer. Meth. Eng.}, 14751 year = {1984}, 14752 volume = {20}, 14753 pages = {2311--2324} 14754} 14755 14756@Unpublished{ jtb-web-page, 14757 title = {{The Java Tree Builder}}, 14758 note = {See \url{http://www.cs.purdue.edu/jtb}}, 14759 author = {Jens Palsberg}, 14760 institution = {Purdue University} 14761} 14762 14763@Unpublished{ palsberg98, 14764 title = {Why Visitors?}, 14765 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 14766 author = {Jens Palsberg}, 14767 institution = {Purdue University}, 14768 year = {1998} 14769} 14770 14771@Unpublished{ ply-web-page, 14772 title = {{PLY (Python Lex-Yacc)}}, 14773 note = {\url{http://systems.cs.chicago.edu/ply}}, 14774 author = {David Beazley}, 14775 institution = {University of Chicago} 14776} 14777 14778@Misc{ adic-web-page, 14779 title = {{ADIC Web page}}, 14780 note = {\url{http://www.mcs.anl.gov/autodiff}}, 14781 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 14782 institution = {Argonne National Laboratory} 14783} 14784 14785@Article{ naumann02, 14786 author = {Uwe Naumann}, 14787 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 14788 computational graph}, 14789 journal = {Mathematical Programming (to appear)}, 14790 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 14791 year = {2003} 14792} 14793 14794@Article{ kaper1, 14795 author = {H. G. Kaper and T. J. Kaper}, 14796 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 14797 journal = {Physica D}, 14798 year = {2002}, 14799 pages = {66--93}, 14800 volume = {165} 14801} 14802 14803@Misc{ veltisto-web-page, 14804 author = {George Biros}, 14805 title = {{Veltisto Web page}}, 14806 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 14807} 14808 14809@Article{ karypiskumar98, 14810 author = {George Karypis and Vipin Kumar}, 14811 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 14812 Ordering}, 14813 journal = {Journal of Parallel and Distributed Computing}, 14814 volume = {48}, 14815 pages = {71--85}, 14816 year = {1998} 14817} 14818 14819@TechReport{ karypiskumar97, 14820 author = {Karypis, George and Kumar, V.}, 14821 institution = {Department of Computer Science, University of Minnesota}, 14822 keywords = {graph partitioning; ParMetis}, 14823 note = {http://www.cs.umn.edu/~metis}, 14824 number = {97-060}, 14825 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 14826 year = {1997} 14827} 14828 14829@Misc{ parmetis-web-page, 14830 author = {George {Karypis et al.}}, 14831 title = {{ParMETIS Web page}}, 14832 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 14833 year = {2005} 14834} 14835 14836@Misc{ sparskit-web-page, 14837 author = {Yousef {Saad et al.}}, 14838 title = {{SPARSKIT Web page}}, 14839 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 14840} 14841 14842@Misc{ dscpack-web-page, 14843 author = {Padma Raghavan}, 14844 title = {{DSCPACK Web page}}, 14845 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 14846} 14847 14848@Misc{ gaussian-web-page, 14849 author = {}, 14850 title = {{Gaussian Web page}}, 14851 note = {\url{http://gaussian.com}}, 14852 key = {{Gaussian} {Web} page} 14853} 14854 14855@Book{ lapack-user-guide, 14856 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 14857 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 14858 Sorensen}, 14859 title = {LAPACK Users' Guide, Third Edition}, 14860 publisher = {SIAM}, 14861 year = {1999} 14862} 14863 14864@Manual{ nwchem4.1, 14865 author = {High Performance Computational Chemistry Group}, 14866 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 14867 year = {2002}, 14868 organization = {Pacific Northwest National Laboratory}, 14869 address = {Richland, Washington 99325-0999 USA}, 14870 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 14871} 14872 14873@TechReport{ tchem, 14874 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 14875 author = {Cosmin Safta and Habib Najm and Omar Knio}, 14876 institution = {Sandia National Laboratories}, 14877 number = {SAND2011-3282}, 14878 year = {2011} 14879} 14880 14881@Misc{ scidac-web-page, 14882 author = {}, 14883 title = {{{SciDAC Initiative Web page}}}, 14884 note = {\url{http://www.osti.gov/scidac}}, 14885 key = {{SciDAC Initiative Web page}} 14886} 14887 14888@Misc{ cmrs:homepage, 14889 author = {Amitava {Bhattacharjee (PI)}}, 14890 title = {{Center for Magnetic Reconnection Studies}}, 14891 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 14892} 14893 14894@Misc{ tops:homepage, 14895 author = {David {Keyes (PI)}}, 14896 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 14897 howpublished = {\url{http://scalablesolvers.org}} 14898} 14899 14900@Misc{ tstt:homepage, 14901 author = {David Brown and Jim Glimm and Lori Freitag}, 14902 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 14903 howpublished = {\url{http://www.tstt-scidac.org}}, 14904 year = {2005} 14905} 14906 14907@Misc{ petsc:applications, 14908 author = {B. F. {Smith et al.}}, 14909 title = {{Scientific Applications Using {PETSc}}}, 14910 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 14911} 14912 14913@Misc{ petsc:users, 14914 author = {B. F. {Smith et al.}}, 14915 title = {{PETSc User Statistics}}, 14916 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 14917} 14918 14919@Misc{ cemm:homepage, 14920 author = {Steve {Jardin (PI)}}, 14921 title = {{Center for Extended MHD Modeling}}, 14922 howpublished = {\url{http://w3.pppl.gov/CEMM}} 14923} 14924 14925@Misc{ m3d:homepage, 14926 author = {Steve {Jardin et al.}}, 14927 title = {{M3D Web page}}, 14928 howpublished = {\url{http://w3.pppl.gov/m3d}} 14929} 14930 14931@Misc{ nimrod:homepage, 14932 author = {Carl R. {Sovinec et al.}}, 14933 title = {{NIMROD Web page}}, 14934 howpublished = {http://nimrodteam.org} 14935} 14936 14937@Misc{ grace-web-page, 14938 author = {Manish {Parashar et al.}}, 14939 title = {{GrACE Web Page}}, 14940 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 14941} 14942 14943@Misc{ accel1, 14944 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 14945 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 14946 author = {K. Ko and R. Ryne (PIs)} 14947} 14948 14949@Unpublished{ katzspiegelman03, 14950 author = {Richard F. Katz and Marc Spiegelman}, 14951 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 14952 advection-diffusion problems}, 14953 note = {Columbia University, in preparation} 14954} 14955 14956@Misc{ acts:homepage, 14957 author = {}, 14958 title = {{Advanced CompuTational Software (ACTS) Web page}}, 14959 howpublished = {\url{http://acts.nersc.gov}}, 14960 key = {{Advanced CompuTational Software (ACTS) Web page}} 14961} 14962 14963@Article{ superlu99, 14964 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 14965 Joseph W. H. Liu}, 14966 title = {A supernodal approach to sparse partial pivoting}, 14967 journal = {SIAM J. Matrix Analysis and Applications}, 14968 year = {1999}, 14969 volume = {20}, 14970 number = {3}, 14971 pages = {720-755} 14972} 14973 14974@Misc{ superlu:homepage, 14975 author = {J. Demmel and J. Gilbert and X. Li}, 14976 title = {{SuperLU Web page}}, 14977 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 14978} 14979 14980@InProceedings{ ccf98, 14981 author = {E. Chow and A. Cleary and R. Falgout}, 14982 title = {Design of the hypre Preconditioner Library}, 14983 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14984 Scientific and Engineering Computing}, 14985 publisher = {SIAM}, 14986 year = {1999} 14987} 14988 14989@TechReport{ hypre-users-manual, 14990 author = {R. Falgout}, 14991 title = {{hypre} Users Manual}, 14992 number = {Revision 2.28}, 14993 institution = {Lawrence Livermore National Laboratory}, 14994 year = {2023}, 14995 url = {https://hypre.readthedocs.io/} 14996} 14997 14998@Misc{ hypre:homepage, 14999 author = {R. Falgout}, 15000 title = {{hypre Web page}}, 15001 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 15002} 15003 15004@InProceedings{ trilinos:gpu, 15005 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 15006 title = {A Light-weight API for Portable Multicore Programming}, 15007 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 15008 Network-Based Processing (PDP)}, 15009 pages = {601--606}, 15010 publisher = {IEEE}, 15011 year = {2010} 15012} 15013 15014@InProceedings{ heroux2004design, 15015 title = {The design of {T}rilinos}, 15016 author = {Heroux, Michael A and Sala, Marzio}, 15017 booktitle = {International Workshop on Applied Parallel Computing}, 15018 pages = {620--628}, 15019 year = {2004}, 15020 organization = {Springer} 15021} 15022 15023@Misc{ trilinos:homepage, 15024 author = {M. {Heroux et al.}}, 15025 title = {{Trilinos Web page}}, 15026 howpublished = {{\tt http://trilinos.sandia.gov/}} 15027} 15028 15029@Article{ trilinos:overview, 15030 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 15031 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 15032 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 15033 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 15034 Kendall S. Stanley}, 15035 title = {An overview of the {T}rilinos project}, 15036 journal = {ACM Transactions on Mathematical Software}, 15037 volume = {31}, 15038 number = {3}, 15039 year = {2005}, 15040 issn = {0098-3500}, 15041 pages = {397--423}, 15042 publisher = {ACM Press}, 15043 doi = {10.1145/1089014.1089021} 15044} 15045 15046@Misc{ rythmos:homepage, 15047 author = {T. Coffey and R. Bartlett}, 15048 title = {Rythmos: Transient Integration of Differential Equations}, 15049 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 15050} 15051 15052@Misc{ triangle:homepage, 15053 author = {J. {Shewchuk}}, 15054 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 15055 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 15056 year = {2005} 15057} 15058 15059@Misc{ tetgen:homepage, 15060 author = {Hang {Si}}, 15061 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 15062 Triangulator}}, 15063 howpublished = {\url{http://tetgen.berlios.de}}, 15064 year = {2005} 15065} 15066 15067@Misc{ opencascade:homepage, 15068 author = {{OpenCASCADE SAS}}, 15069 title = {{Open CASCADE Technology (OCCT)}}, 15070 howpublished = {\url{https://dev.opencascade.org/}}, 15071 year = {2024} 15072} 15073 15074@Misc{ eigen:homepage, 15075 author = {Benoit Jacob and Ga\"el Guennebaud}, 15076 title = {{Eigen} {W}eb page}, 15077 key = {Jacob}, 15078 url = {http://eigen.tuxfamily.org/}, 15079 howpublished = {\url{http://eigen.tuxfamily.org/}}, 15080 year = {2015} 15081} 15082 15083@Misc{ dune:homepage, 15084 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 15085 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 15086 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 15087 Oliver Sander}, 15088 title = {{DUNE} {W}eb page}, 15089 key = {Bastian}, 15090 url = {http://www.dune-project.org/}, 15091 howpublished = {\url{http://www.dune-project.org/}}, 15092 year = {2015} 15093} 15094 15095@Misc{ thrust, 15096 author = {N. Bell and J. Hoberock}, 15097 title = {The {T}hrust Library}, 15098 howpublished = {{\tt http://code.google.com/p/thrust/}}, 15099 year = {2010} 15100} 15101 15102@Misc{ cusp, 15103 author = {N. Bell and M. Garland}, 15104 title = {The {C}usp Library}, 15105 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 15106 year = {2010} 15107} 15108 15109@Misc{ cig:homepage, 15110 author = {M. {Gurnis et al.}}, 15111 title = {{Computational Infrastructure for Geodynamics}}, 15112 howpublished = {\url{http://www.geodynamics.org}} 15113} 15114 15115@Article{ maltsevselkov00, 15116 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 15117 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 15118 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 15119 metabolic reconstruction}, 15120 journal = {Nucleic Acids Res.}, 15121 year = {2000}, 15122 month = jan, 15123 pages = {123-125}, 15124 volume = {28}, 15125 number = {1} 15126} 15127 15128@Article{ more:coloring, 15129 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 15130 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 15131 journal = {SIAM Journal on Numerical Analysis}, 15132 year = {1983}, 15133 month = feb, 15134 pages = {187--209}, 15135 volume = {20}, 15136 number = {1} 15137} 15138 15139@Article{ selkovmaltsev97, 15140 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 15141 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 15142 data}, 15143 journal = {Gene}, 15144 year = {1997}, 15145 pages = {GC11-GC26}, 15146 volume = {197}, 15147 number = {1-2} 15148} 15149 15150@Unpublished{ rocketcenter, 15151 title = {Center for Simulation of Advanced Rockets}, 15152 note = {http://www.csar.uiuc.edu}, 15153 institution = {University of Illinois at Urbana-Champaign} 15154} 15155 15156@Article{ kirby03, 15157 title = {A posteriori error estimates for the mixed hybrid finite element method}, 15158 author = {Robert C Kirby}, 15159 journal = {Computational Geosciences}, 15160 volume = {7}, 15161 pages = {197--214}, 15162 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 15163 year = {2003} 15164} 15165 15166@Article{ kirby2003b, 15167 title = {On the convergence of high resolution methods with multiple time scales for 15168 hyperbolic conservation laws}, 15169 author = {Robert C Kirby}, 15170 journal = {Mathematics of computation}, 15171 volume = {72}, 15172 number = {243}, 15173 pages = {1239--1250}, 15174 year = {2003} 15175} 15176 15177@Article{ dawsonkirby2001, 15178 title = {High resolution schemes for conservation laws with locally varying time steps}, 15179 author = {Clint Dawson and Robert C Kirby}, 15180 journal = {SIAM Journal on Scientific Computing}, 15181 volume = {22}, 15182 number = {6}, 15183 pages = {2256--2281}, 15184 year = {2001}, 15185 publisher = {SIAM} 15186} 15187 15188@Article{ dawsonkirby1999, 15189 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 15190 a dynamically changing mesh}, 15191 author = {Clint Dawson and Robert C Kirby}, 15192 journal = {SIAM Journal on Numerical Analysis}, 15193 volume = {37}, 15194 number = {2}, 15195 pages = {423--442}, 15196 year = {1999}, 15197 publisher = {SIAM} 15198} 15199 15200@Article{ barthlarson00, 15201 author = {T. J. Barth and M. G. Larson}, 15202 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 15203 Hyperbolic Systems}, 15204 journal = {LNCS}, 15205 year = {2000}, 15206 volume = {11}, 15207 publisher = {Spinger-Verlag} 15208} 15209 15210@Article{ xu1, 15211 author = {J. Xu}, 15212 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 15213 journal = {SIAM Review}, 15214 volume = {34}, 15215 pages = {581--613}, 15216 year = {1992} 15217} 15218 15219@Article{ brandt77, 15220 author = {Achi Brandt}, 15221 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 15222 journal = {Mathematics of Computation}, 15223 month = apr, 15224 year = {1977}, 15225 pages = {333--390}, 15226 volume = {31}, 15227 number = {138}, 15228 doi = {10.2307/2006422} 15229} 15230 15231@Article{ brandt1979multigrid, 15232 title = {{Multigrid solutions to elliptic flow problems}}, 15233 author = {Brandt, A. and Dinar, N.}, 15234 journal = {Numerical Methods for Partial Differential Equations}, 15235 pages = {53--147}, 15236 year = {1979} 15237} 15238 15239@InCollection{ brandt1979singular, 15240 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 15241 author = {Achi Brandt}, 15242 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 15243 editor = {Hemker, Pieter W. and Miller, John J.H.}, 15244 pages = {53--142}, 15245 year = {1979}, 15246 publisher = {Academic Press} 15247} 15248 15249@Article{ amge1, 15250 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 15251 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 15252 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 15253 journal = {SIAM J. Scientific Computing}, 15254 volume = {22}, 15255 pages = {1570--1592}, 15256 year = {2000} 15257} 15258 15259@Book{ bramble1, 15260 author = {J. H. Bramble}, 15261 title = {Multigrid Methods}, 15262 publisher = {Longman Scientific and Technical}, 15263 address = {Essex, England}, 15264 year = {1993} 15265} 15266 15267@Book{ arpack98, 15268 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 15269 title = {ARPACK, Users' Guide}, 15270 publisher = {SIAM}, 15271 year = {1998} 15272} 15273 15274@Article{ bbder96, 15275 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 15276 title = {Algorithmic bombardment for the iterative solution of linear systems: A 15277 polyIterative approach}, 15278 journal = {J. of Computational and Applied Mathematics}, 15279 year = {1996}, 15280 volume = {74}, 15281 pages = {91--110} 15282} 15283 15284@Article{ egks94, 15285 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 15286 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 15287 journal = {SIAM J. Scientific Computing}, 15288 year = {1994}, 15289 volume = {15}, 15290 number = {3}, 15291 pages = {681--703} 15292} 15293 15294@Article{ dftb02, 15295 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 15296 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 15297 diamond grain boundaries,}, 15298 journal = {Phys. Rev}, 15299 year = {2002}, 15300 volume = {B65}, 15301 pages = {045403} 15302} 15303 15304@InBook{ lsa, 15305 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 15306 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 15307 title = {The linear system analyzer}, 15308 series = {enabling technologies for computational science}, 15309 year = {2002}, 15310 publisher = {Kluwer}, 15311 location = {Dordrecht} 15312} 15313 15314@Article{ kk97, 15315 author = {Carl T. Kelley and David E. Keyes}, 15316 title = {Convergence analysis of pseudo-transient continuation}, 15317 journal = {SIAM J. Numerical Analysis}, 15318 year = {1998}, 15319 volume = {35}, 15320 pages = {508--523} 15321} 15322 15323@Article{ swtm01, 15324 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 15325 journal = {Journal of Computational Physics}, 15326 year = {2001}, 15327 volume = {172}, 15328 number = {2}, 15329 pages = {472--514}, 15330 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 15331 Method} 15332} 15333 15334@TechReport{ zhou03, 15335 author = {Y. Zhou}, 15336 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 15337 IIGD, RQI and Newton} Updates}, 15338 institution = {Argonne National Laboratory}, 15339 number = {ANL/MCS-P1074-0803}, 15340 note = {Submitted to Numerical Linear Algebra with Applications}, 15341 year = {2003} 15342} 15343 15344@Unpublished{ mtwm03, 15345 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 15346 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 15347 Detailed analysis of one-dimensional applications}, 15348 note = {to appear in the Journal of Chemical Physics}, 15349 year = {2003} 15350} 15351 15352@Article{ singhjosephheslaglowinskipan00, 15353 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 15354 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 15355 particulate flows}, 15356 journal = {J. Non-Newtonian Fluid Mech.}, 15357 volume = {91}, 15358 pages = {165--188}, 15359 year = {2000} 15360} 15361 15362@Book{ joseph02, 15363 author = {Daniel D. Joseph}, 15364 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 15365 publisher = {Springer-Verlag}, 15366 month = mar, 15367 year = {2002}, 15368 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 15369} 15370 15371@Misc{ triangle-web-page, 15372 author = {Jonathan R. Shewchuk}, 15373 title = {{Triangle Web} page}, 15374 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 15375} 15376 15377@InCollection{ shewchuk96, 15378 author = {Jonathan R. Shewchuk}, 15379 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 15380 Triangulator}, 15381 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 15382 editor = {Ming C. Lin and Dinesh Manocha}, 15383 series = {Lecture Notes in Computer Science}, 15384 volume = {1148}, 15385 publisher = {Springer-Verlag}, 15386 pages = {203--222}, 15387 month = may, 15388 year = {1996}, 15389 note = {From the First ACM Workshop on Applied Computational Geometry} 15390} 15391 15392@Article{ leaf1, 15393 author = {Transient Dynamics of Pinning of Domain Walls}, 15394 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 15395 journal = {J. Magnetism and Magnetic Materials}, 15396 volume = {241}, 15397 pages = {118--123}, 15398 year = {2002} 15399} 15400 15401@Article{ leaf2, 15402 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 15403 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 15404 Superconductivity}, 15405 journal = {SIAM J. Sci. Comp.}, 15406 volume = {23}, 15407 pages = {1944--1959}, 15408 year = {2002} 15409} 15410 15411@Article{ leaf3, 15412 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 15413 title = {Hysteresis in Layered Spring Magnets}, 15414 journal = { Discreet and Continuous Dynamical Systems, Series B}, 15415 volume = {1}, 15416 pages = {219--232}, 15417 year = {2001} 15418} 15419 15420@Article{ leaf4, 15421 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 15422 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 15423 journal = {J. Phys. D Appl. Phys.}, 15424 volume = {35}, 15425 pages = {2339--2343}, 15426 year = {2002} 15427} 15428 15429@Article{ leaf5, 15430 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 15431 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 15432 journal = {Submitted to Phys. Rev. B.}, 15433 note = {Submitted}, 15434 year = {2003} 15435} 15436 15437@Article{ graysumpternoidbarnes01, 15438 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 15439 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 15440 Nanospheres}, 15441 journal = {Chem. Phys. Lett.}, 15442 volume = {333}, 15443 pages = {308--313}, 15444 year = {2001} 15445} 15446 15447@InProceedings{ petsc-efficient, 15448 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 15449 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 15450 Libraries}, 15451 booktitle = {Modern Software Tools in Scientific Computing}, 15452 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 15453 publisher = {Birkh{\"{a}}user Press}, 15454 pages = {163--202}, 15455 year = {1997} 15456} 15457 15458@Article{ mumps01, 15459 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 15460 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 15461 journal = {SIAM Journal on Matrix Analysis and Applications}, 15462 volume = {23}, 15463 number = {1}, 15464 pages = {15--41}, 15465 year = {2001} 15466} 15467 15468@Article{ mumps19, 15469 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 15470 Multicore Architectures}}, 15471 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 15472 journal = {ACM Transactions on Mathematical Software}, 15473 volume = {45}, 15474 issue = {1}, 15475 pages = {2:1--2:26}, 15476 year = {2019} 15477} 15478 15479@Article{ zoltan06, 15480 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 15481 \c{C}ataly\"urek and Robert H. Bisseling}, 15482 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 15483 journal = {SIAM Parallel Processing for Scientific Computing}, 15484 month = feb, 15485 year = {2006} 15486} 15487 15488@Article{ lidemmel03, 15489 author = {Xiaoye S. Li and James W. Demmel}, 15490 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 15491 unsymmetric linear systems}, 15492 journal = {ACM Transactions on Mathematical Software}, 15493 year = {2003}, 15494 month = jun, 15495 volume = {29}, 15496 number = {2}, 15497 pages = {110--140} 15498} 15499 15500@TechReport{ superlu, 15501 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 15502 title = {{SuperLU} Users' Guide}, 15503 number = {LBNL-44289}, 15504 institution = {Lawrence Berkeley National Laboratory}, 15505 year = {2003}, 15506 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 15507} 15508 15509@TechReport{ trilinos-overview03, 15510 title = {{An Overview of {T}rilinos}}, 15511 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 15512 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 15513 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 15514 Willenbring and Alan Williams}, 15515 institution = {Sandia National Laboratories}, 15516 number = {SAND2003-2927}, 15517 year = {2003} 15518} 15519 15520@TechReport{ trilinos-users-guide, 15521 title = {{Trilinos} Users Guide}, 15522 author = {Michael A. Heroux and James M. Willenbring}, 15523 institution = {Sandia National Laboratories}, 15524 number = {SAND2003-2952}, 15525 url = {http://trilinos.sandia.gov/}, 15526 year = {2003} 15527} 15528 15529@Article{ pilut01, 15530 author = {David Hysom and Alex Pothen}, 15531 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 15532 journal = {SIAM Journal on Scientific Computing}, 15533 volume = {22}, 15534 pages = {2194--2215}, 15535 year = {2001} 15536} 15537 15538@TechReport{ boomeramg00, 15539 author = {V.~E. Henson and U.~M. Yang}, 15540 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 15541 institution = {Lawrence Livermore National Laboratory}, 15542 number = {UCRL-JC-133948}, 15543 year = {2000} 15544} 15545 15546@InCollection{ baker2012scaling, 15547 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 15548 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 15549 and Schulz, Martin and Yang, Ulrike Meier}, 15550 booktitle = {Competence in High Performance Computing 2010}, 15551 pages = {215--226}, 15552 year = {2012}, 15553 publisher = {Springer} 15554} 15555 15556@Article{ knollkeyes:04, 15557 author = {D. A. Knoll and D. E. Keyes}, 15558 year = {2004}, 15559 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 15560 journal = {J. Comp. Phys.}, 15561 volume = {193}, 15562 pages = {357-397} 15563} 15564 15565@Article{ chacon02, 15566 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 15567 title = {An implicit nonlinear reduced resistive {MHD} solver}, 15568 journal = {J. Comput. Phys}, 15569 volume = {188}, 15570 year = {2002}, 15571 pages = {15--36} 15572} 15573 15574@Article{ mousseau03, 15575 author = {V. A. Mousseau and D. A. Knoll}, 15576 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 15577 Radiation Diffusion}, 15578 journal = {J. Comput. Physics}, 15579 year = {2003} 15580} 15581 15582@Article{ mousseau00, 15583 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 15584 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 15585 Radiation Diffusion}, 15586 journal = {J. Comput. Physics}, 15587 year = {2000}, 15588 pages = {743--765}, 15589 volume = {160} 15590} 15591 15592@Unpublished{ facets:homepage, 15593 author = {John {Cary (PI)}}, 15594 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 15595 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 15596} 15597 15598@Unpublished{ cpes:homepage, 15599 author = {{C.S.} {Chang (PI)}}, 15600 title = {{Center for Plasma Edge Simulation (CPES)}}, 15601 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 15602} 15603 15604@Misc{ epsi:homepage, 15605 author = {{C.S.} {Chang (PI)}}, 15606 title = {{Center for Edge Physics Simulation (EPSI)}}, 15607 note = {\url{http://epsi.pppl.gov}} 15608} 15609 15610@Unpublished{ groundwater-scidac2:web, 15611 author = {Peter {Lichtner (PI)}}, 15612 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15613 Advanced Computing}, 15614 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 15615} 15616 15617@Misc{ pflotran:web, 15618 author = {Peter {Lichtner (PI)}}, 15619 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15620 Advanced Computing}}, 15621 note = {\url{http://ees.lanl.gov/pflotran/}} 15622} 15623 15624@Misc{ accel-scidac2-solicitation, 15625 author = {{DOE Office of Science}}, 15626 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 15627 year = {2006}, 15628 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 15629} 15630 15631@Article{ nieter04, 15632 author = {C. Nieter and J. R. Cary}, 15633 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 15634 journal = {J. Comp. Phys.}, 15635 year = {2004}, 15636 volume = {196}, 15637 pages = {448} 15638} 15639 15640@Article{ synergia06, 15641 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 15642 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 15643 journal = {J. Comp. Phys.}, 15644 year = {2006}, 15645 volume = {211}, 15646 pages = {229-248} 15647} 15648 15649@Unpublished{ stoltz07, 15650 author = {P. H. Stoltz}, 15651 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 15652 year = {2007}, 15653 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 15654 Albuquerque, NM, 2007} 15655} 15656 15657@Misc{ iter:homepage, 15658 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15659 year = {2007}, 15660 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15661 howpublished = {\url{http://www.iter.org}} 15662} 15663 15664@Misc{ epp2010, 15665 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 15666 Council}}, 15667 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 15668 Particle Physics}, 15669 year = {2006}, 15670 howpublished = {The National Academies Press, ISBN: 0309101948} 15671} 15672 15673@Misc{ post-fsp-report, 15674 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 15675 and P.~Colella and S.~C.~Jardin}, 15676 title = {{Report of Fusion Simulation Project Steering Committee}}, 15677 month = aug, 15678 year = {2004}, 15679 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 15680} 15681 15682@Misc{ fsp:workshop2011, 15683 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15684 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15685 month = feb, 15686 year = {2011}, 15687 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 15688} 15689 15690@Book{ hazeltine-meiss-book, 15691 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 15692 title = {Plasma Confinement}, 15693 year = {1991}, 15694 publisher = {Addison-Wesley, Redwood City, CA} 15695} 15696 15697@Article{ falgout05a, 15698 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15699 title = {Conceptual Interfaces in hypre}, 15700 journal = {Future Generation Computer Systems}, 15701 note = {Special issue on PDE software}, 15702 volume = {22}, 15703 year = {2005}, 15704 pages = {239--251} 15705} 15706 15707@Article{ falgout05b, 15708 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15709 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 15710 journal = {ACM Trans. Math. Softw.}, 15711 volume = {31}, 15712 year = {2005}, 15713 pages = {326--350} 15714} 15715 15716@Unpublished{ compass:homepage, 15717 author = {Panagiotis {Spentzouris (PI)}}, 15718 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 15719 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 15720} 15721 15722@Unpublished{ cmsnf:homepage, 15723 author = {{Todd Allen, Director}}, 15724 title = {{Center for Materials Science of Nuclear Fuel}}, 15725 note = {Energy Frontier Research Center, see 15726 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 15727} 15728 15729@Unpublished{ dvi-materials:project, 15730 author = {{L.~C.} {McInnes (PI)}}, 15731 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 15732 note = {{SciDAC}-e project}, 15733 year = {2011} 15734} 15735 15736@Misc{ scidac:homepage, 15737 author = {{DOE Office of Science}}, 15738 title = {{Scientific Discovery through Advanced Computing}}, 15739 year = {2007}, 15740 howpublished = {\url{http://www.scidac.gov}} 15741} 15742 15743@Misc{ corba, 15744 author = {{Object Management Group}}, 15745 year = {2007}, 15746 title = {{Common Object Request Broker Architecture (CORBA)}}, 15747 howpublished = {\url{http://www.corba.org}} 15748} 15749 15750@Article{ uedge, 15751 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 15752 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 15753 Divertor Tokamak}, 15754 journal = {J. Plasma Physics}, 15755 year = {1999}, 15756 volume = {6}, 15757 pages = {1851}, 15758 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 15759} 15760 15761@Article{ bout, 15762 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 15763 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 15764 journal = {J. Plasma Physics}, 15765 year = {2000}, 15766 volume = {7}, 15767 pages = {1951}, 15768 note = {} 15769} 15770 15771@Article{ bout++, 15772 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 15773 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 15774 journal = {Computer Physics Communications}, 15775 year = {2009}, 15776 volume = {180}, 15777 issue = {9}, 15778 pages = {1467 -- 1480}, 15779 note = {} 15780} 15781 15782@Article{ tempest, 15783 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 15784 and G. Kerbel and W.M. Nevins and T. Rognlien}, 15785 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 15786 journal = {Bull. Am. Phys. Soc. }, 15787 year = {2005}, 15788 volume = {50}, 15789 number = {86}, 15790 pages = {CP1}, 15791 note = {} 15792} 15793 15794@Article{ ccahpc, 15795 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 15796 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 15797 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 15798 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 15799 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 15800 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 15801 and Theresa L. Windus and Shujia Zhou}, 15802 title = {A Component Architecture for High-Performance Scientific Computing}, 15803 journal = {Intl. J. High-Perf. Computing Appl.}, 15804 volume = {20}, 15805 pages = {163--202}, 15806 year = {2006}, 15807 note = {ACTS Collection special issue} 15808} 15809 15810@Misc{ cca-forum:homepage, 15811 author = {{Common Component Architecture Forum}}, 15812 note = {\url{http://www.cca-forum.org}}, 15813 year = {2010} 15814} 15815 15816@Misc{ petsc:driven-cavity-example, 15817 title = {{PETSc Driven Cavity Example Code}}, 15818 author = {B. F. {Smith et al.}}, 15819 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 15820} 15821 15822@Misc{ petsc-dm:webpage, 15823 author = {B. F. {Smith et al.}}, 15824 title = {{PETSc DM Webpage}}, 15825 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 15826 year = {2018} 15827} 15828 15829@Misc{ unic-ref, 15830 author = {Giuseppe Palmiotti}, 15831 title = {{UNIC} Neutronics Software}, 15832 note = {Nuclear Engineering Division, Argonne National Laboratory} 15833} 15834 15835% ----------------------------------------------------------------------- 15836% Model coupling refs 15837@Book{ greve-blatter, 15838 author = {Ralf Greve and Heinz Blatter}, 15839 title = {Dynamics of Ice Sheets and Glaciers}, 15840 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 15841 publisher = {Springer}, 15842 year = {2009} 15843} 15844 15845@Misc{ doe-isicles, 15846 key = {ISICLES}, 15847 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 15848 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 15849} 15850 15851@Article{ safta2011tchem, 15852 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 15853 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 15854 journal = {Sandia Report, SAND2011-3282}, 15855 year = {2011} 15856} 15857 15858@Misc{ chemkin-website, 15859 key = {chemkin}, 15860 title = {ANSYS Chemkin-Pro Website}, 15861 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 15862 year = {2017} 15863} 15864 15865@Misc{ mct-website, 15866 key = {MCT}, 15867 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 15868 howpublished = {\url{http://www.mcs.anl.gov/mct}} 15869} 15870 15871@Article{ larson:05, 15872 author = {Jay Larson and Robert Jacob and Everest Ong}, 15873 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 15874 Multi-Physics Parallel Coupled Models}, 15875 journal = {Int. J. High Perf. Comp. App.}, 15876 year = {2005}, 15877 pages = {277--292} 15878} 15879 15880@Article{ dennis2012computational, 15881 title = {Computational performance of ultra-high-resolution capability in the Community 15882 Earth System Model}, 15883 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 15884 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 15885 journal = {International Journal of High Performance Computing Applications}, 15886 volume = {26}, 15887 number = {1}, 15888 pages = {5--16}, 15889 year = {2012}, 15890 publisher = {SAGE Publications} 15891} 15892 15893@InProceedings{ bettge01, 15894 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 15895 year = {2001}, 15896 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 15897 Backroads}, 15898 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15899 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15900 pages = {148 -- 156}, 15901 series = {Lecture Notes in Computer Science}, 15902 volume = {2073}, 15903 publisher = {Springer-Verlag} 15904} 15905 15906@InProceedings{ jacob01, 15907 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 15908 year = {2001}, 15909 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 15910 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15911 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15912 series = {Lecture Notes in Computer Science}, 15913 volume = {2073}, 15914 publisher = {Springer-Verlag} 15915} 15916 15917@Article{ chen2008new, 15918 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 15919 design}, 15920 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 15921 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 15922 journal = {Chinese Science Bulletin}, 15923 volume = {53}, 15924 number = {22}, 15925 pages = {3433--3445}, 15926 year = {2008}, 15927 publisher = {Springer} 15928} 15929 15930@InProceedings{ baum01, 15931 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 15932 and C. Charman}, 15933 year = {2001}, 15934 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 15935 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15936 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15937 series = {Lecture Notes in Computer Science}, 15938 volume = {2073}, 15939 publisher = {Springer-Verlag} 15940} 15941 15942@InProceedings{ lefantzi03, 15943 author = {S. Lefantzi and J. Ray}, 15944 year = {2003}, 15945 title = {A Component-based Scientific Toolkit for Reacting Flows}, 15946 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 15947 volume = {2}, 15948 publisher = {Elsevier} 15949} 15950 15951@Article{ boville98, 15952 author = {B. A. Boville and P. R. Gent}, 15953 title = {The {NCAR} Climate System Model, Version One}, 15954 journal = {Journal of Climate}, 15955 volume = {11}, 15956 year = {1998}, 15957 pages = {1115--1130} 15958} 15959 15960@Misc{ paraschivoiu99, 15961 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 15962 title = {Multi-domain multi-model formulation for compressible flows: Conservative 15963 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 15964 note = {AIAA Paper 99-0784}, 15965 year = {1999} 15966} 15967 15968@Article{ peszynska, 15969 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 15970 title = {Mortar upscaling for multiphysics flow in porous media}, 15971 journal = {Computational Geosciences} 15972} 15973 15974@TechReport{ wheeler00, 15975 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 15976 title = {A distributed computing portal for coupling multi-physics and multiple domains in 15977 porous media}, 15978 institution = {University of Texas at Austin}, 15979 number = {TICAM 00-03}, 15980 year = {2000} 15981} 15982 15983@TechReport{ peszynska00, 15984 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 15985 title = {Multiphysics Coupling of Codes}, 15986 institution = {University of Texas at Austin}, 15987 number = {TICAM 00-02}, 15988 year = {2000} 15989} 15990 15991@Article{ joshaghanijoodatnakshatrala2019, 15992 title = {A stabilized mixed discontinuous Galerkin formulation for double 15993 porosity/permeability model}, 15994 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 15995 journal = {Computer Methods in Applied Mechanics and Engineering}, 15996 volume = {352}, 15997 pages = {508--560}, 15998 year = {2019} 15999} 16000 16001@InProceedings{ cai99, 16002 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 16003 title = {An explicit multi-model compressible flow formulation based on the full potential 16004 equation and the {Euler} equations on {3D} unstructured meshes}, 16005 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 16006 Methods}, 16007 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 16008 year = {1999} 16009} 16010 16011@Article{ he05, 16012 author = {Yun He and Chris H. Q. Ding}, 16013 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 16014 Architectures}, 16015 year = {2005}, 16016 volume = {19}, 16017 pages = {329--240}, 16018 number = {3}, 16019 journal = {Int. Journal of High Performance Computing Applications} 16020} 16021 16022@InProceedings{ uiuc-rocket-center02, 16023 author = {W. A. Dick and M. T. Heath}, 16024 title = {Whole System Simulation of Solid Propellant Rockets}, 16025 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 16026 month = jul, 16027 year = {2002} 16028} 16029 16030@InProceedings{ toth04, 16031 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 16032 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 16033 Oehmke}, 16034 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 16035 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 16036 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 16037 Sun-Earth Connection}, 16038 year = {2004}, 16039 publisher = {Elsevier}, 16040 pages = {383--397} 16041} 16042 16043@Misc{ csdrm:web, 16044 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 16045 Shepherd}, 16046 title = {{Center for Simulation of Dynamic Response of Materials}}, 16047 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 16048} 16049 16050@Misc{ csar:web, 16051 author = {M. {Heath (Director)}}, 16052 title = {{Center for Simulation of Advanced Rockets}}, 16053 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 16054} 16055 16056@Misc{ csafe:web, 16057 author = {D. {Pershing (Director)}}, 16058 title = {{Center for Simulation of Accidental Fires and Explosions}}, 16059 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 16060} 16061 16062@Misc{ cits:web, 16063 author = {P. {Moin (Director)}}, 16064 title = {{Center for Integrated Turbulence Simulations}}, 16065 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 16066} 16067 16068@Misc{ flash:web, 16069 author = {D. {Lamb (Director)}}, 16070 title = {{Center for Integrated Turbulence Simulations}}, 16071 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 16072} 16073 16074@TechReport{ utah-csafe03, 16075 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 16076 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 16077 Problems, Part 1: Algorithm Development}, 16078 institution = {University of Utah, Center for the Simulation of Accidental Fires and 16079 Explosions}, 16080 year = {2003} 16081} 16082 16083@InBook{ shepherd07, 16084 author = {M. Shepherd and E. Seol and B. FrantzDale}, 16085 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 16086 year = {2007}, 16087 booktitle = {CRC Handbook of Dynamic System Modeling}, 16088 publisher = {Wiley}, 16089 pages = {1--41}, 16090 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 16091} 16092 16093@InProceedings{ cactus02, 16094 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 16095 Radke and Edward Seidel and John Shalf}, 16096 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 16097 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 16098 year = {2002}, 16099 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 16100} 16101 16102@Misc{ cactus:homepage, 16103 author = {G. {Allen et al.}}, 16104 title = {{Cactus Web page}}, 16105 howpublished = {\url{http://cactuscode.org}} 16106} 16107 16108@Misc{ open-grid-forum:web, 16109 key = {{Open Grid Forum}}, 16110 title = {{Open Grid Forum}}, 16111 note = {See \url{http://www.ogf.org}} 16112} 16113 16114@Misc{ nox:web, 16115 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 16116 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 16117 note = {See \url{http://software.sandia.gov/nox}} 16118} 16119 16120@Misc{ chombo:web, 16121 author = {P. {Colella (PI)}}, 16122 title = {{Chombo}}, 16123 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 16124} 16125 16126@Article{ lanzkron96, 16127 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 16128 title = {An Analysis of Approximate Nonlinear Elimination}, 16129 journal = {SIAM J. Sci. Comput.}, 16130 volume = {17}, 16131 year = {1996}, 16132 pages = {538--559} 16133} 16134 16135@Article{ jiang95, 16136 author = {J. Jiang and P. Forsyth}, 16137 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 16138 Equations}, 16139 journal = {Computers and Fluids}, 16140 volume = {24}, 16141 pages = {753--770}, 16142 year = {1995} 16143} 16144 16145@Article{ young90, 16146 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 16147 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 16148 journal = {Int. J. Numer. Methods Fluids}, 16149 volume = {11}, 16150 pages = {1075--1095}, 16151 year = {1990} 16152} 16153 16154@Article{ fishwick04, 16155 author = {Paul A. Fishwick}, 16156 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 16157 to Interrelating Model Structures}, 16158 journal = {SCS Trans. on Simulation}, 16159 note = {Special Issue in Grand Challenges in Computer Simulation}, 16160 year = {2004} 16161} 16162 16163@Article{ fishwick03, 16164 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 16165 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 16166 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 16167 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 16168 year = {2003} 16169} 16170 16171@InProceedings{ kirner00, 16172 author = {T. G. Kirner and V. F. Martins}, 16173 title = {Development of an Information Visualization Tool Using Virtual Reality}, 16174 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 16175 year = {2000}, 16176 pages = {604--606} 16177} 16178 16179@InProceedings{ orso03, 16180 author = {A. Orso and J. Jones and M. J. Harrold}, 16181 title = {Visualization of Program-Execution Data for Deployed Software}, 16182 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 16183 year = {2003}, 16184 pages = {67--76} 16185} 16186 16187@Book{ tiller01, 16188 author = {M. Tiller}, 16189 title = {Introduction to Physical System Modeling with Modelica}, 16190 series = {Kluwer International Series inEngineering and Computer Science}, 16191 volume = {615}, 16192 publisher = {Kluwer}, 16193 year = {2001} 16194} 16195 16196@Article{ buck94, 16197 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 16198 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 16199 journal = {Int. Journal of Computer Simulation}, 16200 volume = {4}, 16201 pages = {155--182}, 16202 year = {1994} 16203} 16204 16205@Article{ mu95, 16206 author = {M. Mu and J.R. Rice}, 16207 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 16208 journal = {Comp. Syst. Engr.}, 16209 volume = {6}, 16210 year = {1995}, 16211 pages = {87--95} 16212} 16213 16214@TechReport{ drashansky96, 16215 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 16216 author = {R. Drashansky and A. Joshi and J. R. Rice}, 16217 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 16218 year = {1996} 16219} 16220 16221@Article{ michopoulos05, 16222 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 16223 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 16224 journal = {Journal of Computing and Information Science in Engineering}, 16225 volume = {5}, 16226 issue = {3}, 16227 pages = {198--213}, 16228 year = {2005} 16229} 16230 16231@Article{ dubey09, 16232 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 16233 Multiphysics Simulation Code}, 16234 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 16235 Siegel and K. Weide}, 16236 journal = {Parallel Computing}, 16237 volume = {35}, 16238 issue = {10 -- 11}, 16239 pages = {512 -- 522}, 16240 year = {2009} 16241} 16242 16243@Book{ bottloring95, 16244 author = {Raoul Bott and Loring W. Tu}, 16245 title = {Differential Forms in Algebraic Topology}, 16246 publisher = {Springer}, 16247 year = {1995} 16248} 16249 16250@Book{ kobayashinomizu96, 16251 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 16252 title = {Foundations of Differential Geometry}, 16253 publisher = {Wiley-Interscience}, 16254 year = {1996} 16255} 16256 16257@Article{ hornungkohn02, 16258 author = {Richard D. Hornung and Scott R. Kohn}, 16259 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 16260 journal = {Concurrency and Computation: Practice and Experience}, 16261 volume = {14}, 16262 pages = {347--368}, 16263 year = {2002} 16264} 16265 16266@InProceedings{ concepts06, 16267 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 16268 Gabriel Dos Reis and Andrew Lumsdaine}, 16269 title = {Concepts: Linguistic Support for Generic Programming in C++}, 16270 booktitle = {Proceedings of OOPSLA 2006}, 16271 year = {2006}, 16272 pages = {???--???} 16273} 16274 16275@Book{ hatcher02, 16276 author = {Hatcher, Allen}, 16277 title = {Algebraic Topology}, 16278 publisher = {Cambridge University Press}, 16279 year = {2002} 16280} 16281 16282@Book{ gammahelmjohnsonvlissides95, 16283 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 16284 development, offering timeless and elegant solutions to common problems in 16285 software design. It describes patterns for managing object creation, composing 16286 objects into larger structures, and coordinating control flow between objects. The 16287 book provides numerous examples where using composition rather than inheritance 16288 can improve the reusability and flexibility of code. Note, though, that it's not a 16289 tutorial but a catalog that you can use to find an object-oriented design pattern 16290 that's appropriate for the needs of your particular application--a selection for 16291 virtuoso programmers who appreciate (or require) consistent, well-engineered 16292 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 16293 more valuable than ever! 16294 16295 Use the contents of the CD to create your own design documents and reusable 16296 components. The CD contains: 23 patterns you can cut and paste into your own 16297 design documents; sample code demonstrating pattern implementation; complete 16298 Design Patterns content in standard HTML format, with numerous hyperlinked 16299 cross-references; accessed through a standard web browser; Java-based dynamic 16300 search mechanism, enhancing online search capabilities; graphical user environment, 16301 allowing ease of navigation. 16302 16303 First published in 1995, this landmark work on object-oriented software design 16304 presents a catalog of simple and succinct solutions to common design problems. 16305 Created by four experienced designers, the 23 patterns contained herein have 16306 become an essential resource for anyone developing reusable object-oriented 16307 software. In response to reader demand, the complete text and pattern catalog are 16308 now available on CD-ROM. This electronic version of Design Patterns enables 16309 programmers to install the book directly onto a computer or network for use as an 16310 online reference for creating reusable object-oriented software. 16311 16312 The authors first describe what patterns are and how they can help you in the 16313 design process. They then systematically name, explain, evaluate, and catalog 16314 recurring designs in object-oriented systems. All patterns are compiled from 16315 real-world examples and include code that demonstrates how they may be implemented 16316 in object-oriented programming languages such as C++ and Smalltalk. Readers who 16317 already own the book will want the CD to take advantage of its dynamic search 16318 mechanism and ready-to-install patterns.}}, 16319 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 16320 citeulike-article-id={115158}, 16321 howpublished = {Hardcover}, 16322 isbn = {0201633612}, 16323 keywords = {1995 algorithms architecture book books computer computing design design-pattern 16324 design-patterns design_patterns designpatterns development diplom entwurfsmuster 16325 four gang gof java mathgamespatterns no-tag object object-orientation 16326 object-oriented of oo-patterns oop oriented pattern patterns programming se 16327 software software-development software-engineering software_design 16328 softwareengineering standard}, 16329 month = jan, 16330 publisher = {{Addison-Wesley Professional}}, 16331 title = {Design Patterns}, 16332 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 16333 year = {1995} 16334} 16335 16336@InProceedings{ chaco95, 16337 author = {Bruce Hendrickson and Robert Leland}, 16338 title = {A multilevel algorithm for partitioning graphs}, 16339 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 16340 (CDROM)}, 16341 year = {1995}, 16342 isbn = {0-89791-816-9}, 16343 pages = {28}, 16344 location = {San Diego, California, United States}, 16345 doi = {10.1145/224170.224228}, 16346 publisher = {ACM Press}, 16347 address = {New York} 16348} 16349 16350@Book{ aleksandrov98, 16351 author = {Aleksandrov, Pavel S.}, 16352 title = {Combinatorial Topology}, 16353 publisher = {Dover}, 16354 volume = {3}, 16355 year = {1998} 16356} 16357 16358@Book{ steenrod99, 16359 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 16360 importance in modern physics--such as in gauge theory. This book, a succinct 16361 introduction to the subject by renown mathematician Norman Steenrod, was the first 16362 to present the subject systematically. 16363 16364 It begins with a general introduction to bundles, including such topics as 16365 differentiable manifolds and covering spaces. The author then provides brief 16366 surveys of advanced topics, such as homotopy theory and cohomology theory, before 16367 using them to study further properties of fibre bundles. The result is a classic 16368 and timeless work of great utility that will appeal to serious mathematicians and 16369 theoretical physicists alike. }}, 16370 author = {Steenrod, Norman}, 16371 citeulike-article-id={712999}, 16372 howpublished = {Paperback}, 16373 isbn = {0691005486}, 16374 keywords = {fibre_bundles topology}, 16375 month = apr, 16376 publisher = {{Princeton University Press}}, 16377 title = {The Topology of Fibre Bundles. (PMS-14)}, 16378 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 16379 year = {1999} 16380} 16381 16382@Book{ bredon97, 16383 author = {Bredon, Glen E.}, 16384 title = {Sheaf Theory}, 16385 publisher = {Springer}, 16386 pages = {524}, 16387 series = {Graduate Texts in Mathematics}, 16388 year = {1997} 16389} 16390 16391@TechReport{ tautgesmeyers04, 16392 title = {{MOAB}: A Mesh-Oriented Database}, 16393 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 16394 Ernst}, 16395 institution = {Sandia National Laboratories}, 16396 number = {SAND2004-1592}, 16397 month = apr, 16398 year = {2004} 16399} 16400 16401@Article{ tautges04, 16402 author = {Timothy J. Tautges}, 16403 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 16404 journal = {Engineering With Computers}, 16405 volume = {20}, 16406 pages = {286--293}, 16407 year = {2004} 16408} 16409 16410@InProceedings{ meyers02, 16411 author = {Ray Meyers et. al}, 16412 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 16413 booktitle = {8th International conference on numerical grid generation in computational field 16414 simulations}, 16415 month = jun, 16416 year = {2002} 16417} 16418 16419@InProceedings{ seolshepard05, 16420 author = {E. S. Seol and Mark S. Shephard}, 16421 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 16422 Analysis}, 16423 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 16424 year = {2005} 16425} 16426 16427@Article{ lishephardbeall2005, 16428 title = {3D anisotropic mesh adaptation by mesh modification}, 16429 author = {Xiangrong Li and Mark S Shephard and Mark W Beall}, 16430 journal = {Computer methods in applied mechanics and engineering}, 16431 volume = {194}, 16432 number = {48-49}, 16433 pages = {4915--4950}, 16434 year = {2005}, 16435} 16436 16437@Article{ lushephardtendulkarbeall2014, 16438 title = {Parallel mesh adaptation for high-order finite element methods with curved element geometry}, 16439 author = {Qiukai Lu and Mark S Shephard and Saurabh Tendulkar and Mark W Beall}, 16440 journal = {Engineering with Computers}, 16441 volume = {30}, 16442 pages = {271--286}, 16443 year = {2014}, 16444} 16445 16446@Article{ beallwalshshephard04, 16447 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 16448 title = {A comparison of techniques for geometry access related to mesh generation}, 16449 journal = {Engineering With Computers}, 16450 volume = {20}, 16451 number = {3}, 16452 pages = {210--221}, 16453 year = {2004} 16454} 16455 16456@Article{ careyandersoncarneskirk04, 16457 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 16458 Kirk}, 16459 title = {Some aspects of adaptive grid technology related to boundary and interior 16460 layers}, 16461 journal = {Journal of Computational Applied Mathematics}, 16462 volume = {166}, 16463 number = {1}, 16464 pages = {55--86}, 16465 year = {2004} 16466} 16467 16468@PhDThesis{ gralthesis, 16469 author = {Guntram Berti}, 16470 title = {Generic Software Components for Scientific Computing}, 16471 school = {TU Cottbus}, 16472 year = {2000}, 16473 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 16474} 16475 16476@Article{ whitehead1949, 16477 title = {Combinatorial homotopy. I}, 16478 author = {John HC Whitehead}, 16479 journal = {Bulletin of the American Mathematical Society}, 16480 volume = {55}, 16481 number = {3. P1}, 16482 pages = {213--245}, 16483 year = {1949}, 16484 publisher = {American Mathematical Society} 16485} 16486 16487@Article{ beylkincoifmanrokhlin91, 16488 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 16489 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 16490 journal = {Communications on Pure and Applied Mathematics}, 16491 volume = {44}, 16492 pages = {141--183}, 16493 year = {1991} 16494} 16495 16496@Book{ wesseling92, 16497 author = {Pieter Wesseling}, 16498 title = {An Introduction to Multigrid Methods}, 16499 publisher = {John Wiley and Sons}, 16500 year = {1992} 16501} 16502 16503@Book{ grakakos04, 16504 author = {Loukas Grakakos}, 16505 title = {Classical and Modern Fourier Analysis}, 16506 publisher = {Pearson Education}, 16507 address = {New Jersey}, 16508 year = {2004} 16509} 16510 16511@Misc{ hlib-web-page, 16512 key = {HLib}, 16513 title = {{HLib} {Web} page}, 16514 note = {{\texttt{http://www.hlib.org/}}}, 16515 annote = {Hierarchical matrices for fast integral transform} 16516} 16517 16518@Article{ hackbusch99, 16519 author = {Wolfgang Hackbusch}, 16520 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 16521 Introduction to {$\mathcal H$}-matrices}, 16522 journal = {Computing}, 16523 volume = {62}, 16524 pages = {89--108}, 16525 year = {1999} 16526} 16527 16528@TechReport{ kay1999green, 16529 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 16530 equations}, 16531 author = {Kay, D. and Loghin, D.}, 16532 year = {1999}, 16533 institution = {Oxford University Computing Laboratory}, 16534 number = {99/06} 16535} 16536 16537@Article{ bebendorf2003existence, 16538 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 16539 elliptic operators with {$L^\infty$}-coefficients}, 16540 author = {Bebendorf, M. and Hackbusch, W.}, 16541 journal = {Numerische Mathematik}, 16542 volume = {95}, 16543 number = {1}, 16544 pages = {1--28}, 16545 year = {2003}, 16546 publisher = {Springer} 16547} 16548 16549@Article{ hackbusch2005direct, 16550 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 16551 H$}-matrix approximation}, 16552 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 16553 journal = {Computing and Visualization in Science}, 16554 volume = {8}, 16555 number = {3}, 16556 pages = {179--188}, 16557 year = {2005}, 16558 publisher = {Springer} 16559} 16560 16561@TechReport{ duphof2003, 16562 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 16563 Logg and L. R. Scott}, 16564 title = {The {FE}ni{CS} project}, 16565 institution = {Chalmers Finite Element Center Preprint Series}, 16566 number = {2003--21}, 16567 year = {2003} 16568} 16569 16570@Article{ flame01, 16571 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 16572 Geijn}, 16573 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 16574 journal = {Transactions on Mathematical Software}, 16575 volume = {27}, 16576 number = {4}, 16577 year = {2001}, 16578 pages = {422--455} 16579} 16580 16581@Article{ puschel05, 16582 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 16583 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 16584 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 16585 Nick Rizzolo}, 16586 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 16587 journal = {Proceedings of the IEEE}, 16588 volume = {93}, 16589 number = {2}, 16590 year = {2005}, 16591 note = {special issue on "Program Generation, Optimization, and Adaptation"} 16592} 16593 16594@Article{ kirbylogg06, 16595 author = {Robert C. Kirby and Anders Logg}, 16596 title = {A compiler for variational forms}, 16597 journal = {ACM Transactions on Mathematical Software}, 16598 volume = {32}, 16599 number = {3}, 16600 year = {2006}, 16601 issn = {0098-3500}, 16602 pages = {417--444}, 16603 doi = {10.1145/1163641.1163644}, 16604 publisher = {ACM Press}, 16605 address = {New York, NY} 16606} 16607 16608@Article{ kirbylogg07, 16609 author = {Robert C. Kirby and Anders Logg}, 16610 title = {Efficient compilation of a class of variational forms}, 16611 journal = {ACM Transactions on Mathematical Software}, 16612 volume = {33}, 16613 number = {3}, 16614 year = {2007}, 16615 issn = {0098-3500}, 16616 pages = {17}, 16617 doi = {10.1145/1268769.1268771}, 16618 publisher = {ACM Press}, 16619 address = {New York, NY} 16620} 16621 16622@Article{ bankdupont81, 16623 author = {Randolph Bank and Todd Dupont}, 16624 title = {An optimal order process for solving finite element equations}, 16625 journal = {Mathematics of Computation}, 16626 volume = {36}, 16627 pages = {35--51}, 16628 year = {1981} 16629} 16630 16631@TechReport{ adams00, 16632 author = {Mark F. Adams}, 16633 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 16634 in solid mechanics}, 16635 institution = {UC Berkeley}, 16636 number = {CSD-00-1103}, 16637 year = {2000}, 16638 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 16639} 16640 16641@Article{ bergengradlhuelsemannruede06, 16642 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 16643 title = {A Massively Parallel Multigrid Method for Finite Elements}, 16644 journal = {Computing in Science \& Engineering}, 16645 volume = {8}, 16646 number = {6}, 16647 pages = {56--62}, 16648 year = {2006} 16649} 16650 16651@MastersThesis{ brunethesis08, 16652 author = {Peter R. Brune}, 16653 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 16654 school = {University of Chicago}, 16655 address = {Chicago, IL}, 16656 year = {2008}, 16657 month = feb 16658} 16659 16660@Article{ arnoldwinther02, 16661 author = {Douglas N. Arnold and Ragnar Winther}, 16662 title = {Mixed finite elements for elasticity}, 16663 journal = {Numerische Mathematik}, 16664 volume = {92}, 16665 number = {3}, 16666 month = sep, 16667 year = {2002}, 16668 pages = {401--419}, 16669 doi = {10.1007/s002110100348} 16670} 16671 16672@Article{ arnoldfalkwinther06, 16673 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 16674 title = {Finite element exterior calculus, homological techniques, and applications}, 16675 journal = {Acta Numerica}, 16676 year = {2006}, 16677 volume = {15}, 16678 pages = {1--155}, 16679 publisher = {Cambridge University Press}, 16680 doi = {10.1017/S0962492906210018} 16681} 16682 16683@Article{ kirby04, 16684 author = {Robert C. Kirby}, 16685 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 16686 functions}, 16687 journal = {ACM Transactions on Mathematical Software}, 16688 volume = {30}, 16689 number = {4}, 16690 year = {2004}, 16691 issn = {0098-3500}, 16692 pages = {502--516}, 16693 doi = {10.1145/1039813.1039820}, 16694 publisher = {ACM Press}, 16695 address = {New York, NY} 16696} 16697 16698@Article{ kirby06, 16699 author = {Robert C. Kirby}, 16700 title = {Optimizing {FIAT} with level 3 {BLAS}}, 16701 journal = {ACM Transactions on Mathematical Software}, 16702 volume = {32}, 16703 number = {2}, 16704 year = {2006}, 16705 issn = {0098-3500}, 16706 pages = {223--235}, 16707 doi = {10.1145/1141885.1141889}, 16708 publisher = {ACM Press}, 16709 address = {New York, NY} 16710} 16711 16712@Misc{ bluecrystal08, 16713 author = {{B}lue {C}rystal Cluster}, 16714 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 16715 year = {2008}, 16716 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 16717} 16718 16719@Article{ beylkin95, 16720 author = {Gregory Beylkin}, 16721 title = {On the Fast Fourier Transform of Functions With Singularities}, 16722 journal = {Applied and Computational Harmonic Analysis}, 16723 volume = {2}, 16724 pages = {363--381}, 16725 year = {1995} 16726} 16727 16728@InProceedings{ riehl08, 16729 author = {Jonathan Riehl}, 16730 title = {Implementing the MyFEM Embedded Domain-specific Language}, 16731 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 16732 Development (DSPD'08)}, 16733 address = {Nashville, TN}, 16734 year = {2008} 16735} 16736 16737@Article{ appel85, 16738 author = {Andrew W. Appel}, 16739 date-added = {2008-02-27 12:23:39 +0000}, 16740 date-modified = {2008-02-27 12:24:02 +0000}, 16741 doi = {10.1137/0906008}, 16742 journal = {SIAM Journal on Scientific and Statistical Computing}, 16743 keywords = {treecodes}, 16744 number = {1}, 16745 pages = {85-103}, 16746 publisher = {SIAM}, 16747 title = {An Efficient Program for Many-Body Simulation}, 16748 volume = {6}, 16749 year = {1985} 16750} 16751 16752@Article{ ewald21, 16753 author = {{Ewald}, P.~P.}, 16754 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 16755 journal = {Annalen der Physik}, 16756 year = {1921}, 16757 volume = {369}, 16758 pages = {253-287}, 16759 doi = {10.1002/andp.19213690304}, 16760 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 16761 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16762} 16763 16764@Article{ greengardrokhlin87, 16765 author = {L. Greengard and V. Rokhlin}, 16766 date-added = {2008-02-15 18:43:55 +0000}, 16767 date-modified = {2008-02-26 20:09:11 +0000}, 16768 doi = {10.1016/0021-9991(87)90140-9}, 16769 journal = {J. Comput.\ Phys.}, 16770 keywords = {FMM}, 16771 number = {2}, 16772 pages = {325--348}, 16773 title = {A Fast Algorithm for Particle Simulations}, 16774 url = {citeseer.ist.psu.edu/greengard87fast.html}, 16775 volume = {73}, 16776 year = {1987}, 16777 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 16778} 16779 16780@Article{ greengardrokhlin97, 16781 author = {L. Greengard and V. Rokhlin}, 16782 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 16783 Dimensions}, 16784 journal = {Acta Numerica}, 16785 volume = {6}, 16786 year = {1997}, 16787 pages = {229--269} 16788} 16789 16790@Article{ luchenghuangmccammon06, 16791 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 16792 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 16793 systems}, 16794 journal = {PNAS}, 16795 doi = {10.1073/pnas.0605166103}, 16796 volume = {102}, 16797 number = {51}, 16798 year = {2006}, 16799 pages = {19314--19319} 16800} 16801 16802@Article{ schussnadlereisenberg01, 16803 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 16804 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 16805 from a molecular model}, 16806 journal = {Physical Review E}, 16807 volume = {64}, 16808 number = {3}, 16809 year = {2001} 16810} 16811 16812@Book{ hairerlubichwanner02, 16813 author = {E. Hairer and Ch. Lubich and G. Wanner}, 16814 title = {Geometric Numerical Integration}, 16815 publisher = {Springer-Verlag}, 16816 address = {Berlin Heidelberg}, 16817 year = {2002} 16818} 16819 16820@Article{ holstbakerwang00, 16821 author = {M. Holst and N. Baker and F. Wang}, 16822 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 16823 equation on massively parallel computers}, 16824 journal = {Journal of Computational Chemistry}, 16825 volume = {21}, 16826 year = {2000} 16827} 16828 16829@Book{ hockneyeastwood81, 16830 author = {R. Hockney and J. Eastwood}, 16831 title = {Computer simulation using particles}, 16832 publisher = {McGraw-Hill}, 16833 address = {New York}, 16834 year = {1981} 16835} 16836 16837@Article{ lutydavistironigunsteren94, 16838 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 16839 Gunsteren}, 16840 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 16841 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 16842 journal = {Molecular Simulation}, 16843 volume = {14}, 16844 number = {1}, 16845 year = {1994}, 16846 pages = {11--20} 16847} 16848 16849@Book{ briggshensonmccormick00, 16850 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 16851 title = {A Multigrid Tutorial (2nd ed.)}, 16852 year = {2000}, 16853 isbn = {0-89871-462-1}, 16854 publisher = {Society for Industrial and Applied Mathematics}, 16855 address = {Philadelphia, PA} 16856} 16857 16858@Article{ chartier2003spectral, 16859 title = {Spectral AMGe ($\rho$ AMGe)}, 16860 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 16861 McCormick, S and Ruge, J and Vassilevski, PS}, 16862 journal = {SIAM Journal on Scientific Computing}, 16863 volume = {25}, 16864 number = {1}, 16865 pages = {1--26}, 16866 year = {2003}, 16867 publisher = {SIAM} 16868} 16869 16870@Article{ galvis2010domain, 16871 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 16872 media}, 16873 author = {Galvis, Juan and Efendiev, Yalchin}, 16874 journal = {Multiscale Modeling \& Simulation}, 16875 volume = {8}, 16876 number = {4}, 16877 pages = {1461--1483}, 16878 year = {2010}, 16879 publisher = {SIAM} 16880} 16881 16882@Book{ brennerscott02, 16883 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 16884 title = {The mathematical theory of finite element methods}, 16885 year = {2002}, 16886 isbn = {0-38795-451-1}, 16887 publisher = {Springer}, 16888 pages = {361} 16889} 16890 16891@Book{ trefethenbau97, 16892 author = {Lloyd N. Trefethen and David {Bau, III}}, 16893 title = {Numerical Linear Algebra}, 16894 publisher = {Society for Industrial and Applied Mathematics}, 16895 address = {Philadelphia, PA}, 16896 pages = {xii + 361}, 16897 year = {1997}, 16898 isbn = {0-89871-361-7}, 16899 isbn-13 = {978-0-89871-361-9}, 16900 lccn = {QA184 .T74 1997}, 16901 mrclass = {65-01 (65-02 65Fxx)}, 16902 mrnumber = {MR1444820 (98k:65002)}, 16903 mrreviewer = {Moody T. Chu}, 16904 bibdate = {Wed Jan 07 15:23:19 1998}, 16905 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 16906} 16907 16908@Article{ liptonreagan2014, 16909 title = {Quantum Algorithms via Linear Algebra: A Primer}, 16910 author = {Richard J Lipton and Kenneth W Regan}, 16911 pages = {206}, 16912 isbn = {978-0-26202-839-4}, 16913 year = {2014} 16914} 16915 16916@InProceedings{ rhea08, 16917 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 16918 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 16919 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16920 booktitle = {Proceedings of IEEE/ACM SC '08}, 16921 year = {2008} 16922} 16923 16924@Misc{ bursteddewilcox09, 16925 author = {Carsten Burstedde and Lucas~C. Wilcox}, 16926 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 16927 note = {in preparation} 16928} 16929 16930@Article{ skeeltezcanhardy02, 16931 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 16932 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 16933 journal = {J. Comp. Chem.}, 16934 volume = {23}, 16935 pages = {673--684}, 16936 year = {2002} 16937} 16938 16939@Article{ verschelde99, 16940 author = {Jan Verschelde}, 16941 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 16942 homotopy continuation}, 16943 journal = {ACM Trans. Math. Softw.}, 16944 volume = {25}, 16945 number = {2}, 16946 issn = {0098-3500}, 16947 pages = {251--276}, 16948 doi = {10.1145/317275.317286}, 16949 publisher = {ACM}, 16950 address = {New York, NY}, 16951 year = {1999} 16952} 16953 16954@InProceedings{ sommeseverscheldewampler08, 16955 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 16956 title = {Solving Polynomial Systems Equation by Equation}, 16957 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 16958 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 16959 pages = {133--152}, 16960 publisher = {Springer-Verlag}, 16961 year = {2008} 16962} 16963 16964@Article{ phanthientanner77, 16965 author = {N. Phan-Thien and R.~I. Tanner}, 16966 title = {A new constitutive equation derived from network theory}, 16967 journal = {J. Non-Newt. Fluid Mech.}, 16968 volume = {2}, 16969 pages = {353}, 16970 year = {1977} 16971} 16972 16973@Manual{ sage, 16974 key = {SAGE}, 16975 author = {W.\thinspace{}A. Stein and others}, 16976 organization = {The Sage~Development Team}, 16977 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 16978 note = {{\tt http://www.sagemath.org}}, 16979 year = {2009} 16980} 16981 16982@Misc{ bateshauensteinsommesewampler06, 16983 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 16984 Wampler}, 16985 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 16986 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 16987} 16988 16989@Article{ archer09, 16990 author = {A. J. Archer}, 16991 collaboration = {}, 16992 title = {Dynamical density functional theory for molecular and colloidal fluids: A 16993 microscopic approach to fluid mechanics}, 16994 publisher = {AIP}, 16995 year = {2009}, 16996 journal = {The Journal of Chemical Physics}, 16997 volume = {130}, 16998 number = {1}, 16999 eid = {014509}, 17000 numpages = {8}, 17001 pages = {014509}, 17002 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 17003 transition; statistical distributions; stochastic processes}, 17004 doi = {10.1063/1.3054633} 17005} 17006 17007@Article{ giesekus1966, 17008 author = {Hanswalter Giesekus}, 17009 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 17010 journal = {Rheologica Acta}, 17011 publisher = {Springer Berlin / Heidelberg}, 17012 volume = {5}, 17013 number = {1}, 17014 month = mar, 17015 year = {1966}, 17016 doi = {10.1007/BF01973575}, 17017 pages = {29-35} 17018} 17019 17020@Article{ baaijens98, 17021 author = {F.P. Baaijens}, 17022 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 17023 journal = {Journal of Non-Newtonian Fluid Mechanics}, 17024 volume = {79}, 17025 year = {1998}, 17026 pages = {361--385} 17027} 17028 17029@Book{ joseph90, 17030 author = {D.~D. Joseph}, 17031 title = {Fluid Dynamics of Viscoelastic Liquids}, 17032 publisher = {Springer}, 17033 address = {New York, NY}, 17034 year = {1990} 17035} 17036 17037@Article{ oldroyd50, 17038 author = {J.~G. Oldroyd}, 17039 title = {On the Formulation of Rheological Equations of State}, 17040 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 17041 Sciences}, 17042 volume = {200}, 17043 year = {1950}, 17044 pages = {523--541} 17045} 17046 17047@InProceedings{ bynasungroppthakur04, 17048 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 17049 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 17050 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 17051 year = {2004} 17052} 17053 17054@Book{ pozrikidis07, 17055 author = {C. Pozrikidis}, 17056 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 17057 publisher = {Kluwer (Springer)}, 17058 pages = {675}, 17059 year = {2001}, 17060 isbn = {0792373510} 17061} 17062 17063@Misc{ kritzkeyesfsp07, 17064 author = {A. Kritz and D. Keyes}, 17065 title = {{Fusion Simulation Project Workshop Report}}, 17066 month = jul, 17067 year = {2007}, 17068 note = {Available via 17069 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 17070} 17071 17072@Misc{ dahlburg02, 17073 author = {J. {Dahlburg (Chair)}}, 17074 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 17075 year = {2002}, 17076 note = {Available via 17077 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 17078} 17079 17080@Misc{ brown08, 17081 author = {D. {Brown (Chair)}}, 17082 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 17083 to the Future}}, 17084 year = {2008}, 17085 howpublished = {Office of Science, U.S. Department of Energy}, 17086 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 17087} 17088 17089@Misc{ crosscutting10, 17090 author = {D. Brown and P. {Messina (Chairs)}}, 17091 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 17092 Exascale}}, 17093 year = {2010}, 17094 howpublished = {Office of Science, U.S. Department of Energy}, 17095 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 17096} 17097 17098@Misc{ extreme-scale-solvers-workshop12, 17099 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 17100 L.C. McInnes and E. Ng and S. Wild}, 17101 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 17102 Architectures}, 17103 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 17104 note = {{Washington, DC}, March 8-9, 2012}, 17105 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 17106 year = {2012} 17107} 17108 17109@Misc{ monizrosner09, 17110 author = {{E. Moniz and R. Rosner}}, 17111 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 17112 and Simulation at the Extreme Scale}}, 17113 month = may, 17114 year = {2009}, 17115 note = {See 17116 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 17117} 17118 17119@Misc{ blanford08, 17120 author = {{R. Blandord (Chair)}}, 17121 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 17122 Computing at the Extreme Scale}}, 17123 month = dec, 17124 year = {2008}, 17125 note = {See 17126 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 17127} 17128 17129@Misc{ exascale07, 17130 author = {H. Simon and T. Zacharia and R. Stevens}, 17131 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 17132 year = {2007}, 17133 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 17134} 17135 17136@Misc{ ascrbreakthroughs08, 17137 author = {{Panel on Recent Significant Advancements in Computational Science}}, 17138 title = {Breakthroughs}, 17139 year = {2008}, 17140 note = {See 17141 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 17142} 17143 17144@Misc{ petsc-rd100-2009, 17145 author = {{R\&D Magazine}}, 17146 title = {{PETSc} {R}\&{D} 100 Award}, 17147 year = {2009}, 17148 note = {See 17149 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 17150} 17151 17152@Article{ compass-scidac08, 17153 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 17154 R. Ryne}, 17155 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 17156 Computational Science for Future Accelerators and Accelerator Technologies}, 17157 journal = {J. Phys.: Conf. Ser.}, 17158 volume = {125}, 17159 year = {2008}, 17160 pages = {012001}, 17161 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 17162} 17163 17164@Article{ compass-amundson-scidac08, 17165 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 17166 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 17167 Stoltz}, 17168 journal = {J. Phys.: Conf. Ser.}, 17169 volume = {125}, 17170 year = {2008} 17171} 17172 17173@InProceedings{ muszala09, 17174 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 17175 Simulations}, 17176 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 17177 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 17178 {(CBHPC 2009)}}, 17179 year = {2009} 17180} 17181 17182@Article{ gaston09, 17183 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 17184 Equations}, 17185 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 17186 journal = {Nuclear Engineering and Design}, 17187 volume = {239}, 17188 number = {10}, 17189 year = {2009}, 17190 pages = {1768 -- 1778} 17191} 17192 17193@Article{ gaston09b, 17194 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 17195 Engineering}, 17196 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 17197 and C. Permann and W. Taitano}, 17198 journal = {J. Phys.: Conf. Ser.}, 17199 volume = {180}, 17200 year = {2009}, 17201 pages = {012012} 17202} 17203 17204@Article{ newman09, 17205 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 17206 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 17207 author = {Chris Newman and Glen Hansen and Derek Gaston}, 17208 journal = {Journal of Nuclear Materials}, 17209 volume = {392}, 17210 issue = {1}, 17211 year = {2009}, 17212 pages = {6 -- 15} 17213} 17214 17215@Misc{ www:fenics, 17216 author = {{FE}ni{CS}}, 17217 title = {{FE}ni{CS} Project}, 17218 howpublished = {\url{http://www.fenics.org/}}, 17219 year = {2018} 17220} 17221 17222@InProceedings{ zwart08, 17223 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 17224 Systems}, 17225 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 17226 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 17227 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 17228 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 17229 booktitle = {Proceedings of ICCS 2008}, 17230 year = {2008} 17231} 17232 17233@Article{ klocknerwarburtonbridgehesthaven09, 17234 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 17235 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 17236 journal = {J. Comput. Phys.}, 17237 volume = {228}, 17238 number = {21}, 17239 year = {2009}, 17240 issn = {0021-9991}, 17241 pages = {7863--7882}, 17242 doi = {10.1016/j.jcp.2009.06.041}, 17243 publisher = {Academic Press Professional}, 17244 address = {San Diego, CA} 17245} 17246 17247@PhDThesis{ rankin99, 17248 author = {Rankin, W. T.}, 17249 keywords = {FMM, parallel FMM}, 17250 school = {Department of Electrical and Computer Engineering, Duke University}, 17251 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 17252 year = {1999} 17253} 17254 17255@InProceedings{ warrensalmon93, 17256 abstract = {We report on an efficient adaptive N-body method which we have recently designed 17257 and implemented. The algorithm computes the forces on an arbitrary distribution of 17258 bodies in a time which scales as N log N with the particle number. The accuracy of 17259 the force calculations is analytically bounded, and can be adjusted via a user 17260 defined parameter between a few percent relative accuracy, down to machine 17261 arithmetic accuracy. Instead of using pointers to indicate the topology of the 17262 tree, we identify...}, 17263 address = {New York}, 17264 author = {Warren, Michael S. and Salmon, John K.}, 17265 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 17266 citeulike-article-id={580952}, 17267 keywords = {oct-tree}, 17268 pages = {12--21}, 17269 publisher = {ACM}, 17270 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 17271 year = {1993}, 17272 doi = {10.1145/169627.169640}, 17273 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 17274} 17275 17276@Unpublished{ cruzwccm10, 17277 author = {Felipe A. Cruz}, 17278 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 17279 note = {Presentation at WCCM 2010, Sydney Australia}, 17280 year = {2010} 17281} 17282 17283@Article{ mcguffee06, 17284 author = {S.~R. {McGuffee} and A.~H. Elcock}, 17285 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 17286 of salt, {pH}, point mutations, and protein concentration in simulations of 17287 1000-molecule systems}, 17288 journal = {Journal of the American Chemical Society}, 17289 volume = {128}, 17290 pages = {12098--12110}, 17291 year = {2006} 17292} 17293 17294@Article{ nilsencaihoylandlangtangen10, 17295 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 17296 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 17297 in Python}}, 17298 journal = {ArXiv e-prints}, 17299 archiveprefix = {arXiv}, 17300 eprint = {1002.0705}, 17301 primaryclass = {cs.DC}, 17302 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 17303 - Programming Languages}, 17304 year = {2010}, 17305 month = feb, 17306 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 17307 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 17308} 17309 17310@Misc{ mcinnes:siam09:minisymposium, 17311 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 17312 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 17313 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 17314 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 17315 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 17316 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 17317 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 17318 Austin).} 17319} 17320 17321@Misc{ mcinnes:fsp-summary:feb2011, 17322 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 17323 title = {Solvers and Time Integration Breakout Summary}, 17324 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 17325 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 17326} 17327 17328@Misc{ dvi-materials:siamcse11, 17329 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 17330 Materials}, 17331 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 17332 Smith and L. Wang}, 17333 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 17334 and Engineering, March 3, 2011} 17335} 17336 17337@Misc{ jamroz:cemm10, 17338 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 17339 author = {B. Jamroz and S. Kruger and T. Austin}, 17340 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 17341} 17342 17343@Misc{ kruger:feb4-2011, 17344 title = {personal communication}, 17345 author = {S. Kruger}, 17346 note = {February, 2011} 17347} 17348 17349@Article{ elman1996, 17350 author = {H.C. Elman}, 17351 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 17352 viscosity}, 17353 journal = {SIAM J. Sci. Comput.}, 17354 volume = {20}, 17355 year = {1996}, 17356 pages = {1299--1316} 17357} 17358 17359@Article{ kayloghinwathen2002, 17360 author = {D. Kay and D. Loghin and A. Wathen}, 17361 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 17362 journal = {SIAM J. Sci. Comput.}, 17363 volume = {24}, 17364 year = {2002}, 17365 pages = {237--256} 17366} 17367 17368@Article{ elmanhowleshadidshuttleworthtuminaro2006, 17369 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 17370 title = {Block preconditioners based on approximate commutators}, 17371 journal = {SIAM J. Sci. Comput.}, 17372 volume = {27}, 17373 number = {5}, 17374 year = {2006}, 17375 pages = {1651--1668} 17376} 17377 17378@Article{ braesssarazin1997, 17379 author = {Dietrich Braess and Regina Sarazin}, 17380 title = {An efficient smoother for the {Stokes} problem}, 17381 journal = {Applied Numerical Mathematics}, 17382 volume = {23}, 17383 number = {1}, 17384 year = {1997}, 17385 pages = {3--19}, 17386 doi = {10.1016/S0168-9274(96)00059-1} 17387} 17388 17389@Article{ wright2001large, 17390 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 17391 author = {Wright, T.G. and Trefethen, L.N.}, 17392 journal = {SIAM Journal on Scientific Computing}, 17393 volume = {23}, 17394 pages = {591}, 17395 year = {2001} 17396} 17397 17398@Misc{ wright2002eigtool, 17399 title = {Eig{T}ool}, 17400 author = {Wright, T.G. and Trefethen, LN}, 17401 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 17402 year = {2002} 17403} 17404 17405@Misc{ visit-web-site, 17406 key = {{VisIt}}, 17407 title = {{VisIt web site}}, 17408 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 17409 url = {http://wci.llnl.gov/codes/visit/}, 17410 year = {2011} 17411} 17412 17413@Book{ trefethen1996, 17414 title = {Finite difference and spectral methods for ordinary and partial differential 17415 equations}, 17416 author = {Lloyd Nicholas Trefethen}, 17417 year = {1996}, 17418 publisher = {Cornell University-Department of Computer Science and Center for Applied 17419 Mathematics} 17420} 17421 17422@Book{ trefethen2005spectra, 17423 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 17424 author = {Trefethen, L.N. and Embree, M.}, 17425 year = {2005}, 17426 publisher = {Princeton University Press} 17427} 17428 17429@Article{ gomez2010isogeometric, 17430 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 17431 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 17432 journal = {Computer Methods in Applied Mechanics and Engineering}, 17433 volume = {199}, 17434 number = {25-28}, 17435 pages = {1828--1840}, 17436 issn = {0045-7825}, 17437 year = {2010}, 17438 publisher = {Elsevier} 17439} 17440 17441@Article{ gomez2008isogeometric, 17442 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 17443 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 17444 journal = {Computer Methods in Applied Mechanics and Engineering}, 17445 volume = {197}, 17446 number = {49-50}, 17447 pages = {4333--4352}, 17448 year = {2008}, 17449 publisher = {Elsevier} 17450} 17451 17452@Misc{ fastmath:project, 17453 author = {Lori {Diachin (PI)}}, 17454 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 17455 (FASTMath) Institute}}, 17456 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 17457} 17458 17459@Misc{ exascale-software:proposal, 17460 author = {Peter {Beckman (PI)}}, 17461 title = {{Exascale Software Center}}, 17462 note = {proposal to DOE} 17463} 17464 17465@Misc{ imex:project, 17466 author = {Barry {Smith (PI)}}, 17467 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 17468 Multimodel PDEs}}, 17469 note = {DOE ASCR applied math project} 17470} 17471 17472@Misc{ intel-mic:website, 17473 author = {Intel}, 17474 title = {{Many Integrated Core Architecture}}, 17475 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 17476} 17477 17478@Article{ dudson:2009, 17479 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 17480 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 17481 journal = {Computer Physics Communications}, 17482 volume = {180}, 17483 pages = {1467}, 17484 year = {2009} 17485} 17486 17487@Article{ umansky:2009, 17488 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 17489 title = {{Status and verification of edge plasma turbulence code BOUT}}, 17490 journal = {Computer Physics Communications}, 17491 year = {2009}, 17492 volume = {180}, 17493 pages = {887-903} 17494} 17495 17496@Article{ xu:1998, 17497 author = {X.Q. Xu and R.H. Cohen}, 17498 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 17499 journal = {Computer Physics Communications}, 17500 year = {1998}, 17501 volume = {36}, 17502 number = {1-2}, 17503 pages = {158} 17504} 17505 17506@Article{ tron:1999, 17507 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 17508 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 17509 journal = {SIAM Journal on Optimization}, 17510 volume = {9}, 17511 number = {4}, 17512 pages = {1100-1127}, 17513 year = {1999} 17514} 17515 17516@Article{ stubenamg, 17517 author = {K. St\"{u}ben}, 17518 title = {A review of algebraic multigrid}, 17519 journal = {J. Comput. Appl. Math.}, 17520 volume = {128}, 17521 number = {1-2}, 17522 year = {2001}, 17523 issn = {0377-0427}, 17524 pages = {281--309}, 17525 doi = {10.1016/S0377-0427(00)00516-1}, 17526 publisher = {Elsevier Science Publishers B. V.}, 17527 address = {Amsterdam, The Netherlands, The Netherlands} 17528} 17529 17530@Article{ feuchtermg, 17531 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 17532 title = {Bridging the gap between geometric and algebraic multigrid methods}, 17533 journal = {Computing and visualization in science}, 17534 publisher = {Springer}, 17535 volume = {6}, 17536 number = {1}, 17537 year = {2003}, 17538 pages = {1--13} 17539} 17540 17541@Article{ chowmgsmoothness, 17542 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 17543 only attempts to interpolate in the directions of geometrical smoothness. These 17544 directions are determined by analyzing samples of algebraically smooth error, e. 17545 Neighboring grid points i and j are called smoothly coupled if e i and e j are 17546 consistently nearby in value. In addition, these dierences may be used to dene 17547 interpolation weights. These new ideas may be incorporated into the algebraic 17548 multigrid method. Test results show that the new method can have much lower grid 17549 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 17550 author = {Chow, Edmond}, 17551 citeulike-article-id={7675372}, 17552 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17553 journal = {American Journal of Mathematics}, 17554 keywords = {fem, multigrid}, 17555 pages = {197--215}, 17556 posted-at = {2010-08-17 23:29:51}, 17557 priority = {2}, 17558 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 17559 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17560 volume = {65}, 17561 year = {2001} 17562} 17563 17564@Article{ jonesamge, 17565 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 17566 elements) method based on element agglomeration. In the method, coarse grid 17567 elements are formed by agglomerating fine grid elements. Compatible interpolation 17568 operators are constructed which yield coarse grid basis functions with a minimal 17569 energy property. Heuristics based on interpolation quality measures are used to 17570 guide the agglomeration procedure. The performance of the resulting method is 17571 demonstrated in two-level numerical experiments.}}, 17572 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 17573 citeulike-article-id={8598569}, 17574 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17575 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 17576 journal = {SIAM Journal on Scientific Computing}, 17577 keywords = {amg, fem, multigrid}, 17578 number = {1}, 17579 pages = {109--133}, 17580 posted-at = {2011-01-13 18:05:55}, 17581 priority = {2}, 17582 publisher = {SIAM}, 17583 title = {{AMGE Based on Element Agglomeration}}, 17584 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17585 volume = {23}, 17586 year = {2001} 17587} 17588 17589@Article{ saad1993, 17590 author = {Saad, Youcef}, 17591 doi = {10.1137/0914028}, 17592 issn = {10648275}, 17593 journal = {SIAM Journal on Scientific Computing}, 17594 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 17595 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 17596 precondition-,preconditioned conju-,subject classi cations,variable 17597 preconditioners}, 17598 number = {2}, 17599 pages = {461--469}, 17600 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 17601 volume = {14}, 17602 year = {1993} 17603} 17604 17605@Misc{ path:homepage, 17606 author = {S. Dirkse and M. Ferris and T. Munson}, 17607 title = {{{PATH} {W}eb page}}, 17608 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 17609} 17610 17611@Article{ ketcheson2008, 17612 author = {David I Ketcheson}, 17613 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 17614 Low-Storage Implementations}, 17615 volume = {30}, 17616 journal = {SIAM Journal on Scientific Computing}, 17617 year = {2008}, 17618 pages = {2113--2136} 17619} 17620 17621@Article{ elman2009boundary, 17622 title = {{Boundary conditions in approximate commutator preconditioners for the 17623 Navier-Stokes equations}}, 17624 author = {Elman, H.C. and Tuminaro, R.}, 17625 journal = {Electronic Transactions on Numerical Analysis}, 17626 volume = {35}, 17627 pages = {257--280}, 17628 year = {2009} 17629} 17630 17631@Article{ elman2008tcp, 17632 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 17633 incompressible Navier-Stokes equations}}, 17634 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 17635 R.}, 17636 journal = {Journal of Computational Physics}, 17637 volume = {227}, 17638 number = {1}, 17639 pages = {1790--1808}, 17640 year = {2008}, 17641 publisher = {Academic Press}, 17642 url = {https://www.osti.gov/biblio/920807/} 17643} 17644 17645@Article{ arioli2013, 17646 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 17647 author = {Arioli, Mario}, 17648 journal = {SIAM Journal on Matrix Analysis and Applications}, 17649 volume = {34}, 17650 number = {2}, 17651 pages = {571--592}, 17652 year = {2013}, 17653 publisher = {SIAM} 17654} 17655 17656@Book{ wesseling2009, 17657 title = {Principles of computational fluid dynamics}, 17658 author = {Wesseling, Pieter}, 17659 volume = {29}, 17660 year = {2009}, 17661 publisher = {Springer Science \& Business Media} 17662} 17663 17664@Article{ silvester2001efficient, 17665 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 17666 incompressible flow}}, 17667 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 17668 journal = {Journal of Computational and Applied Mathematics}, 17669 volume = {128}, 17670 number = {1-2}, 17671 pages = {261--279}, 17672 issn = {0377-0427}, 17673 year = {2001}, 17674 publisher = {Elsevier} 17675} 17676 17677@Article{ elman1999bfbt, 17678 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 17679 viscosity}}, 17680 author = {Elman, H.C.}, 17681 journal = {SIAM Journal on Scientific Computing}, 17682 volume = {20}, 17683 number = {4}, 17684 pages = {1299--1316}, 17685 issn = {1064-8275}, 17686 year = {1999}, 17687 publisher = {Citeseer} 17688} 17689 17690@Article{ elman2006bpb, 17691 title = {{Block preconditioners based on approximate commutators}}, 17692 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 17693 journal = {SIAM Journal on Scientific Computing}, 17694 volume = {27}, 17695 number = {5}, 17696 pages = {1651--1668}, 17697 year = {2006}, 17698 publisher = {Philadelphia, PA: SIAM, c1993-} 17699} 17700 17701@Article{ olshanskii2006analysis, 17702 title = {{Analysis of a Stokes interface problem}}, 17703 author = {Olshanskii, M.A. and Reusken, A.}, 17704 journal = {Numerische Mathematik}, 17705 volume = {103}, 17706 number = {1}, 17707 pages = {129--149}, 17708 issn = {0029-599X}, 17709 year = {2006}, 17710 publisher = {Springer} 17711} 17712 17713@Article{ patankar1972cph, 17714 title = {{A calculation procedure for heat, mass and momentum transfer in 17715 three-dimensional parabolic flows}}, 17716 author = {Patankar, S.V. and Spalding, D.B.}, 17717 journal = {Int. J. Heat Mass Transfer}, 17718 volume = {15}, 17719 pages = {1787--1806}, 17720 year = {1972} 17721} 17722 17723@Article{ rannacher1992simple, 17724 title = {{Simple nonconforming quadrilateral Stokes element}}, 17725 author = {Rannacher, R. and Turek, S.}, 17726 journal = {Numerical Methods for Partial Differential Equations}, 17727 volume = {8}, 17728 number = {2}, 17729 pages = {97--111}, 17730 issn = {1098-2426}, 17731 year = {1992}, 17732 publisher = {Wiley Online Library} 17733} 17734 17735@Article{ rannacher2000finite, 17736 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 17737 author = {Rannacher, R.}, 17738 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 17739 pages = {191}, 17740 isbn = {3764364149}, 17741 year = {2000}, 17742 publisher = {Birkhauser} 17743} 17744 17745@Article{ vanka1986block, 17746 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 17747 variables}}, 17748 author = {Vanka, S.P.}, 17749 journal = {Journal of Computational Physics}, 17750 volume = {65}, 17751 number = {1}, 17752 pages = {138--158}, 17753 issn = {0021-9991}, 17754 year = {1986}, 17755 publisher = {Elsevier} 17756} 17757 17758@Article{ eisenstat1983variational, 17759 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 17760 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 17761 journal = {SIAM Journal on Numerical Analysis}, 17762 volume = {20}, 17763 number = {2}, 17764 pages = {345--357}, 17765 year = {1983}, 17766 publisher = {JSTOR} 17767} 17768 17769@InProceedings{ burstedde2008scalable, 17770 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 17771 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 17772 T. and Wilcox, L.C. and Zhong, S.}, 17773 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 17774 pages = {62}, 17775 year = {2008}, 17776 organization = {IEEE Press} 17777} 17778 17779@Article{ burstedde2009parallel, 17780 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 17781 flow problems}, 17782 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 17783 journal = {Computer Methods in Applied Mechanics and Engineering}, 17784 volume = {198}, 17785 number = {21-26}, 17786 pages = {1691--1700}, 17787 year = {2009}, 17788 publisher = {Elsevier} 17789} 17790 17791@Article{ stadler2010dynamics, 17792 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 17793 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 17794 Ghattas, O.}, 17795 journal = {Science}, 17796 volume = {329}, 17797 number = {5995}, 17798 pages = {1033}, 17799 year = {2010}, 17800 publisher = {American Association for the Advancement of Science} 17801} 17802 17803@Article{ tackley2008modelling, 17804 title = {Modelling compressible mantle convection with large viscosity contrasts in a 17805 three-dimensional spherical shell using the yin-yang grid}, 17806 author = {Tackley, P.J.}, 17807 journal = {Physics of the Earth and Planetary Interiors}, 17808 volume = {171}, 17809 number = {1-4}, 17810 pages = {7--18}, 17811 year = {2008}, 17812 publisher = {Elsevier} 17813} 17814 17815@Article{ moresizhonggurnis96, 17816 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 17817 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 17818 viscosity}, 17819 journal = {Physics of the Earth and Planetary Interiors}, 17820 volume = {97}, 17821 pages = {83-–94}, 17822 year = {1996} 17823} 17824 17825@Article{ moresisolomatov95, 17826 author = {Louis N. Moresi and V. S. Solomatov}, 17827 title = {Numerical investigation of {2D} convection with extremely large viscosity 17828 variations}, 17829 journal = {Physics of Fluids}, 17830 volume = {7}, 17831 number = {9}, 17832 pages = {2154-–2162}, 17833 year = {1995} 17834} 17835 17836@Article{ chenmolnar83, 17837 author = {W.-P. Chen and P. Molnar}, 17838 title = {Focal depths of intra-continental and intraplate earthquakes and their 17839 implications for the thermal and mechanical properties of the lithosphere}, 17840 journal = {Journal of Geophysical Research}, 17841 volume = {88}, 17842 pages = {4183–-4214}, 17843 year = {1983} 17844} 17845 17846@Article{ jackson02, 17847 author = {J. Jackson}, 17848 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 17849 journal = {GSA Today}, 17850 volume = {12}, 17851 pages = {4–-10}, 17852 year = {2002} 17853} 17854 17855@Article{ burovwatts06, 17856 author = {E.B. Burov and A.B. Watts}, 17857 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 17858 brulee?}, 17859 journal = {GSA Today}, 17860 volume = {16}, 17861 pages = {4–-10}, 17862 year = {2006} 17863} 17864 17865@InProceedings{ yang:brent:2002, 17866 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 17867 Parallel Distributed Memory Architectures}, 17868 author = {Laurence T. Yang and Richard Brent}, 17869 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 17870 for Parallel Processing}, 17871 year = {2002}, 17872 publisher = {IEEE} 17873} 17874 17875@Article{ demmel2008communication, 17876 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 17877 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 17878 journal = {Arxiv preprint arXiv:0808.2664}, 17879 year = {2008} 17880} 17881 17882@Article{ demmel09, 17883 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 17884 title = {Communication-optimal Iterative Methods}, 17885 journal = {Journal of Physics: Conf. Series}, 17886 volume = {180}, 17887 year = {2009} 17888} 17889 17890@TechReport{ parms04, 17891 author = {Yousef Saad and Masha Sosonkina}, 17892 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 17893 linear systems user's guide}, 17894 number = {UMSI2004-8}, 17895 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 17896 year = {2004} 17897} 17898 17899@Article{ picard1890, 17900 author = {Emile Picard}, 17901 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 17902 m\'ethode des approximations successives}, 17903 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 17904 volume = {4}, 17905 number = {6}, 17906 pages = {145--210}, 17907 year = {1890}, 17908 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 17909} 17910 17911@Book{ rall1969, 17912 author = {Louis B. Rall}, 17913 title = {Computational solution of nonlinear operator equations}, 17914 publisher = {Krieger Pub Co.}, 17915 pages = {225}, 17916 year = {1969} 17917} 17918 17919@Article{ fletcherreeves1964, 17920 author = {R. Fletcher and C. M. Reeves}, 17921 title = {Function Minimization by Conjugate Gradients}, 17922 journal = {Computer Journal}, 17923 volume = {7}, 17924 pages = {149–-154}, 17925 year = {1964} 17926} 17927 17928@InBook{ mcinnesallanetal06, 17929 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 17930 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 17931 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 17932 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 17933 editor = {A.~M.~Bruaset and A.~Tveito}, 17934 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 17935 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 17936 publisher = {Springer}, 17937 year = {2006}, 17938 number = {51}, 17939 series = {Lecture Notes in Computational Science and Engineering}, 17940 pages = {327--381}, 17941 doi = {10.1016/S0167-8191(02)00191-6} 17942} 17943 17944@Article{ cyrshadidtuminaro12, 17945 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 17946 equations}, 17947 journal = {Journal of Computational Physics}, 17948 volume = {231}, 17949 number = {2}, 17950 pages = {345 - 363}, 17951 year = {2012}, 17952 issn = {0021-9991}, 17953 doi = {10.1016/j.jcp.2011.09.001}, 17954 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 17955} 17956 17957@Article{ keyesmcinneswoodwardetal13, 17958 title = {Multiphysics Simulations: Challenges and Opportunities}, 17959 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 17960 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 17961 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 17962 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 17963 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 17964 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 17965 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 17966 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 17967 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 17968 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 17969 journal = {International Journal of High Performance Computing Applications}, 17970 month = feb, 17971 year = {2013}, 17972 volume = {27}, 17973 number = {1}, 17974 pages = {4--83}, 17975 doi = {10.1177/1094342012468181}, 17976 note = {Special issue}, 17977 abstract = {We consider multiphysics applications from algorithmic and architectural 17978 perspectives, where ``algorithmic'' includes both mathematical analysis and 17979 computational complexity and ``architectural'' includes both software and hardware 17980 environments. Many diverse multiphysics applications can be reduced, en route to 17981 their computational simulation, to a common algebraic coupling paradigm. 17982 Mathematical analysis of multiphysics coupling in this form is not always 17983 practical for realistic applications, but model problems representative of 17984 applications discussed herein can provide insight. A variety of software 17985 frameworks for multiphysics applications have been constructed and refined within 17986 disciplinary communities and executed on leading-edge computer systems. We examine 17987 several of these, expose some commonalities among them, and attempt to extrapolate 17988 best practices to future systems. From our study, we summarize challenges and 17989 forecast opportunities.} 17990} 17991 17992@Misc{ rosner10, 17993 author = {Robert {Rosner (Chair)}}, 17994 title = {{The Opportunities and Challenges of Exascale Computing}}, 17995 year = {2010}, 17996 howpublished = {Office of Science, U.S. Department of Energy}, 17997 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 17998} 17999 18000@Misc{ kogge2008exascale, 18001 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 18002 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 18003 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 18004 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 18005 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 18006 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 18007 howpublished = {DARPA}, 18008 year = {2008}, 18009 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 18010} 18011 18012@Misc{ doegrandchallengeworkshops, 18013 key = {Office of Science, U.S. Department of Energy}, 18014 title = {{Scientific Grand Challenges Workshop Series}}, 18015 howpublished = {Office of Science, U.S. Department of Energy, see 18016 \url{http://extremecomputing.labworks.org/workshops.stm}} 18017} 18018 18019@Misc{ lawrence2011, 18020 key = {Lawrence}, 18021 title = {{Ernest Orlando Lawrence Award Winners}}, 18022 howpublished = {U.S. Department of Energy, {\footnotesize 18023 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 18024 year = {2011} 18025} 18026 18027@Article{ murphy2000npi, 18028 title = {{A note on preconditioning for indefinite linear systems}}, 18029 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 18030 journal = {SIAM Journal on Scientific Computing}, 18031 volume = {21}, 18032 number = {6}, 18033 pages = {1969--1972}, 18034 year = {2000}, 18035 publisher = {Philadelphia, PA: SIAM, c1993-} 18036} 18037 18038@Article{ elman2011bouyancy, 18039 title = {Fast iterative solvers for buoyancy driven flow problems}, 18040 journal = {Journal of Computational Physics}, 18041 volume = {230}, 18042 number = {10}, 18043 pages = {3900 - 3914}, 18044 year = {2011}, 18045 note = {}, 18046 issn = {0021-9991}, 18047 doi = {10.1016/j.jcp.2011.02.014}, 18048 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 18049 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 18050 Adaptivity, Preconditioning, Algebraic multigrid} 18051} 18052 18053@Article{ dongarrabeckman11, 18054 author = {J. Dongarra and P. Beckman and et al.}, 18055 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 18056 journal = {Int. J. High Perf. Comput. Applics.}, 18057 volume = {25}, 18058 year = {2011}, 18059 pages = {3--60} 18060} 18061 18062@Article{ mandel1999energy, 18063 title = {Energy optimization of algebraic multigrid bases}, 18064 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 18065 journal = {Computing}, 18066 volume = {62}, 18067 number = {3}, 18068 pages = {205--228}, 18069 year = {1999}, 18070 publisher = {Springer} 18071} 18072 18073@Article{ vanek1996algebraic, 18074 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 18075 problems}, 18076 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 18077 journal = {Computing}, 18078 volume = {56}, 18079 number = {3}, 18080 pages = {179--196}, 18081 year = {1996}, 18082 publisher = {Springer} 18083} 18084 18085@Article{ vanek2001convergence, 18086 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 18087 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 18088 journal = {Numerische Mathematik}, 18089 volume = {88}, 18090 number = {3}, 18091 pages = {559--579}, 18092 year = {2001}, 18093 publisher = {Springer} 18094} 18095 18096@Article{ brannick2007algebraic, 18097 title = {Algebraic multigrid methods based on compatible relaxation and energy 18098 minimization}, 18099 author = {Brannick, J. and Zikatanov, L.}, 18100 journal = {Domain decomposition methods in science and engineering XVI}, 18101 pages = {15--26}, 18102 year = {2007}, 18103 publisher = {Springer} 18104} 18105 18106@Article{ brannickfalgout2010, 18107 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 18108 author = {James J. Brannick and Robert D. Falgout}, 18109 journal = {SIAM Journal on Scientific Computing}, 18110 volume = {32}, 18111 number = {3}, 18112 pages = {1393--1416}, 18113 url = {http://epubs.siam.org/doi/10.1137/090772216}, 18114 doi = {10.1137/090772216}, 18115 issn = {1064-8275}, 18116 year = {2010} 18117} 18118 18119@Article{ xu2004energy, 18120 title = {On an energy minimizing basis for algebraic multigrid methods}, 18121 author = {Xu, J. and Zikatanov, L.}, 18122 journal = {Computing and Visualization in Science}, 18123 volume = {7}, 18124 number = {3}, 18125 pages = {121--127}, 18126 year = {2004}, 18127 publisher = {Springer} 18128} 18129 18130@Article{ dblp:journals/toms/bakerhlt09, 18131 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 18132 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 18133 journal = {ACM Trans. Math. Softw.}, 18134 volume = {36}, 18135 number = {3}, 18136 year = {2009}, 18137 doi = {10.1145/1527286.1527287}, 18138 bibsource = {DBLP, http://dblp.uni-trier.de} 18139} 18140 18141@Article{ dblp:journals/siamsc/yanggbllhn05, 18142 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 18143 Parry Husbands and Esmond G. Ng}, 18144 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 18145 journal = {SIAM J. Scientific Computing}, 18146 volume = {27}, 18147 number = {3}, 18148 year = {2005}, 18149 pages = {873-892}, 18150 doi = {10.1137/040613767}, 18151 bibsource = {DBLP, http://dblp.uni-trier.de} 18152} 18153 18154@TechReport{ ml-guide, 18155 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 18156 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 18157 institution = {Sandia National Laboratories}, 18158 year = {2006}, 18159 number = {SAND2006-2649} 18160} 18161 18162@Article{ brannick06, 18163 title = {An energy-based AMG coarsening strategy}, 18164 volume = {13}, 18165 doi = {10.1002/nla.480}, 18166 number = {2-3}, 18167 journal = {Numerical Linear Algebra with Applications}, 18168 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 18169 and Ruge, J}, 18170 year = {2006}, 18171 pages = {133--148} 18172} 18173 18174@Article{ olson10, 18175 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 18176 title = {A new perspective on strength measures in algebraic multigrid}, 18177 journal = {Numerical Linear Algebra with Applications}, 18178 volume = {17}, 18179 number = {4}, 18180 pages = {713--733}, 18181 year = {2010}, 18182 publisher = {John Wiley \& Sons, Ltd.}, 18183 issn = {1099-1506}, 18184 doi = {10.1002/nla.669} 18185} 18186 18187@Article{ olson11, 18188 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 18189 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 18190 Minimization}, 18191 journal = {SIAM J. Sci. Comput.}, 18192 issue_date = {April 2011}, 18193 volume = {33}, 18194 issue = {2}, 18195 month = apr, 18196 year = {2011}, 18197 issn = {1064-8275}, 18198 pages = {966--991}, 18199 numpages = {26}, 18200 doi = {10.1137/100803031}, 18201 acmid = {2078825}, 18202 publisher = {Society for Industrial and Applied Mathematics}, 18203 address = {Philadelphia, PA}, 18204 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 18205 aggregation} 18206} 18207 18208@Article{ dorit2011, 18209 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 18210 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 18211 journal = {Multiscale Modeling {\&} Simulation}, 18212 volume = {9}, 18213 number = {1}, 18214 year = {2011}, 18215 pages = {407-423}, 18216 doi = {10.1137/100791142} 18217} 18218 18219@Article{ chen2011algebraic, 18220 title = {Algebraic distance on graphs}, 18221 author = {Chen, Jie and Safro, Ilya}, 18222 journal = {SIAM Journal on Scientific Computing}, 18223 volume = {33}, 18224 number = {6}, 18225 pages = {3468--3490}, 18226 year = {2011}, 18227 publisher = {SIAM} 18228} 18229 18230@InProceedings{ adams04, 18231 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 18232 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 18233 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 18234 half a billion degrees of freedom}, 18235 note = {Gordon Bell Award}, 18236 year = {2004} 18237} 18238 18239@Article{ adams03a, 18240 author = {Adams, M.~F.}, 18241 journal = {Numerical Linear Algebra with Applications}, 18242 number = {2-3}, 18243 pages = {141-153}, 18244 title = {Algebraic multigrid methods for constrained linear systems with applications to 18245 contact problems in solid mechanics}, 18246 volume = {11}, 18247 year = {2004} 18248} 18249 18250@Article{ adams-10a, 18251 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 18252 doi = {10.1016/j.jcp.2010.04.024}, 18253 issn = {0021-9991}, 18254 journal = {Journal of Computational Physics}, 18255 keywords = {Implicit magnetohydrodynamics}, 18256 number = {18}, 18257 pages = {6208 - 6219}, 18258 title = {Toward textbook multigrid efficiency for fully implicit resistive 18259 magnetohydrodynamics}, 18260 volume = {229}, 18261 year = {2010} 18262} 18263 18264@InProceedings{ adams98, 18265 address = {Copper Mountain, CO}, 18266 author = {Adams, M.~F.}, 18267 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 18268 title = {A Parallel Maximal Independent Set Algorithm}, 18269 year = {1998} 18270} 18271 18272@InProceedings{ madaypatera89, 18273 author = {Y. Maday and A. T. Patera}, 18274 title = {Spectral element methods for the {Navier-Stokes} equations}, 18275 editor = {A. K. Noor and J. T. Oden}, 18276 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 18277 pages = {71-–143}, 18278 publisher = {ASME}, 18279 address = {New York, NY}, 18280 year = {1989} 18281} 18282 18283@Article{ mishra2012mlmcfvm, 18284 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 18285 conservation laws in multi-dimensions}, 18286 journal = {Journal of Computational Physics}, 18287 volume = {231}, 18288 number = {8}, 18289 pages = {3365--3388}, 18290 year = {2012}, 18291 issn = {0021-9991}, 18292 doi = {10.1016/j.jcp.2012.01.011}, 18293 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 18294 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 18295 Carlo, Parallelization} 18296} 18297 18298@Article{ barth2011mlmcfe, 18299 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 18300 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 18301 Switzerland}, 18302 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 18303 stochastic coefficients}, 18304 journal = {Numerische Mathematik}, 18305 publisher = {Springer Berlin / Heidelberg}, 18306 issn = {0029-599X}, 18307 keyword = {Mathematics and Statistics}, 18308 pages = {123-161}, 18309 volume = {119}, 18310 issue = {1}, 18311 doi = {10.1007/s00211-011-0377-0}, 18312 year = {2011} 18313} 18314 18315@Article{ nguyen2011hybridizable, 18316 title = {Hybridizable discontinuous {G}alerkin methods}, 18317 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 18318 journal = {Spectral and High Order Methods for Partial Differential Equations}, 18319 pages = {63--84}, 18320 year = {2011}, 18321 publisher = {Springer} 18322} 18323 18324@Misc{ snyder-scidac3:proposal, 18325 author = {Philip {Snyder (PI)}}, 18326 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 18327 note = {proposal to DOE SciDAC3}, 18328 month = oct, 18329 year = {2011} 18330} 18331 18332@Misc{ wirth-scidac3:proposal, 18333 author = {Brian {Wirth (PI)}}, 18334 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 18335 through Leadership Class Computing}}, 18336 note = {proposal to DOE SciDAC3}, 18337 month = oct, 18338 year = {2011} 18339} 18340 18341@Misc{ cary-scidac3:proposal, 18342 author = {John {Cary (PI)}}, 18343 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 18344 Stability (IMMPACTS)}}, 18345 note = {proposal to DOE SciDAC3}, 18346 month = oct, 18347 year = {2011} 18348} 18349 18350@Misc{ vashista-scidac3:proposal, 18351 author = {Priya {Vashista (PI)}}, 18352 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 18353 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 18354 Multi-Petaflops Simulations}}, 18355 note = {proposal to DOE SciDAC3}, 18356 month = mar, 18357 year = {2012} 18358} 18359 18360@Article{ elemental2012, 18361 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 18362 Robert {v}an~{d}e~{G}eijn}, 18363 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 18364 journal = {{ACM} Transactions on Mathematical Software}, 18365 volume = {39}, 18366 number = {2}, 18367 year = {2013} 18368} 18369 18370@Misc{ elemental-web-page, 18371 author = {Jack Poulson}, 18372 title = {Elemental: Distributed memory dense linear algebra}, 18373 howpublished = {\url{http://libelemental.org}}, 18374 url = {http://libelemental.org/}, 18375 year = {2015} 18376} 18377 18378@Book{ scalesreport, 18379 title = {A Science-based Case for Large-scale Simulation}, 18380 editor = {D. E. Keyes}, 18381 publisher = {U.S. Department of Energy}, 18382 year = {2004}, 18383 url = {http://www.pnl.gov/scales} 18384} 18385 18386@InProceedings{ cilk95, 18387 address = {Santa Barbara, California}, 18388 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 18389 Leiserson and Keith H. Randall and Yuli Zhou}, 18390 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 18391 Parallel Programming (PPoPP)}, 18392 day = {19--21}, 18393 month = jul, 18394 pages = {207--216}, 18395 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 18396 year = {1995} 18397} 18398 18399@Misc{ valgrind-web-page, 18400 author = {Julian Seward}, 18401 title = {Valgrind}, 18402 url = {http://valgrind.org/}, 18403 howpublished = {\url{http://valgrind.org/}}, 18404 year = {2012} 18405} 18406 18407@Article{ blas79, 18408 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 18409 title = {Basic linear algebra subprograms for Fortran usage}, 18410 journal = {ACM Transactions on Mathematical Software}, 18411 volume = {5}, 18412 pages = {308--323}, 18413 year = {1979} 18414} 18415 18416@TechReport{ lapack90, 18417 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 18418 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 18419 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 18420 institution = {Computer Science Dept., University of Tennessee}, 18421 number = {CS-90-105}, 18422 month = may, 18423 year = {1990} 18424} 18425 18426@TechReport{ nvidiafermi, 18427 author = {NVIDIA}, 18428 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 18429 institution = {NVIDIA}, 18430 year = {2009} 18431} 18432 18433@Misc{ intelmic, 18434 author = {Many Core Group, Cambridge University}, 18435 title = {Intel Many Integrated Core Architecture}, 18436 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 18437 month = dec, 18438 year = {2010} 18439} 18440 18441@Article{ abusufahkucklawrie81, 18442 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 18443 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 18444 Transformations}, 18445 journal = {IEEE Trans. Comput.}, 18446 volume = {30}, 18447 number = {5}, 18448 pages = {341--356}, 18449 year = {1981} 18450} 18451 18452@InProceedings{ guobikshandifraguelagarzaranpadua08, 18453 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 18454 and Padua, David}, 18455 title = {Programming with tiles}, 18456 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 18457 parallel programming}, 18458 series = {PPoPP '08}, 18459 year = {2008}, 18460 isbn = {978-1-59593-795-7}, 18461 location = {Salt Lake City, UT}, 18462 pages = {111--122}, 18463 numpages = {12}, 18464 doi = {10.1145/1345206.1345225}, 18465 acmid = {1345225}, 18466 publisher = {ACM}, 18467 address = {New York, NY} 18468} 18469 18470@Article{ strout04, 18471 journal = {International Journal of High Performance Computing Applications}, 18472 year = {2004}, 18473 title = {Sparse Tiling for Stationary Iterative Methods}, 18474 month = feb, 18475 publisher = {Sage Publications}, 18476 pages = {95-114}, 18477 volume = {18}, 18478 number = {1}, 18479 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 18480} 18481 18482@Misc{ openclstandard, 18483 author = {Khronos Group}, 18484 title = {{OpenCL} 1.2 Specification}, 18485 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 18486 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 18487 year = {2011} 18488} 18489 18490@Misc{ stlguide, 18491 author = {SGI}, 18492 title = {Standard Template Library Programmer's Guide}, 18493 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 18494 url = {http://www.sgi.com/tech/stl/}, 18495 year = {2011} 18496} 18497 18498@Book{ stepanov09, 18499 author = {Alexander Stepanov and Paul McJones}, 18500 title = {Elements of Programming}, 18501 publisher = {Addison-Wesley}, 18502 isbn = {978-0-321-63537-2}, 18503 year = {2009} 18504} 18505 18506@Article{ bangerthhartmannkanschat2007, 18507 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18508 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 18509 journal = {ACM Trans. Math. Softw.}, 18510 year = {2007}, 18511 volume = {33}, 18512 number = {4}, 18513 pages = {24/1--24/27} 18514} 18515 18516@Misc{ dealii-web-page, 18517 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18518 title = {{deal.II}}, 18519 howpublished = {\url{http://www.dealii.org/}}, 18520 url = {http://www.dealii.org/}, 18521 year = {2012} 18522} 18523 18524@InBook{ siek2012, 18525 title = {The C++0x ``Concepts'' Effort}, 18526 author = {Jeremy G. Siek}, 18527 editor = {Jeremy Gibbons}, 18528 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 18529 UK, March 22-26, 2010, Revised Lectures}, 18530 pages = {175--216}, 18531 isbn = {978-3-642-32202-0}, 18532 doi = {10.1007/978-3-642-32202-0_4}, 18533 url = {http://arxiv.org/abs/1201.0027}, 18534 note = {\url{http://arxiv.org/abs/1201.0027}}, 18535 publisher = {Springer Berlin Heidelberg}, 18536 year = {2012} 18537} 18538 18539@Misc{ sharpclaw, 18540 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 18541 author = {Ketcheson, D. I. and Parsani, M.}, 18542 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18543 PDEs,sharpclaw,software}, 18544 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18545 PDEs,sharpclaw,software}, 18546 title = {{SharpClaw software}}, 18547 year = {2011} 18548} 18549 18550@Book{ leveque2002, 18551 title = {Finite volume methods for hyperbolic problems}, 18552 author = {Randall J LeVeque}, 18553 volume = {31}, 18554 year = {2002} 18555} 18556 18557@Misc{ clawpack45, 18558 note = {\url{http://www.clawpack.org}}, 18559 author = {LeVeque, R. J. and Berger, M. J.}, 18560 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 18561 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 18562 title = {{Clawpack Software version 4.5}}, 18563 url = {www.clawpack.org}, 18564 year = {2011} 18565} 18566 18567@Article{ nilsen2010, 18568 archiveprefix = {arXiv}, 18569 arxivid = {arXiv:1002.0705v1}, 18570 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 18571 eprint = {arXiv:1002.0705v1}, 18572 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 18573 parallelization of scientific codes by a function-centric approach in 18574 Python.pdf:pdf}, 18575 journal = {Computational Science \& Discovery}, 18576 keywords = {parallel,programming,python,software}, 18577 mendeley-tags = {parallel,programming,python,software}, 18578 pages = {015003}, 18579 publisher = {IOP Publishing}, 18580 title = {{Simplifying the parallelization of scientific codes by a function-centric 18581 approach in Python}}, 18582 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 18583 volume = {3}, 18584 year = {2010} 18585} 18586 18587@Book{ langtangen09, 18588 author = {Hans Petter Langtangen}, 18589 title = {Python Scripting for Computational Science}, 18590 publisher = {Springer}, 18591 series = {Texts in Computational Science and Engineering}, 18592 pages = {784}, 18593 isbn = {3540739157}, 18594 year = {2009} 18595} 18596 18597@Book{ numpyguide, 18598 author = {Travis E. Oliphant}, 18599 title = {Guide to {N}umpy}, 18600 publisher = {Trelgol}, 18601 year = {2008} 18602} 18603 18604@Misc{ pycuda, 18605 author = {Andreas Kl\"ockner}, 18606 title = {{PyCUDA}}, 18607 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 18608 year = {2011} 18609} 18610 18611@Misc{ pyopencl, 18612 author = {Andreas Kl\"ockner}, 18613 title = {{PyOpenCL}}, 18614 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 18615 year = {2011} 18616} 18617 18618@Article{ klockner2012, 18619 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 18620 Paul Ivanov and Ahmed Fasih}, 18621 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 18622 generation}, 18623 journal = {Parallel Computing}, 18624 volume = {38}, 18625 number = {3}, 18626 pages = {157--174}, 18627 year = {2012}, 18628 issn = {0167-8191}, 18629 doi = {10.1016/j.parco.2011.09.001} 18630} 18631 18632%%%%%% Matt Stuff %%%%%% 18633@Article{ morrabozdagknepleyrassvesselinov, 18634 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 18635 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 18636 Velimir Vesselinov}, 18637 journal = {Eos}, 18638 volume = {102}, 18639 doi = {10.1029/2021EO159258}, 18640 month = {Jun}, 18641 year = {2021} 18642} 18643 18644@Misc{ knepley:icerm-workshop:2012, 18645 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 18646 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 18647 Models for Large-scale Simulations}, 18648 note = {Workshop sponsored by the Institute for Computational and Experimental Research 18649 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 18650 \url{http://icerm.brown.edu/tw12-1-exascale}}, 18651 year = {2012} 18652} 18653 18654@TechReport{ kirbyknepleyscott04, 18655 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18656 title = {Optimal Evaluation of Finite Element Matrices}, 18657 type = {Technical Report}, 18658 number = {TR-2004-04}, 18659 institution = {University of Chicago}, 18660 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 18661 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 18662 pages = {14}, 18663 month = may, 18664 year = {2004} 18665} 18666 18667@TechReport{ kirbyknepleyscott10, 18668 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18669 title = {Languages and Compilers for Variational Forms}, 18670 type = {Technical Report}, 18671 number = {TR-2010-09}, 18672 institution = {University of Chicago}, 18673 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 18674 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 18675 month = oct, 18676 year = {2010} 18677} 18678 18679@TechReport{ kirbyknepleyscott10b, 18680 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18681 title = {Evaluation of the Action of Finite Element Operators}, 18682 type = {Technical Report}, 18683 number = {TR-2010-08}, 18684 institution = {University of Chicago}, 18685 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 18686 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 18687 month = oct, 18688 year = {2010} 18689} 18690 18691@TechReport{ bruneknepleyscott11, 18692 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18693 title = {Exponential grids in high-dimensional space}, 18694 type = {Technical Report}, 18695 number = {TR-2011-07}, 18696 institution = {University of Chicago}, 18697 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 18698 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 18699 month = dec, 18700 year = {2011} 18701} 18702 18703@TechReport{ zheng11, 18704 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 18705 Zhang and Yaolin Shi}, 18706 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 18707 strongly variable viscosity based on {Matlab} and {CUDA}}, 18708 type = {Research Report}, 18709 number = {UMSI 2011/33}, 18710 institution = {University of Minnesota Supercomputing Institute}, 18711 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 18712 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 18713 month = mar, 18714 year = {2011} 18715} 18716 18717@InProceedings{ zheng2010, 18718 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 18719 Zhang and Yaolin Shi}, 18720 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 18721 booktitle = {Eos Transactions of the AGU}, 18722 organization = {American Geophysical Union}, 18723 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 18724 year = {2010} 18725} 18726 18727@InCollection{ terrelkirbyknepleyscott12, 18728 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 18729 and Garth N. Wells}, 18730 title = {Finite elements for incompressible fluids}, 18731 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18732 booktitle = {Automated solutions of differential equations by the finite element method}, 18733 series = {Lecture Notes in Computational Science and Engineering}, 18734 volume = {84}, 18735 pages = {163--169}, 18736 publisher = {Springer-Verlag}, 18737 year = {2012} 18738} 18739 18740@InCollection{ mardalhaga12, 18741 author = {Kent-Andre Mardal and Joachim Berdal Haga}, 18742 title = {Block preconditioning of systems of PDEs}, 18743 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18744 booktitle = {Automated solutions of differential equations by the finite element method}, 18745 series = {Lecture Notes in Computational Science and Engineering}, 18746 volume = {84}, 18747 pages = {643--655}, 18748 publisher = {Springer-Verlag}, 18749 year = {2012} 18750} 18751 18752@InCollection{ kirbyknepleyloggscottterrel12, 18753 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 18754 Andy R. Terrel}, 18755 title = {Discrete optimization of finite element matrix evaluation}, 18756 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18757 booktitle = {Automated solutions of differential equations by the finite element method}, 18758 series = {Lecture Notes in Computational Science and Engineering}, 18759 volume = {84}, 18760 pages = {385--397}, 18761 publisher = {Springer-Verlag}, 18762 year = {2012} 18763} 18764 18765@InCollection{ kirby12, 18766 author = {Robert C. Kirby}, 18767 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 18768 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18769 booktitle = {Automated solutions of differential equations by the finite element method}, 18770 series = {Lecture Notes in Computational Science and Engineering}, 18771 volume = {84}, 18772 publisher = {Springer-Verlag}, 18773 year = {2012} 18774} 18775 18776@Article{ brownconveryhotesknepleypetropolous1993, 18777 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 18778 Labros Petropolous}, 18779 title = {Closed strings with low harmonics and kinks}, 18780 journal = {Physical Review D}, 18781 volume = {48}, 18782 number = {6}, 18783 year = {1993} 18784} 18785 18786@Article{ minimax1996, 18787 title = {MiniMax: What has been learned thus far}, 18788 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 18789 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 18790 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 18791 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 18792 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 18793 journal = {Nuovo Cimento}, 18794 volume = {19}, 18795 number = {1}, 18796 pages = {1045--1049}, 18797 year = {1996} 18798} 18799 18800@Article{ minimax1997, 18801 author = {Minimax Collaboration}, 18802 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 18803 Production}, 18804 journal = {Physical Review D}, 18805 volume = {55}, 18806 number = {9}, 18807 year = {1997} 18808} 18809 18810@Article{ minimax2000, 18811 author = {Minimax Collaboration}, 18812 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 18813 journal = {Physical Review D}, 18814 volume = {61}, 18815 number = {3}, 18816 year = {2000} 18817} 18818 18819@Article{ kirbyknepleyloggscott05, 18820 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 18821 title = {Optimizing the evaluation of finite element matrices}, 18822 journal = {SIAM Journal on Scientific Computing}, 18823 volume = {27}, 18824 number = {3}, 18825 pages = {741--758}, 18826 year = {2005} 18827} 18828 18829@Article{ bardhanknepleyanitescu2008, 18830 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 18831 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 18832 of Molecular Solvation}, 18833 journal = {Journal of Chemical Physics}, 18834 volume = {130}, 18835 number = {10}, 18836 pages = {104108}, 18837 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 18838 Research}, 18839 doi = {10.1063/1.3081148}, 18840 year = {2008} 18841} 18842 18843%Poster at Biophysical Society Fall Meeting 18844@Article{ bardhanknepley2017, 18845 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18846 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 18847 Hydration-Shell {Poisson}-{Boltzmann} Model}, 18848 journal = {Biophysical Journal}, 18849 volume = {110}, 18850 number = {3}, 18851 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 18852 doi = {10.1016/j.bpj.2015.11.1766}, 18853 year = {2017} 18854} 18855 18856@Article{ tabrizirahimigoossensknepleybardhan2018, 18857 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 18858 Interface Condition (SLIC) Continuum Dielectric Model}, 18859 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 18860 Matthew G. Knepley and Jaydeep P. Bardhan}, 18861 journal = {International Journal of Quantum Chemistry}, 18862 note = {Accepted}, 18863 year = {2018} 18864} 18865 18866@Article{ knepley2010, 18867 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 18868 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 18869 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 18870 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 18871 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 18872 title = {{Reproducible Research: addressing the need for data and code sharing in 18873 computational science}}, 18874 journal = {Computing in Science and Engineering}, 18875 volume = {12}, 18876 number = {5}, 18877 pages = {8--13}, 18878 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 18879 year = {2010} 18880} 18881 18882@Article{ ketchesonahmadiaknepley2011, 18883 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 18884 Hyperbolic PDE Codes}, 18885 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 18886 journal = {SIAM News}, 18887 volume = {44}, 18888 number = {7}, 18889 month = sep, 18890 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 18891 year = {2011} 18892} 18893 18894@Article{ yokotabardhanknepleybarbahamada2011, 18895 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 18896 Tsuyoshi Hamada}, 18897 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 18898 a billion unknowns}, 18899 journal = {Computer Physics Communications}, 18900 volume = {182}, 18901 number = {6}, 18902 pages = {1272--1283}, 18903 year = {2011}, 18904 issn = {0010-4655}, 18905 doi = {10.1016/j.cpc.2011.02.013}, 18906 url = {http://arxiv.org/abs/1007.4591} 18907} 18908 18909@Article{ bardhanknepley2011, 18910 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18911 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 18912 Results for Spherical Inclusions}, 18913 journal = {Journal of Chemical Physics}, 18914 volume = {135}, 18915 number = {12}, 18916 pages = {124107--124117}, 18917 url = {http://arxiv.org/abs/1109.0651}, 18918 note = {\url{http://arxiv.org/abs/1109.0651}}, 18919 year = {2011} 18920} 18921 18922@Article{ bruneknepleyscott2013, 18923 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18924 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 18925 Graded Meshes}, 18926 journal = {SIAM Journal on Scientific Computing}, 18927 url = {http://arxiv.org/abs/1104.0261}, 18928 note = {\url{http://arxiv.org/abs/1104.0261}}, 18929 volume = {35}, 18930 number = {1}, 18931 pages = {A173--A191}, 18932 year = {2013} 18933} 18934 18935@Article{ bardhanknepley2012a, 18936 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18937 title = {Computational science and re-discovery: open-source implementations of 18938 ellipsoidal harmonics for problems in potential theory}, 18939 journal = {Computational Science \& Discovery}, 18940 volume = {5}, 18941 pages = {014006}, 18942 note = {\url{http://arxiv.org/abs/1204.0267}}, 18943 doi = {10.1088/1749-4699/5/1/014006}, 18944 year = {2012} 18945} 18946 18947@Article{ kreienkampetal2013, 18948 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 18949 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 18950 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 18951 contributions of molecular binding}, 18952 journal = {Molecular Based Mathematical Biology}, 18953 volume = {1}, 18954 pages = {124--150}, 18955 doi = {10.2478/mlbmb-2013-0007}, 18956 issn = {2299-3266}, 18957 month = jun, 18958 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 18959 year = {2013} 18960} 18961 18962@Article{ bardhanknepleybrune2015, 18963 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 18964 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 18965 Boundary-Integral Operators}, 18966 journal = {Molecular Based Mathematical Biology}, 18967 volume = {3}, 18968 number = {1}, 18969 pages = {1--22}, 18970 doi = {10.1515/mlbmb-2015-0001}, 18971 year = {2015} 18972} 18973 18974@Article{ bardhanknepley14, 18975 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18976 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 18977 Conditions}, 18978 journal = {Journal of Chemical Physics}, 18979 volume = {141}, 18980 number = {13}, 18981 pages = {131103}, 18982 doi = {10.1063/1.4897324}, 18983 year = {2014} 18984} 18985 18986@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 18987 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 18988 Electrostatics}, 18989 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 18990 Matthew G. Knepley}, 18991 booktitle = {Proceedings of PIERS}, 18992 pages = {1215--1221}, 18993 month = jul, 18994 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 18995 year = {2015} 18996} 18997 18998@Article{ tabriziknepleybardhan2016, 18999 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 19000 condition at the solute-solvent interface}, 19001 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 19002 journal = {Molecular Physics}, 19003 volume = {114}, 19004 number = {16-17}, 19005 pages = {2558--2567}, 19006 doi = {10.1080/00268976.2016.1198503}, 19007 year = {2016} 19008} 19009 19010% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 19011@Article{ tabrizigoossensrahimiknepleybardhan2017, 19012 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 19013 Mixtures Using a Solvation-Layer Interface Condition}, 19014 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 19015 Matthew G. Knepley and Jaydeep P. Bardhan}, 19016 journal = {Journal of Chemical Physics}, 19017 volume = {146}, 19018 number = {9}, 19019 pages = {094103}, 19020 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 19021 eprint = {https://arxiv.org/abs/1611.02150}, 19022 doi = {10.1063/1.4977037}, 19023 note = {PMCID: PMC5336475}, 19024 year = {2017} 19025} 19026 19027@Article{ tabrizigoossenscooperknepleybardhan2017, 19028 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 19029 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 19030 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 19031 Matthew G. Knepley and Jaydeep P. Bardhan}, 19032 number = {6}, 19033 pages = {2897--2914}, 19034 journal = {Journal of Chemical Theory and Computation}, 19035 year = {2017} 19036} 19037 19038@InProceedings{ mcclanahan2011, 19039 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 19040 K and Vuduc, Richard}, 19041 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 19042 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 19043 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 19044 year = {2011} 19045} 19046 19047@Article{ ghyselsashbymeerbergenvanroose2013, 19048 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 19049 title = {Hiding global communication latency in the {GMRES} algorithm on massively 19050 parallel machines}, 19051 journal = {SIAM Journal on Scientific Computing}, 19052 volume = {35}, 19053 number = {1}, 19054 pages = {C48--C71}, 19055 year = {2013} 19056} 19057 19058@Article{ ghyselsvanroose2014, 19059 author = {P. Ghysels and W. Vanroose}, 19060 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 19061 Algorithm}, 19062 journal = {Parallel Computing}, 19063 volume = {40}, 19064 number = {7}, 19065 pages = {224--238}, 19066 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 19067 doi = {10.1016/j.parco.2013.06.001}, 19068 year = {2014} 19069} 19070 19071@InProceedings{ strzodkagoddeke06, 19072 author = {R. Strzodka and D. G\"oddeke}, 19073 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 19074 from Low Precision Components}, 19075 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 19076 Computing Machines}, 19077 note = {FCCM ’06}, 19078 pages = {259--270}, 19079 year = {2006}, 19080 organization = {IEEE Computer Society} 19081} 19082 19083@InCollection{ jacquesnicolasvollaire12, 19084 author = {T. Jacques and L. Nicolas and C. Vollaire}, 19085 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 19086 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 19087 booktitle = {High-Performance Computing and Networking}, 19088 series = {Lecture Notes in Computer Science}, 19089 volume = {1593}, 19090 pages = {1025--1031}, 19091 publisher = {Springer}, 19092 year = {1999} 19093} 19094 19095@InProceedings{ hoeflerlumsdainerehm07, 19096 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 19097 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 19098 for MPI}}, 19099 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 19100 Networking, Storage and Analysis, SC07}, 19101 location = {Reno, NV}, 19102 publisher = {IEEE Computer Society/ACM}, 19103 source = {http://www.unixer.de/~htor/publications/}, 19104 month = nov, 19105 year = {2007} 19106} 19107 19108@InProceedings{ hoeflersiebretlumsdaine10, 19109 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 19110 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 19111 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 19112 Parallel Programming (PPoPP'10)}, 19113 month = jan, 19114 location = {Bangalore, India}, 19115 publisher = {ACM}, 19116 isbn = {978-1-60558-708-0}, 19117 source = {http://www.unixer.de/~htor/publications/}, 19118 pages = {159--168}, 19119 year = {2010} 19120} 19121 19122@Article{ ruppweinbubjungelgrasser15, 19123 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 19124 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 19125 journal = {ACM Transactions on Mathematical Software (TOMS)}, 19126 volume = {43}, 19127 number = {2}, 19128 pages = {11}, 19129 year = {2016}, 19130 publisher = {ACM} 19131} 19132 19133@Article{ bai_hu_reichel_1994, 19134 title = {A {Newton} basis {GMRES} implementation}, 19135 volume = {14}, 19136 url = {}, 19137 number = {}, 19138 journal = {IMA Journal of Numerical Analysis}, 19139 author = {Z. Bai and D. Hu and L. Reichel}, 19140 year = {1994}, 19141 pages = {563--581} 19142} 19143 19144@Article{ chronopoulos_gear_1989, 19145 title = {{S-step} iterative methods for symmetric linear systems}, 19146 volume = {25}, 19147 url = {}, 19148 number = {}, 19149 journal = {Journal of Computational and Applied Mathematics}, 19150 author = {A. T. Chronopoulos and C. W. Gear}, 19151 year = {1989}, 19152 pages = {153--168} 19153} 19154 19155@Article{ chronopoulos_1996, 19156 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 19157 author = {A. T. Chronopoulos and C. D. Swanson}, 19158 journal = {Parallel Computing}, 19159 volume = {22}, 19160 number = {5}, 19161 year = {1996}, 19162 pages = {623--641} 19163} 19164 19165@Article{ chronopoulos_2010, 19166 author = {A. T. Chronopoulos and A. Kucherov}, 19167 title = {Block {S-step} {Krylov} Iterative Methods}, 19168 journal = {Numerical Linear Algebra with Applications}, 19169 volume = {17}, 19170 number = {1}, 19171 pages = {3--15}, 19172 year = {2010} 19173} 19174 19175@Article{ sturler_vorst_1995, 19176 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 19177 distributed memory computers}, 19178 volume = {18}, 19179 url = {}, 19180 number = {}, 19181 journal = {Applied Numerical Mathematics}, 19182 author = {E. De Sturler and H. A. van der Vorst}, 19183 year = {1995}, 19184 pages = {441--459} 19185} 19186 19187@Article{ joubert_carey_1992, 19188 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 19189 I: Theory}, 19190 volume = {44}, 19191 url = {}, 19192 number = {}, 19193 journal = {International journal of computer mathematics}, 19194 author = {W. D. Joubert and G. F. Carey}, 19195 year = {1992}, 19196 pages = {243--267} 19197} 19198 19199@Article{ elman_saadsaylor_1986, 19200 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 19201 of linear equations}, 19202 volume = {7}, 19203 url = {}, 19204 number = {3}, 19205 journal = {SIAM Journal on Scientific and Statistical Computing}, 19206 author = {Howard Elman and Y. Saad and P. E. Saylor}, 19207 year = {1986}, 19208 pages = {840--855} 19209} 19210 19211@Article{ golub95innerand, 19212 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 19213 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 19214 journal = {SIAM J. Numer. Anal}, 19215 year = {1995}, 19216 volume = {35}, 19217 pages = {300--319} 19218} 19219 19220@Article{ golub_varga_1961, 19221 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 19222 and second-order {Richardson} iterative methods, parts {I} and {II}}, 19223 volume = {3}, 19224 url = {}, 19225 number = {}, 19226 journal = {Numer. Math.}, 19227 author = {Gene Golub and R.S. Varga}, 19228 year = {1961}, 19229 pages = {147--168} 19230} 19231 19232@Article{ el_maliki_guenette_fortin_2011, 19233 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 19234 element problems}, 19235 volume = {18}, 19236 doi = {10.1002/nla.757}, 19237 number = {5}, 19238 journal = {Numerical Linear Algebra with Applications}, 19239 author = {A. {El maliki} and R. Guenette and M. Fortin}, 19240 year = {2011}, 19241 pages = {789-803} 19242} 19243 19244@Article{ adavani2008multigrid, 19245 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 19246 Constraints}, 19247 author = {Adavani, S.S. and Biros, G.}, 19248 journal = {SIAM Journal on Scientific Computing}, 19249 volume = {31}, 19250 number = {1}, 19251 pages = {369--397}, 19252 year = {2008}, 19253 publisher = {Society for Industrial and Applied Mathematics} 19254} 19255 19256@Article{ horton1995space, 19257 title = {A space-time multigrid method for parabolic {PDE}s}, 19258 author = {Horton, G. and Vandewalle, S.}, 19259 journal = {SIAM Journal on Scientific Computing}, 19260 volume = {16}, 19261 number = {4}, 19262 pages = {848--864}, 19263 year = {1995} 19264} 19265 19266@Article{ lewis2005model, 19267 title = {Model problems for the multigrid optimization of systems governed by differential 19268 equations}, 19269 author = {Lewis, R.M. and Nash, S.G.}, 19270 journal = {SIAM Journal on Scientific Computing}, 19271 volume = {26}, 19272 number = {6}, 19273 pages = {1811--1837}, 19274 year = {2005}, 19275 publisher = {Philadelphia, PA: SIAM, c1993-} 19276} 19277 19278@Article{ nash2000mgopt, 19279 title = {A multigrid approach to discretized optimization problems}, 19280 author = {Nash, S.G.}, 19281 journal = {Optimization Methods and Software}, 19282 volume = {14}, 19283 number = {1-2}, 19284 pages = {99--116}, 19285 year = {2000}, 19286 publisher = {Taylor \& Francis} 19287} 19288 19289@Article{ borzi2009multigrid, 19290 title = {Multigrid Methods for {PDE} Optimization}, 19291 author = {Borz{\`i}, A. and Schulz, V.}, 19292 journal = {SIAM Review}, 19293 volume = {51}, 19294 pages = {361}, 19295 year = {2009} 19296} 19297 19298@Article{ borzi2005multigrid, 19299 title = {A multigrid scheme for elliptic constrained optimal control problems}, 19300 author = {Borz{\`i}, A. and Kunisch, K.}, 19301 journal = {Computational Optimization and Applications}, 19302 volume = {31}, 19303 number = {3}, 19304 pages = {309--333}, 19305 year = {2005}, 19306 publisher = {Springer} 19307} 19308 19309@Article{ borzi2003multigrid, 19310 title = {Multigrid methods for parabolic distributed optimal control problems}, 19311 author = {Borz{\`i}, A.}, 19312 journal = {Journal of Computational and Applied Mathematics}, 19313 volume = {157}, 19314 number = {2}, 19315 pages = {365--382}, 19316 year = {2003}, 19317 publisher = {Elsevier} 19318} 19319 19320@Article{ ito2002receding, 19321 title = {Receding horizon optimal control for infinite dimensional systems}, 19322 author = {Ito, K. and Kunisch, K.}, 19323 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 19324 volume = {8}, 19325 number = {1}, 19326 pages = {741--760}, 19327 year = {2002}, 19328 publisher = {Cambridge University Press} 19329} 19330 19331@Article{ schulz1998solving, 19332 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 19333 author = {Schulz, V.H.}, 19334 journal = {Computing and Visualization in Science}, 19335 volume = {1}, 19336 number = {2}, 19337 pages = {83--96}, 19338 year = {1998}, 19339 publisher = {Springer} 19340} 19341 19342@Article{ hazra2005aerodynamic, 19343 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 19344 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 19345 journal = {Journal of Computational Physics}, 19346 volume = {204}, 19347 number = {1}, 19348 pages = {46--64}, 19349 year = {2005}, 19350 publisher = {Elsevier} 19351} 19352 19353@Article{ mandel1985multilevel, 19354 title = {On multilevel iterative methods for integral equations of the second kind and 19355 related problems}, 19356 author = {Mandel, J.}, 19357 journal = {Numerische Mathematik}, 19358 volume = {46}, 19359 number = {1}, 19360 pages = {147--157}, 19361 year = {1985}, 19362 publisher = {Springer} 19363} 19364 19365@Article{ king1992multilevel, 19366 title = {Multilevel algorithms for ill-posed problems}, 19367 author = {King, J.T.}, 19368 journal = {Numerische Mathematik}, 19369 volume = {61}, 19370 number = {1}, 19371 pages = {311--334}, 19372 year = {1992}, 19373 publisher = {Springer} 19374} 19375 19376@Article{ kaltenbacher2001regularizing, 19377 title = {On the regularizing properties of a full multigrid method for ill-posed 19378 problems}, 19379 author = {Kaltenbacher, B.}, 19380 journal = {Inverse Problems}, 19381 volume = {17}, 19382 pages = {767}, 19383 year = {2001}, 19384 publisher = {IOP Publishing} 19385} 19386 19387@Article{ kaltenbacher2002multi, 19388 title = {A multi-grid method with a priori and a posteriori level choice for the 19389 regularization of nonlinear ill-posed problems}, 19390 author = {Kaltenbacher, B. and Schicho, J.}, 19391 journal = {Numerische Mathematik}, 19392 volume = {93}, 19393 number = {1}, 19394 pages = {77--107}, 19395 year = {2002}, 19396 publisher = {Springer} 19397} 19398 19399@Article{ burger2006regularizing, 19400 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 19401 author = {Burger, M. and Kaltenbacher, B.}, 19402 journal = {SIAM Journal on Numerical Analysis}, 19403 volume = {44}, 19404 pages = {153}, 19405 year = {2006} 19406} 19407 19408@Article{ draganescu2008optimal, 19409 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 19410 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 19411 journal = {Mathematics of Computation}, 19412 volume = {77}, 19413 number = {264}, 19414 pages = {2001--2038}, 19415 year = {2008} 19416} 19417 19418@Article{ bastian1998additive, 19419 title = {Additive and multiplicative multi-grid---a comparison}, 19420 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 19421 journal = {Computing}, 19422 volume = {60}, 19423 number = {4}, 19424 pages = {345--364}, 19425 year = {1998}, 19426 publisher = {Springer} 19427} 19428 19429@Article{ fournier2001multiplicative, 19430 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 19431 compressible flow computations on unstructured meshes}, 19432 author = {Fournier, L. and Lanteri, S.}, 19433 journal = {Applied Numerical Mathematics}, 19434 volume = {36}, 19435 number = {4}, 19436 pages = {401--426}, 19437 year = {2001}, 19438 publisher = {Elsevier} 19439} 19440 19441@Article{ chow2006survey, 19442 title = {A survey of parallelization techniques for multigrid solvers}, 19443 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 19444 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 19445 Simon, eds}, 19446 volume = {20}, 19447 pages = {179--201}, 19448 year = {2006} 19449} 19450 19451@InBook{ brandt2001multiscale, 19452 title = {Multiscale scientific computation: {R}eview 2001}, 19453 author = {Brandt, A.}, 19454 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 19455 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 19456 series = {Lecture Notes in Computational Science and Engineering}, 19457 year = {2001}, 19458 volume = {20}, 19459 pages = {3--96}, 19460 publisher = {Springer Verlag} 19461} 19462 19463@InCollection{ brandt2003multigrid, 19464 title = {Multigrid solvers and multilevel optimization strategies}, 19465 author = {Brandt, A. and Ron, D.}, 19466 booktitle = {Multilevel Optimization and VLSICAD}, 19467 editors = {J. Cong and J.R. Shinnerl}, 19468 pages = {1--69}, 19469 publisher = {Kluwer Academic Publishers}, 19470 year = {2003} 19471} 19472 19473@InBook{ brandt2009principles, 19474 title = {Principles of systematic upscaling}, 19475 author = {Brandt, A.}, 19476 booktitle = {Bridging the Scales in Science and Engineering}, 19477 editors = {J. Fish}, 19478 publisher = {Oxford University Press}, 19479 pages = {193--215}, 19480 year = {2009} 19481} 19482 19483@Article{ livne2004coarsening, 19484 title = {Coarsening by compatible relaxation}, 19485 author = {Livne, O.E.}, 19486 journal = {Numerical Linear Algebra with Applications}, 19487 volume = {11}, 19488 number = {2-3}, 19489 pages = {205--227}, 19490 year = {2004}, 19491 publisher = {Wiley Online Library} 19492} 19493 19494@InProceedings{ brandt1986stochastic, 19495 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 19496 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 19497 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 19498 Methods, held at Cologne, October 1-4, 1985}, 19499 volume = {1228}, 19500 pages = {65--98}, 19501 year = {1986}, 19502 organization = {Springer} 19503} 19504 19505@Article{ halko2011finding, 19506 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 19507 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 19508 Approximate Matrix Decompositions}, 19509 journal = {SIAM Review}, 19510 volume = {53}, 19511 number = {2}, 19512 year = {2011}, 19513 pages = {217-288}, 19514 doi = {10.1137/090771806} 19515} 19516 19517@InProceedings{ mhdy09, 19518 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 19519 booktitle = {Proceedings of SC09}, 19520 organization = {ACM}, 19521 title = {Minimizing communication in sparse matrix solvers}, 19522 doi = {10.1145/1654059.1654096}, 19523 year = {2009} 19524} 19525 19526@InProceedings{ vanrosendale83, 19527 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 19528 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 19529 author = {J. van Rosendale}, 19530 year = {1983}, 19531 publisher = {IEEE Computer Society} 19532} 19533 19534@PhDThesis{ vuduc95, 19535 title = {Quantitative performance modeling of scientific computations and creating 19536 locality in numerical algorithms}, 19537 author = {R. Vuduc}, 19538 journal = {Massachusetts Institute of Technology}, 19539 school = {Massachusetts Institute of Technology}, 19540 year = {1995} 19541} 19542 19543@Article{ simoncini2003flexible, 19544 title = {Flexible inner-outer {Krylov} subspace methods}, 19545 author = {Simoncini, V. and Szyld, D.B.}, 19546 journal = {SIAM Journal on Numerical Analysis}, 19547 pages = {2219--2239}, 19548 year = {2003}, 19549 publisher = {JSTOR} 19550} 19551 19552@Article{ parks2006recycling, 19553 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 19554 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 19555 journal = {SIAM Journal on Scientific Computing}, 19556 volume = {28}, 19557 number = {5}, 19558 pages = {1651--1674}, 19559 year = {2006}, 19560 publisher = {Society for Industrial and Applied Mathematics} 19561} 19562 19563@Article{ freund2003model, 19564 title = {Model reduction methods based on Krylov subspaces}, 19565 author = {Freund, R.W.}, 19566 journal = {Acta Numerica}, 19567 volume = {12}, 19568 number = {1}, 19569 pages = {267--319}, 19570 year = {2003}, 19571 publisher = {Cambridge Univ Press} 19572} 19573 19574@InBook{ gutknecht2006block, 19575 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 19576 an introduction}, 19577 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 19578 author = {Gutknecht, M.H.}, 19579 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 19580 publisher = {Anamaya Publishers}, 19581 location = {New Delhi}, 19582 pages = {420-447}, 19583 year = {2006} 19584} 19585 19586@Article{ moulton1998black, 19587 title = {The black box multigrid numerical homogenization algorithm}, 19588 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 19589 journal = {Journal of Computational Physics}, 19590 volume = {142}, 19591 number = {1}, 19592 pages = {80--108}, 19593 year = {1998}, 19594 publisher = {Elsevier} 19595} 19596 19597@Article{ neuss2001homogenization, 19598 title = {Homogenization and multigrid}, 19599 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 19600 journal = {Computing}, 19601 volume = {66}, 19602 number = {1}, 19603 pages = {1--26}, 19604 year = {2001}, 19605 publisher = {Springer} 19606} 19607 19608@Article{ bai2002krylov, 19609 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 19610 systems}, 19611 author = {Bai, Z.}, 19612 journal = {Applied Numerical Mathematics}, 19613 volume = {43}, 19614 number = {1}, 19615 pages = {9--44}, 19616 year = {2002}, 19617 publisher = {Elsevier} 19618} 19619 19620@InProceedings{ dong2003piecewise, 19621 title = {Piecewise polynomial nonlinear model reduction}, 19622 author = {Dong, N. and Roychowdhury, J.}, 19623 booktitle = {Design Automation Conference, 2003. Proceedings}, 19624 pages = {484--489}, 19625 year = {2003}, 19626 organization = {IEEE} 19627} 19628 19629@Article{ bond2009stable, 19630 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 19631 approximation and projection}, 19632 author = {Bond, B.N. and Daniel, L.}, 19633 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 19634 volume = {28}, 19635 number = {10}, 19636 pages = {1467--1480}, 19637 year = {2009}, 19638 publisher = {IEEE} 19639} 19640 19641@Article{ xin2000front, 19642 title = {Front Propagation in Heterogeneous Media}, 19643 author = {Xin, J.}, 19644 journal = {SIAM Review}, 19645 volume = {42}, 19646 number = {2}, 19647 pages = {161--230}, 19648 year = {2000}, 19649 publisher = {Society for Industrial and Applied Mathematics} 19650} 19651 19652@Article{ owhadi2011localized, 19653 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 19654 Nonseparated Scales and High Contrast}, 19655 author = {Owhadi, H. and Zhang, L.}, 19656 journal = {Multiscale Modeling and Simulation}, 19657 volume = {9}, 19658 pages = {1373}, 19659 year = {2011} 19660} 19661 19662@Article{ berlyand2010flux, 19663 title = {Flux norm approach to finite dimensional homogenization approximations with 19664 non-separated scales and high contrast}, 19665 author = {Berlyand, L. and Owhadi, H.}, 19666 journal = {Archive for rational mechanics and analysis}, 19667 volume = {198}, 19668 number = {2}, 19669 pages = {677--721}, 19670 year = {2010}, 19671 publisher = {Springer} 19672} 19673 19674@Article{ babuska2011optimal, 19675 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 19676 Application to Multiscale Problems}, 19677 author = {Babuska, I. and Lipton, R.}, 19678 journal = {Multiscale Modeling \& Simulation}, 19679 volume = {9}, 19680 pages = {373}, 19681 year = {2011} 19682} 19683 19684@Article{ boettinger2002phase, 19685 title = {Phase-Field Simulation of Solidification}, 19686 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 19687 journal = {Annual review of materials research}, 19688 volume = {32}, 19689 number = {1}, 19690 pages = {163--194}, 19691 year = {2002}, 19692 publisher = {Annual Reviews} 19693} 19694 19695@Article{ karma1998quantitative, 19696 title = {Quantitative phase-field modeling of dendritic growth in two and three 19697 dimensions}, 19698 author = {Karma, A. and Rappel, W.J.}, 19699 journal = {Physical Review E}, 19700 volume = {57}, 19701 number = {4}, 19702 pages = {4323}, 19703 year = {1998}, 19704 publisher = {APS} 19705} 19706 19707@Article{ chen2002phase, 19708 title = {Phase-field models for microstructure evolution}, 19709 author = {Chen, L.Q.}, 19710 journal = {Annual review of materials research}, 19711 volume = {32}, 19712 number = {1}, 19713 pages = {113--140}, 19714 year = {2002}, 19715 publisher = {Annual Reviews} 19716} 19717 19718@Article{ galbally2010reductionuq, 19719 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 19720 problems}, 19721 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 19722 journal = {International journal for numerical methods in engineering}, 19723 volume = {81}, 19724 number = {12}, 19725 pages = {1581--1608}, 19726 year = {2010}, 19727 publisher = {Wiley Online Library} 19728} 19729 19730@Article{ griebel1995abstract, 19731 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 19732 author = {Griebel, M. and Oswald, P.}, 19733 journal = {Numerische Mathematik}, 19734 volume = {70}, 19735 number = {2}, 19736 pages = {163--180}, 19737 year = {1995}, 19738 publisher = {Springer} 19739} 19740 19741@InProceedings{ voutchkov2006multiobjective, 19742 title = {Multiobjective optimization using surrogates}, 19743 author = {Voutchkov, I. and Keane, A.J.}, 19744 booktitle = {Adaptive Computing in Design and Manufacture}, 19745 pages = {167--175}, 19746 year = {2006}, 19747 publisher = {The MC Escher Company} 19748} 19749 19750@Article{ leary2001constraint, 19751 title = {A constraint mapping approach to the structural optimization of an expensive 19752 model using surrogates}, 19753 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 19754 journal = {Optimization and Engineering}, 19755 volume = {2}, 19756 number = {4}, 19757 pages = {385--398}, 19758 year = {2001}, 19759 publisher = {Springer} 19760} 19761 19762@InProceedings{ legresley2000airfoil, 19763 title = {Airfoil design optimization using reduced order models based on proper orthogonal 19764 decomposition}, 19765 author = {LeGresley, P.A. and Alonso, J.J.}, 19766 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 19767 year = {2000} 19768} 19769 19770@Book{ myers2009response, 19771 title = {Response surface methodology: process and product optimization using designed 19772 experiments}, 19773 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 19774 volume = {705}, 19775 year = {2009}, 19776 publisher = {John Wiley \& Sons} 19777} 19778 19779@Article{ carlberg2012gnat, 19780 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 19781 application to computational fluid dynamics and turbulent flows}, 19782 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 19783 journal = {arXiv}, 19784 volume = {1207.1349}, 19785 year = {2012} 19786} 19787 19788@Article{ biros2008multilevel, 19789 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 19790 author = {Biros, G. and Dogan, G.}, 19791 journal = {Inverse Problems}, 19792 volume = {24}, 19793 pages = {034010}, 19794 year = {2008}, 19795 publisher = {IOP Publishing} 19796} 19797 19798@Article{ rees2010optimal, 19799 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 19800 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 19801 journal = {SIAM Journal on Scientific Computing}, 19802 volume = {32}, 19803 pages = {271}, 19804 year = {2010} 19805} 19806 19807@Article{ rees2010block, 19808 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 19809 author = {Rees, T. and Stoll, M.}, 19810 journal = {Numerical Linear Algebra with Applications}, 19811 volume = {17}, 19812 number = {6}, 19813 pages = {977--996}, 19814 year = {2010}, 19815 publisher = {Wiley Online Library} 19816} 19817 19818@Article{ rees2011preconditioning, 19819 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 19820 Equations}, 19821 author = {Rees, T. and Wathen, A.J.}, 19822 journal = {SIAM Journal on Scientific Computing}, 19823 volume = {33}, 19824 number = {5}, 19825 pages = {2903--2926}, 19826 year = {2011}, 19827 publisher = {Society for Industrial and Applied Mathematics} 19828} 19829 19830@Article{ vogel2007fbicg, 19831 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19832 author = {Vogel,J.A.}, 19833 journal = {Applied Mathematics and Computation}, 19834 volume = {188}, 19835 number = {1}, 19836 pages = {226–-233}, 19837 year = {2007}, 19838 publisher = {Elsevier} 19839} 19840 19841@Unpublished{ leehammond2010, 19842 author = {B. Lee and G.E. Hammond}, 19843 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 19844 Equation}, 19845 key = {multigrid}, 19846 note = {manuscript, 2010} 19847} 19848 19849@Article{ vandeneshop2004inexact, 19850 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 19851 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 19852 journal = {SIAM Journal on Matrix Analysis and Applications}, 19853 volume = {26}, 19854 number = {1}, 19855 pages = {125--153}, 19856 year = {2004} 19857} 19858 19859@Article{ fbicg.fbcgs, 19860 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19861 author = {Judith A. Vogel}, 19862 journal = {Applied Mathematics and Computation}, 19863 volume = {188}, 19864 number = {1}, 19865 pages = {226--233}, 19866 year = {2007} 19867} 19868 19869@Article{ simoncini2003inexact, 19870 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 19871 Computing}, 19872 author = {Valeria Simoncini and Daniel B. Szyld}, 19873 journal = {SIAM Journal on Scientific Computing}, 19874 volume = {25}, 19875 number = {2}, 19876 pages = {454--477}, 19877 year = {2003} 19878} 19879 19880@Article{ fqmr, 19881 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 19882 author = {Daniel B. Szyld and Judith A. Vogel}, 19883 journal = {SIAM Journal on Scientific Computing}, 19884 volume = {23}, 19885 number = {2}, 19886 pages = {363--380}, 19887 year = {2001} 19888} 19889 19890@Article{ ipcg, 19891 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 19892 author = {Gene H. Golub and Qiang Ye}, 19893 journal = {SIAM Journal on Scientific Computing}, 19894 volume = {21}, 19895 number = {4}, 19896 pages = {1305--1320}, 19897 year = {1999} 19898} 19899 19900@Article{ idr.sonneveld, 19901 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 19902 Systems of Linear Equations}, 19903 author = {Peter Sonneveld and Martin B. van Gijzen}, 19904 journal = {SIAM Journal on Scientific Computing}, 19905 volume = {31}, 19906 number = {2}, 19907 pages = {1035--1062}, 19908 year = {2008} 19909} 19910 19911@Article{ flexiblecg, 19912 title = {Flexible Conjugate Gradients}, 19913 author = {Yvan Notay}, 19914 journal = {SIAM Journal on Scientific Computing}, 19915 volume = {22}, 19916 number = {4}, 19917 pages = {1444--1460}, 19918 year = {2000} 19919} 19920 19921@Article{ generalizedcg, 19922 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 19923 Variable-Step Preconditioning}, 19924 author = {O. Axelsson and P. S. Vassilevski}, 19925 journal = {SIAM Journal on Matrix Analysis and Applications}, 19926 volume = {12}, 19927 number = {4}, 19928 pages = {625--644}, 19929 year = {1991} 19930} 19931 19932@Article{ bicg, 19933 title = {{Conjugate Gradient} methods for indefinite systems}, 19934 author = {R. Fletcher}, 19935 journal = {Lecture Notes in Mathematics}, 19936 volume = {506}, 19937 pages = {73--89}, 19938 year = {1976} 19939} 19940 19941@Article{ idr.bcgs, 19942 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 19943 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 19944 journal = {Applied Numerical Mathematics}, 19945 volume = {60}, 19946 pages = {1100--1114}, 19947 year = {2010} 19948} 19949 19950@Article{ idr.bcgsl, 19951 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 19952 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 19953 journal = {SIAM J. Sci. Comput.}, 19954 volume = {32}, 19955 number = {5}, 19956 pages = {2687--2709}, 19957 year = {2010} 19958} 19959 19960@Article{ idr.min.sync, 19961 title = {Minimizing synchronization in {IDR(s)}}, 19962 author = {T.P. Collignon and M.B. van Gijzen}, 19963 journal = {Numerical Linear Algebra with Applications}, 19964 volume = {18}, 19965 number = {5}, 19966 pages = {805--825}, 19967 year = {2011} 19968} 19969 19970@TechReport{ flexible.idr, 19971 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 19972 Sparse Linear Systems}, 19973 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 19974 institution = {Delft University of Technology}, 19975 number = {11-06}, 19976 year = {2011} 19977} 19978 19979@Article{ vangenuchten1980, 19980 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 19981 Soils}, 19982 author = {M. Th. van Genuchten}, 19983 journal = {Soil Science Society of America Journal}, 19984 volume = {44}, 19985 pages = {892--898}, 19986 year = {1980} 19987} 19988 19989@Article{ gmresr94, 19990 title = {{GMRESR}: a family of nested {GMRES} methods}, 19991 author = {H. A. Van der Vorst and C. Vuik}, 19992 journal = {Numerical Linear Algebra with Applications}, 19993 volume = {1}, 19994 number = {4}, 19995 pages = {369--386}, 19996 year = {1994} 19997} 19998 19999@Article{ knepley10, 20000 author = {Matthew G. Knepley}, 20001 title = {Removing the Barrier to Scalability in Parallel FMM}, 20002 journal = {CoRR}, 20003 volume = {abs/1008.2410}, 20004 note = {\url{http://arxiv.org/abs/1008.2410}}, 20005 year = {2010} 20006} 20007 20008@Article{ teng1998, 20009 author = {Shang-Hua Teng}, 20010 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 20011 N-Body Simulation}, 20012 journal = {SIAM J. Sci. Comput.}, 20013 volume = {19}, 20014 number = {2}, 20015 month = mar, 20016 pages = {635--656}, 20017 year = {1998}, 20018 issn = {1064-8275}, 20019 numpages = {22}, 20020 doi = {10.1137/S1064827595288942}, 20021 acmid = {289842}, 20022 issue_date = {March 1998}, 20023 publisher = {Society for Industrial and Applied Mathematics}, 20024 address = {Philadelphia, PA}, 20025 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 20026 parallel processing, partitioning, scientific computing, the fast multipole 20027 method, tree-codes} 20028} 20029 20030@InProceedings{ skinnerkramer05, 20031 author = {David Skinner and William Kramer}, 20032 title = {Understanding the causes of performance variability in HPC workloads}, 20033 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 20034 International}, 20035 organization = {IEEE}, 20036 pages = {137--149}, 20037 year = {2005} 20038} 20039 20040@Article{ notay_2000, 20041 author = {Yvan Notay}, 20042 title = {Flexible {Conjugate Gradients}}, 20043 journal = {SIAM Journal on Scientific Computing}, 20044 volume = {22}, 20045 number = {4}, 20046 year = {2000}, 20047 pages = {1444--1460} 20048} 20049 20050@Article{ bereux1996, 20051 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 20052 computations}, 20053 author = {Fran{\c{c}}ois B{\'e}reux}, 20054 journal = {Computer Methods in Applied Mechanics and Engineering}, 20055 volume = {133}, 20056 number = {1-2}, 20057 pages = {93--124}, 20058 year = {1996} 20059} 20060 20061@Article{ pawlowski2006globalization, 20062 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 20063 fully coupled solution of the {N}avier-{S}tokes equations}, 20064 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 20065 journal = {SIAM Review}, 20066 volume = {48}, 20067 number = {4}, 20068 pages = {700--721}, 20069 year = {2006}, 20070 publisher = {SIAM} 20071} 20072 20073@Article{ roppshadid2009, 20074 title = {Stability of operator splitting methods for systems with indefinite operators: 20075 Advection--diffusion--reaction systems}, 20076 author = {David L Ropp and John N Shadid}, 20077 journal = {Journal of Computational Physics}, 20078 volume = {228}, 20079 number = {9}, 20080 pages = {3508--3516}, 20081 year = {2009} 20082} 20083 20084@Article{ brown1985experiments, 20085 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 20086 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 20087 journal = {SIAM Journal on Scientific and Statistical Computing}, 20088 volume = {6}, 20089 number = {2}, 20090 pages = {297--313}, 20091 year = {1985}, 20092 publisher = {SIAM} 20093} 20094 20095@Article{ bicgsl_1993, 20096 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 20097 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 20098 Spectrum}, 20099 journal = {Electronic Transactions on Numerical Analysis}, 20100 volume = {1}, 20101 year = {1993}, 20102 pages = {11--32} 20103} 20104 20105@Book{ brandt2011revised, 20106 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 20107 Edition}, 20108 author = {Achi Brandt and Oren Livne}, 20109 year = {2011}, 20110 publisher = {SIAM} 20111} 20112 20113@Article{ axelsson1990algebraic, 20114 title = {Algebraic multilevel preconditioning methods, {II}}, 20115 author = {Axelsson, O. and Vassilevski, P.S.}, 20116 journal = {SIAM Journal on Numerical Analysis}, 20117 volume = {27}, 20118 number = {6}, 20119 pages = {1569--1590}, 20120 year = {1990}, 20121 publisher = {SIAM} 20122} 20123 20124@Article{ zulehner2002analysis, 20125 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 20126 author = {Zulehner, W.}, 20127 journal = {Mathematics of computation}, 20128 volume = {71}, 20129 number = {238}, 20130 pages = {479--506}, 20131 year = {2002} 20132} 20133 20134@Article{ pralet2010, 20135 author = {L. Giraud and A. Haidar and S. Pralet}, 20136 title = {Using multiple levels of parallelism to enhance the performance of domain 20137 decomposition solvers}, 20138 journal = {Parallel Computing}, 20139 volume = {36}, 20140 number = {5-6}, 20141 pages = {285--296}, 20142 year = {2010} 20143} 20144 20145@Book{ brennerscottfem, 20146 title = {The Mathematical Theory of Finite Element Methods}, 20147 author = {Susanne C. Brenner and L. Ridgway Scott}, 20148 edition = {3rd Edition}, 20149 series = {Texts in Applied Mathematics}, 20150 year = {2008}, 20151 publisher = {Springer-Verlag} 20152} 20153 20154@Book{ ortega1987iterative, 20155 title = {Iterative solution of nonlinear equations in several variables}, 20156 author = {Ortega, James M and Rheinboldt, Werner C}, 20157 volume = {30}, 20158 publisher = {Society for Industrial and Applied Mathematics}, 20159 year = {1987} 20160} 20161 20162@InBook{ rheinboldtch6, 20163 author = {Werner C. Rheinboldt}, 20164 title = {6. Combinations of Processes}, 20165 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 20166 chapter = {6}, 20167 pages = {59--74}, 20168 doi = {10.1137/1.9781611970012.ch6}, 20169 year = {1998} 20170} 20171 20172@Article{ allgowerbohmerpotrarheinboldt86, 20173 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 20174 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 20175 journal = {SIAM Journal on Numerical Analysis}, 20176 volume = {23}, 20177 number = {1}, 20178 pages = {160-169}, 20179 year = {1986}, 20180 doi = {10.1137/0723011} 20181} 20182 20183@Article{ rheinboldt76, 20184 author = {Werner C. Rheinboldt}, 20185 title = {On measures of ill-conditioning for nonlinear equations}, 20186 journal = {Mathematics of Computation}, 20187 volume = {30}, 20188 number = {133}, 20189 pages = {104--111}, 20190 year = {1976} 20191} 20192 20193@Article{ little61, 20194 author = {John D. C. Little}, 20195 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 20196 journal = {Operations Research}, 20197 volume = {9}, 20198 number = {3}, 20199 pages = {383--387}, 20200 note = {\url{http://www.jstor.org/stable/167570}}, 20201 year = {1961} 20202} 20203 20204@Misc{ top500, 20205 author = {{TOP500 Supercomputer Sites}}, 20206 url = {http://www.top500.org}, 20207 year = {2013} 20208} 20209 20210@Misc{ hassediagram, 20211 author = {Wikipedia}, 20212 title = {Hasse Diagram}, 20213 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 20214 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 20215 year = {2015} 20216} 20217 20218@Misc{ groupoid, 20219 author = {Wikipedia}, 20220 title = {Groupoid}, 20221 url = {https://en.wikipedia.org/wiki/Groupoid}, 20222 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 20223 year = {2015} 20224} 20225 20226@Misc{ cwcomplex, 20227 author = {Wikipedia}, 20228 title = {{CW} complex}, 20229 url = {http://en.wikipedia.org/wiki/CW_complex}, 20230 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 20231 year = {2015} 20232} 20233 20234@Misc{ linearalgebra, 20235 author = {Wikipedia}, 20236 title = {Linear Algebra}, 20237 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 20238 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 20239 year = {2015} 20240} 20241 20242@Misc{ amdahlslaw, 20243 author = {Wikipedia}, 20244 title = {Amdahl's Law}, 20245 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 20246 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 20247 year = {2015} 20248} 20249 20250@Misc{ gustafsonslaw, 20251 author = {Wikipedia}, 20252 title = {Gustafson's Law}, 20253 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 20254 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 20255 year = {2015} 20256} 20257 20258@Misc{ occamsrazor, 20259 author = {Wikipedia}, 20260 title = {Occam's razor}, 20261 url = {https://en.wikipedia.org/wiki/Occam%27s_razor}, 20262 note = {\url{https://en.wikipedia.org/wiki/Occam%27s_razor}}, 20263 year = {2015} 20264} 20265 20266@InProceedings{ amdahl1967, 20267 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 20268 Capabilities}, 20269 author = {Gene M. Amdahl}, 20270 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 20271 series = {AFIPS '67 (Spring)}, 20272 location = {Atlantic City, New Jersey}, 20273 pages = {483--485}, 20274 numpages = {3}, 20275 doi = {10.1145/1465482.1465560}, 20276 acmid = {1465560}, 20277 publisher = {ACM}, 20278 address = {New York, NY, USA}, 20279 year = {1967} 20280} 20281 20282@Article{ gustafson1988, 20283 title = {Reevaluating {Amdahl}'s Law}, 20284 author = {Gustafson, John L.}, 20285 journal = {Communications of the ACM}, 20286 volume = {31}, 20287 number = {5}, 20288 month = may, 20289 issn = {0001-0782}, 20290 pages = {532--533}, 20291 doi = {10.1145/42411.42415}, 20292 acmid = {42415}, 20293 year = {1988} 20294} 20295 20296@Book{ eijkhout2014, 20297 title = {Introduction to High Performance Scientific Computing}, 20298 author = {Victor Eijkhout}, 20299 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 20300 publisher = {TACC}, 20301 year = {2014} 20302} 20303 20304@Article{ korelc2002multilanguage, 20305 title = {Multi-language and multi-environment generation of nonlinear finite element 20306 codes}, 20307 author = {Korelc, J.}, 20308 journal = {Engineering with Computers}, 20309 volume = {18}, 20310 number = {4}, 20311 pages = {312--327}, 20312 year = {2002}, 20313 publisher = {Springer} 20314} 20315 20316@TechReport{ taylor2011feap, 20317 title = {{FEAP}: A Finite Element Analysis Program}, 20318 subtitle = {Version 8.3 User Manual}, 20319 author = {R. L. Taylor}, 20320 year = {2011}, 20321 institution = {University of California, Berkeley} 20322} 20323 20324@Article{ bergeraftosmismurman2005, 20325 title = {Analysis of slope limiters on irregular grids}, 20326 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 20327 journal = {AIAA paper}, 20328 volume = {490}, 20329 pages = {2005}, 20330 year = {2005} 20331} 20332 20333@InProceedings{ ferreirabridgesbrightwell08, 20334 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 20335 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 20336 Noise Injection}, 20337 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 20338 series = {SC '08}, 20339 year = {2008}, 20340 isbn = {978-1-4244-2835-9}, 20341 location = {Austin, Texas}, 20342 pages = {19:1--19:12}, 20343 articleno = {19}, 20344 numpages = {12}, 20345 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 20346 acmid = {1413390}, 20347 publisher = {IEEE Press}, 20348 address = {Piscataway, NJ} 20349} 20350 20351@Article{ banach22, 20352 author = {Stefan Banach}, 20353 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 20354 \'equations int\'egrales}, 20355 journal = {Fund. Math.}, 20356 volume = {3}, 20357 pages = {133--181}, 20358 year = {1922} 20359} 20360 20361@Article{ bangerthbursteddeheisterkronbichler2012, 20362 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 20363 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 20364 Element Codes}, 20365 journal = {ACM Trans. Math. Softw.}, 20366 issue_date = {December 2011}, 20367 volume = {38}, 20368 number = {2}, 20369 month = jan, 20370 year = {2012}, 20371 issn = {0098-3500}, 20372 pages = {14:1--14:28}, 20373 articleno = {14}, 20374 numpages = {28}, 20375 doi = {10.1145/2049673.2049678}, 20376 acmid = {2049678}, 20377 publisher = {ACM}, 20378 address = {New York, NY, USA}, 20379 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 20380 design} 20381} 20382 20383@Article{ eisenstatwalker1994, 20384 author = {Stanley Eisenstat and Homer Walker}, 20385 title = {Globally Convergent Inexact {N}ewton Methods}, 20386 journal = {SIAM Journal on Optimization}, 20387 volume = {4}, 20388 number = {2}, 20389 pages = {393--422}, 20390 year = {1994}, 20391 doi = {10.1137/0804022} 20392} 20393 20394@Book{ blumcuckershubsmale98, 20395 title = {Complexity and Real Computation}, 20396 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 20397 year = {1998}, 20398 publisher = {Springer} 20399} 20400 20401@Article{ caili2011, 20402 author = {Cai, X.-C. and Li, X.}, 20403 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 20404 Elimination for Problems with High Local Nonlinearity}, 20405 journal = {SIAM Journal on Scientific Computing}, 20406 volume = {33}, 20407 number = {2}, 20408 pages = {746-762}, 20409 year = {2011}, 20410 doi = {10.1137/080736272} 20411} 20412 20413@Article{ cai2009, 20414 author = {X.-C. Cai}, 20415 title = { Nonlinear overlapping domain decomposition methods}, 20416 journal = {Lecture Notes in Computational Science}, 20417 volume = {70}, 20418 pages = {217-224}, 20419 year = {2009} 20420} 20421 20422@Article{ lanzkronrosewilkes1996, 20423 title = {An analysis of approximate nonlinear elimination}, 20424 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 20425 journal = {SIAM Journal on Scientific Computing}, 20426 volume = {17}, 20427 number = {2}, 20428 pages = {538--559}, 20429 year = {1996}, 20430 publisher = {SIAM} 20431} 20432 20433@TechReport{ gropp1993sowing, 20434 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 20435 author = {Gropp, W}, 20436 year = {1995}, 20437 number = {ANL/MCS-TM-208}, 20438 institution = {Argonne National Laboratory} 20439} 20440 20441@TechReport{ gropp1993sowing2, 20442 title = {Users Manual for doctext: Producing Documentation from Source Code}, 20443 author = {Gropp, W}, 20444 year = {1995}, 20445 number = {ANL/MCS-TM-206}, 20446 institution = {Argonne National Laboratory} 20447} 20448 20449@TechReport{ gropp1993simplified, 20450 title = {Simplified Linear Equation Solvers users manual}, 20451 author = {Gropp, W and Smith, B}, 20452 year = {1993}, 20453 number = {ANL--93/8}, 20454 institution = {Argonne National Laboratory} 20455} 20456 20457@Misc{ simplifiedbsd, 20458 author = {{University of California, Berkeley}}, 20459 title = {Simplified {Berkeley} Software Distribution License}, 20460 note = {see 20461 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 20462} 20463 20464@Book{ chaconstraub14, 20465 author = {Scott Chacon and Ben Straub}, 20466 title = {Pro Git}, 20467 publisher = {Apress}, 20468 year = {2014}, 20469 pages = {456}, 20470 note = {Available online at \url{http://git-scm.com/book/}} 20471} 20472 20473@Misc{ bitbucket, 20474 author = {Atlassian}, 20475 title = {Bitbucket}, 20476 note = {Platform available from \url{http://bitbucket.org}} 20477} 20478 20479@Misc{ gitworkflows, 20480 author = {GitWorkflows}, 20481 note = {Available at 20482 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 20483} 20484 20485@Misc{ figshare, 20486 author = {FigShare}, 20487 note = {Available at \url{http://palgrave.figshare.com/}} 20488} 20489 20490@InProceedings{ beazley1996swig, 20491 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 20492 {C++}}, 20493 author = {Beazley, David M}, 20494 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 20495 pages = {129--139}, 20496 year = {1996} 20497} 20498 20499@Misc{ softwareproductivityworkshopreport14, 20500 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 20501 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 20502 title = {Software Productivity for Extreme-Scale Science}, 20503 note = {Report on DOE Workshop, January 13-14, 2014}, 20504 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 20505 year = {2014} 20506} 20507 20508@Misc{ softwareproductivitywhitepaper13, 20509 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 20510 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 20511 Tang}, 20512 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 20513 Capability of Extreme-Scale Computing}, 20514 note = {whitepaper submitted to DOE, available via 20515 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 20516 year = {2013} 20517} 20518 20519@Misc{ ideas:project, 20520 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 20521 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 20522 howpublished = {\url{http://ideas-productivity.org}}, 20523 year = {2015} 20524} 20525 20526@TechReport{ keyesmcinneswoodwardetal2012, 20527 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 20528 and B. Sheehan}, 20529 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 20530 institution = {Argonne National Laboratory}, 20531 number = {ANL/MCS-TM-330}, 20532 month = oct, 20533 year = {2012} 20534} 20535 20536@Misc{ sawsfs-web-page, 20537 author = {Surtai Han and Barry Smith and Hong Zhang}, 20538 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 20539 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 20540 year = {2015} 20541} 20542 20543@Misc{ sawshk-web-page, 20544 author = {Surtai Han and Barry Smith and Hong Zhang}, 20545 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 20546 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 20547 year = {2015} 20548} 20549 20550@Misc{ sawsnestk-web-page, 20551 author = {Surtai Han and Barry Smith and Hong Zhang}, 20552 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 20553 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 20554 year = {2015} 20555} 20556 20557@Misc{ m2acs:project, 20558 author = {M. {Anitescu et al.}}, 20559 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 20560 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 20561 year = {2015} 20562} 20563 20564@Misc{ hssmn13, 20565 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 20566 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 20567 Developing Mathematical Libraries and Simulation Codes}, 20568 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 20569 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 20570 year = {2013} 20571} 20572 20573@Misc{ atpesc:website, 20574 key = {{Argonne Training Program for Extreme-Scale Computing}}, 20575 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 20576 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 20577 year = {2018} 20578} 20579 20580@Article{ barraultmadaynguyenpatera2004, 20581 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 20582 title = {An empirical interpolation method: application to efficient reduced-basis 20583 discretization of partial differential equations}, 20584 journal = {Comptes Rendus Mathematique}, 20585 volume = {339}, 20586 number = {9}, 20587 pages = {667--672}, 20588 year = {2004}, 20589 issn = {1631-073X}, 20590 doi = {10.1016/j.crma.2004.08.006} 20591} 20592 20593@Article{ simongogotsi08, 20594 title = {Materials for electrochemical capacitors}, 20595 author = {Patrice Simon and Yury Gogotsi}, 20596 journal = {Nature Materials}, 20597 volume = {7}, 20598 number = {11}, 20599 pages = {845--854}, 20600 year = {2008}, 20601 doi = {10.1038/nmat2297} 20602} 20603 20604@Article{ vladsinghrollandmelinteajayangohy14, 20605 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 20606 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 20607 Gohy}, 20608 journal = {Scientific Reports}, 20609 volume = {4}, 20610 year = {2014}, 20611 doi = {10.1038/srep04315} 20612} 20613 20614@Article{ lichengshashurinkeidar12, 20615 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 20616 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 20617 journal = {Graphene}, 20618 volume = {1}, 20619 number = {1}, 20620 pages = {1--13}, 20621 year = {2012}, 20622 doi = {10.4236/graphene.2012.11001} 20623} 20624 20625@Article{ miller07, 20626 title = {A Brief History of Supercapacitors}, 20627 author = {John R. Miller}, 20628 journal = {Battery and Energy Storage Technology}, 20629 pages = {61--78}, 20630 year = {2007} 20631} 20632 20633@Book{ deshpande14, 20634 title = {Ultracapacitors: Future of Energy Storage}, 20635 author = {R. P. Deshpande}, 20636 publisher = {McGraw Hill Education}, 20637 isbn = {978-9339214050}, 20638 pages = {452}, 20639 year = {2014} 20640} 20641 20642@Article{ hojowboggs10, 20643 title = {Historical introduction to capacitor technology}, 20644 author = {J. Ho and T.R. Jow and S. Boggs}, 20645 journal = {IEEE Electrical Insulation Magazine}, 20646 month = jan, 20647 volume = {26}, 20648 number = {1}, 20649 pages = {20--25}, 20650 year = {2010}, 20651 doi = {10.1109/MEI.2010.5383924}, 20652 issn = {0883-7554} 20653} 20654 20655@Article{ gillespie14, 20656 title = {A review of steric interactions of ions: Why some theories succeed and others 20657 fail to acount for ion size}, 20658 author = {Dirk Gillespie}, 20659 journal = {Microfluidics and Nanofluidics}, 20660 volume = {18}, 20661 number = {5-6}, 20662 pages = {717--738}, 20663 year = {2015} 20664} 20665 20666@Article{ gillespievaliskoboda05, 20667 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 20668 title = {Density functional theory of the electrical double layer: the RFD functional}, 20669 journal = {J. Phys.: Condens. Matter}, 20670 volume = {17}, 20671 pages = {6609--6626}, 20672 year = {2005} 20673} 20674 20675@Article{ valiskobodagillespie07, 20676 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 20677 title = {Selective adsorption of ions with different diameter and valence at 20678 highly-charged interfaces}, 20679 journal = {J. Phys. Chem. C}, 20680 volume = {111}, 20681 pages = {15575--15585}, 20682 year = {2007} 20683} 20684 20685@Article{ gillespie08, 20686 author = {Dirk Gillespie}, 20687 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 20688 case study}, 20689 journal = {Biophys. J.}, 20690 volume = {94}, 20691 pages = {1169--1184}, 20692 year = {2008} 20693} 20694 20695@Article{ liwuwang15, 20696 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 20697 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 20698 journal = {Biophysical Journal}, 20699 volume = {94}, 20700 number = {3}, 20701 pages = {737--746}, 20702 doi = {10.1529/biophysj.107.112508}, 20703 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 20704 year = {2015} 20705} 20706 20707@Article{ gillespie12, 20708 title = {High energy conversion efficiency in nanofluidic channels}, 20709 author = {Dirk Gillespie}, 20710 journal = {Nano Letters}, 20711 volume = {12}, 20712 pages = {1410--1416}, 20713 year = {2012} 20714} 20715 20716@Article{ dieterich79, 20717 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 20718 author = {James H. Dieterich}, 20719 journal = {Journal of Geophysical Research: Solid Earth}, 20720 volume = {84}, 20721 number = {B5}, 20722 pages = {2161--2168}, 20723 year = {1979}, 20724 publisher = {Wiley Online Library} 20725} 20726 20727@Article{ bodakovacsgillespiekristof14, 20728 title = {Selective transport through a model calcium channel studied by Local Equilibrium 20729 Monte Carlo simulations coupled to the Nernst--Planck equation}, 20730 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 20731 Krist{\'o}f}, 20732 journal = {Journal of Molecular Liquids}, 20733 volume = {189}, 20734 pages = {100--112}, 20735 year = {2014}, 20736 publisher = {Elsevier} 20737} 20738 20739@Article{ brandt05, 20740 title = {Multiscale solvers and systematic upscaling in computational physics}, 20741 author = {Brandt, A}, 20742 journal = {Computer Physics Communications}, 20743 volume = {169}, 20744 number = {1}, 20745 pages = {438--441}, 20746 year = {2005}, 20747 publisher = {Elsevier} 20748} 20749 20750@Article{ rosenfeld89, 20751 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 20752 density-functional theory of freezing}, 20753 author = {Yaakov Rosenfeld}, 20754 journal = {Physical review letters}, 20755 volume = {63}, 20756 number = {9}, 20757 pages = {980}, 20758 year = {1989}, 20759 publisher = {APS} 20760} 20761 20762@Article{ schindlermitchellmccabecummingslevan13, 20763 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 20764 Approach}, 20765 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 20766 M Douglas LeVan}, 20767 journal = {The Journal of Physical Chemistry C}, 20768 volume = {117}, 20769 number = {41}, 20770 pages = {21337--21350}, 20771 year = {2013}, 20772 publisher = {ACS Publications} 20773} 20774 20775@Misc{ tramonto, 20776 author = {Laura Frink and et. al.}, 20777 title = {TRAMONTO 3.0 web site}, 20778 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 20779 year = {2014} 20780} 20781 20782@InCollection{ zhongyuenmoresiknepley15, 20783 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 20784 title = {Numerical Methods for Mantle Convection}, 20785 booktitle = {Treatise on Geophysics}, 20786 publisher = {Elsevier}, 20787 volume = {7}, 20788 editor = {Gerald Schubert}, 20789 edition = {second}, 20790 year = {2015} 20791} 20792 20793@Article{ richarson1911, 20794 author = {Lewis Fry Richardson}, 20795 title = {The approximate arithmetical solution by finite differences of physical problems 20796 including differential equations, with an application to the stresses in a masonry 20797 dam}, 20798 journal = {Philosophical Transactions of the Royal Society A}, 20799 volume = {210}, 20800 number = {459--470}, 20801 pages = {307--357}, 20802 doi = {10.1098/rsta.1911.0009}, 20803 year = {1911} 20804} 20805 20806@Article{ kirkwood34, 20807 author = {John G. Kirkwood}, 20808 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 20809 Application to Zwitterions}, 20810 journal = {The Journal of Chemical Physics}, 20811 volume = {2}, 20812 number = {7}, 20813 year = {1934} 20814} 20815 20816@TechReport{ schoof1994exodus, 20817 title = {{EXODUS II}: a finite element data model}, 20818 author = {Larry A Schoof and Victor R Yarberry}, 20819 institution = {Sandia National Laboratories}, 20820 number = {SAND92-2137}, 20821 address = {Albuquerque, NM}, 20822 year = {1994} 20823} 20824 20825@Misc{ poirier1998cgns, 20826 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 20827 and Fancis Y Enomoto}, 20828 title = {The CGNS system}, 20829 note = {AIAA Paper 98-3007}, 20830 year = {1998} 20831} 20832 20833@Article{ deyobarashephard2001, 20834 title = {Towards curvilinear meshing in 3D: the case of quadratic simplices}, 20835 author = {Saikat Dey and Robert M O'Bara and Mark S Shephard}, 20836 journal = {Computer-Aided Design}, 20837 volume = {33}, 20838 number = {3}, 20839 pages = {199--209}, 20840 year = {2001}, 20841} 20842 20843@InProceedings{ gomezhaimesgalbraith2022, 20844 title = {On Analysis Driven Shape Design Using B-Splines}, 20845 author = {Marlena Gomez and Robert Haimes and Marshall C Galbraith}, 20846 booktitle = {AIAA SciTech 2022 Forum}, 20847 pages = {1736}, 20848 year = {2022} 20849} 20850 20851@InProceedings{ cloughoberaizakrajsek2019, 20852 title = {Automated Wing Internal Structure Placement Guided by Finite Element Analysis}, 20853 author = {Justin L Clough and Assad A Oberai and Andrew J Zakrajsek}, 20854 booktitle = {AIAA Aviation 2019 Forum}, 20855 pages = {3369}, 20856 year = {2019} 20857} 20858 20859@InProceedings{ joegandhidannenhofferdalir2019, 20860 title = {Rapid generation of parametric aircraft structural models}, 20861 author = {John Joe and Viraj Gandhi and John Dannenhoffer and Hamid Dalir}, 20862 booktitle = {AIAA SciTech 2019 Forum}, 20863 pages = {2229}, 20864 year = {2019} 20865} 20866 20867@InProceedings{ haimesdannenhoffer2013, 20868 title = {The engineering sketch pad: A solid-modeling, feature-based, web-enabled system for building parametric geometry}, 20869 author = {Robert Haimes and John Dannenhoffer}, 20870 booktitle = {21st AIAA Computational Fluid Dynamics Conference}, 20871 pages = {3073}, 20872 year = {2013} 20873} 20874 20875@Article{ geuzaine2009gmsh, 20876 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 20877 facilities}, 20878 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 20879 journal = {International Journal for Numerical Methods in Engineering}, 20880 volume = {79}, 20881 number = {11}, 20882 pages = {1309--1331}, 20883 year = {2009}, 20884 publisher = {Wiley Online Library} 20885} 20886 20887@Article{ si2015, 20888 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 20889 author = {Hang Si}, 20890 journal = {ACM Trans. on Mathematical Software}, 20891 volume = {41}, 20892 number = {2}, 20893 month = feb, 20894 doi = {10.1145/2629697}, 20895 year = {2015} 20896} 20897 20898@TechReport{ blackerbohnhoffedwards1994, 20899 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 20900 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 20901 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 20902 year = {1994} 20903} 20904 20905@Article{ bjorck1994, 20906 title = {Numerics of Gram-Schmidt orthogonalization}, 20907 author = {{\AA}ke Bj{\"o}rck}, 20908 journal = {Linear Algebra and Its Applications}, 20909 volume = {197}, 20910 pages = {297--316}, 20911 year = {1994}, 20912 publisher = {Elsevier} 20913} 20914 20915@PhDThesis{ yood05, 20916 author = {Charles Nelson Yood}, 20917 title = {Argonne National Laboratory and the Emergence of Computer and Computational 20918 Science, 1946--1992}, 20919 school = {The Pennsylvania State University}, 20920 month = aug, 20921 year = {2005} 20922} 20923 20924@Article{ fearnleysander79, 20925 title = {Hermann Grassmann and the Creation of Linear Algebra}, 20926 author = {Desmond Fearnley-Sander}, 20927 journal = {The American Mathematical Monthly}, 20928 volume = {86}, 20929 pages = {809--817}, 20930 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 20931 year = {1979} 20932} 20933 20934@InCollection{ knepley2012, 20935 author = {Matthew G. Knepley}, 20936 title = {Programming Languages for Scientific Computing}, 20937 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20938 publisher = {Springer}, 20939 year = {2012}, 20940 editor = {Bj\"orn Engquist}, 20941 doi = {10.1007/978-3-540-70529-1}, 20942 url = {http://arxiv.org/abs/1209.1711} 20943} 20944 20945@InBook{ knepley2015, 20946 title = {Programming Languages for Scientific Computing}, 20947 author = {Matthew G. Knepley}, 20948 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20949 editor = {Bj{\"o}rn Engquist}, 20950 publisher = {Springer Berlin Heidelberg}, 20951 address = {Berlin, Heidelberg}, 20952 pages = {1173--1181}, 20953 isbn = {978-3-540-70529-1}, 20954 doi = {10.1007/978-3-540-70529-1_250}, 20955 year = {2015} 20956} 20957 20958@Book{ hughes2000, 20959 author = {Thomas J. R. Hughes}, 20960 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 20961 series = {Dover Civil and Mechanical Engineering}, 20962 pages = {704}, 20963 year = {2000}, 20964 isbn = {978-0486411811}, 20965 publisher = {Dover} 20966} 20967 20968@Article{ roache2002, 20969 title = {Code verification by the method of manufactured solutions}, 20970 author = {Patrick J. Roache}, 20971 journal = {Journal of Fluids Engineering}, 20972 volume = {124}, 20973 number = {1}, 20974 pages = {4--10}, 20975 year = {2002}, 20976 publisher = {American Society of Mechanical Engineers} 20977} 20978 20979@InCollection{ rokosgorman13, 20980 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 20981 author = {Georgios Rokos and Gerard Gorman}, 20982 booktitle = {Facing the Multicore-Challenge III}, 20983 series = {Lecture Notes in Computer Science}, 20984 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 20985 publisher = {Springer Berlin Heidelberg}, 20986 volume = {7686}, 20987 pages = {143-144}, 20988 doi = {10.1007/978-3-642-35893-7_22}, 20989 isbn = {978-3-642-35892-0}, 20990 year = {2013} 20991} 20992 20993@Misc{ hdf5:homepage, 20994 author = {{The HDF Group}}, 20995 title = {The {HDF5} Homepage}, 20996 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 20997 year = {2015} 20998} 20999 21000@Misc{ paraview:homepage, 21001 author = {Kitware}, 21002 title = {The {ParaView} Homepage}, 21003 howpublished = {\url{http://www.paraview.org/}}, 21004 year = {2015} 21005} 21006 21007@Misc{ xdmf:homepage, 21008 author = {Kitware}, 21009 title = {The Extensible Data Model and Format ({XDMF})}, 21010 howpublished = {\url{http://www.xdmf.org/}}, 21011 year = {2015} 21012} 21013 21014@Article{ cullerkarp1993, 21015 title = {LogP: Towards a realistic model of parallel computation}, 21016 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 21017 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 21018 journal = {SIGPLAN Notices}, 21019 volume = {28}, 21020 number = {7}, 21021 pages = {1--12}, 21022 year = {1993}, 21023 publisher = {ACM} 21024} 21025 21026@Article{ aggarwalvitter1988, 21027 title = {The input/output complexity of sorting and related problems}, 21028 author = {Alok Aggarwal and Jeffrey Vitter}, 21029 journal = {Communications of the ACM}, 21030 volume = {31}, 21031 number = {9}, 21032 pages = {1116--1127}, 21033 year = {1988}, 21034 publisher = {ACM} 21035} 21036 21037@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 21038 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 21039 Chandramowlishwaran and Richard Vuduc}, 21040 title = {Balance principles for algorithm-architecture co-design}, 21041 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 21042 month = may, 21043 address = {Berkeley, CA, USA}, 21044 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 21045 year = {2011} 21046} 21047 21048@Article{ williamswatermanpatterson2009, 21049 title = {Roofline: an insightful visual performance model for multicore architectures}, 21050 author = {Samuel Williams and Andrew Waterman and David Patterson}, 21051 journal = {Communications of the ACM}, 21052 volume = {52}, 21053 number = {4}, 21054 pages = {65--76}, 21055 year = {2009}, 21056 publisher = {ACM} 21057} 21058 21059@Misc{ roofline-web-page, 21060 author = {Samuel Williams and {et. al.}}, 21061 title = {{R}oofline {P}erformance {M}odel}, 21062 key = {Roofline}, 21063 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 21064 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 21065} 21066 21067@Misc{ roofline-talk2008, 21068 author = {Samuel Williams and David Patterson}, 21069 title = {{R}oofline {P}erformance {M}odel}, 21070 key = {Roofline}, 21071 year = {2008}, 21072 note = {ParLab Summer Retreat}, 21073 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 21074 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 21075} 21076 21077@Article{ lee2006, 21078 title = {The problem with threads}, 21079 author = {Edward A Lee}, 21080 journal = {Computer}, 21081 volume = {39}, 21082 number = {5}, 21083 pages = {33--42}, 21084 year = {2006}, 21085 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 21086 publisher = {IEEE Computer Society Press} 21087} 21088 21089@Article{ hoefler2012, 21090 title = {{Optimization principles for collective neighborhood communications}}, 21091 author = {Torsten Hoefler and Timo Schneider}, 21092 journal = {International Conference for High Performance Computing, Networking, Storage and 21093 Analysis, SC}, 21094 doi = {10.1109/SC.2012.86}, 21095 isbn = {9781467308069}, 21096 issn = {21674329}, 21097 year = {2012} 21098} 21099 21100@Book{ grahamknuthpatashnik1989, 21101 title = {Concrete Mathematics}, 21102 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 21103 publisher = {Addison-Wesley}, 21104 year = {1989} 21105} 21106 21107@Book{ jackson1962, 21108 title = {Classical Electrodynamics}, 21109 author = {John David Jackson}, 21110 publisher = {John Wiley \& Sons}, 21111 year = {1962} 21112} 21113 21114@Article{ leveque2013, 21115 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 21116 author = {Randall J. LeVeque}, 21117 journal = {SIAM News}, 21118 volume = {46}, 21119 number = {3}, 21120 month = apr, 21121 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 21122 year = {2013} 21123} 21124 21125@InProceedings{ wang2014, 21126 title = {Fjos: Practical, predictable, and efficient system support for fork/join 21127 parallelism}, 21128 author = {Qi Wang and Gabriel Parmer}, 21129 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 21130 20th}, 21131 pages = {25--36}, 21132 year = {2014}, 21133 organization = {IEEE} 21134} 21135 21136@Article{ fangsaad2009, 21137 author = {Haw-ren Fang and Yousef Saad}, 21138 title = {Two classes of multisecant methods for nonlinear acceleration}, 21139 journal = {Numerical Linear Algebra with Applications}, 21140 volume = {16}, 21141 number = {3}, 21142 pages = {197--221}, 21143 year = {2009}, 21144 doi = {10.1002/nla.617} 21145} 21146 21147@Misc{ hpcchallenge, 21148 title = {HPC Challenge}, 21149 author = {Jack Dongarra and Piotr Luszczek and others}, 21150 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 21151 year = {2015} 21152} 21153 21154@InProceedings{ hoeflerschneiderlumsdaine2008, 21155 title = {Accurately measuring collective operations at massive scale}, 21156 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 21157 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 21158 Processing (IPDPS)}, 21159 pages = {1--8}, 21160 year = {2008}, 21161 doi = {10.1109/IPDPS.2008.4536494}, 21162 organization = {IEEE} 21163} 21164 21165@Book{ potraptak1984, 21166 title = {Nondiscrete Induction and Iterative Processes}, 21167 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 21168 series = {Research Notes in Mathematics}, 21169 year = {1984}, 21170 publisher = {Pitman} 21171} 21172 21173@Book{ pilz1977, 21174 title = {Near-rings: the theory and its applications}, 21175 author = {G{\"u}nter Pilz}, 21176 year = {1977}, 21177 publisher = {New York} 21178} 21179 21180@Article{ birkenjameson2009, 21181 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 21182 author = {Philipp Birken and Antony Jameson}, 21183 journal = {International Journal for Numerical Methods in Fluids}, 21184 volume = {62}, 21185 number = {5}, 21186 pages = {565--573}, 21187 publisher = {John Wiley \& Sons, Ltd.}, 21188 doi = {10.1002/fld.2030}, 21189 issn = {1097-0363}, 21190 year = {2010} 21191} 21192 21193@Article{ anderson1965, 21194 title = {Iterative procedures for nonlinear integral equations}, 21195 author = {Donald G Anderson}, 21196 journal = {Journal of the ACM (JACM)}, 21197 volume = {12}, 21198 number = {4}, 21199 pages = {547--560}, 21200 year = {1965}, 21201 publisher = {ACM} 21202} 21203 21204@Article{ ptak1966, 21205 title = {Some metric aspects of the open mapping and closed graph theorems}, 21206 author = {Vlastimil Pt{\'a}k}, 21207 journal = {Mathematische Annalen}, 21208 volume = {163}, 21209 number = {2}, 21210 pages = {95--104}, 21211 year = {1966}, 21212 publisher = {Springer} 21213} 21214 21215@Article{ ptak1974, 21216 title = {A quantitative refinement of the closed graph theorem}, 21217 author = {Vlastimil Pt{\'a}k}, 21218 journal = {Czechoslovak Mathematical Journal}, 21219 volume = {24}, 21220 number = {3}, 21221 pages = {503--506}, 21222 year = {1974}, 21223 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 21224} 21225 21226@Article{ ptak1975, 21227 title = {The rate of convergence of {Newton's} process}, 21228 author = {Vlastimil Pt{\'a}k}, 21229 journal = {Numerische Mathematik}, 21230 volume = {25}, 21231 number = {3}, 21232 pages = {279--285}, 21233 year = {1975}, 21234 publisher = {Springer} 21235} 21236 21237@Article{ ptak1976, 21238 title = {Nondiscrete mathematical induction and iterative existence proofs}, 21239 author = {Vlastimil Pt{\'a}k}, 21240 journal = {Linear algebra and its applications}, 21241 volume = {13}, 21242 number = {3}, 21243 pages = {223--238}, 21244 year = {1976}, 21245 publisher = {Elsevier} 21246} 21247 21248@Article{ ptak1977, 21249 title = {What should be a rate of convergence?}, 21250 author = {Vlastimil Pt{\'a}k}, 21251 journal = {RAIRO-Analyse num{\'e}rique}, 21252 volume = {11}, 21253 number = {3}, 21254 pages = {279--286}, 21255 year = {1977} 21256} 21257 21258@Article{ potraptak1980, 21259 title = {Sharp error bounds for {Newton's} process}, 21260 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 21261 journal = {Numerische Mathematik}, 21262 volume = {34}, 21263 number = {1}, 21264 pages = {63--72}, 21265 year = {1980}, 21266 publisher = {Springer} 21267} 21268 21269@Article{ liesen2014, 21270 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 21271 author = {J{\"o}rg Liesen}, 21272 journal = {IMA Journal of Numerical Analysis}, 21273 doi = {10.1093/imanum/drv037}, 21274 archiveprefix = {arXiv}, 21275 eprint = {1405.2683}, 21276 primaryclass = {math-na}, 21277 year = {2015} 21278} 21279 21280@Book{ traub1964, 21281 title = {Iterative Methods for the Solution of Equations}, 21282 author = {Joseph F Traub}, 21283 year = {1964}, 21284 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 21285} 21286 21287@InProceedings{ shalfvecpar2010, 21288 title = {Exascale Computing Technology Challenges}, 21289 author = {John Shalf and Sudip Dosanjh and John Morrison}, 21290 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 21291 pages = {1–-25}, 21292 year = {2010} 21293} 21294 21295@Article{ frechet1907, 21296 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 21297 author = {Maurice Ren\'e Fr\'echet}, 21298 journal = {C. R. Acad. Sci. Paris}, 21299 volume = {144}, 21300 pages = {1414--1416}, 21301 year = {1907} 21302} 21303 21304@Article{ riesz1907, 21305 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 21306 author = {Frigyes Riesz}, 21307 journal = {C. R. Acad. Sci. Paris}, 21308 volume = {144}, 21309 pages = {1409--1411}, 21310 year = {1907} 21311} 21312 21313@Article{ riesz1909, 21314 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 21315 author = {Frigyes Riesz}, 21316 journal = {C. R. Acad. Sci. Paris}, 21317 volume = {149}, 21318 pages = {974--977}, 21319 year = {1909} 21320} 21321 21322@Misc{ rieszmarkovkakutanirepresentationtheorem, 21323 author = {Wikipedia}, 21324 title = {Riesz-Markov-Kakutani Representation Theorem}, 21325 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 21326 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 21327 year = {2015} 21328} 21329 21330@Article{ markov1938, 21331 title = {On mean values and exterior densities}, 21332 author = {Andrey Markov}, 21333 journal = {Rec. Math. Moscou}, 21334 volume = {4}, 21335 pages = {165--190}, 21336 year = {1938} 21337} 21338 21339@Article{ kakutani1941, 21340 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 21341 space of continuous functions.)}, 21342 author = {Shizuo Kakutani}, 21343 journal = {Ann. of Math.}, 21344 volume = {2}, 21345 number = {42}, 21346 pages = {994--1024}, 21347 doi = {10.2307/1968778}, 21348 year = {1941} 21349} 21350 21351@Article{ michoskimeyersonisaacwaelbroeck2014, 21352 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 21353 tokamaks}, 21354 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 21355 journal = {Journal of Computational Physics}, 21356 volume = {274}, 21357 pages = {898--919}, 21358 year = {2014}, 21359 publisher = {Elsevier} 21360} 21361 21362@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 21363 title = {Extreme-scale AMR}, 21364 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 21365 Stadler and Tim Warburton and Lucas Wilcox}, 21366 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 21367 Computing, Networking, Storage and Analysis}, 21368 pages = {1--12}, 21369 year = {2010}, 21370 organization = {IEEE Computer Society}, 21371 doi = {10.1109/SC.2010.25} 21372} 21373 21374@InProceedings{ isaacbursteddeghattas2012, 21375 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 21376 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 21377 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 21378 International}, 21379 pages = {426--437}, 21380 year = {2012}, 21381 organization = {IEEE}, 21382 doi = {10.1109/IPDPS.2012.47} 21383} 21384 21385@Article{ isaacpetrastadlerghattas2015, 21386 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 21387 through inference to prediction for large-scale problems, with application to flow 21388 of the {Antarctic} ice sheet}, 21389 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 21390 journal = {Journal of Computational Physics}, 21391 volume = {296}, 21392 pages = {348--368}, 21393 year = {2015}, 21394 publisher = {Elsevier}, 21395 doi = {10.1016/j.jcp.2015.04.047} 21396} 21397 21398@Article{ isaacbursteddewilcoxghattas2015, 21399 title = {Recursive Algorithms for Distributed Forests of Octrees}, 21400 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 21401 journal = {SIAM Journal on Scientific Computing}, 21402 volume = {37}, 21403 number = {5}, 21404 pages = {C497-C531}, 21405 eprint = {1406.0089}, 21406 eprinttype = {arXiv}, 21407 year = {2015}, 21408 doi = {10.1137/140970963} 21409} 21410 21411@Article{ isaacstadlerghattas2015, 21412 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 21413 elements on nonconforming and anisotropic meshes, with application to ice sheet 21414 dynamics}, 21415 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 21416 journal = {SIAM Journal on Scientific Computing}, 21417 number = {6}, 21418 pages = {804--833}, 21419 volume = {37}, 21420 year = {2015}, 21421 doi = {10.1137/140974407} 21422} 21423 21424@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 21425 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 21426 earth's mantle}, 21427 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 21428 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 21429 Alessandro Curioni and Omar Ghattas}, 21430 booktitle = {Proceedings of the International Conference for High Performance Computing, 21431 Networking, Storage and Analysis}, 21432 pages = {5}, 21433 year = {2015}, 21434 organization = {ACM}, 21435 doi = {10.1145/2807591.2807675} 21436} 21437 21438@Article{ bunchhopcroft1974, 21439 title = {Triangular factorization and inversion by fast matrix multiplication}, 21440 author = {James R Bunch and John E Hopcroft}, 21441 journal = {Mathematics of Computation}, 21442 volume = {28}, 21443 number = {125}, 21444 pages = {231--236}, 21445 doi = {10.2307/2005828}, 21446 year = {1974} 21447} 21448 21449@Article{ nemirovsky1991, 21450 title = {On optimality of Krylov's information when solving linear operator equations}, 21451 author = {A.S Nemirovsky}, 21452 journal = {Journal of Complexity}, 21453 volume = {7}, 21454 number = {2}, 21455 pages = {121--130}, 21456 doi = {10.1016/0885-064X(91)90001-E}, 21457 year = {1991} 21458} 21459 21460@Misc{siamcseprize, 21461 author = {{PETSc Team}}, 21462 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21463 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21464 url = {https://www.siam.org/prizes/sponsored/cse.php}, 21465 year = {2015} 21466} 21467 21468@Article{ rathgeber2017, 21469 title = {Firedrake: automating the finite element method by composing abstractions}, 21470 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 21471 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 21472 Graham R and Kelly, Paul HJ}, 21473 archiveprefix = {arXiv}, 21474 journal = {ACM Transaction on Mathematical Software}, 21475 eprint = {1501.01809}, 21476 volume = {43}, 21477 issue = {3}, 21478 number = {24}, 21479 year = {2017}, 21480 url = {http://arxiv.org/abs/1501.01809} 21481} 21482 21483@Article{ kirby2006b, 21484 title = {Topological optimization of the evaluation of finite element matrices}, 21485 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 21486 journal = {SIAM Journal on Scientific Computing}, 21487 volume = {28}, 21488 number = {1}, 21489 pages = {224--240}, 21490 year = {2006}, 21491 publisher = {SIAM} 21492} 21493 21494@Article{ luporini2015, 21495 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 21496 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 21497 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 21498 Assembly}, 21499 journal = {ACM Trans. Archit. Code Optim.}, 21500 issue_date = {January 2015}, 21501 volume = {11}, 21502 number = {4}, 21503 month = jan, 21504 year = {2015}, 21505 issn = {1544-3566}, 21506 pages = {57:1--57:25}, 21507 articleno = {57}, 21508 numpages = {25}, 21509 doi = {10.1145/2687415}, 21510 acmid = {2687415}, 21511 publisher = {ACM}, 21512 address = {New York, NY, USA}, 21513 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 21514 optimizations} 21515} 21516 21517@Article{ markall2012, 21518 title = {Finite element assembly strategies on multi- and many-core architectures}, 21519 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 21520 C. D. and Sherwin, S. J.}, 21521 journal = {International Journal for Numerical Methods in Fluids}, 21522 year = {2013}, 21523 volume = {71}, 21524 pages = {80--97}, 21525 doi = {10.1002/fld.3648} 21526} 21527 21528@Article{ markall2010, 21529 title = {Towards generating optimised finite element solvers for GPUs from high-level 21530 specifications}, 21531 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 21532 journal = {Procedia Computer Science}, 21533 volume = {1}, 21534 number = {1}, 21535 pages = {1815--1823}, 21536 year = {2010}, 21537 note = {{ICCS} 2010}, 21538 doi = {10.1016/j.procs.2010.04.203} 21539} 21540 21541@Article{ longkirbywaanders2010, 21542 title = {Unified embedded parallel finite element computations via software-based 21543 Fr{\'e}chet differentiation}, 21544 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 21545 journal = {SIAM Journal on Scientific Computing}, 21546 volume = {32}, 21547 number = {6}, 21548 pages = {3323--3351}, 21549 year = {2010}, 21550 publisher = {SIAM} 21551} 21552 21553@Article{ kirby2010, 21554 title = {From functional analysis to iterative methods}, 21555 author = {Robert C Kirby}, 21556 journal = {SIAM review}, 21557 volume = {52}, 21558 number = {2}, 21559 pages = {269--293}, 21560 year = {2010}, 21561 publisher = {SIAM} 21562} 21563 21564@Article{ kirby2014, 21565 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 21566 author = {Robert C Kirby}, 21567 journal = {SIAM Journal on Scientific Computing}, 21568 volume = {36}, 21569 number = {2}, 21570 pages = {A846--A868}, 21571 year = {2014}, 21572 publisher = {SIAM} 21573} 21574 21575@Article{ kirby2011, 21576 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 21577 author = {Robert C Kirby}, 21578 journal = {Numerische Mathematik}, 21579 volume = {117}, 21580 number = {4}, 21581 pages = {631--652}, 21582 year = {2011}, 21583 publisher = {Springer} 21584} 21585 21586@Article{ arnoldfalkwinther2006, 21587 title = {Finite element exterior calculus, homological techniques, and applications}, 21588 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 21589 journal = {Acta numerica}, 21590 volume = {15}, 21591 pages = {1--155}, 21592 year = {2006}, 21593 publisher = {Cambridge Univ Press} 21594} 21595 21596@Article{ arnoldlogg2014, 21597 title = {Periodic table of the finite elements}, 21598 author = {Douglas Arnold and Anders Logg}, 21599 month = nov, 21600 journal = {SIAM News}, 21601 year = {2014} 21602} 21603 21604@Article{ janssonhoffmanjansson2012, 21605 title = {Framework for massively parallel adaptive finite element computational fluid 21606 dynamics on tetrahedral meshes}, 21607 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 21608 journal = {SIAM Journal on Scientific Computing}, 21609 volume = {34}, 21610 number = {1}, 21611 pages = {C24--C41}, 21612 year = {2012}, 21613 publisher = {SIAM} 21614} 21615 21616@Article{ rogneshamcottermcrae2013, 21617 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 21618 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 21619 journal = {Geoscientific Model Development}, 21620 volume = {6}, 21621 number = {6}, 21622 pages = {2099--2119}, 21623 year = {2013}, 21624 publisher = {Copernicus GmbH} 21625} 21626 21627@Book{ loggmardalwells2012, 21628 title = {Automated solution of differential equations by the finite element method: The 21629 {FEniCS} book}, 21630 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 21631 volume = {84}, 21632 year = {2012}, 21633 publisher = {Springer Science \& Business Media} 21634} 21635 21636@Article{ cotterkirby2014, 21637 title = {Mixed finite elements for global tide models}, 21638 author = {Colin J Cotter and Robert C Kirby}, 21639 archiveprefix = {arXiv}, 21640 journal = {Submitted}, 21641 eprint = {1410.0045}, 21642 year = {2014}, 21643 url = {http://arxiv.org/abs/1410.0045} 21644} 21645 21646@Article{ kirbykieu2015, 21647 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 21648 author = {Robert C Kirby and Thinh Tri Kieu}, 21649 journal = {Numerische Mathematik}, 21650 volume = {130}, 21651 number = {2}, 21652 pages = {257--291}, 21653 year = {2015}, 21654 publisher = {Springer} 21655} 21656 21657@Article{ brennankirby2015, 21658 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 21659 model}, 21660 author = {Brian Brennan and Robert C Kirby}, 21661 journal = {Submitted to Computers and Mathematics with Applications}, 21662 year = {2015} 21663} 21664 21665@Article{ howlekirbydillon2013, 21666 title = {Block preconditioners for coupled physics problems}, 21667 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 21668 journal = {SIAM Journal on Scientific Computing}, 21669 volume = {35}, 21670 number = {5}, 21671 pages = {S368--S385}, 21672 year = {2013}, 21673 publisher = {SIAM} 21674} 21675 21676@Book{ malekstrakos2014, 21677 title = {Preconditioning and the conjugate gradient method in the context of solving 21678 PDEs}, 21679 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 21680 volume = {1}, 21681 year = {2014}, 21682 publisher = {SIAM} 21683} 21684 21685@Misc{ isaac2022, 21686 title = {Unifying the geometric decompositions of full and trimmed polynomial spaces in finite element exterior calculus}, 21687 author = {Toby Isaac}, 21688 eprint = {2112.02174}, 21689 archivePrefix = {arXiv}, 21690 primaryClass = {math.NA}, 21691 url = {https://arxiv.org/abs/2112.02174}, 21692 year = {2022} 21693} 21694 21695@Article{ desturler1995, 21696 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 21697 distributed memory computers}, 21698 author = {E. de Sturler and H.A. van der Vorst}, 21699 journal = {Applied Numerical Mathematics}, 21700 volume = {18}, 21701 number = {4}, 21702 pages = {441--459}, 21703 year = {1995}, 21704 doi = {10.1016/0168-9274(95)00079-A} 21705} 21706 21707@Article{ velicmaymoresi2009, 21708 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 21709 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 21710 journal = {Journal of Mathematical Modelling and Algorithms}, 21711 volume = {8}, 21712 number = {3}, 21713 pages = {343--355}, 21714 year = {2009}, 21715 publisher = {Springer} 21716} 21717 21718@Article{ may2012, 21719 title = {Volume reconstruction of point cloud data sets derived from computational 21720 geodynamic simulations}, 21721 author = {May, DA}, 21722 journal = {Geochemistry, Geophysics, Geosystems}, 21723 volume = {13}, 21724 number = {5}, 21725 year = {2012}, 21726 publisher = {Wiley Online Library} 21727} 21728 21729@Article{ quenettehodkinson2010, 21730 title = {StgDomain--scalable parallel domain software components for particle-in-cell 21731 finite element methods}, 21732 author = {Quenette, Steve and Hodkinson, Luke}, 21733 journal = {Concurrency and Computation: Practice and Experience}, 21734 volume = {22}, 21735 number = {12}, 21736 pages = {1593--1603}, 21737 year = {2010}, 21738 publisher = {Wiley Online Library} 21739} 21740 21741@Book{ velic2005, 21742 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 21743 author = {Velic, Mirko}, 21744 year = {2005}, 21745 publisher = {Monash University} 21746} 21747 21748@Article{ velicknepleymay2016, 21749 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 21750 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 21751 note = {in preparation}, 21752 year = {2016} 21753} 21754 21755@Article{ traubwozniakowski1979, 21756 title = {Convergence and complexity of Newton iteration for operator equations}, 21757 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 21758 journal = {Journal of the ACM (JACM)}, 21759 volume = {26}, 21760 number = {2}, 21761 pages = {250--258}, 21762 year = {1979}, 21763 publisher = {ACM} 21764} 21765 21766@Article{ sterck2013, 21767 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 21768 author = {Hans De Sterck}, 21769 journal = {Numerical Linear Algebra with Applications}, 21770 volume = {20}, 21771 number = {3}, 21772 pages = {453--471}, 21773 year = {2013} 21774} 21775 21776@Article{ sterckwinlaw2015, 21777 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 21778 tensor approximation}, 21779 author = {Hans De Sterck and Manda Winlaw}, 21780 journal = {Numerical Linear Algebra with Applications}, 21781 volume = {22}, 21782 number = {3}, 21783 pages = {410--432}, 21784 year = {2015} 21785} 21786 21787@Article{ sterckhowse2015, 21788 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 21789 approximate {Tucker} tensor decompositions}, 21790 author = {Hans De Sterck and Alexander Howse}, 21791 journal = {SIAM Journal on Scientific Computing}, 21792 note = {submitted}, 21793 year = {2015} 21794} 21795 21796@Book{ ladevezesimmonds1999, 21797 title = {Nonlinear computational structural mechanics: {N}ew approaches and 21798 non-incremental methods of calculation}, 21799 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 21800 series = {{M}echanical {E}ngineering {S}eries}, 21801 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 21802 isbn = {9780387985947}, 21803 lccn = {98029990}, 21804 year = {1999}, 21805 publisher = {Springer} 21806} 21807 21808@InProceedings{ walkerwoodwardyang2010, 21809 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 21810 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 21811 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 21812 year = {2010} 21813} 21814 21815@Article{ lottwalkerwoodwardyang2012, 21816 title = {An accelerated {P}icard method for nonlinear systems related to variably 21817 saturated flow}, 21818 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 21819 journal = {Advances in Water Resources}, 21820 volume = {38}, 21821 number = {0}, 21822 pages = {92--101}, 21823 doi = {10.1016/j.advwatres.2011.12.013}, 21824 year = {2012} 21825} 21826 21827@TechReport{ mohrrude1998, 21828 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 21829 author = {Marcus Mohr and Ulrich R\"ude}, 21830 type = {Technical Report}, 21831 number = {394}, 21832 institution = {University of Augsburg}, 21833 year = {1998} 21834} 21835 21836@InProceedings{ mohr2000, 21837 title = {Low Communication Parallel Multigrid}, 21838 author = {Mohr, Marcus}, 21839 booktitle = {Euro-Par 2000 Parallel Processing}, 21840 pages = {806--814}, 21841 year = {2000}, 21842 organization = {Springer} 21843} 21844 21845@Article{ brandtdiskin1994, 21846 title = {Multigrid solvers on decomposed domains}, 21847 author = {Achi Brandt and Boris Diskin}, 21848 journal = {Contemporary Mathematics}, 21849 volume = {157}, 21850 year = {1994}, 21851 publisher = {AMERICAN MATHEMATICAL SOCIETY} 21852} 21853 21854@InProceedings{ prabhuetal2011, 21855 title = {A Survey of the Practice of Computational Science}, 21856 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 21857 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 21858 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 21859 David I.}, 21860 booktitle = {State of the Practice Reports}, 21861 series = {SC '11}, 21862 year = {2011}, 21863 isbn = {978-1-4503-1139-7}, 21864 location = {Seattle, Washington}, 21865 pages = {19:1--19:12}, 21866 articleno = {19}, 21867 numpages = {12}, 21868 doi = {10.1145/2063348.2063374}, 21869 acmid = {2063374}, 21870 publisher = {ACM}, 21871 address = {New York, NY, USA} 21872} 21873 21874@PhDThesis{ dinarthesis1979, 21875 title = {Fast methods for the numerical solution of boundary value problems}, 21876 author = {N. Dinar}, 21877 school = {Weizmann Institute of Science}, 21878 year = {1979} 21879} 21880 21881@Article{ thomasdiskinbrandt2001, 21882 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 21883 high Reynolds number wakes and boundary layers}, 21884 author = {James L Thomas and Boris Diskin and Achi Brandt}, 21885 journal = {Computers \& fluids}, 21886 volume = {30}, 21887 number = {7}, 21888 pages = {853--874}, 21889 year = {2001}, 21890 publisher = {Elsevier} 21891} 21892 21893@Article{ greenbaumptakstrakos1996, 21894 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 21895 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 21896 journal = {SIAM Journal on Matrix Analysis and Applications}, 21897 volume = {17}, 21898 number = {3}, 21899 pages = {465--469}, 21900 year = {1996}, 21901 publisher = {SIAM} 21902} 21903 21904@Article{ nangiapatankarbhalla2019, 21905 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 21906 density ratio multiphase flows}, 21907 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 21908 journal = {Journal of Computational Physics}, 21909 volume = {398}, 21910 pages = {108804}, 21911 year = {2019} 21912} 21913 21914@Article{ bhallanangiadafnakisbraccomattiazzo2019, 21915 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 21916 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 21917 library}, 21918 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 21919 Bracco and Giuliana Mattiazzo}, 21920 journal = {Applied Ocean Research}, 21921 note = {In press}, 21922 year = {2019} 21923} 21924 21925@Article{ bhallagriffithpatankardonev2013, 21926 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 21927 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 21928 Alexander Donev}, 21929 journal = {Journal of Chemical Physics}, 21930 volume = {139}, 21931 number = {21}, 21932 pages = {214112}, 21933 year = {2013} 21934} 21935 21936@Article{ bhallabalegriffithpatankar2014, 21937 title = {Fully resolved immersed electrohydrodynamics for particle motion, 21938 electrolocation, and self-propulsion}, 21939 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 21940 Patankar}, 21941 journal = {Journal of Computational Physics}, 21942 volume = {256}, 21943 pages = {88--108}, 21944 year = {2014} 21945} 21946 21947@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 21948 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 21949 multiblob approach}, 21950 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 21951 and Boyce E. Griffith and Alexander Donev}, 21952 journal = {Communications in Applied Mathematics and Computational Science}, 21953 volume = {11}, 21954 number = {2}, 21955 pages = {217--296}, 21956 year = {2016} 21957} 21958 21959@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 21960 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 21961 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 21962 P.J. Kahrilas and Neelesh A. Patankar}, 21963 journal = {Journal of Computational Physics}, 21964 volume = {298}, 21965 pages = {446--465}, 21966 year = {2015} 21967} 21968 21969@Article{ balenevelnbhallamaciverpatankar2015, 21970 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 21971 and vertebrates}, 21972 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 21973 A. Patankar}, 21974 journal = {PLoS Biology}, 21975 volume = {13}, 21976 number = {4}, 21977 pages = {1--22}, 21978 year = {2015} 21979} 21980 21981@Article{ balehaobhallapatankar2014, 21982 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 21983 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 21984 journal = {Proceedings of the National Academy of Sciences}, 21985 volume = {111}, 21986 number = {21}, 21987 pages = {7517--7521}, 21988 year = {2014} 21989} 21990 21991@Article{ bhallabalegriffithpatankar2013, 21992 title = {A unified mathematical framework and an adaptive numerical method for 21993 fluid--structure interaction with rigid, deforming, and elastic bodies}, 21994 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 21995 Patankar}, 21996 journal = {Journal of Computational Physics}, 21997 volume = {250}, 21998 pages = {446--476}, 21999 year = {2013}, 22000 publisher = {Elsevier} 22001} 22002 22003@Article{ takeikatz2013, 22004 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 22005 Governing equations and linearized analysis}, 22006 author = {Yasuko Takei and Richard F. Katz}, 22007 journal = {Journal of Fluid Mechanics}, 22008 volume = {734}, 22009 issn = {1469-7645}, 22010 pages = {424--455}, 22011 numpages = {32}, 22012 doi = {10.1017/jfm.2013.482}, 22013 month = nov, 22014 year = {2013} 22015} 22016 22017@Misc{ stewart2011, 22018 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 22019 author = {G. W. Stewart}, 22020 note = {Translated with commentary by G. W. Stewart}, 22021 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 22022 year = {2011} 22023} 22024 22025@Article{ douglisnirenberg1955, 22026 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 22027 author = {Avron Douglis and Louis Nirenberg}, 22028 journal = {Communications on Pure and Applied Mathematics}, 22029 volume = {8}, 22030 pages = {503--538}, 22031 year = {1955} 22032} 22033 22034@Article{ gorelickgalunsharonbasribrandt2006, 22035 title = {Shape Representation and Classification Using the Poisson Equation}, 22036 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 22037 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 22038 volume = {28}, 22039 number = {12}, 22040 pages = {1991--2005}, 22041 year = {2006} 22042} 22043 22044@Article{ salsbury2006, 22045 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 22046 solvation energies}, 22047 author = {Freddie R. Salsbury Jr.}, 22048 journal = {Molecular Physics}, 22049 volume = {104}, 22050 number = {08}, 22051 pages = {1299--1309}, 22052 year = {2006} 22053} 22054 22055@Article{ sigalov2006, 22056 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 22057 approximation}, 22058 author = {G. Sigalov and A. Fenley and A. Onufriev}, 22059 journal = {Journal of Chemical Physics}, 22060 volume = {124}, 22061 number = {124902}, 22062 year = {2006} 22063} 22064 22065@Article{ dennard1974, 22066 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 22067 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 22068 Andre R LeBlanc}, 22069 journal = {IEEE Journal of Solid-State Circuits}, 22070 volume = {9}, 22071 number = {5}, 22072 pages = {256--268}, 22073 year = {1974} 22074} 22075 22076@Article{ zeegeijn2015, 22077 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 22078 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 22079 journal = {ACM Transactions on Mathematical Software}, 22080 volume = {41}, 22081 number = {3}, 22082 pages = {14:1--14:33}, 22083 month = jun, 22084 year = {2015}, 22085 issue_date = {jun}, 22086 doi = {10.1145/2764454} 22087} 22088 22089@Article{ campbell1976, 22090 title = {Assessing the Impact of Planned Social Change}, 22091 author = {Donald T. Campbell}, 22092 journal = {Occasional Paper Series, The Public Affairs Center}, 22093 number = {8}, 22094 publisher = {Dartmouth College}, 22095 year = {1976} 22096} 22097 22098@Article{ smaldinomcelreath2016, 22099 title = {The natural selection of bad science}, 22100 author = {Paul E. Smaldino and Richard McElreath}, 22101 journal = {Royal Society Open Science}, 22102 volume = {3}, 22103 number = {9}, 22104 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 22105 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 22106 doi = {10.1098/rsos.160384}, 22107 year = {2016}, 22108 publisher = {The Royal Society} 22109} 22110 22111@Article{ harlowwelch1965, 22112 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 22113 free surface}, 22114 author = {Francis H Harlow and J Eddie Welch}, 22115 journal = {Physics of fluids}, 22116 volume = {8}, 22117 number = {12}, 22118 pages = {2182--2189}, 22119 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 22120 year = {1965} 22121} 22122 22123@Article{ diskinthomasmineck2005, 22124 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 22125 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 22126 journal = {SIAM Journal on Scientific Computing}, 22127 volume = {27}, 22128 number = {1}, 22129 pages = {108--129}, 22130 doi = {10.1137/030601521}, 22131 issn = {1064-8275}, 22132 year = {2005} 22133} 22134 22135@TechReport{ scott2012, 22136 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 22137 Computer Science}, 22138 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 22139 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 22140 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 22141 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 22142 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 22143 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 22144 Yuen}, 22145 institution = {University of Chicago}, 22146 number = {2012-02}, 22147 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 22148 year = {2012} 22149} 22150 22151@Article{ roth2010, 22152 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 22153 author = {Roland Roth}, 22154 journal = {J. Phys. Cond. Mat.}, 22155 volume = {22}, 22156 pages = {063102}, 22157 year = {2010} 22158} 22159 22160@Article{ wu2008, 22161 title = {Density functional theory for liquid structure and thermodynamics}, 22162 author = {J. Z. Wu}, 22163 journal = {Struct. Bond.}, 22164 doi = {10.1007/430_2008_3}, 22165 year = {2008} 22166} 22167 22168@Article{ goel2008, 22169 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 22170 by {Monte Carlo} simulations and density functional theory}, 22171 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 22172 journal = {J. Chem. Phys.}, 22173 volume = {129}, 22174 pages = {154707}, 22175 year = {2008} 22176} 22177 22178@Article{ marchxiaoyubiros2015, 22179 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 22180 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 22181 journal = {SIAM Journal on Scientific Computing (to appear)}, 22182 year = {2015} 22183} 22184 22185@InProceedings{ yangduraiswamigumerovdavis2003, 22186 title = {Improved fast gauss transform and efficient kernel density estimation}, 22187 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 22188 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 22189 pages = {664--671}, 22190 year = {2003}, 22191 organization = {IEEE} 22192} 22193 22194@Article{ fornberglarssonflyer2011, 22195 title = {Stable computations with Gaussian radial basis functions}, 22196 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 22197 journal = {SIAM Journal on Scientific Computing}, 22198 volume = {33}, 22199 number = {2}, 22200 pages = {869--892}, 22201 year = {2011}, 22202 publisher = {SIAM} 22203} 22204 22205@InProceedings{ srinivasanqiduraiswami2010, 22206 title = {GPUML: Graphical processors for speeding up kernel machines}, 22207 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 22208 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 22209 Implementations, and Applications}, 22210 year = {2010} 22211} 22212 22213@Article{ jadamecbillen2010, 22214 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 22215 a slab edge}, 22216 author = {Margarete A Jadamec and Magali I Billen}, 22217 journal = {Nature}, 22218 volume = {465}, 22219 number = {7296}, 22220 pages = {338--341}, 22221 year = {2010} 22222} 22223 22224@Article{ jadamecbillen2012, 22225 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 22226 numerical models of the Alaska slab edge}, 22227 author = {Margarete A Jadamec and Magali I Billen}, 22228 journal = {Journal of Geophysical Research: Solid Earth}, 22229 volume = {117}, 22230 number = {B2}, 22231 year = {2012} 22232} 22233 22234@Article{ jadamec2015, 22235 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 22236 author = {Margarete A Jadamec}, 22237 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 22238 volume = {211}, 22239 pages = {135}, 22240 year = {2015} 22241} 22242 22243@Article{ durancejadamecfalloonnicholls2012, 22244 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 22245 olivine-hosted melt inclusions and geochemical modelling with insights from 22246 geodynamic models}, 22247 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 22248 journal = {Australian Journal of Earth Sciences}, 22249 volume = {59}, 22250 number = {6}, 22251 pages = {913--931}, 22252 year = {2012} 22253} 22254 22255@Article{ sharplesmoresijadamecrevote2015, 22256 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 22257 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 22258 journal = {Journal of Geophysical Research: Solid Earth}, 22259 volume = {120}, 22260 number = {6}, 22261 pages = {4379--4404}, 22262 year = {2015} 22263} 22264 22265@Article{ hayniejadamec2017, 22266 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 22267 geodynamic models}, 22268 author = {Kirstie L Haynie and Margarete A Jadamec}, 22269 journal = {Tectonics}, 22270 note = {in review}, 22271 year = {2017} 22272} 22273 22274@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 22275 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 22276 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 22277 Lithgow-Bertelloni and Wenbo Xu}, 22278 journal = {Geophysical Journal International}, 22279 volume = {179}, 22280 number = {2}, 22281 pages = {1169--1185}, 22282 year = {2009} 22283} 22284 22285@Article{ zhong2006, 22286 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 22287 plume excess temperature, and upper mantle temperature}, 22288 author = {Shijie Zhong}, 22289 journal = {Journal of Geophysical Research: Solid Earth}, 22290 volume = {111}, 22291 number = {B4}, 22292 year = {2006} 22293} 22294 22295@Article{ billenhirth2007, 22296 title = {Rheologic controls on slab dynamics}, 22297 author = {Magali I Billen and Greg Hirth}, 22298 journal = {Geochemistry, Geophysics, Geosystems}, 22299 volume = {8}, 22300 number = {8}, 22301 year = {2007} 22302} 22303 22304@Article{ hirthkohlstedt2003, 22305 title = {Rheology of the upper mantle and the mantle wedge: A view from the 22306 experimentalists}, 22307 author = {Greg Hirth and David Kohlstedt}, 22308 journal = {Inside the subduction Factory}, 22309 pages = {83--105}, 22310 year = {2003} 22311} 22312 22313@Article{ longsilver2008, 22314 title = {The subduction zone flow field from seismic anisotropy: A global view}, 22315 author = {Maureen D Long and Paul G Silver}, 22316 journal = {science}, 22317 volume = {319}, 22318 number = {5861}, 22319 pages = {315--318}, 22320 year = {2008} 22321} 22322 22323@Article{ karatowu1993, 22324 title = {Rheology of the upper mantle: A synthesis}, 22325 author = {Shun-ichiro Karato and Patrick Wu}, 22326 journal = {Science}, 22327 volume = {260}, 22328 number = {5109}, 22329 pages = {771--778}, 22330 year = {1993} 22331} 22332 22333@Article{ long2013mantle, 22334 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 22335 for wedge processes}, 22336 author = {Long, Maureen D and Wirth, Erin A}, 22337 journal = {Journal of Geophysical Research: Solid Earth}, 22338 volume = {118}, 22339 number = {2}, 22340 pages = {583--606}, 22341 year = {2013}, 22342 publisher = {Wiley Online Library} 22343} 22344 22345@Article{ hoernle2008arc, 22346 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 22347 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 22348 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 22349 Alvarado, Guillermo and Protti, Marino and others}, 22350 journal = {Nature}, 22351 volume = {451}, 22352 number = {7182}, 22353 pages = {1094--1097}, 22354 year = {2008}, 22355 publisher = {Nature Publishing Group} 22356} 22357 22358@Article{ savage1999, 22359 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 22360 splitting?}, 22361 author = {MK Savage}, 22362 journal = {Reviews of Geophysics}, 22363 volume = {37}, 22364 number = {1}, 22365 pages = {65--106}, 22366 year = {1999} 22367} 22368 22369@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 22370 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 22371 of airborne contaminants}, 22372 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 22373 Omar Ghattas and Bart Van Bloemen Waanders}, 22374 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 22375 pages = {43}, 22376 year = {2005}, 22377 organization = {IEEE Computer Society} 22378} 22379 22380@Article{ draganescusoane2013, 22381 title = {Multigrid solution of a distributed optimal control problem constrained by the 22382 {Stokes} equations}, 22383 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 22384 journal = {Applied Mathematics and Computation}, 22385 volume = {219}, 22386 number = {10}, 22387 pages = {5622--5634}, 22388 year = {2013} 22389} 22390 22391@Article{ zhonggurnis1995, 22392 title = {Mantle convection with plates and mobile, faulted plate margins}, 22393 author = {Shijie Zhong and Michael Gurnis}, 22394 journal = {Science}, 22395 volume = {267}, 22396 number = {5199}, 22397 pages = {838}, 22398 year = {1995} 22399} 22400 22401@Article{ studerbobinchahidmousavicandesdahan2012, 22402 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 22403 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 22404 and Emmanuel Candes and Maxime Dahan}, 22405 journal = {Proceedings of the National Academy of Sciences}, 22406 volume = {109}, 22407 number = {26}, 22408 pages = {E1679--E1687}, 22409 year = {2012} 22410} 22411 22412@Article{ borsukhigdonstowreckhow2001, 22413 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 22414 matter loading in estuaries and coastal zones}, 22415 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 22416 journal = {Ecological Modelling}, 22417 volume = {143}, 22418 number = {3}, 22419 pages = {165--181}, 22420 year = {2001} 22421} 22422 22423@Article{ liebermanwillcox2012, 22424 title = {Goal-oriented inference: Approach, linear theory, and application to advection 22425 diffusion}, 22426 author = {Chad Lieberman and Karen Willcox}, 22427 journal = {SIAM Journal on Scientific Computing}, 22428 volume = {34}, 22429 number = {4}, 22430 pages = {A1880--A1904}, 22431 year = {2012} 22432} 22433 22434@Article{ chaillatbiros2012, 22435 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 22436 frequencies and multiple sources for the scalar {Helmholtz} equation}, 22437 author = {St{\'e}phanie Chaillat and George Biros}, 22438 journal = {Journal of Computational Physics}, 22439 volume = {231}, 22440 number = {12}, 22441 pages = {4403--4421}, 22442 year = {2012} 22443} 22444 22445@Article{ farhattezaurdjellouli2002, 22446 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 22447 problems by a regularized {Newton} method}, 22448 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 22449 journal = {Inverse problems}, 22450 volume = {18}, 22451 number = {5}, 22452 pages = {1229}, 22453 year = {2002} 22454} 22455 22456@Article{ orozcoghattas1992, 22457 title = {Massively parallel aerodynamic shape optimization}, 22458 author = {Orozco, Carlos E and Ghattas, ON}, 22459 journal = {Computing Systems in Engineering}, 22460 volume = {3}, 22461 number = {1-4}, 22462 pages = {311--320}, 22463 year = {1992} 22464} 22465 22466@Article{ reutheralonsorimlingerjameson1999, 22467 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 22468 adjoint formulation on distributed memory parallel computers}, 22469 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 22470 journal = {Computers \& fluids}, 22471 volume = {28}, 22472 number = {4}, 22473 pages = {675--700}, 22474 year = {1999} 22475} 22476 22477@Article{ rudistadlerghattas2016, 22478 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 22479 Heterogeneous Viscosity}, 22480 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 22481 journal = {ArXiv e-prints}, 22482 archiveprefix = {arXiv}, 22483 primaryclass = {math.NA}, 22484 eprint = {1607.03936}, 22485 month = jul, 22486 year = {2016} 22487} 22488 22489@Article{ borzikunisch2006, 22490 title = {A globalization strategy for the multigrid solution of elliptic optimal control 22491 problems}, 22492 author = {Borzi, A and Kunisch, K}, 22493 journal = {Optimisation Methods and Software}, 22494 volume = {21}, 22495 number = {3}, 22496 pages = {445--459}, 22497 year = {2006} 22498} 22499 22500@Article{ nash2000, 22501 title = {A multigrid approach to discretized optimization problems}, 22502 author = {Stephen G Nash}, 22503 journal = {Optimization Methods and Software}, 22504 volume = {14}, 22505 number = {1-2}, 22506 pages = {99--116}, 22507 year = {2000} 22508} 22509 22510@Article{ jameson1983, 22511 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 22512 method}, 22513 author = {Antony Jameson}, 22514 journal = {Applied mathematics and computation}, 22515 volume = {13}, 22516 number = {3-4}, 22517 pages = {327--355}, 22518 year = {1983} 22519} 22520 22521@Article{ billen2008, 22522 title = {Modeling the dynamics of subducting slabs}, 22523 author = {Magali I Billen}, 22524 journal = {Annu. Rev. Earth Planet. Sci.}, 22525 volume = {36}, 22526 pages = {325--356}, 22527 year = {2008} 22528} 22529 22530@Article{ gerya2011, 22531 title = {Future directions in subduction modeling}, 22532 author = {Taras Gerya}, 22533 journal = {Journal of Geodynamics}, 22534 volume = {52}, 22535 number = {5}, 22536 pages = {344--378}, 22537 year = {2011} 22538} 22539 22540@Article{ tackley2000, 22541 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 22542 theory}, 22543 author = {Paul J Tackley}, 22544 journal = {Science}, 22545 volume = {288}, 22546 number = {5473}, 22547 pages = {2002--2007}, 22548 year = {2000} 22549} 22550 22551@Article{ caseydewey1984, 22552 title = {Initiation of subduction zones along transform and accreting plate boundaries, 22553 triple-junction evolution, and forearc spreading centres—implications for 22554 ophiolitic geology and obduction}, 22555 author = {JF Casey and JF Dewey}, 22556 journal = {Geological Society, London, Special Publications}, 22557 volume = {13}, 22558 number = {1}, 22559 pages = {269--290}, 22560 year = {1984} 22561} 22562 22563@Article{ doughertyclayton2014, 22564 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 22565 in the {South Cocos} plate}, 22566 author = {Sara L Dougherty and Robert W Clayton}, 22567 journal = {Journal of Geophysical Research: Solid Earth}, 22568 volume = {119}, 22569 number = {4}, 22570 pages = {3424--3447}, 22571 year = {2014} 22572} 22573 22574@Article{ syracusemaceiraprietozhangammon2016, 22575 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 22576 velocity from the joint inversion of seismic and gravity data}, 22577 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 22578 Charles J Ammon}, 22579 journal = {Earth and Planetary Science Letters}, 22580 volume = {444}, 22581 pages = {139--149}, 22582 year = {2016} 22583} 22584 22585@Article{ bowergurnisflament2015, 22586 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 22587 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 22588 journal = {Physics of the Earth and Planetary Interiors}, 22589 volume = {238}, 22590 pages = {8--22}, 22591 year = {2015} 22592} 22593 22594@Book{ ciarlet1976, 22595 title = {Numerical analysis of the finite element method}, 22596 author = {Philippe G Ciarlet}, 22597 volume = {59}, 22598 year = {1976}, 22599 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 22600} 22601 22602@InProceedings{ liumellorcrummey2013, 22603 title = {A data-centric profiler for parallel programs}, 22604 author = {Xu Liu and John Mellor-Crummey}, 22605 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 22606 Storage and Analysis (SC)}, 22607 pages = {1--12}, 22608 year = {2013}, 22609 organization = {IEEE} 22610} 22611 22612@InCollection{ ernstgander2012, 22613 title = {Why it is difficult to solve Helmholtz problems with classical iterative 22614 methods}, 22615 author = {Oliver G Ernst and Martin J Gander}, 22616 booktitle = {Numerical analysis of multiscale problems}, 22617 pages = {325--363}, 22618 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 22619 year = {2012} 22620} 22621 22622@Article{ warburtonkarniadakis1999, 22623 title = {A discontinuous {G}alerkin method for the viscous {MHD} equations}, 22624 author = {Timothy C Warburton and George E Karniadakis}, 22625 journal = {Journal of Computational Physics}, 22626 volume = {152}, 22627 number = {2}, 22628 pages = {608--641}, 22629 year = {1999} 22630} 22631 22632@Article{ salahsoulaimanihabashi2001, 22633 title = {A finite element method for magnetohydrodynamics}, 22634 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 22635 journal = {Computer Methods in Applied Mechanics and Engineering}, 22636 volume = {43}, 22637 number = {190}, 22638 pages = {5867--5892}, 22639 year = {2001} 22640} 22641 22642@Article{ nesliturktezersezgin2005, 22643 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 22644 author = {Ali I Nesliturk and M Tezer-Sezgin}, 22645 journal = {Computer methods in applied mechanics and engineering}, 22646 volume = {194}, 22647 number = {9}, 22648 pages = {1201--1224}, 22649 year = {2005} 22650} 22651 22652@Article{ strakschellart2016, 22653 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 22654 Upwellings: Insights from Analog Models}, 22655 author = {Vincent Strak and Wouter P Schellart}, 22656 journal = {Journal of Geophysical Research: Solid Earth}, 22657 year = {2016} 22658} 22659 22660@InBook{ kirbyloggrognesterrel2012, 22661 title = {Common and unusual finite elements}, 22662 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 22663 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22664 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22665 {FEniCS} Book}, 22666 publisher = {Springer Berlin Heidelberg}, 22667 address = {Berlin, Heidelberg}, 22668 pages = {95--119}, 22669 isbn = {978-3-642-23099-8}, 22670 doi = {10.1007/978-3-642-23099-8_3}, 22671 year = {2012} 22672} 22673 22674@InBook{ kirbymardal2012, 22675 author = {Robert C. Kirby and Kent-Andre Mardal}, 22676 title = {Constructing general reference finite elements}, 22677 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22678 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22679 {FEniCS} Book}, 22680 publisher = {Springer Berlin Heidelberg}, 22681 address = {Berlin, Heidelberg}, 22682 pages = {121--132}, 22683 isbn = {978-3-642-23099-8}, 22684 doi = {10.1007/978-3-642-23099-8_4}, 22685 year = {2012} 22686} 22687 22688@Book{ wriggers2008, 22689 title = {Nonlinear finite element methods}, 22690 author = {Peter Wriggers}, 22691 publisher = {Springer Science \& Business Media}, 22692 year = {2008} 22693} 22694 22695@Book{ zienkiewicztaylor1977, 22696 title = {The finite element method}, 22697 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 22698 publisher = {McGraw-hill London}, 22699 volume = {3}, 22700 year = {1977} 22701} 22702 22703@Article{ rogneskirbylogg2009, 22704 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 22705 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 22706 journal = {SIAM Journal on Scientific Computing}, 22707 volume = {31}, 22708 number = {6}, 22709 pages = {4130--4151}, 22710 year = {2009} 22711} 22712 22713@Book{ kelley03, 22714 title = {Solving nonlinear equations with Newton's method}, 22715 author = {Carl T. Kelley}, 22716 publisher = {SIAM}, 22717 year = {2003} 22718} 22719 22720@Article{ turing1937, 22721 title = {The Chemical Basis of Morphogenesis}, 22722 author = {A. M. Turing}, 22723 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 22724 volume = {237}, 22725 number = {641}, 22726 pages = {37--72}, 22727 doi = {10.1098/rstb.1952.0012}, 22728 issn = {0080-4622}, 22729 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 22730 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 22731 year = {1952} 22732} 22733 22734@Article{ fabienknepleymillsriviere2017, 22735 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 22736 multigrid method}, 22737 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 22738 Rivi\`ere}, 22739 journal = {SIAM Journal on Scientific Computing}, 22740 url = {https://arxiv.org/abs/1705.09907}, 22741 volume = {41}, 22742 number = {2}, 22743 pages = {C73--C96}, 22744 doi = {10.1137/17M1128903}, 22745 year = {2018} 22746} 22747 22748@Article{ fabienknepleyriviere2018, 22749 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 22750 porous media}, 22751 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 22752 journal = {International Journal for Numerical Methods in Engineering}, 22753 volume = {116}, 22754 number = {3}, 22755 pages = {161--177}, 22756 doi = {10.1002/nme.5919}, 22757 year = {2018} 22758} 22759 22760@Article{ fabienknepleyriviere2020, 22761 title = {A high order hybridizable discontinuous Galerkin method for incompressible 22762 miscible displacement in heterogeneous media}, 22763 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22764 journal = {Results in Applied Mathematics}, 22765 url = {https://arxiv.org/abs/1809.00747}, 22766 volume = {8}, 22767 pages = {100089}, 22768 doi = {10.1016/j.rinam.2019.100089}, 22769 year = {2020} 22770} 22771 22772@Article{ fabienknepleyriviere2019b, 22773 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 22774 second order elliptic problems}, 22775 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22776 journal = {Journal of Numerical Mathematics}, 22777 volume = {28}, 22778 number = {3}, 22779 pages = {161--174}, 22780 doi = {10.1515/jnma-2019-0027}, 22781 year = {2019} 22782} 22783 22784@Article{ fabien2019, 22785 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 22786 Elasticity}, 22787 author = {Maurice S. Fabien}, 22788 journal = {Communications in Computational Physics}, 22789 volume = {27}, 22790 number = {2}, 22791 pages = {513--545}, 22792 issn = {1991-7120}, 22793 doi = {10.4208/cicp.OA-2018-0235}, 22794 year = {2019} 22795} 22796 22797@Unpublished{ awanoufabienguzmanstern2020, 22798 title = {Hybridization and postprocessing in finite element exterior calculus}, 22799 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 22800 eprint = {2008.00149}, 22801 note = {preprint}, 22802 primaryclass = {math.NA}, 22803 year = {2020} 22804} 22805 22806@Article{ fabienguzmanneilanzytoon2022, 22807 title = {Low-order divergence-free approximations for the Stokes problem on Worsey--Farin and Powell--Sabin splits}, 22808 author = {Maurice Fabien and Johnny Guzm{\'a}n and Michael Neilan and Ahmed Zytoon}, 22809 journal = {Computer Methods in Applied Mechanics and Engineering}, 22810 volume = {390}, 22811 pages = {114444}, 22812 year = {2022}, 22813} 22814 22815@Article{ chaabanegiraultrivierethompson2018, 22816 title = {A stable enriched {G}alerkin element for the {S}tokes problem}, 22817 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 22818 journal = {Applied Numerical Mathematics}, 22819 volume = {132}, 22820 pages = {1--21}, 22821 issn = {0168-9274}, 22822 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 22823 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 22824 year = {2018} 22825} 22826 22827@Article{ thompsonriviereknepley2018, 22828 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 22829 Resuscitation In The Small Intestine}, 22830 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 22831 journal = {Mathematical Medicine and Biology}, 22832 volume = {36}, 22833 number = {4}, 22834 pages = {513--548}, 22835 doi = {10.1093/imammb/dqz00}, 22836 year = {2019} 22837} 22838 22839@Article{ kevrekidisthompsongoriely2020, 22840 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 22841 Diseases}, 22842 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 22843 journal = {Physics Letters A}, 22844 volume = {384}, 22845 number = {36}, 22846 pages = {126935}, 22847 year = {2020} 22848} 22849 22850@Article{ mardalrognesthompson2021, 22851 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 22852 {Stokes-Biot} Stability Revisited}, 22853 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 22854 journal = {BIT Numerical Mathematics}, 22855 pages = {1--36}, 22856 year = {2021} 22857} 22858 22859@Article{ piersantileethompsonmardalrognes2021, 22860 title = {Parameter robust preconditioning by congruence for multiple-network 22861 poroelasticity}, 22862 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 22863 Rognes, Marie E}, 22864 journal = {SIAM Journal on Scientific Computing}, 22865 volume = {43}, 22866 number = {4}, 22867 pages = {B984--B1007}, 22868 year = {2021}, 22869 publisher = {SIAM} 22870} 22871 22872@Article{ walkerknepleyaagaardwilliams2023, 22873 title = {Multiphysics Modeling in {PyLith}: Poroelasticity}, 22874 author = {Robert L. Walker and Matthew G. Knepley and Brad T. Aagaard and Charles A. Williams}, 22875 journal = {Geophysical Journal International}, 22876 volume = {235}, 22877 number = {3}, 22878 pages = {2442--2475}, 22879 doi = {10.1093/gji/ggad370}, 22880 year = {2023} 22881} 22882 22883@Article{ bhavsar2024influence, 22884 title = {Influence of initial slab dip, inter-plate coupling, and nonlinear rheology on dynamic weakening at the lithosphere-asthenosphere boundary}, 22885 author = {Vivek Bhavsar and Margarete A. Jadamec and Matthew G. Knepley}, 22886 journal = {Journal of Geophysical Research: Solid Earth}, 22887 doi = {10.1029/2023JB028423}, 22888 year = {2024}, 22889} 22890 22891@InProceedings{ actorfuentesriviere2020b, 22892 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 22893 Level Set Equation and Deep Learning for Image Segmentation}, 22894 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22895 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 22896 year = {2020} 22897} 22898 22899@Article{ actorfuentesriviere2020, 22900 title = {Robust Regularized Networks in the Presence of Noise}, 22901 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22902 journal = {Medical Image Analysis}, 22903 note = {In revision}, 22904 year = {2020} 22905} 22906 22907@Book{ byerly1893, 22908 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 22909 ellipsoidal harmonics, with applications to problems in mathematical physics}, 22910 author = {William Elwood Byerly}, 22911 publisher = {Dover}, 22912 year = {1893} 22913} 22914 22915@Book{ hobson1931, 22916 title = {The theory of spherical and ellipsoidal harmonics}, 22917 author = {Ernest William Hobson}, 22918 year = {1931}, 22919 publisher = {CUP Archive} 22920} 22921 22922@Book{ dassios2012, 22923 title = {Ellipsoidal harmonics: theory and applications}, 22924 author = {George Dassios}, 22925 volume = {146}, 22926 year = {2012}, 22927 publisher = {Cambridge University Press} 22928} 22929 22930@Book{ miller1977, 22931 title = {Symmetry and separation of variables}, 22932 author = {Miller, Jr, Willard}, 22933 year = {1977}, 22934 address = {Reading, MA}, 22935 publisher = {Addison-Wesley Publishing Co., Inc.} 22936} 22937 22938@TechReport{ epanet-users-manual, 22939 author = {Lewis A. Rossman}, 22940 title = {{EPANET 2} Users Manual}, 22941 institution = {Water Supply and Water Resources Division, National Risk Management Research 22942 Laboratory, Cincinnati, OH 45268}, 22943 year = {2000} 22944} 22945 22946@Article{ klocknerbarnettgreengardoneil2013, 22947 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 22948 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 22949 O'Neil}, 22950 journal = {Journal of Computational Physics}, 22951 volume = {252}, 22952 pages = {332--349}, 22953 year = {2013} 22954} 22955 22956@Article{ turcksinkronbichlerbangerth2016, 22957 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 22958 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 22959 journal = {ACM Transactions on Mathematical Software)}, 22960 volume = {43}, 22961 number = {1}, 22962 pages = {2}, 22963 year = {2016} 22964} 22965 22966@Article{ vitushkin1954, 22967 title = {On {Hilbert's} thirteenth problem}, 22968 author = {A. G. Vitushkin}, 22969 journal = {Dokl. Akad. Nauk SSSR}, 22970 volume = {95}, 22971 pages = {701--704}, 22972 year = {1954} 22973} 22974 22975@Article{ kolmogorov1957, 22976 title = {On the representation of continuous functions of several variables as 22977 superpositions of continuous functions of one variable and addition}, 22978 author = {Andrei N. Kolmogorov}, 22979 journal = {Dokl. Akad. Nauk SSSR}, 22980 pages = {953--956}, 22981 volume = {114:5}, 22982 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 22983 year = {1957} 22984} 22985 22986@Article{ fridman1967, 22987 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 22988 Theorem}}, 22989 author = {B. L. Fridman}, 22990 journal = {Dokl. Akad. Nauk SSR}, 22991 volume = {177:5}, 22992 pages = {1019--1022}, 22993 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 22994 year = {1967} 22995} 22996 22997@Article{ sprecher1972, 22998 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 22999 author = {David Sprecher}, 23000 journal = {Journal of Mathematical Analysis and Applications}, 23001 volume = {38}, 23002 pages = {208--213}, 23003 year = {1972} 23004} 23005 23006@Article{ diaconisshahshahani1984, 23007 title = {On nonlinear functions of linear combinations}, 23008 author = {Persi Diaconis and Mehrdad Shahshahani}, 23009 journal = {SIAM Journal on Scientific and Statistical Computing}, 23010 volume = {5}, 23011 number = {1}, 23012 pages = {175--191}, 23013 year = {1984}, 23014 publisher = {SIAM} 23015} 23016 23017@InProceedings{ hechtnielsen1987, 23018 title = {Kolmogorov's mapping neural network existence theorem}, 23019 author = {R. Hecht-Nielsen}, 23020 booktitle = {Proceedings of the International Conference on Neural Networks}, 23021 volume = {III}, 23022 pages = {11--14}, 23023 publisher = {IEEE Press}, 23024 year = {1987} 23025} 23026 23027@InProceedings{ hechtnielsen1989, 23028 title = {Theory of the back-propagation neural network}, 23029 author = {R. Hecht-Nielsen}, 23030 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 23031 volume = {I}, 23032 pages = {593--608}, 23033 publisher = {IEEE Press}, 23034 year = {1989} 23035} 23036 23037@Article{ girosipoggio1989, 23038 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 23039 author = {Federico Girosi and Tomaso Poggio}, 23040 journal = {Neural Computation}, 23041 volume = {1}, 23042 number = {4}, 23043 pages = {465--469}, 23044 year = {1989}, 23045 publisher = {MIT Press} 23046} 23047 23048@InBook{ koppen2002, 23049 title = {On the Training of a Kolmogorov Network}, 23050 author = {Mario K\"oppen}, 23051 pages = {474--9}, 23052 publisher = {ICANN 2002, LNCS 2415}, 23053 year = {2002} 23054} 23055 23056@PhDThesis{ bryant2008, 23057 title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in 23058 applications with low and high dimensional data}, 23059 author = {Donald W Bryant}, 23060 school = {University of Central Florida}, 23061 year = {2008} 23062} 23063 23064@InCollection{ griebel2006, 23065 title = {Sparse Grids for Higher Dimensional Problems}, 23066 author = {Michael Griebel}, 23067 booktitle = {Foundations of Computational Mathematics}, 23068 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 23069 publisher = {Cambridge University Press}, 23070 pages = {106--161}, 23071 doi = {10.1017/CBO9780511721571.004}, 23072 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 23073 month = jun, 23074 day = {29}, 23075 year = {2006} 23076} 23077 23078@Article{ braungriebel2009, 23079 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 23080 author = {Jurgen Bra\"un and Michael Griebel}, 23081 journal = {Constructive Approximation}, 23082 pages = {653--675}, 23083 volume = {30}, 23084 year = {2009} 23085} 23086 23087@InProceedings{ lenifougerolletruchetet2009, 23088 title = {Kolmogorov superposition theorem and its application to wavelet image 23089 decompositions}, 23090 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 23091 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 23092 of the SPIE}, 23093 pages = {724804--724804}, 23094 doi = {10.1117/12.805916}, 23095 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 23096 year = {2009} 23097} 23098 23099@Article{ oseledets2011, 23100 title = {Tensor-train decomposition}, 23101 author = {Ivan V Oseledets}, 23102 journal = {SIAM Journal on Scientific Computing}, 23103 volume = {33}, 23104 number = {5}, 23105 pages = {2295--2317}, 23106 year = {2011} 23107} 23108 23109@PhDThesis{ liu2015, 23110 title = {Kolmogorov superposition theorem and its applications}, 23111 author = {Xing Liu}, 23112 school = {Imperial College London}, 23113 year = {2015} 23114} 23115 23116@Article{ lecunbengiohinton2015, 23117 title = {Deep learning}, 23118 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 23119 journal = {Nature}, 23120 volume = {521}, 23121 number = {7553}, 23122 pages = {436--444}, 23123 year = {2015} 23124} 23125 23126@Book{ trefethen2013, 23127 title = {Approximation theory and approximation practice}, 23128 author = {Lloyd N Trefethen}, 23129 publisher = {SIAM}, 23130 year = {2013} 23131} 23132 23133@Article{ butlergrahammattiswalsh2017, 23134 title = {A measure-theoretic interpretation of sample based numerical integration with 23135 applications to inverse and prediction problems under uncertainty}, 23136 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 23137 journal = {SIAM Journal on Scientific Computing}, 23138 volume = {39}, 23139 number = {5}, 23140 pages = {A2072--A2098}, 23141 year = {2017} 23142} 23143 23144@Article{ logg2009, 23145 title = {Efficient representation of computational meshes}, 23146 author = {Anders Logg}, 23147 journal = {International Journal of Computational Science and Engineering}, 23148 volume = {4}, 23149 number = {4}, 23150 pages = {283--295}, 23151 year = {2009} 23152} 23153 23154@Article{ agelekandersonbangerthbarth2017, 23155 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 23156 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 23157 journal = {ACM Transactions on Mathematical Software (TOMS)}, 23158 volume = {44}, 23159 number = {1}, 23160 pages = {5}, 23161 year = {2017} 23162} 23163 23164@Article{ actorknepley2018, 23165 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 23166 Superposition Theorem}}, 23167 author = {Jonas Actor and Matthew G. Knepley}, 23168 eprint = {1712.08286}, 23169 archiveprefix = {arXiv}, 23170 primaryclass = {math.na}, 23171 note = {\url{http://arxiv.org/abs/1712.08286}}, 23172 year = {2018} 23173} 23174 23175@Book{ driscollhaletrefethen2014, 23176 title = {Chebfun guide}, 23177 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 23178 publisher = {Pafnuty Publications, Oxford}, 23179 year = {2014} 23180} 23181 23182@Article{ johntobiska2000, 23183 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 23184 solution of the incompressible Navier-Stokes equations}, 23185 author = {Volker John and Lutz Tobiska}, 23186 journal = {International Journal for Numerical Methods in Fluids}, 23187 volume = {33}, 23188 number = {4}, 23189 pages = {453--473}, 23190 year = {2000} 23191} 23192 23193@Article{ vanka1986, 23194 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 23195 author = {S. P. Vanka}, 23196 journal = {Computer Methods in Applied Mechanics and Engineering}, 23197 volume = {59}, 23198 number = {1}, 23199 pages = {29--48}, 23200 year = {1986} 23201} 23202 23203@Article{ bartelgunther2018, 23204 author = {Andreas Bartel and Michael G\"unther}, 23205 title = {{PDAEs} in refined electrical network modeling}, 23206 journal = {SIAM Review}, 23207 volume = {60}, 23208 number = {1}, 23209 pages = {56--91}, 23210 doi = {10.1137/17M1113643}, 23211 year = {2018} 23212} 23213 23214@Article{ matpower, 23215 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 23216 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 23217 systems research and education}, 23218 journal = {IEEE Transactions on Power Systems}, 23219 volume = {26}, 23220 number = {1}, 23221 pages = {12--19}, 23222 year = {2011}, 23223 doi = {10.1109/TPWRS.2010.2051168} 23224} 23225 23226@Article{ betrieyan2018, 23227 author = {G. Betrie and E. Yan}, 23228 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 23229 Energy and Water Nexus}, 23230 journal = {Applied Energy, Submitted}, 23231 volume = {}, 23232 number = {}, 23233 pages = {}, 23234 doi = {}, 23235 year = {2018} 23236} 23237 23238@Article{ faeth2012, 23239 author = {P. Faeth}, 23240 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 23241 journal = {Environment: Science and Policy for Sustainable Development}, 23242 volume = {54(1)}, 23243 number = {1}, 23244 pages = {4--19}, 23245 year = {2012}, 23246 doi = {10.1080/00139157.2012.639595} 23247} 23248 23249@InProceedings{ hagberg2008, 23250 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 23251 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 23252 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 23253 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 23254 year = {2008}, 23255 pages = {11--15} 23256} 23257 23258@Misc{ simulink-web-page, 23259 author = {Mathworks}, 23260 title = {{SIMULINK} web page}, 23261 note = {\url{https://www.mathworks.com/products/simulink.html}}, 23262 year = {2017} 23263} 23264 23265@Misc{ labview-web-page, 23266 author = {National Instruments}, 23267 title = {{LabVIEW} web page}, 23268 note = {\url{http://www.ni.com/labview/}}, 23269 key = {labview}, 23270 year = {2017} 23271} 23272 23273@Misc{ modelica-web-page, 23274 author = {Modelica Association}, 23275 title = {Modelica web page}, 23276 note = {\url{https://www.modelica.org/}}, 23277 year = {2017} 23278} 23279 23280@InProceedings{ yangsc16, 23281 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 23282 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 23283 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 23284 Computing, Networking, Storage and Analysis}, 23285 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 23286 Dynamics}, 23287 note = {Gordon Bell Award}, 23288 year = {2016} 23289} 23290 23291@InProceedings{ bekassc15, 23292 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 23293 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 23294 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 23295 Computing, Networking, Storage and Analysis}, 23296 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 23297 Earth's Mantle}, 23298 note = {Gordon Bell Award}, 23299 year = {2015} 23300} 23301 23302@Misc{ improving-software-whitepaper2017, 23303 author = {M. Heroux and L.C. McInnes}, 23304 title = {Improving and accelerating scientific discovery through better software}, 23305 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 23306 doi = {10.6084/m9.figshare.5339692}, 23307 year = {2017} 23308} 23309 23310@Misc{ doe:40thanniversarycollection, 23311 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 23312 changed the face of science}, 23313 key = {Department of Energy, Office of Science}, 23314 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 23315 year = {2017} 23316} 23317 23318@Misc{ siam:fellowsprogram, 23319 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 23320 key = {SIAM}, 23321 howpublished = {\url{http://www.siam.org/prizes/fellows}} 23322} 23323 23324@Misc{ r-and-d100:awards2009, 23325 title = {{R\&D100 Award Winners 2009}}, 23326 key = {{R\&D100 Award Winners 2009}}, 23327 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 23328} 23329 23330@Misc{ xsdk:website, 23331 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 23332 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 23333 howpublished = {\url{https://xsdk.info}} 23334} 23335 23336@Misc{ xsdk-community-installation-policies2017, 23337 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 23338 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 23339 note = {version 0.3, November 7, 2017}, 23340 doi = {10.6084/m9.figshare.4495133}, 23341 year = {2017} 23342} 23343 23344@Misc{ xsdk-community-package-policies2017, 23345 title = {{xSDK} Community Package Policies}, 23346 author = {B. Smith and R. Bartlett and {xSDK developers}}, 23347 note = {version 0.3, November 7, 2017}, 23348 doi = {10.6084/m9.figshare.4495136}, 23349 year = {2017} 23350} 23351 23352@Misc{ ideas-what-are-interoperable-libraries, 23353 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 23354 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 23355 Ulrike Yang and {all xSDK developers}}, 23356 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 23357 \url{https://ideas-productivity.org/resources/howtos/}}, 23358 year = {2016} 23359} 23360 23361@Misc{ ideas-productivity:website, 23362 title = {{IDEAS Scientific Software Productivity Project}}, 23363 key = {IDEAS Scientific Software Productivity Project}, 23364 howpublished = {\url{https://ideas-productivity.org}} 23365} 23366 23367@Misc{ ecp:website, 23368 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 23369 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 23370 note = {\url{https://exascaleproject.org}}, 23371 year = {2018} 23372} 23373 23374@Misc{ siam-cse-jan2018, 23375 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 23376 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 23377 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 23378 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 23379 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 23380 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 23381 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 23382 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 23383 title = {Research and Education in Computational Science and Engineering}, 23384 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 23385 Review}}, 23386 year = {2018} 23387} 23388 23389@Misc{ doe-appliedmathpimeeting2017, 23390 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 23391 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 23392 Willcox and Steven Lee}, 23393 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 23394 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 23395 year = {2017} 23396} 23397 23398@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 23399 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 23400 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 23401 Sciences}}, 23402 note = {available via 23403 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 23404 year = {2015} 23405} 23406 23407@Misc{ sisc-specialissueintro, 23408 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 23409 Software'} and {'Big Data in CSE'}}, 23410 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 23411 month = nov, 23412 year = {2016}, 23413 journal = {SIAM J. Sci. Comput.}, 23414 doi = {10.1137/16N974188} 23415} 23416 23417@Article{ xsdk-foundations2017, 23418 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 23419 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 23420 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 23421 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 23422 journal = {Supercomputing Frontiers and Innovations}, 23423 month = feb, 23424 year = {2017}, 23425 note = {available via \url{https://arxiv.org/abs/1702.08425}} 23426} 23427 23428@Misc{ openfoam:website, 23429 title = {{OpenFOAM}}, 23430 author = {OpenFOAM Team}, 23431 key = {OpenFOAM}, 23432 howpublished = {\url{https://openfoam.com}} 23433} 23434 23435@Misc{ mfem:website, 23436 title = {{MFEM}}, 23437 author = {Tzanio Kolev and MFEM Team}, 23438 key = {MFEM}, 23439 howpublished = {\url{https://mfem.org}} 23440} 23441 23442@Misc{ deal.ii:website, 23443 title = {{{deal.II}: An open-source finite element library}}, 23444 author = {Wolfgang Bangerth and Deal.II Team}, 23445 howpublished = {\url{http://www.dealii.org}}, 23446 year = {2018} 23447} 23448 23449@Misc{ ibamr:website, 23450 title = {{{IBAMR}: Immersed Boundary Method Adaptive Mesh Refinement Software Infrastructure}}, 23451 author = {Boyce Griffith and IBAMR Team}, 23452 howpublished = {\url{https://ibamr.github.io/}}, 23453 year = {2023} 23454} 23455 23456@Misc{ fission-gas-scidac:website, 23457 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 23458 author = {A. David {Andersson (PI)}}, 23459 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 23460 year = {2018} 23461} 23462 23463@Misc{ tokamak-disruption-scidac:project, 23464 title = {{Tokamak Disruption Simulation}}, 23465 author = {Xianzhu {Tang (PI)}}, 23466 howpublished = {SciDAC project}, 23467 year = {2018} 23468} 23469 23470@InProceedings{ duplyakin2018memory, 23471 title = {Evaluating Active Learning with Cost and Memory Awareness}, 23472 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 23473 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 23474 pages = {214--223}, 23475 year = {2018}, 23476 organization = {IEEE}, 23477 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 23478} 23479 23480@InProceedings{ duplyakin2016active, 23481 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 23482 title = {Active Learning in Performance Analysis}, 23483 booktitle = {Proceedings of the IEEE Cluster Conference}, 23484 year = {2016}, 23485 month = sep, 23486 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 23487 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 23488} 23489 23490@Misc{ xgc1:website, 23491 title = {{XGC1 project website}}, 23492 author = {C. S. Chang and others}, 23493 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 23494 year = {2018} 23495} 23496 23497@Misc{ wdmapp-bhattacharjee-ecp:website, 23498 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 23499 Plasmas}}, 23500 author = {A. Bhattacharjee and others}, 23501 note = {ECP application project}, 23502 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 23503 year = {2018} 23504} 23505 23506@Misc{ subsurface-steefel-ecp:website, 23507 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 23508 and Mechanics}}, 23509 note = {ECP application project}, 23510 author = {C. Steefel and others}, 23511 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 23512 year = {2018} 23513} 23514 23515@Article{ chombo-crunch:2014, 23516 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 23517 with Carbon Sequestration}, 23518 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 23519 journal = {Computing in Science and Engineering}, 23520 volume = {16}, 23521 issue = {6}, 23522 year = {2014}, 23523 pages = {22--31}, 23524 doi = {10.1109/MCSE.2014.77} 23525} 23526 23527@Article{ courantfriedrichslewy1967, 23528 title = {On the partial difference equations of mathematical physics}, 23529 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 23530 journal = {IBM journal of Research and Development}, 23531 volume = {11}, 23532 number = {2}, 23533 pages = {215--234}, 23534 year = {1967}, 23535 publisher = {IBM} 23536} 23537 23538@Article{ erway2017solving, 23539 title = {On solving large-scale limited-memory quasi-Newton equations}, 23540 author = {Erway, Jennifer B and Marcia, Roummel F}, 23541 journal = {Linear Algebra and its Applications}, 23542 volume = {515}, 23543 pages = {196--225}, 23544 year = {2017}, 23545 publisher = {Elsevier} 23546} 23547 23548@Article{ griewank2012broyden, 23549 title = {Broyden updating, the good and the bad!}, 23550 author = {Griewank, Andreas}, 23551 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 23552 pages = {301--315}, 23553 year = {2012} 23554} 23555 23556@Book{ tarantola2005, 23557 title = {Inverse problem theory and methods for model parameter estimation}, 23558 author = {Albert Tarantola}, 23559 volume = {89}, 23560 year = {2005}, 23561 publisher = {SIAM} 23562} 23563 23564@Article{ rutkaikristof2010, 23565 title = {Dynamic Monte Carlo simulation in mixtures}, 23566 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 23567 journal = {The Journal of Chemical Physics}, 23568 volume = {132}, 23569 number = {10}, 23570 pages = {104107}, 23571 year = {2010}, 23572 publisher = {AIP} 23573} 23574 23575@Book{ vogel2002, 23576 title = {Computational methods for inverse problems}, 23577 author = {Curtis R Vogel}, 23578 volume = {23}, 23579 year = {2002}, 23580 publisher = {SIAM} 23581} 23582 23583@Article{ malqvistpeterseim2014, 23584 title = {Localization of elliptic multiscale problems}, 23585 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 23586 journal = {Mathematics of Computation}, 23587 volume = {83}, 23588 number = {290}, 23589 pages = {2583--2603}, 23590 year = {2014} 23591} 23592 23593@Article{ brandtbrannickkahllivshits2011, 23594 title = {Bootstrap {AMG}}, 23595 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 23596 journal = {SIAM Journal on Scientific Computing}, 23597 volume = {33}, 23598 number = {2}, 23599 pages = {612--632}, 23600 year = {2011} 23601} 23602 23603@InProceedings{ barralalauzet2014, 23604 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 23605 moving mesh strategy}, 23606 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 23607 booktitle = {44th AIAA Fluid Dynamics Conference}, 23608 pages = {2773}, 23609 year = {2014} 23610} 23611 23612@InProceedings{ barralalauzetloseille2015, 23613 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 23614 problems involving moving geometries}, 23615 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 23616 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 23617 pages = {2039}, 23618 year = {2015} 23619} 23620 23621@Article{ barralolivieralauzet2017, 23622 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 23623 problems with body-fitted moving geometries}, 23624 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 23625 journal = {Journal of Computational Physics}, 23626 volume = {331}, 23627 pages = {157--187}, 23628 year = {2017} 23629} 23630 23631@Article{ ibanezbarralkrakosloseillemichalpark2017, 23632 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 23633 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 23634 Michal and Mike Park}, 23635 journal = {Procedia engineering}, 23636 volume = {203}, 23637 pages = {154--166}, 23638 year = {2017} 23639} 23640 23641@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 23642 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 23643 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 23644 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 23645 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 23646 pages = {1103}, 23647 year = {2018} 23648} 23649 23650@InProceedings{ barralangeloudiskramergormanpiggott2018, 23651 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 23652 modelling}, 23653 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 23654 and Matthew D Piggott}, 23655 booktitle = {EGU General Assembly Conference Abstracts}, 23656 volume = {20}, 23657 pages = {19168}, 23658 year = {2018} 23659} 23660 23661@Article{ principe2009, 23662 title = {{Mathematical models for thermally coupled low speed flows}}, 23663 author = {Javier Principe and Ramon Codina}, 23664 journal = {Advances in Theoretical and Applied Mechanics}, 23665 volume = {2}, 23666 number = {1-4}, 23667 pages = {93--112}, 23668 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 23669 year = {2009} 23670} 23671 23672@Book{ vandervorst2003, 23673 title = {Iterative {K}rylov Methods for Large Linear Systems}, 23674 author = {van der Vorst, H.}, 23675 isbn = {9780521818285}, 23676 publisher = {Cambridge University Press}, 23677 year = {2003} 23678} 23679 23680@Book{ peres2006, 23681 author = {Asher Peres}, 23682 title = {Quantum theory: concepts and methods}, 23683 volume = {57}, 23684 publisher = {Springer Science \& Business Media}, 23685 year = {2006} 23686} 23687 23688@Book{ kuttler2012, 23689 title = {Linear algebra: theory and applications}, 23690 author = {Kenneth Kuttler}, 23691 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 23692 year = {2012} 23693} 23694 23695@Book{ elman_silvester_wathen_2014, 23696 place = {Oxford}, 23697 title = {Finite elements and fast iterative solvers: with applications in incompressible 23698 fluid dynamics}, 23699 publisher = {Oxford University Press}, 23700 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 23701 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 23702 year = {2014} 23703} 23704 23705@Article{ alametal2007, 23706 title = {An evaluation of the ORNL Cray XT3}, 23707 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 23708 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 23709 journal = {International Journal of High Performance Computing Applications}, 23710 volume = {22}, 23711 number = {1}, 23712 pages = {52--80}, 23713 doi = {10.1177/1094342007085019}, 23714 year = {2007} 23715} 23716 23717@Article{ plazacarey2000, 23718 title = {Local refinement of simplicial grids based on the skeleton}, 23719 author = {Plaza, A. and Carey, Graham F.}, 23720 journal = {Applied Numerical Mathematics}, 23721 doi = {10.1016/S0168-9274(99)00022-7}, 23722 issn = {01689274}, 23723 volume = {32}, 23724 number = {2}, 23725 pages = {195--218}, 23726 year = {2000} 23727} 23728 23729@Article{ carsonstrakos2020, 23730 title = {On the cost of iterative computations}, 23731 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 23732 journal = {Phil. Trans. R. Soc. A}, 23733 volume = {378}, 23734 number = {20190050}, 23735 doi = {10.1098/rsta.2019.0050}, 23736 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 23737 year = {2020} 23738} 23739 23740@Article{ schoberl1999, 23741 title = {Multigrid methods for a parameter dependent problem in primal variables}, 23742 author = {Joachim Sch{\"o}berl}, 23743 journal = {Numerische Mathematik}, 23744 volume = {84}, 23745 number = {1}, 23746 pages = {97--119}, 23747 year = {1999} 23748} 23749 23750@Article{ wuleexuzikatanov2008, 23751 title = {Convergence analysis on iterative methods for semidefinite systems}, 23752 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 23753 journal = {Journal of Computational Mathematics}, 23754 pages = {797--815}, 23755 year = {2008} 23756} 23757 23758@Article{ maierrannacher2016, 23759 title = {Duality-based adaptivity in finite element discretization of heterogeneous 23760 multiscale problems}, 23761 author = {Maier, Matthias and Rannacher, Rolf}, 23762 journal = {Journal of Numerical Mathematics}, 23763 volume = {24}, 23764 number = {3}, 23765 pages = {167--187}, 23766 year = {2016} 23767} 23768 23769@Article{ maierrannacher2018, 23770 title = {A duality-based optimization approach for model adaptivity in heterogeneous 23771 multiscale problems}, 23772 author = {Maier, Matthias and Rannacher, Rolf}, 23773 journal = {Multiscale Modeling \& Simulation}, 23774 volume = {16}, 23775 number = {1}, 23776 pages = {412--428}, 23777 year = {2018} 23778} 23779 23780@Article{ margetismaierluskin2017, 23781 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 23782 metamaterial sheet}, 23783 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 23784 journal = {Studies in Applied Mathematics}, 23785 volume = {139}, 23786 number = {4}, 23787 pages = {599--625}, 23788 year = {2017} 23789} 23790 23791@Article{ maiermargetisluskin2017b, 23792 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 23793 approximation and validation}, 23794 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 23795 journal = {Journal of Computational Physics}, 23796 volume = {339}, 23797 pages = {126--145}, 23798 year = {2017} 23799} 23800 23801@Article{ maiermargetisluskin2018, 23802 title = {Generation of surface plasmon-polaritons by edge effects}, 23803 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 23804 journal = {Communications in Mathematical Sciences}, 23805 volume = {16}, 23806 number = {1}, 23807 pages = {77--95}, 23808 url = {http://arxiv.org/abs/1702.00848}, 23809 year = {2018} 23810} 23811 23812@Article{ maiermattheakiskaxirasluskinmargetis2018, 23813 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 23814 metamaterials}, 23815 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23816 Mitchell and Margetis, Dionisios}, 23817 journal = {Physical Review B}, 23818 volume = {97}, 23819 number = {3}, 23820 pages = {035307}, 23821 year = {2018} 23822} 23823 23824@Article{ maiermattheakiskaxirasluskinmargetis2019, 23825 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 23826 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23827 Mitchell and Margetis, Dionisios}, 23828 journal = {Proceedings of the Royal Society A}, 23829 volume = {475}, 23830 number = {2230}, 23831 pages = {20190220}, 23832 year = {2019} 23833} 23834 23835@Article{ maiermargetisluskin2020, 23836 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 23837 two scales}, 23838 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 23839 journal = {Physical Review B}, 23840 volume = {102}, 23841 number = {7}, 23842 pages = {075308}, 23843 year = {2020} 23844} 23845 23846@Article{ margetismaierstauberlowluskin2020, 23847 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 23848 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 23849 Luskin, Mitchell}, 23850 journal = {Journal of Physics A: Mathematical and Theoretical}, 23851 volume = {53}, 23852 number = {5}, 23853 pages = {055201}, 23854 year = {2020} 23855} 23856 23857@Article{ maiermargetismellet2020, 23858 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 23859 structures}, 23860 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 23861 journal = {Journal of Computational and Applied Mathematics}, 23862 volume = {377}, 23863 pages = {112909}, 23864 year = {2020} 23865} 23866 23867@Article{ maierkronbichler2021, 23868 title = {Efficient parallel 3D computation of the compressible Euler equations with an 23869 invariant-domain preserving second-order finite-element scheme}, 23870 author = {Maier, Matthias and Kronbichler, Martin}, 23871 journal = {ACM Transactions on Parallel Computing}, 23872 volume = {8}, 23873 number = {3}, 23874 pages = {1--30}, 23875 year = {2021} 23876} 23877 23878@Article{ guermondmaierpopovtomas2021, 23879 title = {Second-order invariant domain preserving approximation of the compressible 23880 Navier--Stokes equations}, 23881 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 23882 journal = {Computer Methods in Applied Mechanics and Engineering}, 23883 volume = {375}, 23884 pages = {113608}, 23885 year = {2021} 23886} 23887 23888@Article{ liliptonmaier2021, 23889 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 23890 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 23891 eprint = {2009.12166}, 23892 archiveprefix = {arXiv}, 23893 primaryclass = {phys.optics}, 23894 year = {2021} 23895} 23896 23897@Article{ songmaierluskin2020, 23898 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 23899 gradient-index graphene waveguides}, 23900 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23901 journal = {Journal of Computational Physics}, 23902 volume = {423}, 23903 pages = {109871}, 23904 year = {2020} 23905} 23906 23907@Article{ songmaierluskin2019, 23908 title = {Adaptive finite element simulations of waveguide configurations involving 23909 parallel 2D material sheets}, 23910 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23911 journal = {Computer Methods in Applied Mechanics and Engineering}, 23912 volume = {351}, 23913 pages = {20--34}, 23914 year = {2019} 23915} 23916 23917% 23918% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 23919% 23920% 23921@Unpublished{ rob1, 23922 author = {Rob Kunz}, 23923 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 23924 State University}, 23925 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 23926 sponsors = {U.S. Navy, NRC}, 23927 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 23928 simulations, including lake warming by power plants}, 23929 dates = {Oct 3 and 4, 2002}, 23930 email = {rfk@wt.arl.psu.edu} 23931} 23932 23933@Unpublished{ au1, 23934 author = {Feng Wang and William Appelbe}, 23935 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 23936 url = {http://www.vpac.org}, 23937 sponsors = { }, 23938 note = {Using PETSc for a Variety of Geophysical Simulations}, 23939 dates = {Nov 22, 2002} 23940} 23941 23942@Unpublished{ carl1, 23943 author = {Carl Sovinec}, 23944 institution = {Applied Physics, University of Wisconsin}, 23945 url = {http://nimrodteam.org}, 23946 sponsors = {DOE Office of Fusion Research}, 23947 note = {Investigating using PETSc for NIMROD}, 23948 dates = {Nov 21, 2002}, 23949 email = {sovinec@engr.wisc.edu} 23950} 23951 23952@Unpublished{ au1b, 23953 author = {Pablo Carrica and Robert Wilson}, 23954 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 23955 url = {http://}, 23956 sponsors = {Office of Naval Research}, 23957 note = {Using PETSc for a hydrodynamics of ships and submarines}, 23958 dates = {Sept, 2002}, 23959 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 23960} 23961 23962% ------------------- TAO References ---------------------- 23963@Article{ benson:2001:csp, 23964 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 23965 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 23966 journal = {{ACM} Transactions on Mathematical Software}, 23967 volume = {27}, 23968 number = {3}, 23969 month = sep, 23970 year = {2001}, 23971 pages = {361--376} 23972} 23973 23974@TechReport{ tao-user-ref-2000, 23975 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 23976 title = {{TAO} Users Manual}, 23977 year = {2000}, 23978 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23979 number = {ANL/MCS-TM-242}, 23980 note = {See \url{http://www.mcs.anl.gov/tao}} 23981} 23982 23983% ------------------- Optimization References ---------------------- 23984@Book{ optguide93, 23985 title = {Optimization Software Guide}, 23986 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 23987 publisher = {SIAM Publications}, 23988 address = {Philadelphia}, 23989 year = {1993} 23990} 23991 23992@InProceedings{ more84, 23993 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 23994 Hillstrom}, 23995 title = {The {MINPACK} Project}, 23996 booktitle = {Sources and Development of Mathematical Software}, 23997 editor = {Wayne R. Cowell}, 23998 year = {1984}, 23999 pages = {88--111} 24000} 24001 24002@Article{ steihaug:83, 24003 author = {Trond Steihaug}, 24004 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 24005 journal = {SIAM J. Numer. Anal.}, 24006 volume = {20}, 24007 year = {1983}, 24008 pages = {626--637}, 24009 key = {steihaug92 ! trust_region} 24010} 24011 24012@TechReport{ minpack2test, 24013 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 24014 title = {The {MINPACK-2} Test Problem Collection}, 24015 institution = {Argonne National Laboratory}, 24016 year = {1991}, 24017 number = {ANL/MCS-TM-150}, 24018 key = {more91 ! MINPACK-2} 24019} 24020 24021@TechReport{ hohmann:94, 24022 author = {Andreas Hohmann}, 24023 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 24024 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 24025 year = {1994}, 24026 number = {SC-94-4}, 24027 key = {Hohmann94} 24028} 24029 24030@TechReport{ meza:94, 24031 author = {Juan C. Meza}, 24032 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 24033 institution = {Sandia National Laboratory}, 24034 year = {1994}, 24035 number = {SAND94-8225}, 24036 key = {Meza94} 24037} 24038 24039@Book{ dennis:83, 24040 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 24041 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 24042 publisher = {Prentice-Hall, Inc.}, 24043 address = {Englewood Cliffs, NJ}, 24044 year = {1983} 24045} 24046 24047@TechReport{ more:92, 24048 author = {Jorge J. Mor\'{e} and David Thuente}, 24049 title = {Line search algorithms with guaranteed sufficient decrease}, 24050 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 24051 year = {1992}, 24052 number = {MCS-P330-1092} 24053} 24054 24055@Article{ more-toraldo, 24056 author = {Jorge J. Mor\'e and G. Toraldo}, 24057 journal = {SIOPT}, 24058 pages = {93--113}, 24059 title = {On the solution of large quadratic programming problems with bound constraints}, 24060 volume = {1}, 24061 year = {1991} 24062} 24063 24064@Article{ byrd:1995:lma, 24065 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 24066 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 24067 journal = {SIAM Journal on Scientific Computing}, 24068 volume = {16}, 24069 number = {5}, 24070 pages = {1190--1208}, 24071 month = sep, 24072 year = {1995}, 24073 coden = {SJOCE3}, 24074 issn = {1064-8275 (print), 1095-7197 (electronic)}, 24075 mrclass = {90C30 (65K05)}, 24076 mrnumber = {96e:90039}, 24077 mrreviewer = {Henry Wolkowicz}, 24078 bibdate = {Fri Dec 4 16:17:35 MST 1998} 24079} 24080 24081@Article{ lin_c3, 24082 author = {C.-J. Lin and J. J. Mor\'e}, 24083 title = {Newton's method for large bound-constrained optimization problems}, 24084 year = {1999}, 24085 journal = {SIOPT}, 24086 volume = {9(4)}, 24087 pages = {1100--1127}, 24088 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 24089} 24090 24091@TechReport{ dolan2, 24092 author = {E. Dolan and J. J. Mor\'{e}}, 24093 title = {Benchmarking Optimization Software with Performance Profiles}, 24094 year = {2001}, 24095 month = jan, 24096 number = {ANL/MCS-P861-1200}, 24097 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 24098 address = {Argonne, IL}, 24099 url = {http://www.mcs.anl.gov/~more/cops/} 24100} 24101 24102@InProceedings{ owlqn, 24103 author = {Galen Andrew and Jianfeng Gao}, 24104 title = {Scalable training of L1-regularized log-linear models}, 24105 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 24106 pages = {33--40}, 24107 year = {2007} 24108} 24109 24110@Article{ bmrm, 24111 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 24112 title = {Bundle methods for regularized risk minimization}, 24113 year = {2010}, 24114 journal = {Journal of Machine Learning Research}, 24115 volume = {11}, 24116 pages = {311--365} 24117} 24118 24119% ------------------- Component Software References ---------------------- 24120@InProceedings{ cca99, 24121 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 24122 McInnes and S. Parker and B. Smolinski}, 24123 title = {Toward a Common Component Architecture for High-Performance Scientific 24124 Computing}, 24125 booktitle = {Proceedings of {High Performance Distributed Computing}}, 24126 pages = {115--124}, 24127 year = {1999}, 24128 note = {See \url{http://cca-forum.org}} 24129} 24130 24131@Book{ szyperski98, 24132 author = {Clemens Szyperski}, 24133 title = {Component Software: Beyond Object-Oriented Programming}, 24134 publisher = {ACM Press}, 24135 address = {New York}, 24136 year = {1998} 24137} 24138 24139@Article{ broy98, 24140 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 24141 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 24142 Stal and Clemens Szyperski}, 24143 title = {What Characterizes a (Software) Component?}, 24144 journal = {Software -- Concepts and Tools}, 24145 publisher = {Springer-Verlag}, 24146 year = {1998}, 24147 volume = {19}, 24148 pages = {49--56} 24149} 24150 24151@Article{ componentware:94, 24152 author = {Jon Udell}, 24153 title = {Componentware}, 24154 journal = {Byte}, 24155 volume = {may}, 24156 pages = {46--56}, 24157 year = {1994}, 24158 key = {Udell94 ! componentware} 24159} 24160 24161@Misc{ cca-web-page, 24162 author = {{Common Component Architecture Forum}}, 24163 note = {See \url{http://cca-forum.org}} 24164} 24165 24166% --------------- References for Tools Used by TAO Developers ----------------- 24167 24168% 24169% tohtml: Used to generate on-line TAO users manual and manual pages 24170% 24171@TechReport{ tohtml, 24172 author = {William Gropp}, 24173 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 24174 institution = {Argonne National Laboratory}, 24175 number = {ANL/MCS-TM-00}, 24176 month = jan, 24177 year = {1995}, 24178 key = {tohtml} 24179} 24180 24181% 24182% doctext: Used to generate tex version of TAO manual pages 24183% 24184@TechReport{ doctext, 24185 author = {William Gropp}, 24186 title = {Users Manual for doctext: Producing documentation from {C} source code}, 24187 institution = {Argonne National Laboratory}, 24188 number = {ANL/MCS-TM-00}, 24189 month = jan, 24190 year = {1995}, 24191 key = {doctext} 24192} 24193 24194% ------------------------- PETSc References ------------------------------ 24195@InProceedings{ petsc, 24196 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 24197 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 24198 Libraries}, 24199 booktitle = {Modern Software Tools in Scientific Computing}, 24200 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 24201 publisher = {Birkhauser Press}, 24202 pages = {163--202}, 24203 year = {1997} 24204} 24205 24206% ------------------------- Misc Other References ------------------------------ 24207@Misc{ indeps-web-page, 24208 title = {{InDEPS} {W}eb page}, 24209 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 24210 author = {et al. Robert Armstrong}, 24211 institution = {Sandia National Laboratory}, 24212 key = {{InDEPS} {W}eb page} 24213} 24214 24215@Misc{ pooma, 24216 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 24217 chitectures}, 24218 year = {1996}, 24219 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 24220 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 24221} 24222 24223@Misc{ isis++-web-page, 24224 title = {{ISIS++} {W}eb Page}, 24225 note = {See \url{http://ca.sandia.gov/isis}}, 24226 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 24227 institution = {Sandia National Laboratories} 24228} 24229 24230@Misc{ trilinos-web-page, 24231 title = {{Trilinos} {W}eb Page}, 24232 note = {See 24233 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 24234 author = {Mike Heroux et al.}, 24235 institution = {Sandia National Laboratories} 24236} 24237 24238@Misc{ alice-web-page, 24239 title = {{ALICE} {W}eb page}, 24240 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 24241 Argonne National Laboratory}, 24242 key = {{ALICE} {W}eb page} 24243} 24244 24245@Misc{ autodiff-webpage, 24246 author = {{Computational Differentiation Project}}, 24247 note = {See \url{http://www.mcs.anl.gov/autodiff}} 24248} 24249 24250@Misc{ coool-home-page, 24251 author = {Lydia Deng and Wences Gouveia and John Scales}, 24252 title = {{The CWP Object-Oriented Optimization Library}}, 24253 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 24254} 24255 24256@Misc{ rice-inversion-home-page, 24257 author = {Mark S. Gokenbach and William W. Symes}, 24258 title = {{The Hilbert Class Library}}, 24259 note = {See \url{http://www.trip.caam.rice.edu/}} 24260} 24261 24262@Misc{ opt++-home-page, 24263 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 24264 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 24265} 24266 24267@Article{ gockenbach:1999:ccl, 24268 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 24269 title = {C++ Classes for Linking Optimization with Complex Simulations}, 24270 journal = {{ACM} Transactions on Mathematical Software}, 24271 volume = {25}, 24272 number = {2}, 24273 month = jun, 24274 year = {1999}, 24275 pages = {191-212}, 24276 abstract = {The object-oriented programming paradigm can be used to overcome the 24277 incompatibilities between off-the-shelf optimization software and application 24278 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 24279 objects arising in optimization problems, such as vectors, linear operators, and 24280 so forth, as C++ classes, making it possible to write optimization code in a 24281 natural fashion, while allowing application software such as simulators to use the 24282 most convenient data structures and programming style. In spite of the poor 24283 reputation C++ has for runtime performance, the use of mixed-language programming 24284 allows performance equal to that achieved by standard Fortran packages, as 24285 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 24286 accepted = {April 1999}, 24287 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 24288} 24289 24290@Misc{ neos-guide, 24291 author = {{The Optimization Software Guide}}, 24292 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 24293} 24294 24295@Article{ boyd, 24296 title = {Distributed optimization and statistical learning via the alternating direction 24297 method of multipliers}, 24298 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 24299 Jonathan and others}, 24300 journal = {Foundations and Trends{\textregistered} in Machine learning}, 24301 volume = {3}, 24302 number = {1}, 24303 pages = {1-122}, 24304 year = {2011}, 24305 publisher = {Now Publishers, Inc.} 24306} 24307 24308@Misc{ :alertsys, 24309 title = {page{ALERT}}, 24310 organization = {Alert Systems, Inc}, 24311 address = {Madison, Wisconsin}, 24312 note = {http://www.alertsys.com/} 24313} 24314 24315@Manual{ :cmfortran, 24316 title = {{CM} {F}ortran Language Reference Manual}, 24317 organization = {Thinking Machines Corporation}, 24318 year = {1994}, 24319 address = {Cambridge, MA} 24320} 24321 24322@Manual{ :cmmd, 24323 title = {{CMMD} Reference Manual, Version 3.0}, 24324 organization = {Thinking Machines Corporation}, 24325 year = {1993}, 24326 address = {Cambridge, MA} 24327} 24328 24329@Manual{ :cmssl, 24330 title = {{CMSSL} for {CM} {F}ortran}, 24331 volume = {I}, 24332 organization = {Thinking Machines Corporation}, 24333 year = {1994}, 24334 address = {Cambridge, MA} 24335} 24336 24337@Misc{ :condor, 24338 author = {M. Livny}, 24339 title = {{PI}, The {Condor} Project, High Throughput Computing}, 24340 howpublished = {www.cs.wisc.edu/condor} 24341} 24342 24343@Manual{ :connection, 24344 title = {Connection Machine {CM}--5 Technical Summary}, 24345 organization = {Thinking Machines Corporation}, 24346 year = {1993}, 24347 address = {Cambridge, MA} 24348} 24349 24350@Manual{ :cplex, 24351 title = {{CPLEX} Optimizer}, 24352 organization = {ILOG CPLEX Division}, 24353 address = {889 Alder Avenue, Incline Village, Nevada}, 24354 note = {http://www.cplex.com/} 24355} 24356 24357@Manual{ :cplextm, 24358 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 24359 (Version 2.0)}, 24360 organization = {CPLEX Optimization Inc.}, 24361 year = {1992}, 24362 address = {Incline Village, Nevada} 24363} 24364 24365@Misc{ :fatcop, 24366 author = {M. C. Ferris}, 24367 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 24368 Solver}, 24369 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 24370} 24371 24372@Misc{ :metaneos, 24373 author = {S. J. Wright}, 24374 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 24375 howpublished = {www-unix.mcs.anl.gov/metaneos} 24376} 24377 24378@InCollection{ gropp.more:optimization, 24379 author = {W. Gropp and J. J. Mor\'e}, 24380 title = {Optimization environments and the {NEOS} Server}, 24381 booktitle = {Approximation Theory and Optimization}, 24382 pages = {167--182}, 24383 publisher = {Cambridge University Press}, 24384 year = {1997}, 24385 editor = {M. D. Buhmann and A. Iserles} 24386} 24387 24388@Article{ czyzyk.mesnier.ea:neos, 24389 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 24390 title = {The {NEOS} Server}, 24391 journal = {IEEE Journal on Computational Science and Engineering}, 24392 volume = {5}, 24393 year = {1998}, 24394 pages = {68--75} 24395} 24396 24397@Book{ :osl, 24398 title = {Handbook for {IBM OSL}}, 24399 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 24400 year = {1994}, 24401 publisher = {Boyd and Fraser}, 24402 address = {Danvers, Massachusetts} 24403} 24404 24405@Manual{ :pro-matlab, 24406 title = {{PRO}--{MATLAB} User's Guide}, 24407 organization = {The MathWorks, Inc.}, 24408 year = {1989}, 24409 address = {21 Eliot Street, South Natick, MA 01760} 24410} 24411 24412@Misc{ :prostate, 24413 key = {Biomedical}, 24414 title = {Biomedical Business International Newsletter}, 24415 howpublished = {pp. 72--75}, 24416 year = {1996} 24417} 24418 24419@Misc{ :sipcase, 24420 key = {Natural}, 24421 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 24422 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 24423} 24424 24425@Book{ aarts.korst:simulated, 24426 author = {E. Aarts and J. Korst}, 24427 title = {Simulated Annealing and Boltzman Machines}, 24428 year = {1990}, 24429 publisher = {John Wiley \& Sons}, 24430 address = {Chichester} 24431} 24432 24433@TechReport{ aarts.laarhoven.ea:local-search-based, 24434 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 24435 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 24436 institution = {Centre for Quantitative Methods}, 24437 year = {1991}, 24438 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 24439 number = {106}, 24440 type = {CQM-Not} 24441} 24442 24443@Article{ aashtiani.magnanti:equilibria, 24444 author = {H. Z. Aashtiani and T. L. Magnanti}, 24445 title = {Equilibria on a congested transportation network}, 24446 journal = {SIAM Journal on Algebraic and Discrete Methods}, 24447 volume = {2}, 24448 year = {1981}, 24449 pages = {213--226} 24450} 24451 24452@Article{ ablow.brigham:analog, 24453 author = {C. M. Ablow and G. Brigham}, 24454 title = {An Analog Solution of Programming Problems}, 24455 journal = {Operations Research}, 24456 year = {1955}, 24457 volume = {3}, 24458 pages = {388--394} 24459} 24460 24461@Article{ achuthan.grabowski.ea:optimal, 24462 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 24463 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 24464 journal = {Opsearch}, 24465 year = {1981}, 24466 volume = {18}, 24467 pages = {117--138} 24468} 24469 24470@Book{ adelman.robinson:income, 24471 author = {I. Adelman and S. Robinson}, 24472 title = {Income Distribution Policy in Developing Countries}, 24473 publisher = {Stanford University Press}, 24474 year = {1978}, 24475 address = {Stanford, California} 24476} 24477 24478@Article{ adler.resende.ea:implementation, 24479 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 24480 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 24481 journal = {Mathematical Programming}, 24482 year = {1989}, 24483 volume = {44}, 24484 pages = {297--336} 24485} 24486 24487@TechReport{ aeberhard.coomans.ea:comparison, 24488 author = {S. Aeberhard and D. Coomans and O. de Vel}, 24489 title = {Comparison of Classifiers in High Dimensional Settings}, 24490 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 24491 University of North Queensland}, 24492 year = {1992}, 24493 number = {92-02}, 24494 type = {Technical Report} 24495} 24496 24497@Article{ aganagic.cottle:constructive, 24498 author = {M. Aganagi\'{c} and R. W. Cottle}, 24499 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 24500 Minors}, 24501 journal = {Mathematical Programming}, 24502 year = {1987}, 24503 volume = {37}, 24504 pages = {223--231} 24505} 24506 24507@TechReport{ aganagic:iterative, 24508 author = {M. Aganagi\'{c}}, 24509 title = {Iterative Methods for the Linear Complementarity Problem}, 24510 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 24511 University}, 24512 year = {1978}, 24513 type = {SOL}, 24514 number = {78-10}, 24515 address = {Stanford, California} 24516} 24517 24518@Book{ ahlfors:complex, 24519 author = {L. V. Ahlfors}, 24520 title = {Complex Analysis}, 24521 publisher = {McGraw--Hill Book Company}, 24522 address = {New York}, 24523 series = {International Series in Pure and Applied Mathematics}, 24524 edition = {Second}, 24525 year = {1966} 24526} 24527 24528@Article{ ahn:solution, 24529 author = {B--H. Ahn}, 24530 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 24531 journal = {Journal of Optimization Theory and Applications}, 24532 year = {1981}, 24533 volume = {33}, 24534 pages = {175--185} 24535} 24536 24537@Article{ al-fahed.stavroulakis.ea:hard, 24538 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24539 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 24540 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 24541 volume = {71}, 24542 year = {1991}, 24543 pages = {257--265} 24544} 24545 24546@Article{ al-fahed.stavroulakis.ea:linear, 24547 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24548 title = {A linear complementarity approach to the frictionless gripper}, 24549 journal = {International Journal of Robotic Research}, 24550 volume = {11}, 24551 year = {1992}, 24552 pages = {112--122} 24553} 24554 24555@Article{ al-khayyal.falk:jointly, 24556 author = {F. A. Al--Khayyal and J. E. Falk}, 24557 title = {Jointly Constrained Biconvex Programming}, 24558 journal = {Mathematics of Operations Research}, 24559 year = {1983}, 24560 volume = {8}, 24561 pages = {273--286} 24562} 24563 24564@Article{ al-khayyal.kyparisis:finite, 24565 author = {F. A. Al--Khayyal and J. Kyparisis}, 24566 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 24567 Inequalities}, 24568 journal = {Journal of Optimization Theory and Applications}, 24569 year = {1991}, 24570 volume = {70}, 24571 pages = {319--332} 24572} 24573 24574@PhDThesis{ al-khayyal:biconvex, 24575 author = {F. A. Al--Khayyal}, 24576 title = {Biconvex Programming and Biconcave Minimization}, 24577 year = {1977}, 24578 school = {The George Washington University} 24579} 24580 24581@Article{ alart.curnier:mixed, 24582 author = {P. Alart and A. Curnier}, 24583 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 24584 solution methods}, 24585 journal = {Computer Methods in Applied Mechanics and Engineering}, 24586 volume = {92}, 24587 year = {1991}, 24588 pages = {353--375} 24589} 24590 24591@Misc{ alexander.kellog.ea:piecewise, 24592 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 24593 title = {Piecewise smooth continuation}, 24594 howpublished = {Manuscript}, 24595 year = {1979} 24596} 24597 24598@InCollection{ alexander.li.ea:piecewise, 24599 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 24600 title = {Piecewise smooth homotopies}, 24601 booktitle = {Homotopy Methods and Global Convergence}, 24602 pages = {1--14}, 24603 publisher = {Plenum Press}, 24604 year = {1983}, 24605 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 24606 address = {New York} 24607} 24608 24609@InCollection{ alexander:topological, 24610 author = {J.~C. Alexander}, 24611 title = {The topological theory of an embedding method}, 24612 booktitle = {Continuation Methods}, 24613 pages = {37--68}, 24614 publisher = {Academic Press}, 24615 year = {1978}, 24616 editor = {H. Wacker}, 24617 address = {New York} 24618} 24619 24620@Book{ allen:probability, 24621 author = {A. O. Allen}, 24622 title = {Probability, Statistics and Queueing Theory}, 24623 publisher = {Academic Press}, 24624 year = {1990}, 24625 address = {London}, 24626 edition = {Second} 24627} 24628 24629@Book{ allgower.georg:numerical, 24630 author = {E. L. Allgower and K. Georg}, 24631 title = {Numerical Continuation Methods, An Introduction}, 24632 publisher = {Springer-Verlag}, 24633 year = {1990}, 24634 address = {Berlin} 24635} 24636 24637@InProceedings{ allgower.georg:predictor-corrector, 24638 crossref = {bachem.grotschel.ea:mathematical}, 24639 author = {E. L. Allgower and K. Georg}, 24640 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 24641 Zero Points of Nonlinear Mappings}, 24642 pages = {15--56} 24643} 24644 24645@Article{ aluffi-pentini.parisi.ea:algorithm, 24646 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 24647 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 24648 Algorithm}, 24649 journal = {ACM Transactions on Mathematical Software}, 24650 year = {1988}, 24651 volume = {14}, 24652 pages = {366--380} 24653} 24654 24655@Article{ anandalingam.friesz:hierarchical, 24656 author = {G. Anandalingam and T. L. Friesz}, 24657 title = {Hierarchical Optimization: An Introduction}, 24658 journal = {Annals of Operations Research}, 24659 year = {1992}, 24660 volume = {34}, 24661 pages = {1--11} 24662} 24663 24664@Article{ anandalingam.white:solution, 24665 author = {G. Anandalingam and D. J. White}, 24666 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 24667 Functions}, 24668 journal = {IEEE Transactions on Automatic Control}, 24669 year = {1990}, 24670 volume = {35}, 24671 number = {10}, 24672 pages = {1170--1173} 24673} 24674 24675@Article{ andersen.andersen:presolving, 24676 author = {E. Andersen and K. Andersen}, 24677 title = {Presolving in Linear Programming}, 24678 year = {1995}, 24679 journal = {Mathematical Programming}, 24680 volume = {71}, 24681 pages = {221--245} 24682} 24683 24684@InProceedings{ andersen.ye:homogeneous, 24685 author = {E. Andersen and Y. Ye}, 24686 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 24687 Equality Constraints}, 24688 crossref = {ferris.pang:complementarity}, 24689 pages = {1--11} 24690} 24691 24692@Book{ anderson.bai.ea:lapack, 24693 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 24694 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 24695 Sorensen}, 24696 title = {{LAPACK} User's Guide}, 24697 publisher = {SIAM}, 24698 year = {1995}, 24699 address = {Philadelphia, Pennsylvania}, 24700 edition = {Second} 24701} 24702 24703@Article{ anderson.ferris:direct, 24704 author = {E. J. Anderson and M. C. Ferris}, 24705 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 24706 year = {2001}, 24707 journal = {SIAM Journal on Optimization, forthcoming}, 24708 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 24709 key = {55} 24710} 24711 24712@InProceedings{ anderson.ferris:genetic, 24713 author = {E. J. Anderson and M. C. Ferris}, 24714 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 24715 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 24716 Waterloo, Ontario, Canada, May 28--30}, 24717 publisher = {University of Waterloo Press}, 24718 key = {14}, 24719 year = {1990} 24720} 24721 24722@Article{ anderson.ferris:genetic*1, 24723 author = {E. J. Anderson and M. C. Ferris}, 24724 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 24725 Problem}, 24726 journal = {ORSA Journal on Computing}, 24727 year = {1994}, 24728 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 24729 volume = {6}, 24730 pages = {161--173}, 24731 key = {22} 24732} 24733 24734@InProceedings{ anderson.ferris:parallel, 24735 author = {E. J. Anderson and M. C. Ferris}, 24736 title = {Parallel Genetic Algorithms in Optimization}, 24737 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 24738 Computing, Chicago, Illinois, December 11-13}, 24739 year = {1989}, 24740 key = {12} 24741} 24742 24743@Unpublished{ anderson.lewis:primal, 24744 author = {E. J. Anderson and A. S. Lewis}, 24745 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24746 note = {In preparation} 24747} 24748 24749@Book{ anderson.nash:linear, 24750 author = {E. J. Anderson and P. Nash}, 24751 title = {Linear Programming in Infinite--Dimensional Spaces}, 24752 year = {1987}, 24753 publisher = {John Wiley \& Sons}, 24754 address = {Chichester} 24755} 24756 24757@InProceedings{ anderson:primal, 24758 author = {E. J. Anderson}, 24759 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24760 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 24761 Programming, Cambridge, September 1984}, 24762 year = {1985}, 24763 editor = {E. J. Anderson and A. B. Philpott}, 24764 publisher = {Springer-Verlag}, 24765 address = {Berlin} 24766} 24767 24768@Article{ andradottir:method, 24769 author = {S. Andrad\'{o}ttir}, 24770 title = {A Method of Discrete Stochastic Optimization}, 24771 journal = {Management Science}, 24772 year = {1995}, 24773 volume = {41}, 24774 pages = {1946--1961} 24775} 24776 24777@Article{ andradottir:global, 24778 author = {S. Andrad\'{o}ttir}, 24779 title = {A Global Search Method for Discrete Stochastic Optimization}, 24780 journal = {SIAM Journal on Optimization}, 24781 year = {1996}, 24782 volume = {6}, 24783 pages = {513--530} 24784} 24785 24786@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 24787 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 24788 title = {An infeasible--interior--point predictor--corrector algorithm for the 24789 {P}$_x$--geometric {LCP}}, 24790 institution = {Department of Mathematics, The University of Iowa}, 24791 address = {Iowa City, Iowa}, 24792 year = {1994}, 24793 number = {62}, 24794 type = {Reports on Computational Mathematics} 24795} 24796 24797@TechReport{ anitescu.potra:formulating, 24798 author = {M. Anitescu and F. A. Potra}, 24799 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 24800 Linear Complementarity Problems}, 24801 institution = {Department of Mathematics, The University of Iowa}, 24802 year = {1996}, 24803 type = {Report}, 24804 number = {93}, 24805 address = {Iowa City, Iowa} 24806} 24807 24808@Article{ anstreicher.lee.ea:crashing, 24809 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 24810 title = {Crashing a Maximum-Weight Complementarity Basis}, 24811 journal = {Mathematical Programming}, 24812 year = {1992}, 24813 volume = {54}, 24814 pages = {281--294} 24815} 24816 24817@Article{ anstreicher:combined, 24818 author = {K. M. Anstreicher}, 24819 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 24820 programming}, 24821 journal = {Mathematical Programming}, 24822 year = {1991}, 24823 volume = {52}, 24824 pages = {429--440} 24825} 24826 24827@Article{ anstreicher:combined*1, 24828 author = {K. M. Anstreicher}, 24829 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 24830 journal = {Mathematical Programming}, 24831 year = {1989}, 24832 volume = {43}, 24833 pages = {209--223} 24834} 24835 24836@InCollection{ arbenz.gander.ea:remote, 24837 author = {P. Arbenz and W. Gander and M. Oettli}, 24838 title = {The Remote Computational System}, 24839 booktitle = {High-Performance Computation and Networks}, 24840 publisher = {Springer-Verlag}, 24841 year = {1996}, 24842 volume = {1067}, 24843 series = {Lecture Notes in Computer Science}, 24844 pages = {662--667} 24845} 24846 24847@InCollection{ arcus:comsoal, 24848 author = {A. L. Arcus}, 24849 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 24850 booktitle = {Readings in Production and Operations Management}, 24851 year = {1966}, 24852 editor = {E. S. Buffa}, 24853 publisher = {John Wiley \& Sons}, 24854 address = {New York} 24855} 24856 24857@TechReport{ arioli.chan.ea:computing, 24858 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 24859 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 24860 Optimization Calculations}, 24861 institution = {CERFACS}, 24862 year = {1993}, 24863 number = {TR/PA/93/34} 24864} 24865 24866@Article{ armijo:minimization, 24867 author = {L. Armijo}, 24868 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 24869 Derivatives}, 24870 journal = {Pacific Journal of Mathematics}, 24871 year = {1966}, 24872 volume = {16}, 24873 pages = {1--3} 24874} 24875 24876@Article{ arrow.debreu:existence, 24877 author = {K. Arrow and G. Debreu}, 24878 title = {Existence of Equilibrium for a Competitive Economy}, 24879 journal = {Econometrica}, 24880 year = {1954}, 24881 volume = {22}, 24882 pages = {265--290} 24883} 24884 24885@InCollection{ arrow.solow:gradient, 24886 author = {K. J. Arrow and R. M. Solow}, 24887 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 24888 booktitle = {Studies in Linear and Nonlinear Programming}, 24889 year = {1958}, 24890 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 24891 publisher = {Stanford University Press}, 24892 address = {Stanford, California}, 24893 pages = {166--176} 24894} 24895 24896@Book{ aubin.ekeland:nonlinear, 24897 author = {J.-P. Aubin and I. Ekeland}, 24898 title = {Applied nonlinear analysis}, 24899 publisher = {John Wiley \& Sons}, 24900 address = {New York}, 24901 year = {1984} 24902} 24903 24904@Article{ auchmuty:variational, 24905 author = {G. Auchmuty}, 24906 title = {Variational Principles for Variational Inequalities}, 24907 journal = {Numerical Functional Analysis and Optimization}, 24908 year = {1989}, 24909 volume = {10}, 24910 pages = {863--874} 24911} 24912 24913@Book{ auerbach.kotlikoff:dynamic, 24914 author = {A. J. Auerbach and L. J. Kotlikoff}, 24915 title = {Dynamic Fiscal Policy}, 24916 publisher = {Cambridge University Press}, 24917 address = {Cambridge, England}, 24918 year = {1987} 24919} 24920 24921@InProceedings{ ault.deutsch.ea:interpolating, 24922 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 24923 title = {Interpolating Subspaces in Approximation Theory}, 24924 booktitle = {Approximation Theory}, 24925 year = {1970}, 24926 editor = {A. Talbot}, 24927 publisher = {Academic Press}, 24928 address = {London} 24929} 24930 24931@Article{ auslender.crouzeix:global, 24932 author = {A. A. Auslender and J.--P. Crouzeix}, 24933 title = {Global Regularity Theorems}, 24934 journal = {Mathematics of Operations Research}, 24935 year = {1988}, 24936 volume = {13}, 24937 pages = {243--253} 24938} 24939 24940@Article{ auslender.haddou:interior-proximal, 24941 author = {A. Auslender and M. Haddou}, 24942 title = {An interior-proximal method for convex linearly constrained problems and its 24943 extension to variational inequalities}, 24944 year = {1995}, 24945 journal = {Mathematical Programming}, 24946 pages = {77--100}, 24947 volume = {71} 24948} 24949 24950@Article{ auslender:convergence, 24951 author = {A. Auslender}, 24952 title = {Convergence of stationary sequences for variational inequalities with maximal 24953 monotone operators}, 24954 journal = {Applied Mathematics and Optimization}, 24955 volume = {28}, 24956 year = {1993}, 24957 pages = {161--172} 24958} 24959 24960@Book{ auslender:optimization, 24961 author = {A. Auslender}, 24962 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 24963 year = {1976}, 24964 publisher = {Masson}, 24965 address = {Paris} 24966} 24967 24968@TechReport{ averick.carter.ea:minpack-2, 24969 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 24970 title = {The {MINPACK-2} Test Problem Collection}, 24971 institution = {Argonne National Laboratory}, 24972 year = {1992}, 24973 address = {Argonne, Illinois}, 24974 number = {MCS-P153-0692} 24975} 24976 24977@TechReport{ axline.billups.ea:guidelines, 24978 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 24979 title = {Guidelines for Software Security ({U})}, 24980 institution = {SNL}, 24981 year = {1989}, 24982 month = oct, 24983 address = {Albuquerque, New Mexico}, 24984 number = {SAND88-2955} 24985} 24986 24987@Article{ ayres.walter:greenhouse, 24988 author = {R. U. Ayres and J. Walter}, 24989 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 24990 journal = {Environmental and Resource Economics}, 24991 year = {1991}, 24992 volume = {1}, 24993 pages = {237--270} 24994} 24995 24996@PhDThesis{ bagley:behaviour, 24997 author = {J. D. Bagley}, 24998 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 24999 Algorithms}, 25000 year = {1967}, 25001 school = {University of Michigan} 25002} 25003 25004@Article{ bain.stewart:application, 25005 author = {R. S. Bain and W. E. Stewart}, 25006 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 25007 Algebraic Equation Systems}, 25008 journal = {Computers in Chemical Engineering}, 25009 year = {1991}, 25010 volume = {15}, 25011 pages = {203--208} 25012} 25013 25014@Article{ baker.lasdon:successive, 25015 author = {T. E. Baker and L. S. Lasdon}, 25016 title = {Successive Linear Programming at {E}xxon}, 25017 journal = {Management Science}, 25018 year = {1985}, 25019 volume = {31}, 25020 pages = {264--274} 25021} 25022 25023@InProceedings{ baker:reducing, 25024 crossref = {grefenstette:genetic}, 25025 author = {J. E. Baker}, 25026 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 25027 pages = {14--21} 25028} 25029 25030@Article{ balas.zemel:algorithm, 25031 author = {E. Balas and E. Zemel}, 25032 title = {An Algorithm for Large Zero--One Knapsack Problems}, 25033 journal = {Operations Research}, 25034 year = {1980}, 25035 volume = {28}, 25036 pages = {1132--1154} 25037} 25038 25039@Book{ ballard.fullerton.ea:general, 25040 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 25041 title = {A General Equilibrium Model for Tax Policy Evaluation}, 25042 publisher = {The University of Chicago Press}, 25043 year = {1985}, 25044 series = {National Bureau of Economic Research Monograph} 25045} 25046 25047@InProceedings{ balog.angelos.ea:dose, 25048 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 25049 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 25050 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 25051 Radiation Therapy, Salt Lake City}, 25052 year = {1997}, 25053 editor = {D. D. Leavitt and G. Starkshall}, 25054 publisher = {Medical Physics Publishing}, 25055 address = {St. Louis, Missouri}, 25056 pages = {323--326} 25057} 25058 25059@Article{ baraff:fast, 25060 author = {D. Baraff}, 25061 title = {Fast contact force computation for nonpenetrating rigid bodies}, 25062 journal = {Computer Graphics (Proceedings SIGRAPH)}, 25063 year = {1994}, 25064 pages = {23--34}, 25065 volume = {28} 25066} 25067 25068@Article{ baraff:issues, 25069 author = {D. Baraff}, 25070 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 25071 journal = {Algorithmica}, 25072 volume = {10}, 25073 year = {1993}, 25074 pages = {292--352} 25075} 25076 25077@Book{ barrett.berry.ea:templates, 25078 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 25079 Methods}, 25080 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 25081 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 25082 year = {1994}, 25083 publisher = {SIAM}, 25084 address = {Philadelphia, Pennsylvania} 25085} 25086 25087@Article{ bard:algorithm, 25088 author = {J. F. Bard}, 25089 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 25090 journal = {Mathematics of Operations Research}, 25091 year = {1983}, 25092 volume = {8}, 25093 pages = {260--272} 25094} 25095 25096@Article{ bard:convex, 25097 author = {J. F. Bard}, 25098 title = {Convex Two-Level Optimization}, 25099 journal = {Mathematical Programming}, 25100 year = {1988}, 25101 volume = {40}, 25102 pages = {15--27} 25103} 25104 25105@InCollection{ bard:eclectic, 25106 author = {Y. Bard}, 25107 title = {An Eclectic Approach to Nonlinear Programming}, 25108 booktitle = {Optimization}, 25109 publisher = {University of Queensland Press}, 25110 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 25111 year = {1972}, 25112 address = {St. Lucia, Queensland, Australia}, 25113 pages = {116--128} 25114} 25115 25116@Article{ barnes:variation, 25117 author = {E. R. Barnes}, 25118 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 25119 journal = {Mathematical Programming}, 25120 year = {1986}, 25121 volume = {36}, 25122 pages = {174--182} 25123} 25124 25125@Article{ bartels.golub:simplex, 25126 author = {R. H. Bartels and G. H. Golub}, 25127 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 25128 journal = {Communications of the Asociation for Computing Machinery}, 25129 year = {1969}, 25130 volume = {12}, 25131 pages = {266--268} 25132} 25133 25134@Article{ barton.ivey:nelder, 25135 author = {R. Barton and J. S. Ivey}, 25136 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 25137 journal = {Management Science}, 25138 year = {1996}, 25139 volume = {42}, 25140 number = {7}, 25141 pages = {954--973} 25142} 25143 25144@Article{ battiti:first-, 25145 author = {R. Battiti}, 25146 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 25147 {N}ewton's Method}, 25148 journal = {Neural Computation}, 25149 year = {1992}, 25150 volume = {4}, 25151 pages = {141--166} 25152} 25153 25154@Article{ baudet:asynchronous, 25155 author = {G. M. Baudet}, 25156 title = {Asynchronous iterative methods for multiprocesors}, 25157 journal = {Journal of the Association for Computing Machinery}, 25158 year = {1978}, 25159 volume = {25}, 25160 pages = {226--244} 25161} 25162 25163@InProceedings{ baum.haussler:what, 25164 author = {E. B. Baum and D. Haussler}, 25165 title = {What Size Net Gives Valid Generalization}, 25166 booktitle = {Advances in Neural Information Processing Systems I}, 25167 year = {1989}, 25168 editor = {D. S. Touretzky}, 25169 publisher = {Morgan Kaufmann}, 25170 address = {San Mateo, California}, 25171 pages = {81--90} 25172} 25173 25174@Misc{ baum:private, 25175 author = {E. B. Baum}, 25176 title = {Private Communication}, 25177 year = {1992}, 25178 address = {NEC Research Institute, Princeton, New Jersey} 25179} 25180 25181@Book{ bazaraa.sherali.ea:nonlinear, 25182 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 25183 title = {Nonlinear Programming}, 25184 edition = {Second}, 25185 publisher = {John Wiley and Sons}, 25186 address = {New York}, 25187 year = {1993} 25188} 25189 25190@Book{ bazaraa.shetty:nonlinear, 25191 author = {M. S. Bazaraa and C. M. Shetty}, 25192 title = {Nonlinear Programming: Theory and Algorithms}, 25193 publisher = {John Wiley \& Sons}, 25194 year = {1979}, 25195 address = {New York, New York} 25196} 25197 25198@Article{ beale:cycling, 25199 author = {E. M. L. Beale}, 25200 title = {Cycling in the Dual Simplex Method}, 25201 journal = {Naval Research Logistics Quarterly}, 25202 year = {1955}, 25203 volume = {2}, 25204 pages = {103--107} 25205} 25206 25207@InProceedings{ becker.cun:improving, 25208 author = {S. Becker and Y. le Cun}, 25209 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 25210 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 25211 year = {1988}, 25212 editor = {D. S. Touretzky}, 25213 publisher = {Morgan Kaufmann}, 25214 address = {San Mateo, California}, 25215 pages = {29--37} 25216} 25217 25218@Book{ ben-israel.ben-tal.ea:optimality, 25219 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 25220 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 25221 year = {1981}, 25222 publisher = {John Wiley \& Sons}, 25223 address = {New York} 25224} 25225 25226@Article{ ben-israel:newton-raphson, 25227 author = {A. Ben--Israel}, 25228 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 25229 journal = {Journal of Mathematical Analysis and its Applications}, 25230 year = {1966}, 25231 volume = {15}, 25232 pages = {243--252} 25233} 25234 25235@Article{ ben-tal.melman.ea:curved, 25236 author = {A. Ben--Tal and A. Melman and J. Zowe}, 25237 title = {Curved Search Methods for Unconstrained Optimization}, 25238 journal = {Optimization}, 25239 year = {1990}, 25240 volume = {21}, 25241 pages = {669--695}, 25242 publisher = {John Wiley \& Sons}, 25243 address = {New York} 25244} 25245 25246@InProceedings{ bennett.ferris.ea:genetic, 25247 crossref = {belew.booker:fourth}, 25248 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 25249 title = {A Genetic Algorithm for Database Query Optimization}, 25250 pages = {400--407}, 25251 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 25252 key = {19} 25253} 25254 25255@Article{ bennett.mangasarian:bilinear, 25256 author = {K. P. Bennett and O. L. Mangasarian}, 25257 title = {Bilinear Separation of Two Sets in n-Space}, 25258 journal = {Computational Optimization and Applications}, 25259 year = {1993}, 25260 volume = {2}, 25261 pages = {207--227} 25262} 25263 25264@Article{ bennett.mangasarian:multicategory, 25265 author = {K. P. Bennett and O. L. Mangasarian}, 25266 title = {Multicategory Separation via Linear Programming}, 25267 journal = {Optimization Methods and Software}, 25268 year = {1993}, 25269 volume = {3}, 25270 pages = {27--39} 25271} 25272 25273@InProceedings{ bennett.mangasarian:neural, 25274 author = {K. P. Bennett and O. L. Mangasarian}, 25275 title = {Neural Network Training via Linear Programming}, 25276 booktitle = {Advances in Optimization and Parallel Computing}, 25277 year = {1992}, 25278 editor = {P. M. Pardalos}, 25279 publisher = {North Holland}, 25280 address = {Amsterdam}, 25281 pages = {56--67} 25282} 25283 25284@Article{ bennett.mangasarian:robust, 25285 author = {K. P. Bennett and O. L. Mangasarian}, 25286 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 25287 journal = {Optimization Methods and Software}, 25288 year = {1992}, 25289 volume = {1}, 25290 pages = {23--34} 25291} 25292 25293@Article{ bennett.mangasarian:serial, 25294 author = {K. P. Bennett and O. L. Mangasarian}, 25295 title = {Serial and Parallel Multicategory Separation}, 25296 journal = {SIAM Journal on Optimization}, 25297 year = {1994}, 25298 volume = {4}, 25299 pages = {722--734} 25300} 25301 25302@TechReport{ bennett.wu.ea:support, 25303 author = {K. P. Bennett and D. Wu and L. Auslender}, 25304 title = {On Support Vector Decision Trees for Database Marketing}, 25305 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 25306 year = {1998}, 25307 optkey = {}, 25308 opttype = {RPI Math Report}, 25309 optnumber = {98-100}, 25310 optaddress = {Troy, New York}, 25311 optmonth = {}, 25312 optnote = {}, 25313 optannote = {} 25314} 25315 25316@InProceedings{ bennett:decision, 25317 author = {K. P. Bennett}, 25318 title = {Decision Tree Construction Via Linear Programming}, 25319 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 25320 Society Conference}, 25321 year = {1992}, 25322 editor = {M. Evans}, 25323 address = {Utica, Illinois}, 25324 pages = {97--101} 25325} 25326 25327@Book{ berge.ghouila-houri:programming, 25328 author = {C. Berge and A. Ghouila-Houri}, 25329 title = {Programming, Games and Transportation Networks}, 25330 year = {1965}, 25331 publisher = {John Wiley \& Sons}, 25332 address = {New York} 25333} 25334 25335@Book{ berge:topological, 25336 author = {C. Berge}, 25337 title = {Topological Spaces}, 25338 year = {1963}, 25339 publisher = {McMillan}, 25340 address = {New York} 25341} 25342 25343@TechReport{ berkelaar.jansen.ea:basis, 25344 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 25345 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 25346 Complementarity Problems}, 25347 institution = {Department of Econometrics and Operations Research}, 25348 year = {1996}, 25349 address = {Erasmus University, Rotterdam, The Netherlands} 25350} 25351 25352@Article{ bertsekas.baz:distributed, 25353 author = {D. P. Bertsekas and D. El Baz}, 25354 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 25355 journal = {SIAM Journal on Control and Optimization}, 25356 year = {1987}, 25357 volume = {25}, 25358 pages = {74--85} 25359} 25360 25361@Article{ bertsekas.gafni:projection, 25362 author = {D. P. Bertsekas and E. M. Gafni}, 25363 title = {Projection Methods for Variational Inequalities with Application to the Traffic 25364 Assignment Problem}, 25365 journal = {Mathematical Programming Study}, 25366 year = {1982}, 25367 volume = {17}, 25368 pages = {139--159} 25369} 25370 25371@Article{ bertsekas.hossein.ea:relaxation, 25372 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 25373 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 25374 journal = {SIAM Journal on Control and Optimization}, 25375 year = {1987}, 25376 volume = {25}, 25377 pages = {1219--1243} 25378} 25379 25380@Unpublished{ bertsekas.tseng:partial, 25381 author = {D. P. Bertsekas and P. Tseng}, 25382 title = {Partial Proximal Minimization for Convex Programming}, 25383 year = {1991}, 25384 note = {Manuscript} 25385} 25386 25387@Article{ bertsekas.tsitsiklis:analysis, 25388 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25389 title = {An Analysis of Stochastic Shortest Path Problems}, 25390 journal = {Mathematics of Operations Research}, 25391 year = {1991}, 25392 volume = {16}, 25393 pages = {580--595} 25394} 25395 25396@Book{ bertsekas.tsitsiklis:parallel, 25397 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25398 title = {Parallel and Distributed Computation: Numerical Methods}, 25399 publisher = {Prentice-Hall, Inc}, 25400 year = {1989}, 25401 address = {Englewood Cliffs, New Jersey} 25402} 25403 25404@Book{ bertsekas:constrained, 25405 author = {D. P. Bertsekas}, 25406 title = {Constrained Optimization and Lagrange Multiplier Methods}, 25407 year = {1982}, 25408 publisher = {Academic Press}, 25409 address = {New York} 25410} 25411 25412@Book{ bertsekas:dynamic, 25413 author = {D. P. Bertsekas}, 25414 title = {Dynamic Programming and Optimal Control}, 25415 publisher = {Athena Scientific}, 25416 year = {1995}, 25417 address = {Belmont MA} 25418} 25419 25420@Article{ bertsekas:enlarging, 25421 author = {D. P. Bertsekas}, 25422 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 25423 Optimization}, 25424 journal = {Journal of Optimization Theory and Applications}, 25425 year = {1982}, 25426 volume = {36}, 25427 pages = {221--252} 25428} 25429 25430@Article{ bertsekas:goldstein-levitin-poljak, 25431 author = {D. P. Bertsekas}, 25432 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 25433 journal = {IEEE Transactions on Automatic Control}, 25434 year = {1976}, 25435 volume = {AC-21}, 25436 pages = {174--184} 25437} 25438 25439@Article{ bertsekas:multiplier, 25440 author = {D. P. Bertsekas}, 25441 title = {Multiplier Methods: {A} Survey}, 25442 journal = {Automatica}, 25443 year = {1976}, 25444 volume = {12}, 25445 pages = {133--145} 25446} 25447 25448@Article{ bertsekas:necessary, 25449 author = {D. P. Bertsekas}, 25450 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 25451 journal = {Mathematical Programming}, 25452 year = {1975}, 25453 volume = {9}, 25454 pages = {87--99} 25455} 25456 25457@Book{ bertsekas:nonlinear, 25458 author = {D. P. Bertsekas}, 25459 title = {Nonlinear Programming}, 25460 publisher = {Athena Scientific}, 25461 year = {1995}, 25462 address = {Belmont, Massachusetts} 25463} 25464 25465@Article{ bertsekas:projected, 25466 author = {Dimitri P. Bertsekas}, 25467 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 25468 journal = {SIAM Journal on Control and Optimization}, 25469 year = {1982}, 25470 volume = {20}, 25471 pages = {221--246} 25472} 25473 25474@Article{ billups.dirkse.ea:comparison, 25475 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 25476 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 25477 journal = {Computational Optimization and Applications}, 25478 year = {1997}, 25479 pages = {3--25}, 25480 volume = {7}, 25481 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 25482 key = {51} 25483} 25484 25485@Article{ billups.ferris:convergence, 25486 author = {S. C. Billups and M. C. Ferris}, 25487 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 25488 Starting Points}, 25489 journal = {SIAM Journal on Optimization}, 25490 year = {1996}, 25491 volume = {6}, 25492 pages = {316--325}, 25493 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 25494 key = {34} 25495} 25496 25497@TechReport{ billups.ferris:convergence*1, 25498 author = {S. C. Billups and M. C. Ferris}, 25499 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 25500 Points}, 25501 institution = {Computer Sciences Department, University of Wisconsin}, 25502 year = {1993}, 25503 address = {Madison, Wisconsin}, 25504 number = {1180}, 25505 note = {Revised version in SIAM Journal on Optimization.} 25506} 25507 25508@Article{ billups.ferris:qpcomp, 25509 author = {S. C. Billups and M. C. Ferris}, 25510 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 25511 year = {1997}, 25512 journal = {Mathematical Programming}, 25513 pages = {533--562}, 25514 volume = {76}, 25515 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 25516 key = {47} 25517} 25518 25519@Article{ billups.ferris:solutions, 25520 author = {S. C. Billups and M. C. Ferris}, 25521 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 25522 journal = {Mathematics of Operations Research}, 25523 volume = {24}, 25524 pages = {219--236}, 25525 year = {1999}, 25526 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 25527 key = {42}, 25528 institution = {Computer Sciences Department, University of Wisconsin}, 25529 address = {Madison, Wisconsin}, 25530 type = {Mathematical Programming Technical Report}, 25531 number = {94--15} 25532} 25533 25534@TechReport{ billups.murata.ea:users, 25535 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 25536 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 25537 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 25538 institution = {SNL}, 25539 year = {1994}, 25540 month = jan, 25541 address = {Albuquerque, New Mexico}, 25542 number = {SAND91--1482} 25543} 25544 25545@TechReport{ billups.speight.ea:nonmonotone, 25546 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 25547 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 25548 Problems}, 25549 institution = {Department of Mathematics, University of Colorado}, 25550 year = {1999}, 25551 address = {Denver, Colorado} 25552} 25553 25554@PhDThesis{ billups:algorithms, 25555 author = {S. C. Billups}, 25556 title = {Algorithms for Complementarity Problems and Generalized Equations}, 25557 school = {University of Wisconsin--Madison}, 25558 year = {1995}, 25559 address = {Madison, Wisconsin}, 25560 month = aug 25561} 25562 25563@MastersThesis{ billups:augmented, 25564 author = {S. C. Billups}, 25565 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 25566 school = {Virginia Tech}, 25567 year = {1985}, 25568 address = {Blacksburg, Virginia} 25569} 25570 25571@TechReport{ billups:homotopy, 25572 author = {S. C. Billups}, 25573 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 25574 institution = {Department of Mathematics, University of Colorado}, 25575 year = {1998}, 25576 address = {Denver, Colorado} 25577} 25578 25579@Article{ billups:improving, 25580 author = {S. C. Billups}, 25581 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 25582 Proximal Perturbations}, 25583 year = {2000}, 25584 journal = {Mathematical Programming}, 25585 volume = {87}, 25586 pages = {153--176} 25587} 25588 25589@Book{ birge.louveaux:introduction, 25590 author = {J. R. Birge and R. Louveaux}, 25591 title = {Introduction to Stochastic Programming}, 25592 publisher = {Springer}, 25593 address = {New York}, 25594 year = {1997} 25595} 25596 25597@TechReport{ bischof.carle.ea:adifor, 25598 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 25599 title = {{ADIFOR} 2.0 User's Guide}, 25600 institution = {Argonne National Laboratory}, 25601 year = {1995}, 25602 address = {Argonne, Illinois}, 25603 number = {ANL/MCS--TM--192}, 25604 type = {Mathematics and Computer Science Division Report} 25605} 25606 25607@Book{ bisschop.entriken:aimms, 25608 author = {J. Bisschop and R. Entriken}, 25609 title = {{AIMMS} -- The Modeling System}, 25610 year = {1993}, 25611 publisher = {Paragon Decision Technology}, 25612 address = {Haarlem, The Netherlands} 25613} 25614 25615@Article{ bisschop.meeraus:development, 25616 author = {J. Bisschop and A. Meeraus}, 25617 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 25618 Environment}, 25619 journal = {Mathematical Programming Study}, 25620 year = {1982}, 25621 volume = {20}, 25622 pages = {1--29} 25623} 25624 25625@Misc{ bixby.ceria.ea:miplib, 25626 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 25627 title = {{MIPLIB} 3.0}, 25628 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 25629} 25630 25631@InProceedings{ bjorkman.klarbring.ea:sequential, 25632 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 25633 Sj{\"{o}}din}, 25634 title = {Sequential quadratic programming for non-linear elastic contact problems}, 25635 editor = {J. Herskovits}, 25636 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 25637 Systems}, 25638 volume = {2}, 25639 year = {1993}, 25640 pages = {301--308} 25641} 25642 25643@Article{ bjorkman:path, 25644 author = {G. Bj{\"o}rkman}, 25645 title = {Path Following and Critical Points for Contact Problems}, 25646 journal = {Computational Mechanics}, 25647 volume = {10}, 25648 pages = {231--246}, 25649 year = {1992} 25650} 25651 25652@Article{ bjorkman:solution, 25653 author = {G. Bj{\"o}rkman}, 25654 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 25655 of Linear Complementarity Problems}, 25656 journal = {International Journal for Numerical Methods in Engineering}, 25657 volume = {31}, 25658 pages = {1553--1566}, 25659 year = {1991} 25660} 25661 25662@Article{ bland:pivot, 25663 author = {R. G. Bland}, 25664 title = {New Pivot Rules for the Simplex Method}, 25665 journal = {Mathematics of Operations Research}, 25666 year = {1977}, 25667 volume = {2}, 25668 pages = {103--107} 25669} 25670 25671@Article{ block.levin:boundedness, 25672 author = {H. D. Block and S. A. Levin}, 25673 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 25674 Inequalities}, 25675 journal = {Proceedings of the American Mathematical Society}, 25676 year = {1970}, 25677 volume = {26}, 25678 pages = {229--235} 25679} 25680 25681@Book{ bloomer:power, 25682 author = {J. Bloomer}, 25683 title = {Power Programming with {RPC}}, 25684 publisher = {O'Reilly and Associates, Inc.}, 25685 address = {Sebastopol, CA}, 25686 year = {1992} 25687} 25688 25689@InProceedings{ blum.rivest:training, 25690 author = {A. Blum and R. L. Rivest}, 25691 title = {Training a 3-Node Neural Network is {NP}-Complete}, 25692 booktitle = {Advances in Neural Information Processing Systems I}, 25693 year = {1989}, 25694 editor = {D. S. Touretzky}, 25695 publisher = {Morgan Kaufmann}, 25696 address = {San Mateo, California}, 25697 pages = {494--501} 25698} 25699 25700@InProceedings{ boehringer.ferris.ea:exemptions, 25701 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 25702 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 25703 from a General Equilibrium Model for Six {EU} Countries}, 25704 key = {49}, 25705 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 25706 year = {1995} 25707} 25708 25709@Article{ boender.kan:bayesian, 25710 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 25711 title = {Bayesian Stopping Rules for Global Optimization}, 25712 journal = {Mathematical Programming}, 25713 year = {1987}, 25714 volume = {37}, 25715 pages = {59--80} 25716} 25717 25718@Article{ boggs:convergence, 25719 author = {P. T. Boggs}, 25720 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 25721 Problems}, 25722 journal = {Mathematics of Computation}, 25723 year = {1976}, 25724 volume = {30}, 25725 pages = {512--522} 25726} 25727 25728@InProceedings{ bolzon.cochetti.ea:computing, 25729 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 25730 title = {On computing all solutions in decohesion}, 25731 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 25732 International Congress of Theoretical and Applied Mechanics}, 25733 year = {1996}, 25734 address = {Kyoto} 25735} 25736 25737@InProceedings{ bolzon.maier.ea:holonomic, 25738 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25739 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 25740 study of mathematical programming approaches}, 25741 booktitle = {Fracture Mechanics of Concrete Structures}, 25742 editor = {F. H. Wittmann}, 25743 series = {Second International Conference on Fracture Mechanics of Concrete Structures 25744 (FRAMCOS 2)}, 25745 year = {1995}, 25746 publisher = {Aedificatio Publishers}, 25747 pages = {885--898} 25748} 25749 25750@InProceedings{ bolzon.maier.ea:holonomic*1, 25751 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25752 title = {On holonomic structural analysis as a complementarity problem}, 25753 booktitle = {APCOM96, Seoul}, 25754 year = {1996} 25755} 25756 25757@Article{ bolzon.maier.ea:multiplicity, 25758 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25759 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 25760 journal = {Computational Mechanics}, 25761 year = {1997}, 25762 volume = {19}, 25763 pages = {511--516} 25764} 25765 25766@Article{ bongartz.conn.ea:cute, 25767 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 25768 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 25769 year = {1995}, 25770 journal = {{ACM} Transactions on Mathematical Software}, 25771 volume = {21}, 25772 pages = {123--160} 25773} 25774 25775@Article{ boppana:eigenvalues, 25776 author = {R. Boppana}, 25777 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 25778 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 25779 pages = {280--285}, 25780 year = {1987} 25781} 25782 25783@Article{ bortfeld.kahler.ea:x-ray, 25784 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 25785 title = {{X}-ray field compensation with multileaf collimators}, 25786 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25787 year = {1994}, 25788 volume = {28}, 25789 number = {3}, 25790 pages = {723--730} 25791} 25792 25793@Article{ bortfeld.schlegel:optimization, 25794 author = {T. Bortfeld and W. Schlegel}, 25795 title = {Optimization of beam orientations in radiation therapy: some theoretical 25796 considerations}, 25797 journal = {Physics in Medicine and Biology}, 25798 year = {1993}, 25799 volume = {38}, 25800 number = {2}, 25801 pages = {291--304} 25802} 25803 25804@Article{ borwein:stability, 25805 author = {J. M. Borwein}, 25806 title = {Stability and regular points of inequality systems}, 25807 journal = {Journal of Optimization Theory and Applications}, 25808 year = {1986}, 25809 volume = {48}, 25810 pages = {9--52} 25811} 25812 25813@Article{ boyer:present, 25814 author = {A. L. Boyer}, 25815 title = {Present and Future Developments in Radiotherapy Treatment Units}, 25816 journal = {Seminars in Radiation Oncology}, 25817 year = {1995}, 25818 volume = {5}, 25819 number = {2}, 25820 pages = {146--155} 25821} 25822 25823@Article{ bracken.mcgill:mathematical, 25824 author = {J. Bracken and J. T. McGill}, 25825 title = {Mathematical programs with optimization problems in the constraints}, 25826 journal = {Operations Research}, 25827 volume = {21}, 25828 year = {1973}, 25829 pages = {37--44} 25830} 25831 25832@Article{ bradley.fayyad.ea:mathematical, 25833 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 25834 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 25835 journal = {INFORMS Journal on Computing}, 25836 year = {1999}, 25837 volume = {11}, 25838 pages = {217--238} 25839} 25840 25841@TechReport{ bradley.mangasarian.ea:clustering, 25842 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25843 title = {Clustering via Concave Minimization}, 25844 institution = {Computer Sciences Department, University of Wisconsin}, 25845 year = {1996}, 25846 type = {Mathematical Programming Technical Report}, 25847 number = {96-03}, 25848 address = {Madison, Wisconsin} 25849} 25850 25851@TechReport{ bradley.mangasarian.ea:feature, 25852 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25853 title = {Feature Selection via Mathematical Programming}, 25854 institution = {Computer Sciences Department, University of Wisconsin}, 25855 year = {1995}, 25856 type = {Mathematical Programming Technical Report}, 25857 number = {95-21}, 25858 address = {Madison, Wisconsin} 25859} 25860 25861@Article{ bradley.mangasarian:massive, 25862 author = {P. S. Bradley and O. L. Mangasarian}, 25863 title = {Massive Data Discrimination via Linear Support Vector Machines}, 25864 year = {2000}, 25865 journal = {Optimization Methods and Software}, 25866 volume = {13}, 25867 pages = {1-10} 25868} 25869 25870@PhDThesis{ brady:condition, 25871 author = {L. Brady}, 25872 title = {Condition Constants for Solutions of Convex Inequalities}, 25873 year = {1988}, 25874 address = {Madison, Wisconsin}, 25875 school = {Computer Sciences Department, University of Wisconsin} 25876} 25877 25878@Article{ braess:uber, 25879 author = {D. Braess}, 25880 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 25881 journal = {Unternehmensforschung}, 25882 year = {1968}, 25883 volume = {12}, 25884 pages = {258--268} 25885} 25886 25887@Article{ brahme:optimization, 25888 author = {A. Brahme}, 25889 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 25890 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25891 year = {1993}, 25892 volume = {25}, 25893 pages = {373--375} 25894} 25895 25896@Article{ brahme:stationary, 25897 author = {A. Brahme}, 25898 title = {Optimization of stationary and moving beam radiation therapy techniques}, 25899 journal = {Radiother. Oncol.}, 25900 year = {1988}, 25901 volume = {12}, 25902 pages = {129--140} 25903} 25904 25905@InCollection{ brahme:treatment, 25906 author = {A. Brahme}, 25907 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 25908 booktitle = {Radiation Therapy Physics}, 25909 publisher = {Springer-Verlag}, 25910 year = {1995}, 25911 editor = {A. R. Smith}, 25912 address = {Berlin}, 25913 pages = {209--246} 25914} 25915 25916@TechReport{ branch:getting, 25917 author = {M. A. Branch}, 25918 title = {Getting {CUTE} with {M}atlab}, 25919 institution = {Cornell University}, 25920 year = {1994}, 25921 type = {Cornell Theory Center Report}, 25922 number = {CTC94TR194}, 25923 address = {Ithaca, New York} 25924} 25925 25926@Article{ brearley.mitra.ea:analysis, 25927 author = {A. Brearley and G. Mitra and H. Williams}, 25928 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 25929 Algorithm}, 25930 journal = {Mathematical Programming}, 25931 year = {1975}, 25932 volume = {8}, 25933 pages = {54--83} 25934} 25935 25936@Article{ bredensteiner.bennett:feature, 25937 author = {E. Bredensteiner and K. Bennett}, 25938 title = {Feature Minimization within Decision Trees}, 25939 journal = {Computational Optimization and Applications}, 25940 year = {1998}, 25941 volume = {10}, 25942 pages = {111--126} 25943} 25944 25945@Article{ bregman:relaxation, 25946 author = {L. M. Bregman}, 25947 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 25948 Application to the Solution of Problems in Convex Programming}, 25949 journal = {USSR Computational Mathematics and Mathematical Physics}, 25950 year = {1967}, 25951 volume = {7}, 25952 pages = {200--217} 25953} 25954 25955@Book{ brenner.hall:making, 25956 author = {D. J. Brenner and E. J. Hall}, 25957 title = {Making the Radiation Therapy Decision}, 25958 publisher = {Contemporary Books}, 25959 year = {1996}, 25960 address = {Chicago, IL} 25961} 25962 25963@Book{ brent:algorithms, 25964 author = {R. P. Brent}, 25965 title = {Algorithms for Minimization without Derivatives}, 25966 publisher = {Prentice-Hall, Inc}, 25967 year = {1973}, 25968 address = {Englewood Cliffs, New Jersey} 25969} 25970 25971@Article{ brewster.mohan.ea:three, 25972 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 25973 title = {Three dimensional conformal treatment planning with multileaf collimators}, 25974 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25975 year = {1995}, 25976 volume = {33}, 25977 number = {5}, 25978 pages = {1081--1089} 25979} 25980 25981@Article{ brezis.lions:produits, 25982 author = {H. Br\'{e}zis and P.--L. Lions}, 25983 title = {Produits Infinis de Resolvantes}, 25984 journal = {Israel Journal of Mathematics}, 25985 year = {1978}, 25986 volume = {29}, 25987 pages = {329--345} 25988} 25989 25990@Book{ brezis:operateurs, 25991 author = {H. Br\'{e}zis}, 25992 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 25993 Espaces de Hilbert}, 25994 publisher = {North-Holland}, 25995 address = {Amsterdam}, 25996 year = {1973} 25997} 25998 25999@Book{ brooke.kendrick.ea:gams, 26000 author = {A. Brooke and D. Kendrick and A. Meeraus}, 26001 title = {{GAMS}: {A} User's Guide}, 26002 year = {1988}, 26003 publisher = {The Scientific Press}, 26004 address = {South San Francisco, CA} 26005} 26006 26007@Article{ brown.demarzo.ea:computing, 26008 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 26009 title = {Computing Equilibria when Asset Markets Are Incomplete}, 26010 journal = {Econometrica}, 26011 year = {1996}, 26012 volume = {64}, 26013 pages = {1--28} 26014} 26015 26016@Article{ bruck:iterative, 26017 author = {R. E. Bruck}, 26018 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 26019 in {H}ilbert Space}, 26020 journal = {Bulletin of the American Mathematical Society}, 26021 year = {1975}, 26022 volume = {81}, 26023 pages = {890--892} 26024} 26025 26026@Article{ bunch.parlett:direct, 26027 author = {J. R. Bunch and B. N. Parlett}, 26028 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 26029 journal = {SIAM Journal on Numerical Analysis}, 26030 year = {1971}, 26031 volume = {8}, 26032 pages = {639--655} 26033} 26034 26035@Article{ burachik.iusem.ea:enlargement, 26036 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 26037 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 26038 year = {1997}, 26039 journal = {Set-Valued Analysis, forthcoming} 26040} 26041 26042@TechReport{ burachik.iusem:generalized, 26043 author = {R. S. Burachik and A. N. Iusem}, 26044 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 26045 Problem}, 26046 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 26047 year = {1995}, 26048 type = {Working Paper}, 26049 address = {Rio de Janeiro} 26050} 26051 26052@Article{ burachik.iusem:generalized*1, 26053 author = {R. S. Burachik and A. N. Iusem}, 26054 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 26055 {A} {H}ilbert Space}, 26056 year = {1998}, 26057 journal = {SIAM Journal on Optimization}, 26058 volume = {8}, 26059 pages = {197--216} 26060} 26061 26062@Article{ burdakov:globally, 26063 author = {O. P. Burdakov}, 26064 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 26065 of Nonlinear Equations}, 26066 journal = {Soviet Mathematics Doklady}, 26067 year = {1980}, 26068 volume = {22}, 26069 pages = {376--379} 26070} 26071 26072@Article{ burges:tutorial, 26073 author = {C. J. C. Burges}, 26074 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 26075 journal = {Data Mining and Knowledge Discovery}, 26076 volume = {2}, 26077 number = {2}, 26078 pages = {121-167}, 26079 year = {1998} 26080} 26081 26082@Article{ burke.ferris.ea:clarke, 26083 author = {J. V. Burke and M. C. Ferris and M. Qian}, 26084 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 26085 journal = {Journal of Mathematical Analysis and its Applications}, 26086 year = {1992}, 26087 volume = {166}, 26088 pages = {199--213}, 26089 key = {16} 26090} 26091 26092@Unpublished{ burke.ferris.ea:least, 26093 author = {J. V. Burke and M. C. Ferris and L. Qi}, 26094 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 26095 year = {1994}, 26096 month = mar, 26097 note = {Manuscript}, 26098 key = {999} 26099} 26100 26101@Article{ burke.ferris:characterization, 26102 author = {J. V. Burke and M. C. Ferris}, 26103 title = {Characterization of Solution Sets of Convex Programs}, 26104 journal = {Operations Research Letters}, 26105 year = {1991}, 26106 volume = {10}, 26107 pages = {57--60}, 26108 key = {10} 26109} 26110 26111@Article{ burke.ferris:gauss-newton, 26112 author = {J. V. Burke and M. C. Ferris}, 26113 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 26114 journal = {Mathematical Programming}, 26115 year = {1995}, 26116 volume = {71}, 26117 pages = {179--194}, 26118 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 26119 key = {32} 26120} 26121 26122@Article{ burke.ferris:weak, 26123 author = {J. V. Burke and M. C. Ferris}, 26124 title = {Weak Sharp Minima in Mathematical Programming}, 26125 journal = {SIAM Journal on Control and Optimization}, 26126 year = {1993}, 26127 volume = {31}, 26128 pages = {1340--1359}, 26129 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 26130 key = {23} 26131} 26132 26133@Article{ burke.more.ea:convergence, 26134 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 26135 title = {Convergence Properties of Trust Region Methods for Linear and Convex 26136 Constraints}, 26137 journal = {Mathematical Programming}, 26138 year = {1990}, 26139 volume = {47}, 26140 pages = {305--336} 26141} 26142 26143@Article{ burke.more:exposing, 26144 author = {J. V. Burke and J. J. Mor\'{e}}, 26145 title = {Exposing Constraints}, 26146 journal = {SIAM Journal on Optimization}, 26147 year = {1994}, 26148 volume = {4}, 26149 pages = {573--595} 26150} 26151 26152@Article{ burke.more:identification, 26153 author = {J. V. Burke and J. J. Mor\'{e}}, 26154 title = {On the Identification of Active Constraints}, 26155 journal = {SIAM Journal on Numerical Analysis}, 26156 year = {1988}, 26157 volume = {25}, 26158 pages = {1197--1211} 26159} 26160 26161@Article{ burke.poliquin:optimality, 26162 author = {J. V. Burke and R. A. Poliquin}, 26163 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 26164 journal = {Mathematical Programming}, 26165 year = {1992}, 26166 volume = {57}, 26167 pages = {103--120} 26168} 26169 26170@Article{ burke.tseng:unified, 26171 author = {J. V. Burke and P. Tseng}, 26172 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 26173 journal = {SIAM Journal on Optimization}, 26174 year = {1996}, 26175 volume = {6}, 26176 pages = {265--282} 26177} 26178 26179@Article{ burke.xu:global, 26180 author = {J. V. Burke and S. Xu}, 26181 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 26182 Linear Complementarity Problems}, 26183 year = {1998}, 26184 journal = {Mathematics of Operations Research}, 26185 volume = {23}, 26186 pages = {719--735} 26187} 26188 26189@TechReport{ burke:algorithms, 26190 author = {J. V. Burke}, 26191 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 26192 Inequalities that have both Global and Quadratic Convergence Properties}, 26193 institution = {Argonne National Laboratory}, 26194 year = {1985}, 26195 address = {Argonne, Illinois}, 26196 number = {ANL/MCS--TM--54}, 26197 type = {Mathematics and Computer Science Division Report} 26198} 26199 26200@Article{ burke:descent, 26201 author = {J. V. Burke}, 26202 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 26203 journal = {Mathematical Programming}, 26204 year = {1985}, 26205 volume = {33}, 26206 pages = {260--279} 26207} 26208 26209@Article{ burke:exact, 26210 author = {J. V. Burke}, 26211 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 26212 journal = {SIAM Journal on Control and Optimization}, 26213 year = {1991}, 26214 volume = {29}, 26215 pages = {968--998} 26216} 26217 26218@Article{ burke:identification, 26219 author = {J. V. Burke}, 26220 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 26221 journal = {SIAM Journal on Numerical Analysis}, 26222 year = {1990}, 26223 volume = {27}, 26224 pages = {1081--1102} 26225} 26226 26227@Article{ burke:robust, 26228 author = {J. V. Burke}, 26229 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 26230 journal = {SIAM Journal on Optimization}, 26231 year = {1992}, 26232 volume = {2}, 26233 pages = {325--347} 26234} 26235 26236@Article{ burke:second, 26237 author = {J. V. Burke}, 26238 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 26239 journal = {Mathematical Programming}, 26240 year = {1987}, 26241 volume = {38}, 26242 pages = {287--302} 26243} 26244 26245@Article{ burke:sequential, 26246 author = {J. V. Burke}, 26247 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 26248 Programs}, 26249 journal = {Journal of Mathematical Analysis and its Applications}, 26250 year = {1989}, 26251 volume = {139}, 26252 pages = {319--351} 26253} 26254 26255@Article{ burman.kutcher.ea:fitting, 26256 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 26257 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 26258 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26259 year = {1991}, 26260 optvolume = {21}, 26261 optpages = {123-135} 26262} 26263 26264@TechReport{ busovaca:handling, 26265 author = {S. Busovaca}, 26266 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 26267 institution = {University of Waterloo}, 26268 year = {1985}, 26269 address = {Ontario}, 26270 number = {CS85 34}, 26271 type = {Technical Report} 26272} 26273 26274@Article{ butler.martin:method, 26275 author = {T. Butler and A. V. Martin}, 26276 title = {On a Method of {C}ourant for Minimizing Functionals}, 26277 journal = {Journal of Mathematical Physics}, 26278 year = {1962}, 26279 volume = {41}, 26280 pages = {291--299} 26281} 26282 26283@Article{ calamai.more:projected, 26284 author = {P. H. Calamai and J. J. Mor\'{e}}, 26285 title = {Projected Gradient Methods for Linearly Constrained Problems}, 26286 journal = {Mathematical Programming}, 26287 year = {1987}, 26288 volume = {39}, 26289 pages = {93--116} 26290} 26291 26292@Article{ cao.ferris:genetic, 26293 author = {M. Cao and M. C. Ferris}, 26294 title = {Genetic Algorithms in Optimization}, 26295 journal = {Journal of Undergraduate Mathematics and its Applications}, 26296 year = {1991}, 26297 volume = {12}, 26298 pages = {81--90}, 26299 key = {17} 26300} 26301 26302@Article{ cao.ferris:interior, 26303 author = {M. Cao and M. C. Ferris}, 26304 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 26305 journal = {Journal of Optimization Theory and Applications}, 26306 year = {1994}, 26307 volume = {83}, 26308 pages = {269--283}, 26309 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 26310 key = {28} 26311} 26312 26313@Article{ cao.ferris:lineality, 26314 author = {M. Cao and M. C. Ferris}, 26315 title = {Lineality Removal for Copositive--Plus Normal Maps}, 26316 year = {1995}, 26317 volume = {2}, 26318 pages = {1--10}, 26319 journal = {Communications on Applied Nonlinear Analysis}, 26320 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 26321 key = {38} 26322} 26323 26324@Article{ cao.ferris:pc, 26325 author = {M. Cao and M. C. Ferris}, 26326 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 26327 journal = {Linear Algebra and Its Applications}, 26328 year = {1996}, 26329 volume = {246}, 26330 pages = {299--312}, 26331 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 26332 key = {37} 26333} 26334 26335@Article{ cao.ferris:pivotal, 26336 author = {M. Cao and M. C. Ferris}, 26337 title = {A Pivotal Method for Affine Variational Inequalities}, 26338 journal = {Mathematics of Operations Research}, 26339 year = {1996}, 26340 volume = {21}, 26341 pages = {44--64}, 26342 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 26343 key = {29} 26344} 26345 26346@PhDThesis{ cao:piecewise, 26347 author = {M. Cao}, 26348 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 26349 school = {Computer Sciences Department, University of Wisconsin}, 26350 year = {1994}, 26351 address = {Madison, Wisconsin}, 26352 note = {Technical Report 1210} 26353} 26354 26355@Article{ caroe.schultz:dual, 26356 author = {C. C. Car{\o}e and R. Schultz}, 26357 title = {Dual Decomposition in Stochastic Integer Programming}, 26358 journal = {Operations Research Letters}, 26359 volume = {24}, 26360 pages = {37-45}, 26361 year = {1999} 26362} 26363 26364@Article{ carol.targovnik.ea:initial, 26365 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 26366 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 26367 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 26368 conformal radiation therapy system}, 26369 journal = {Stereotactic and Functional Neurosurgery}, 26370 year = {1996}, 26371 volume = {66}, 26372 pages = {30--34} 26373} 26374 26375@Article{ carolan.hill.ea:empirical, 26376 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 26377 Wichmann}, 26378 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 26379 Applications}, 26380 journal = {Operations Research}, 26381 year = {1990}, 26382 volume = {38}, 26383 pages = {240--248} 26384} 26385 26386@Article{ carroll:created, 26387 author = {C. W. Carroll}, 26388 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 26389 Systems}, 26390 journal = {Operations Research}, 26391 year = {1961}, 26392 volume = {9}, 26393 pages = {169--184} 26394} 26395 26396@PhDThesis{ carroll:operations, 26397 author = {C. W. Carroll}, 26398 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 26399 Process}, 26400 year = {1959}, 26401 address = {Appleton, Wisconsin}, 26402 school = {Institute of Paper Chemistry} 26403} 26404 26405@TechReport{ casanova.dongarra:netsolve, 26406 author = {H. Casanova and J. Dongarra}, 26407 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 26408 institution = {University of Tennessee}, 26409 year = {1996}, 26410 type = {Technical Report} 26411} 26412 26413@TechReport{ cavalier.soyster:computational, 26414 author = {T. M. Cavalier and A. L. Soyster}, 26415 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 26416 institution = {Pennsylvania State University}, 26417 year = {1985}, 26418 address = {Pennsylvania}, 26419 number = {85-105}, 26420 type = {ISME Working Paper} 26421} 26422 26423@TechReport{ censor.iusem.ea:interior-point, 26424 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 26425 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 26426 Problem with Paramonotone Operators}, 26427 institution = {University of Haifa}, 26428 year = {1994}, 26429 type = {Working Paper} 26430} 26431 26432@Article{ censor.lent:iterative, 26433 author = {Y. Censor and A. Lent}, 26434 title = {An Iterative Row-Action Method for Interval Convex Programming}, 26435 journal = {Journal of Optimization Theory and Applications}, 26436 year = {1981}, 26437 volume = {34}, 26438 pages = {275--291} 26439} 26440 26441@InCollection{ censor.pierro.ea:iterative, 26442 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 26443 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 26444 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 26445 XXIV}, 26446 publisher = {Banach Center}, 26447 year = {1987}, 26448 editor = {A. J. Wakulicz}, 26449 address = {Warsaw, Poland} 26450} 26451 26452@Article{ censor.segman:block-iterative, 26453 author = {Y. Censor and J. Segman}, 26454 title = {On Block-Iterative Entropy Maximization}, 26455 journal = {Journal of Information and Optimization Science}, 26456 year = {1987}, 26457 volume = {8}, 26458 pages = {275--291} 26459} 26460 26461@Article{ censor.zenios:proximal, 26462 author = {Y. Censor and S. A. Zenios}, 26463 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 26464 journal = {Journal of Optimization Theory and Applications}, 26465 year = {1992}, 26466 volume = {73}, 26467 pages = {451--464} 26468} 26469 26470@Article{ censor:parallel, 26471 author = {Yair Censor}, 26472 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 26473 Therapy}, 26474 journal = {Mathematical Programming}, 26475 year = {1988}, 26476 volume = {42}, 26477 pages = {307--325} 26478} 26479 26480@Article{ censor:row-action, 26481 author = {Yair Censor}, 26482 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 26483 journal = {SIAM Review}, 26484 year = {1981}, 26485 volume = {23}, 26486 pages = {444--466} 26487} 26488 26489@Article{ chajakis.zenios:synchronous, 26490 author = {E. D. Chajakis and S. A. Zenios}, 26491 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 26492 Nonlinear Network Optimization}, 26493 journal = {Parallel Computing}, 26494 year = {1990}, 26495 note = {To appear} 26496} 26497 26498@Article{ chamberlain.powell.ea:watchdog, 26499 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 26500 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 26501 Optimization}, 26502 journal = {Mathematical Programming Study}, 26503 year = {1982}, 26504 volume = {16}, 26505 pages = {1--17} 26506} 26507 26508@Article{ chan.pang:generalized, 26509 author = {D. Chan and J. S. Pang}, 26510 title = {The Generalized Quasi-Variational Inequality Problem}, 26511 journal = {Mathematics of Operations Research}, 26512 volume = {7}, 26513 pages = {211--222}, 26514 year = {1982} 26515} 26516 26517@Article{ charalambous:nonlinear, 26518 author = {C. Charalambous}, 26519 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 26520 journal = {Mathematical Programming}, 26521 year = {1977}, 26522 volume = {12}, 26523 pages = {195--225} 26524} 26525 26526@Article{ charnes.cooper.ea:duality, 26527 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 26528 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 26529 journal = {Proceedings of the National Academy of Sciences of the United States}, 26530 year = {1962}, 26531 pages = {783--786} 26532} 26533 26534@Book{ charnes.cooper.ea:introduction, 26535 author = {A. Charnes and W. W. Cooper and A. Henderson}, 26536 title = {An Introduction to Linear Programming}, 26537 year = {1953}, 26538 publisher = {John Wiley \& Sons}, 26539 address = {New York} 26540} 26541 26542@TechReport{ charnes.semple:practical, 26543 author = {A. Charnes and J. Semple}, 26544 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 26545 institution = {CCS}, 26546 year = {1991}, 26547 address = {Austin, Texas}, 26548 number = {663}, 26549 type = {Research Report} 26550} 26551 26552@InProceedings{ charnes:fundamental, 26553 author = {A. Charnes}, 26554 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 26555 booktitle = {Computer and Information Sciences}, 26556 year = {1964}, 26557 editor = {J. T. Lou and R. H. Wilcox}, 26558 publisher = {Spartan Books}, 26559 address = {Washington, D.C.}, 26560 pages = {67--74} 26561} 26562 26563@TechReport{ chen.chen.ea:penalized, 26564 author = {B. Chen and X. Chen and C. Kanzow}, 26565 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 26566 Numerical Results}, 26567 institution = {Institute of Applied Mathematics, University of Hamburg}, 26568 year = {1997}, 26569 type = {Preprint}, 26570 number = {126}, 26571 address = {Hamburg, Germany} 26572} 26573 26574@Article{ chen.chen:global, 26575 author = {B. Chen and X. Chen}, 26576 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 26577 ${R}_0$ {NCP} or Monotone {NCP}}, 26578 journal = {SIAM Journal on Optimization}, 26579 year = {1999}, 26580 volume = {9}, 26581 pages = {624--645} 26582} 26583 26584@Article{ chen.ferris.ea:fatcop, 26585 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 26586 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 26587 Solver}, 26588 journal = {Annals of Operations Research, forthcoming}, 26589 year = {2000}, 26590 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 26591 key = {89}, 26592 type = {Data Mining Institute Technical Report}, 26593 institution = {Computer Sciences Department, University of Wisconsin}, 26594 address = {Madison, Wisconsin}, 26595 number = {99-11} 26596} 26597 26598@TechReport{ chen.ferris:fatcop, 26599 author = {Q. Chen and M. C. Ferris}, 26600 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 26601 type = {Mathematical Programming Technical Report}, 26602 institution = {Computer Sciences Department, University of Wisconsin}, 26603 address = {Madison, Wisconsin}, 26604 year = {1999}, 26605 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 26606 number = {99-05}, 26607 key = {81}, 26608 annote = {Submitted to {\em SIOPT}} 26609} 26610 26611@Article{ chen.florian:nonlinear, 26612 author = {Y. Chen and M. Florian}, 26613 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 26614 Optimality Conditions}, 26615 journal = {Optimization}, 26616 year = {1995}, 26617 volume = {32}, 26618 pages = {193--209} 26619} 26620 26621@TechReport{ chen.florian:o-d, 26622 author = {Y. Chen and M. Florian}, 26623 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 26624 optimality conditions}, 26625 type = {Publication}, 26626 number = {CRT-94-56}, 26627 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 26628 address = {Montr\'eal, Canada}, 26629 year = {1994} 26630} 26631 26632@Article{ chen.harker:continuation, 26633 author = {B. Chen and P. T. Harker}, 26634 title = {A Continuation Method for Monotone Variational Inequalities}, 26635 journal = {Mathematical Programming}, 26636 volume = {69}, 26637 pages = {237--253}, 26638 year = {1995} 26639} 26640 26641@Article{ chen.harker:non-interior, 26642 author = {B. Chen and P. T. Harker}, 26643 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 26644 journal = {SIAM Journal on Matrix Analysis and Applications}, 26645 year = {1993}, 26646 volume = {14}, 26647 pages = {1168--1190} 26648} 26649 26650@Article{ chen.harker:smooth, 26651 author = {B. Chen and P. T. Harker}, 26652 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 26653 journal = {SIAM Journal on Optimization}, 26654 year = {1997}, 26655 volume = {7}, 26656 pages = {403--420} 26657} 26658 26659@Article{ chen.mangasarian:class, 26660 author = {Chunhui Chen and O. L. Mangasarian}, 26661 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 26662 journal = {Computational Optimization and Applications}, 26663 year = {1996}, 26664 volume = {5}, 26665 pages = {97--138} 26666} 26667 26668@Article{ chen.mangasarian:smoothing, 26669 author = {Chunhui Chen and O. L. Mangasarian}, 26670 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 26671 journal = {Mathematical Programming}, 26672 year = {1995}, 26673 volume = {78}, 26674 pages = {51--70} 26675} 26676 26677@Article{ chen.nashed.ea:convergence, 26678 author = {X. Chen and Z. Nashed and L. Qi}, 26679 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 26680 using Adaptive Outer Inverses}, 26681 year = {1997}, 26682 journal = {SIAM Journal on Optimization}, 26683 volume = {7}, 26684 pages = {445--462} 26685} 26686 26687@Article{ chen.qi.ea:global, 26688 author = {X. Chen and L. Qi and D. Sun}, 26689 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 26690 Application to General Box Constrained Variational Inequalities}, 26691 year = {1998}, 26692 journal = {Mathematics of Computation}, 26693 volume = {67}, 26694 pages = {519--540} 26695} 26696 26697@Article{ chen.teboulle:convergence, 26698 author = {G. Chen and M. Teboulle}, 26699 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 26700 Functions}, 26701 journal = {SIAM Journal on Optimization}, 26702 year = {1993}, 26703 volume = {3}, 26704 pages = {538--543} 26705} 26706 26707@Article{ chen.ye:homotopy-smoothing, 26708 author = {X.~Chen and Y.~Ye}, 26709 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 26710 year = {1999}, 26711 journal = {SIAM Journal on Control and Optimization}, 26712 volume = {37}, 26713 pages = {589--616} 26714} 26715 26716@PhDThesis{ chen:forward-backward, 26717 author = {G. H.--G. Chen}, 26718 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 26719 school = {University of Washington}, 26720 year = {1994} 26721} 26722 26723@PhDThesis{ chen:smoothing, 26724 author = {Chunhui Chen}, 26725 title = {Smoothing Methods in Mathematical Programming}, 26726 school = {Computer Sciences Department, University of Wisconsin}, 26727 year = {1995}, 26728 address = {Madison, Wisconsin}, 26729 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26730 annote = {Mathematical Programming Technical Report 95-12} 26731} 26732 26733@Book{ cheney:introduction, 26734 author = {E. W. Cheney}, 26735 title = {Introduction to Approximation Theory}, 26736 year = {1966}, 26737 publisher = {McGraw--Hill}, 26738 address = {New York} 26739} 26740 26741@Article{ cho.kuterdem.ea:spherical, 26742 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 26743 title = {A spherical dose model for radiosurgery treatment planning}, 26744 journal = {Physics in Medicine and Biology}, 26745 year = {1998}, 26746 volume = {43}, 26747 pages = {3145--3148} 26748} 26749 26750@Article{ cho.lee.ea:optimization, 26751 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 26752 title = {Optimization of intensity modulated beams with volume constraints using two 26753 methods: cost function minimization and projection onto convex sets}, 26754 journal = {Medical Physics}, 26755 year = {1998}, 26756 volume = {25}, 26757 number = {4}, 26758 pages = {435--443} 26759} 26760 26761@Article{ choi.desarbo.ea:product, 26762 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 26763 title = {Product Positioning Under Price Competition}, 26764 journal = {Management Science}, 26765 year = {1990}, 26766 volume = {36}, 26767 pages = {175--199} 26768} 26769 26770@Article{ chow.mallet-parret.ea:finding, 26771 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 26772 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 26773 One}, 26774 journal = {Mathematics of Computing}, 26775 year = {1978}, 26776 volume = {32}, 26777 pages = {887--899} 26778} 26779 26780@Article{ christopherson:mathematical, 26781 author = {D. G. Christopherson}, 26782 title = {A new mathematical method for the solution of film lubrication problems}, 26783 journal = {Proceedings of the Institute of Mechanical Engineers}, 26784 volume = {146}, 26785 year = {1941}, 26786 pages = {126--135} 26787} 26788 26789@TechReport{ chun.lee.ea:implementation, 26790 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 26791 title = {An Implementation of the Bundle Decomposition Algorithm}, 26792 institution = {Department of Industrial Engineering, University of Wisconsin}, 26793 year = {1991}, 26794 address = {Madison, Wisconsin}, 26795 number = {91-6} 26796} 26797 26798@Article{ chung:np-completeness, 26799 author = {S.--J. Chung}, 26800 title = {{NP}-Completeness of the Linear Complementarity Problem}, 26801 journal = {Journal of Optimization Theory and Applications}, 26802 volume = {60}, 26803 year = {1989}, 26804 pages = {393--399} 26805} 26806 26807@Book{ chvatal:linear, 26808 author = {V. Chv\'atal}, 26809 title = {Linear Programming}, 26810 year = {1983}, 26811 publisher = {W. H. Freeman and Company}, 26812 address = {New York} 26813} 26814 26815@Book{ ciarlet:finite, 26816 author = {P. G. Ciarlet}, 26817 title = {The Finite Element Method for Elliptic Problems}, 26818 year = {1978}, 26819 publisher = {North-Holland}, 26820 address = {New York} 26821} 26822 26823@Article{ cinquini.contro:optimal, 26824 author = {C. Cinquini and R. Contro}, 26825 title = {Optimal design of beams discretized by elastic plastic finite element}, 26826 journal = {Computers \& Structures}, 26827 volume = {20}, 26828 year = {1985}, 26829 pages = {475--585} 26830} 26831 26832@Book{ clarke:optimization, 26833 author = {F. H. Clarke}, 26834 title = {Optimization and Nonsmooth Analysis}, 26835 year = {1983}, 26836 publisher = {John Wiley \& Sons}, 26837 address = {New York} 26838} 26839 26840@InProceedings{ cleveland.smith:genetic, 26841 crossref = {schaeffer:third}, 26842 author = {G. A. Cleveland and S. F. Smith}, 26843 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 26844 pages = {160--169} 26845} 26846 26847@Book{ cochran:sampling, 26848 author = {W. Cochran}, 26849 title = {Sampling Techniques}, 26850 publisher = {Wiley}, 26851 year = {1977}, 26852 address = {New York}, 26853 edition = {Third} 26854} 26855 26856@Article{ coleman.conn:nonlinear, 26857 author = {T. F. Coleman and A. R. Conn}, 26858 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 26859 journal = {Mathematical Programming}, 26860 year = {1982}, 26861 volume = {24}, 26862 pages = {123--136} 26863} 26864 26865@Article{ coleman.conn:nonlinear*1, 26866 author = {T. F. Coleman and A. R. Conn}, 26867 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 26868 journal = {Mathematical Programming}, 26869 year = {1982}, 26870 volume = {24}, 26871 pages = {137--161} 26872} 26873 26874@TechReport{ coleman.liu:interior, 26875 author = {T. F. Coleman and J. Liu}, 26876 title = {An interior newton method for quadratic programming}, 26877 institution = {Dept. of Computer Science, Cornell University}, 26878 year = {1993}, 26879 number = {TR 93-1388}, 26880 address = {Ithaca, NY}, 26881 month = oct 26882} 26883 26884@Article{ coleman.more:estimation, 26885 author = {T. F. Coleman and J. J. Mor\'{e}}, 26886 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 26887 journal = {SIAM Journal on Numerical Analysis}, 26888 year = {1983}, 26889 volume = {20}, 26890 pages = {187--209} 26891} 26892 26893@Manual{ coleman.verma:admat, 26894 author = {T. F. Coleman and A. Verma}, 26895 title = {{ADMAT} User Guide}, 26896 year = {2000} 26897} 26898 26899@TechReport{ colville:comparative, 26900 author = {A. R. Colville}, 26901 title = {A Comparative Study on Nonlinear Programming Codes}, 26902 institution = {IBM New York Scientific Center}, 26903 year = {1968}, 26904 month = jun, 26905 number = {320--2949}, 26906 type = {Technical Report} 26907} 26908 26909@Article{ comi.maier:extremum, 26910 author = {C. Comi and G. Maier}, 26911 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 26912 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 26913 journal = {European Journal Mechanics A/Solids}, 26914 volume = {9}, 26915 year = {1990}, 26916 pages = {563--585} 26917} 26918 26919@Misc{ condon.dahl.ea:implementing, 26920 author = {T. Condon and H. Dahl and S. Devarajan}, 26921 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 26922 Model}, 26923 year = {1987}, 26924 howpublished = {{DRD} Discussion Paper 290}, 26925 note = {The World Bank, Washington DC} 26926} 26927 26928@Book{ conn.gould.ea:lancelot, 26929 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26930 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 26931 (Release {A})}, 26932 year = {1992}, 26933 publisher = {Springer Verlag}, 26934 address = {Heidelberg, Berlin}, 26935 series = {Springer Series in Computational Mathematics}, 26936 number = {17} 26937} 26938 26939@Article{ conn.gould.ea:numerical, 26940 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26941 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 26942 Nonlinear Optimization}, 26943 journal = {Mathematical Programming}, 26944 year = {1996}, 26945 volume = {75}, 26946 pages = {73--110} 26947} 26948 26949@Book{ cgt, 26950 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26951 title = {Trust-Region Methods}, 26952 year = {2000}, 26953 publisher = {SIAM}, 26954 address = {Philadelphia, Pennsylvania} 26955} 26956 26957@InCollection{ conn.toint:algorithm, 26958 author = {A. R. Conn and Ph. L. Toint}, 26959 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 26960 Optimization}, 26961 booktitle = {Nonlinear Optimization and Applications}, 26962 editor = {G. Di Pillo and F. Giannessi}, 26963 year = {1996}, 26964 publisher = {Plenum Press}, 26965 address = {New York} 26966} 26967 26968@Article{ conry.seireg:mathematical, 26969 author = {T. F. Conry and A. Seireg}, 26970 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 26971 journal = {{ASME} Transactions Journal of Applied Mechanics}, 26972 volume = {93}, 26973 year = {1971}, 26974 pages = {387--392} 26975} 26976 26977@Article{ cook.gerards.ea:sensitivity, 26978 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 26979 title = {Sensitivity Results in Integer Linear Programming}, 26980 journal = {Mathematical Programming}, 26981 year = {1986}, 26982 volume = {34}, 26983 pages = {251--264} 26984} 26985 26986@Article{ cook:taxonomy, 26987 author = {S. A. Cook}, 26988 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 26989 journal = {Information and Control}, 26990 year = {1985}, 26991 volume = {64}, 26992 pages = {2--22} 26993} 26994 26995@Article{ cooper:gradient, 26996 author = {R. E. M. Cooper}, 26997 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 26998 journal = {Radiology}, 26999 year = {1978}, 27000 volume = {128}, 27001 pages = {235--243} 27002} 27003 27004@Article{ cormack:problem, 27005 author = {A. M. Cormack}, 27006 title = {A problem in roatation therapy with x-rays}, 27007 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27008 year = {1987}, 27009 volume = {13}, 27010 pages = {623--630} 27011} 27012 27013@Article{ cormack:problem*1, 27014 author = {A. M. Cormack}, 27015 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 27016 symmetry}, 27017 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27018 year = {1987}, 27019 volume = {13}, 27020 pages = {1921--1925} 27021} 27022 27023@Article{ cottle.dantzig:complementary, 27024 author = {R. W. Cottle and G. B. Dantzig}, 27025 title = {Complementary Pivot Theory of Mathematical Programming}, 27026 journal = {Linear Algebra and Its Applications}, 27027 year = {1968}, 27028 volume = {1}, 27029 pages = {103--125} 27030} 27031 27032@Article{ cottle.dantzig:generalization, 27033 author = {R. W. Cottle and G. B. Dantzig}, 27034 title = {A Generalization of the Linear Complementarity Problem}, 27035 journal = {Journal of Combinatorial Theory}, 27036 year = {1970}, 27037 volume = {8}, 27038 pages = {79--90} 27039} 27040 27041@Book{ cottle.giannessi.ea:variational, 27042 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 27043 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 27044 year = {1980}, 27045 publisher = {John Wiley \& Sons}, 27046 address = {New York} 27047} 27048 27049@InCollection{ cottle.goheen:special, 27050 author = {R. W. Cottle and M. S. Goheen}, 27051 title = {A Special Class of Large Quadratic Programs}, 27052 pages = {361--390}, 27053 crossref = {mangasarian.meyer.ea:nonlinear*3} 27054} 27055 27056@Article{ cottle.golub.ea:solution, 27057 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 27058 title = {On the Solution of Large Structured Complementarity Problems: The Block 27059 Partitioned Case}, 27060 journal = {Applied Mathematics and Optimization}, 27061 year = {1978}, 27062 volume = {4}, 27063 pages = {347--363} 27064} 27065 27066@Book{ cottle.pang.ea:linear, 27067 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 27068 title = {The Linear Complementarity Problem}, 27069 year = {1992}, 27070 publisher = {Academic Press}, 27071 address = {Boston} 27072} 27073 27074@Article{ cottle.pang.ea:sufficient, 27075 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 27076 title = {Sufficient Matrices and the Linear Complementarity Problem}, 27077 journal = {Linear Algebra and Its Applications}, 27078 year = {1989}, 27079 volume = {114/115}, 27080 pages = {231--249} 27081} 27082 27083@PhDThesis{ cottle:nonlinear, 27084 author = {R. W. Cottle}, 27085 title = {Nonlinear programs with positively bounded {J}acobians}, 27086 school = {Department of Mathematics, University of California}, 27087 year = {1964}, 27088 address = {Berkeley, California} 27089} 27090 27091@Article{ cottle:nonlinear*1, 27092 author = {R. W. Cottle}, 27093 title = {Nonlinear programs with positively bounded {J}acobians}, 27094 journal = {Journal of the Society for Industrial and Applied Mathematics}, 27095 volume = {14}, 27096 year = {1966}, 27097 pages = {147--158} 27098} 27099 27100@InCollection{ cottle:principal, 27101 author = {R. W. Cottle}, 27102 title = {The principal pivoting method of quadratic programming}, 27103 booktitle = {Mathematics of the Decision Sciences, Part 1}, 27104 publisher = {American Mathematical Society}, 27105 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 27106 address = {Providence, Rhode Island}, 27107 year = {1968}, 27108 pages = {144--162} 27109} 27110 27111@Unpublished{ courant:calculus, 27112 author = {R. Courant}, 27113 title = {Calculus of Variations and Supplementary Notes and Exercises}, 27114 year = {1956}, 27115 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 27116 New York University} 27117} 27118 27119@Article{ courant:variational, 27120 author = {R. Courant}, 27121 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 27122 journal = {Bulletin of the American Mathematical Society}, 27123 year = {1943}, 27124 volume = {49}, 27125 pages = {1--23} 27126} 27127 27128@Book{ cristianini.shawe-taylor:introduction, 27129 author = {N. Cristianini and J. Shawe-Taylor}, 27130 title = {An Introduction to Support Vector Machines}, 27131 publisher = {Cambridge University Press}, 27132 address = {Cambridge}, 27133 year = {2000} 27134} 27135 27136@Article{ cromme:strong, 27137 author = {L. Cromme}, 27138 title = {Strong Uniqueness}, 27139 journal = {Numerische Mathematik}, 27140 year = {1978}, 27141 volume = {29}, 27142 pages = {179--193} 27143} 27144 27145@Article{ crowder.johnson.ea:solving, 27146 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 27147 title = {Solving Large Scale Zero-One Linear Programming Problems}, 27148 journal = {Operations Research}, 27149 year = {1983}, 27150 volume = {31}, 27151 pages = {803--834} 27152} 27153 27154@Article{ cryer.dempster:equivalence, 27155 author = {C. W. Cryer and M. A. H. Dempster}, 27156 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 27157 Lattice {H}ilbert Spaces}, 27158 journal = {SIAM Journal on Control and Optimization}, 27159 year = {1980}, 27160 volume = {18}, 27161 pages = {76--89} 27162} 27163 27164@Article{ cryer:method, 27165 author = {C. W. Cryer}, 27166 title = {The method of {C}hristopherson for solving free boundary problems for infinite 27167 journal bearings by means of finite differences}, 27168 journal = {Mathematics of Computation}, 27169 volume = {25}, 27170 year = {1971}, 27171 pages = {435--553} 27172} 27173 27174@Article{ cryer:solution, 27175 author = {C. W. Cryer}, 27176 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 27177 journal = {SIAM Journal on Control and Optimization}, 27178 year = {1971}, 27179 volume = {9}, 27180 pages = {385--392} 27181} 27182 27183@Article{ cryer:solution*1, 27184 author = {C. W. Cryer}, 27185 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 27186 journal = {SIAM Journal on Control}, 27187 year = {1971}, 27188 volume = {9}, 27189 pages = {385--392} 27190} 27191 27192@Manual{ culler:split-c, 27193 author = {D. Culler}, 27194 title = {The Split--{C} Programming Language}, 27195 organization = {Computer Science Department, University of California, Berkeley} 27196} 27197 27198@InProceedings{ cun.denker.ea:optimal, 27199 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 27200 title = {Optimal Brain Damage}, 27201 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 27202 year = {1990}, 27203 editor = {D. S. Touretzky}, 27204 publisher = {Morgan Kaufmann}, 27205 address = {San Mateo, California}, 27206 pages = {598--605} 27207} 27208 27209@TechReport{ czyzyk.mehrotra.ea:pcx, 27210 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 27211 title = {{PCx} Users Guide}, 27212 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 27213 University}, 27214 year = {1996}, 27215 type = {Technical Report}, 27216 number = {OTC 96/01} 27217} 27218 27219@TechReport{ czyzyk.mesnier.ea:network-enabled, 27220 address = {Argonne, Illinois}, 27221 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 27222 institution = {Argonne National Laboratory}, 27223 number = {MCS-P615-0996}, 27224 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 27225 type = {Preprint}, 27226 year = {1996} 27227} 27228 27229@Article{ czyzyk.wisniewski.ea:optimization, 27230 title = {Optimization Case Studies in the {NEOS} Guide}, 27231 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 27232 journal = {SIAM Review}, 27233 volume = {41}, 27234 pages = {148--163}, 27235 year = {1999} 27236} 27237 27238@Article{ dai.laan.ea:simplicial, 27239 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 27240 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 27241 Polyhedron}, 27242 journal = {SIAM Journal on Optimization}, 27243 year = {1991}, 27244 volume = {1}, 27245 pages = {151--165} 27246} 27247 27248@Article{ dai.talman:linear, 27249 author = {Y. Dai and D. Talman}, 27250 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 27251 journal = {Mathematics of Operations Research}, 27252 year = {1993}, 27253 pages = {635--644} 27254} 27255 27256@Book{ daniel:approximate, 27257 author = {J. W. Daniel}, 27258 title = {The approximate minimization of functionals}, 27259 year = {1971}, 27260 publisher = {Prentice-Hall, Inc}, 27261 address = {Englewood Cliffs, New Jersey} 27262} 27263 27264@Article{ danskin:theory, 27265 author = {J. M. Danskin}, 27266 title = {The Theory of Min--Max, with Applications}, 27267 journal = {SIAM Journal on Applied Mathematics}, 27268 year = {1964}, 27269 volume = {14}, 27270 pages = {641--664} 27271} 27272 27273@Book{ danskin:theory*1, 27274 author = {J. M. Danskin}, 27275 title = {The Theory of Min--Max}, 27276 year = {1967}, 27277 publisher = {Springer-Verlag}, 27278 address = {New York} 27279} 27280 27281@InCollection{ dantzig.cottle:positive, 27282 author = {G. B. Dantzig and R. W. Cottle}, 27283 title = {Positive (semi-)definite programming}, 27284 booktitle = {Nonlinear Programming}, 27285 publisher = {North-Holland}, 27286 editor = {J. Abadie}, 27287 address = {Amsterdam}, 27288 year = {1967}, 27289 pages = {55--73} 27290} 27291 27292@Article{ dantzig.manne:complementarity, 27293 author = {G. B. Dantzig and A. S. Manne}, 27294 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 27295 Proportions}, 27296 journal = {Journal of Economic Theory}, 27297 year = {1974}, 27298 volume = {9}, 27299 pages = {312--323} 27300} 27301 27302@Article{ dantzig.wolfe:decomposition, 27303 author = {G. B. Dantzig and P. Wolfe}, 27304 title = {Decomposition Principle for Linear Programs}, 27305 journal = {Operations Research}, 27306 year = {1960}, 27307 volume = {8}, 27308 pages = {101--111} 27309} 27310 27311@Book{ dantzig:linear, 27312 author = {G. B. Dantzig}, 27313 title = {Linear Programming and Extensions}, 27314 year = {1963}, 27315 publisher = {Princeton University Press}, 27316 address = {Princeton, New Jersey} 27317} 27318 27319@Manual{ dash:xpress-mp, 27320 title = {{XPRESS-MP} User Guide}, 27321 organization = {Dash Associates}, 27322 address = {Blisworth House, Blisworth, Northants, UK}, 27323 note = {http://www.dashopt.com/} 27324} 27325 27326@Book{ davis:handbook, 27327 author = {L. D. Davis}, 27328 title = {The Handbook of Genetic Algorithms}, 27329 year = {1990}, 27330 publisher = {Van Nostrand Reinhold} 27331} 27332 27333@TechReport{ davis:users, 27334 author = {T. A. Davis}, 27335 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 27336 type = {{Technical Report}}, 27337 year = {1993}, 27338 institution = {Computer and Information Sciences Department, University of Florida}, 27339 address = {Gainesville, Florida} 27340} 27341 27342@TechReport{ dax:computation, 27343 author = {A. Dax}, 27344 title = {The Computation of Descent Directions at Degenerate Points}, 27345 institution = {Hydrological Service of Israel}, 27346 year = {1985}, 27347 type = {Technical Report} 27348} 27349 27350@Article{ dax:note, 27351 author = {A. Dax}, 27352 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 27353 Problem}, 27354 journal = {Mathematical Programming}, 27355 year = {1986}, 27356 volume = {36}, 27357 pages = {72--80} 27358} 27359 27360@Article{ deasy:multiple, 27361 author = {J. O. Deasy}, 27362 title = {Multiple local minima in radiotherapy optimization problems with dose volume 27363 constraints}, 27364 journal = {Medical Physics}, 27365 year = {1997}, 27366 optvolume = {24}, 27367 optnumber = {7}, 27368 optpages = {1157-1161} 27369} 27370 27371@Article{ deboor.ron:computational, 27372 author = {C. {deBoor} and A. Ron}, 27373 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 27374 journal = {Mathematics of Computation}, 27375 year = {1992}, 27376 volume = {58}, 27377 pages = {705--727} 27378} 27379 27380@Article{ debremaecker.ferris.ea:compressional, 27381 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 27382 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 27383 Problems}, 27384 year = {2000}, 27385 key = {82}, 27386 journal = {Engineering Fracture Mechanics}, 27387 volume = {66}, 27388 pages = {287--303} 27389} 27390 27391@Article{ debremaecker.ferris:comparison, 27392 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 27393 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 27394 year = {2000}, 27395 key = {90}, 27396 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 27397 journal = {Engineering Fracture Mechanics}, 27398 volume = {66}, 27399 pages = {601--605}, 27400 institution = {Computer Sciences Department, University of Wisconsin}, 27401 address = {Madison, Wisconsin}, 27402 number = {00-01} 27403} 27404 27405@Article{ dedonato.maier:mathematical, 27406 author = {O. {De~Donato} and G. Maier}, 27407 title = {Mathematical programming methods for the inelastic analysis of reinforced 27408 concrete frames allowing for limited rotation capacity}, 27409 journal = {International Journal for Numerical Methods in Engineering}, 27410 volume = {4}, 27411 year = {1972}, 27412 pages = {307--329} 27413} 27414 27415@Book{ deimling:nonlinear, 27416 author = {K. Deimling}, 27417 title = {Nonlinear Functional Analysis}, 27418 publisher = {Springer-Verlag}, 27419 year = {1985} 27420} 27421 27422@PhDThesis{ dejong:analysis, 27423 author = {K. A. De~Jong}, 27424 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 27425 year = {1975}, 27426 school = {University of Michigan}, 27427 note = {Dissertation Abstracts International 36(10), 5140B} 27428} 27429 27430@Article{ deleone.mangasarian.ea:multi-sweep, 27431 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 27432 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 27433 Linear Complementarity Problem}, 27434 journal = {Annals of Operations Research}, 27435 year = {1990}, 27436 volume = {22}, 27437 pages = {43--54} 27438} 27439 27440@InCollection{ deleone.mangasarian:serial, 27441 author = {R. {De~Leone} and O. L. Mangasarian}, 27442 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 27443 {L}agrangian Successive Overrelaxation}, 27444 booktitle = {Optimization, Parallel Processing and Applications}, 27445 publisher = {Springer-Verlag}, 27446 year = {1988}, 27447 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 27448 volume = {304}, 27449 series = {Lecture Notes in Economics and Mathematical Systems}, 27450 pages = {103--124}, 27451 address = {Berlin} 27452} 27453 27454@TechReport{ deluca.facchinei.ea:combining, 27455 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27456 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 27457 Complementarity Problems: Theory and Numerical Results}, 27458 type = {Preprint}, 27459 institution = {Institute of Applied Mathematics, University of Hamburg}, 27460 year = {1996} 27461} 27462 27463@TechReport{ deluca.facchinei.ea:general, 27464 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27465 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 27466 Numerical Results}, 27467 type = {Preprint}, 27468 institution = {Institute of Applied Mathematics, University of Hamburg}, 27469 year = {1997} 27470} 27471 27472@Article{ deluca.facchinei.ea:semismooth, 27473 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27474 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 27475 Problems}, 27476 journal = {Mathematical Programming}, 27477 volume = {75}, 27478 pages = {407--439}, 27479 year = {1996} 27480} 27481 27482@Article{ deluca.facchinei.ea:theoretical, 27483 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27484 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 27485 Complementarity Problems}, 27486 year = {1999}, 27487 journal = {Computational Optimization and Applications, forthcoming} 27488} 27489 27490@Article{ demarzo.eaves:computing, 27491 author = {P. M. DeMarzo and B. C. Eaves}, 27492 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 27493 journal = {Journal of Mathematical Economics}, 27494 year = {1996}, 27495 volume = {26}, 27496 pages = {479--497} 27497} 27498 27499@Article{ dembo.steihaug:truncated, 27500 author = {R. S. Dembo and T. Steihaug}, 27501 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 27502 Optimization}, 27503 journal = {Mathematical Programming}, 27504 year = {1983}, 27505 volume = {26}, 27506 pages = {190--212} 27507} 27508 27509@Article{ dembo:performance, 27510 author = {R. S. Dembo}, 27511 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 27512 journal = {Mathematical Programming Study}, 27513 year = {1986}, 27514 volume = {26}, 27515 pages = {245--248} 27516} 27517 27518@Article{ demoor.vandenberghe.ea:generalized, 27519 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 27520 title = {The generalized linear complementarity problem and an algorithm to find all its 27521 solutions}, 27522 journal = {Mathematical Programming}, 27523 volume = {57}, 27524 year = {1992}, 27525 pages = {415--426} 27526} 27527 27528@Book{ demyanov.vasilev:nondifferentiable, 27529 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 27530 title = {Nondifferentiable Optimization}, 27531 publisher = {Optimization Software, Inc.}, 27532 year = {1985}, 27533 address = {New York} 27534} 27535 27536@Article{ dennis.torczon:direct, 27537 author = {J. E. Dennis and V. Torczon}, 27538 title = {Direct Search Methods on Parallel Machines}, 27539 journal = {SIAM Journal on Optimization}, 27540 year = {1991}, 27541 volume = {1}, 27542 pages = {448--474} 27543} 27544 27545@TechReport{ depierro.iusem:convergence, 27546 author = {A. R. {De~Pierro} and A. N. Iusem}, 27547 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 27548 Linear Complementarity Problems}, 27549 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 27550 year = {1990}, 27551 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 27552} 27553 27554@Article{ depierro.iusem:relaxed, 27555 author = {A. R. {De~Pierro} and A. N. Iusem}, 27556 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 27557 journal = {Journal of Optimization Theory and Applications}, 27558 year = {1986}, 27559 volume = {51}, 27560 pages = {421--440} 27561} 27562 27563@Book{ dervis.melo.ea:general, 27564 author = {K. Dervis and J. de Melo and S. Robinson}, 27565 title = {General Equilibrium Models of Development Policy}, 27566 publisher = {Cambridge University Press}, 27567 year = {1982}, 27568 address = {Cambridge, England} 27569} 27570 27571@Article{ deschutter.demoor:minimal, 27572 author = {B. {De~Schutter} and B. {De~Moor}}, 27573 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 27574 Problem}, 27575 journal = {Systems \& Control Letters}, 27576 year = {1995}, 27577 pages = {103--111} 27578} 27579 27580@Article{ desilets.golden.ea:predicting, 27581 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 27582 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 27583 journal = {Computers \& Operations Research}, 27584 year = {1992}, 27585 volume = {19}, 27586 pages = {277--285} 27587} 27588 27589@PhDThesis{ desilva:sensitivity, 27590 author = {A. H. DeSilva}, 27591 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 27592 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 27593 Production}, 27594 school = {George Washington University}, 27595 address = {Washington, D.C.}, 27596 year = {1978} 27597} 27598 27599@TechReport{ dijkstra:cooperating, 27600 author = {E. W. Dijkstra}, 27601 title = {Cooperating Sequential Processes}, 27602 institution = {Technological University}, 27603 year = {1965}, 27604 address = {Eindhoven, The Netherlands}, 27605 number = {EWD--123}, 27606 type = {Technical Report} 27607} 27608 27609@Article{ dikin:iterative, 27610 author = {I. I. Dikin}, 27611 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 27612 journal = {Soviet Mathematics Doklady}, 27613 year = {1967}, 27614 volume = {8}, 27615 pages = {674--675} 27616} 27617 27618@InCollection{ dipillo.grippo.ea:class, 27619 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 27620 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 27621 booktitle = {System Modelling and Optimization}, 27622 year = {1981}, 27623 editor = {R. F. Drenick and F. Kozin}, 27624 publisher = {Springer-Verlag}, 27625 address = {Berlin} 27626} 27627 27628@Article{ dipillo.grippo:augmented, 27629 author = {G. Di~Pillo and L. Grippo}, 27630 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 27631 Problems}, 27632 journal = {Journal of Optimization Theory and Applications}, 27633 year = {1982}, 27634 volume = {36}, 27635 pages = {495--519} 27636} 27637 27638@Article{ dipillo.grippo:class, 27639 author = {G. Di~Pillo and L. Grippo}, 27640 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 27641 journal = {SIAM Journal on Control and Optimization}, 27642 year = {1979}, 27643 volume = {17}, 27644 pages = {618--628} 27645} 27646 27647@Article{ dipillo.grippo:continuously, 27648 author = {G. Di~Pillo and L. Grippo}, 27649 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 27650 Problems with Inequality Constraints}, 27651 journal = {SIAM Journal on Control and Optimization}, 27652 year = {1985}, 27653 volume = {23}, 27654 pages = {72--84} 27655} 27656 27657@Article{ dipillo.grippo:exact, 27658 author = {G. Di~Pillo and L. Grippo}, 27659 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 27660 Programming Problems}, 27661 journal = {Mathematical Programming}, 27662 year = {1986}, 27663 volume = {36}, 27664 pages = {1--18} 27665} 27666 27667@TechReport{ dirkse.ferris.ea:gams, 27668 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 27669 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 27670 institution = {Computer Sciences Department, University of Wisconsin}, 27671 year = {1994}, 27672 address = {Madison, Wisconsin}, 27673 number = {94-07}, 27674 type = {Mathematical Programming Technical Report}, 27675 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 27676 key = {25} 27677} 27678 27679@InProceedings{ dirkse.ferris:crash, 27680 crossref = {ferris.pang:complementarity}, 27681 author = {S. P. Dirkse and M. C. Ferris}, 27682 title = {Crash Techniques for Large-Scale Complementarity Problems}, 27683 pages = {40--61}, 27684 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 27685 key = {52} 27686} 27687 27688@Article{ dirkse.ferris:mcplib, 27689 author = {S. P. Dirkse and M. C. Ferris}, 27690 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 27691 journal = {Optimization Methods and Software}, 27692 pages = {319--345}, 27693 volume = {5}, 27694 year = {1995}, 27695 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 27696 key = {36} 27697} 27698 27699@InCollection{ dirkse.ferris:modeling, 27700 author = {S. P. Dirkse and M. C. Ferris}, 27701 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 27702 year = {1999}, 27703 pages = {127--148}, 27704 editor = {M. Fukushima and L. Qi}, 27705 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 27706 publisher = {Kluwer Academic Publishers}, 27707 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 27708 key = {62} 27709} 27710 27711@Article{ dirkse.ferris:path, 27712 author = {S. P. Dirkse and M. C. Ferris}, 27713 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 27714 Complementarity Problems}, 27715 journal = {Optimization Methods and Software}, 27716 pages = {123--156}, 27717 volume = {5}, 27718 year = {1995}, 27719 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 27720 key = {33} 27721} 27722 27723@Article{ dirkse.ferris:pathsearch, 27724 author = {S. P. Dirkse and M. C. Ferris}, 27725 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 27726 journal = {Annals of Operations Research}, 27727 vol = {68}, 27728 year = {1996}, 27729 pages = {211--232}, 27730 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 27731 key = {39} 27732} 27733 27734@InCollection{ dirkse.ferris:traffic, 27735 author = {S. P. Dirkse and M. C. Ferris}, 27736 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 27737 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 27738 Management}, 27739 publisher = {Springer-Verlag}, 27740 year = {1998}, 27741 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 27742 series = {NATO ASI Series F}, 27743 volume = {166}, 27744 pages = {136--163}, 27745 key = {61}, 27746 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 27747} 27748 27749@PhDThesis{ dirkse:robust, 27750 author = {S. P. Dirkse}, 27751 title = {Robust Solution of Mixed Complementarity Problems}, 27752 school = {Computer Sciences Department, University of Wisconsin}, 27753 year = {1994}, 27754 address = {Madison, Wisconsin}, 27755 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 27756 annote = {Mathematical Programming Technical Report 94-12} 27757} 27758 27759@TechReport{ dixon.mills:neural, 27760 author = {L. C. Dixon and D. J. Mills}, 27761 title = {Neural Nets for Massively Parallel Optimisation}, 27762 institution = {Hatfield Polytechnic}, 27763 year = {1992}, 27764 address = {Hatfield, Hertforshire, England}, 27765 number = {Numerical Optimisation Centre Technical Report No. 259} 27766} 27767 27768@Article{ dontchev:local, 27769 author = {A. L. Dontchev}, 27770 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 27771 journal = {C.R. Acad. Sci. Paris Series I}, 27772 year = {1996}, 27773 volume = {332}, 27774 pages = {327--331} 27775} 27776 27777@Article{ douglas.rachford:numerical, 27778 author = {J. Douglas and H. H. Rachford}, 27779 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 27780 Variables}, 27781 journal = {Transactions of the American Mathematical Society}, 27782 year = {1956}, 27783 volume = {82}, 27784 pages = {421--439} 27785} 27786 27787@Article{ drud:conopt, 27788 author = {A. Drud}, 27789 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 27790 Problems}, 27791 journal = {Mathematical Programming}, 27792 year = {1985}, 27793 volume = {31}, 27794 pages = {153--191} 27795} 27796 27797@Article{ dsouza.meyer.ea:mixed, 27798 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27799 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27800 Optimization}, 27801 journal = {Medical Physics}, 27802 year = {1999}, 27803 key = {85}, 27804 volume = {26}, 27805 number = {6}, 27806 pages = {1099} 27807} 27808 27809@TechReport{ dsouza.meyer.ea:mixed*1, 27810 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27811 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27812 Optimization}, 27813 year = {1999}, 27814 key = {87}, 27815 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 27816 institution = {Computer Sciences Department, University of Wisconsin}, 27817 address = {Madison, Wisconsin}, 27818 number = {99-08}, 27819 type = {Mathematical Programming Technical Report}, 27820 annote = {Submitted to } 27821} 27822 27823@Article{ dsouza.meyer.ea:iterative, 27824 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 27825 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 27826 Brachytherapy Treatment Optimization}, 27827 year = {2000}, 27828 key = {96}, 27829 journal = {Physics and Medicine in Biology, forthcoming} 27830} 27831 27832@Article{ du.yu.ea:multileaf, 27833 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 27834 G. Gustafson and A. Martinez and J. W. Wong}, 27835 title = {A multileaf collimator field prescription preparation system for conventional 27836 radiotherapy}, 27837 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27838 year = {1994}, 27839 volume = {30}, 27840 number = {3}, 27841 pages = {707--714} 27842} 27843 27844@Article{ duda.fossum:pattern, 27845 author = {R. O. Duda and H. Fossum}, 27846 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 27847 Discriminant Functions}, 27848 journal = {IEEE Transactions on Electronic Computers}, 27849 year = {1966}, 27850 volume = {15}, 27851 pages = {220--232} 27852} 27853 27854@Book{ duda.hart:pattern, 27855 author = {R. O. Duda and P. E. Hart}, 27856 title = {Pattern Classification and Scene Analysis}, 27857 year = {1973}, 27858 publisher = {John Wiley \& Sons}, 27859 address = {New York} 27860} 27861 27862@Book{ duff.erisman.ea:direct, 27863 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 27864 title = {Direct Methods for Sparse Matrices}, 27865 publisher = {Oxford University Press}, 27866 year = {1986}, 27867 address = {Oxford, England} 27868} 27869 27870@InCollection{ duffin:infinite, 27871 author = {R. J. Duffin}, 27872 title = {Infinite Programs}, 27873 booktitle = {Linear Inequalities and Related Systems}, 27874 year = {1975}, 27875 editor = {H. W. Kuhn and A. W. Tucker}, 27876 publisher = {Princeton University Press}, 27877 address = {Princeton, New Jersey}, 27878 pages = {157--170} 27879} 27880 27881@Article{ dunn.sachs:effect, 27882 author = {J. C. Dunn and E. Sachs}, 27883 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 27884 journal = {Applied Mathematics and Optimization}, 27885 year = {1983}, 27886 volume = {10}, 27887 pages = {143--157} 27888} 27889 27890@Article{ dunn:convergence, 27891 author = {J. C. Dunn}, 27892 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 27893 journal = {Journal of Optimization Theory and Applications}, 27894 year = {1987}, 27895 volume = {55}, 27896 pages = {203--216} 27897} 27898 27899@Article{ dunn:global, 27900 author = {J. C. Dunn}, 27901 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 27902 Gradient Processes}, 27903 journal = {SIAM Journal on Control and Optimization}, 27904 year = {1981}, 27905 volume = {19}, 27906 pages = {368--400} 27907} 27908 27909@Article{ dunn:rates, 27910 author = {J. C. Dunn}, 27911 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 27912 Nonsingular Extremals}, 27913 journal = {SIAM Journal on Control and Optimization}, 27914 year = {1979}, 27915 volume = {17}, 27916 pages = {187--211} 27917} 27918 27919@Article{ dupuis.simha:sampling, 27920 author = {P. Dupuis and R. Simha}, 27921 title = {On Sampling-Controlled Stochastic Approximation}, 27922 journal = {{IEEE} Transactions on Automatic Control}, 27923 year = {1991}, 27924 volume = {36}, 27925 pages = {915--924} 27926} 27927 27928@TechReport{ eager.ferris.ea:models, 27929 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27930 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 27931 institution = {Computer Sciences Department, University of Wisconsin}, 27932 year = {1999}, 27933 type = {Technical Report}, 27934 number = {1402}, 27935 address = {Madison, Wisconsin}, 27936 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 27937 key = {84} 27938} 27939 27940@InProceedings{ eager.ferris.ea:optimized, 27941 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27942 title = {Optimized Regional Caching for On-Demand Data Delivery}, 27943 year = {1999}, 27944 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 27945 volume = {3654}, 27946 address = {Bellingham, Washington}, 27947 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 27948 key = {69}, 27949 pages = {301--316}, 27950 annote = {18 percent acceptance rate} 27951} 27952 27953@Article{ eager.ferris.ea:optimized*1, 27954 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27955 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 27956 journal = {Performance Evaluation}, 27957 year = {2000}, 27958 key = {72}, 27959 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 27960 volume = {42}, 27961 pages = {163--185} 27962} 27963 27964@InProceedings{ eager.vernon:dynamic, 27965 author = {D. L. Eager and M. K. Vernon}, 27966 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 27967 year = {1998}, 27968 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 27969 ({MIS '98})}, 27970 pages = {18--32}, 27971 address = {Istanbul, Turkey} 27972} 27973 27974@Article{ eaves.lemke:equivalence, 27975 author = {B. C. Eaves and C. E. Lemke}, 27976 title = {Equivalence of {LCP} and {PLS}}, 27977 journal = {Mathematics of Operations Research}, 27978 year = {1981}, 27979 volume = {6}, 27980 pages = {475--484} 27981} 27982 27983@Article{ eaves.rothblum:relationships, 27984 author = {B. C. Eaves and U. G. Rothblum}, 27985 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 27986 journal = {Linear Algebra and Its Applications}, 27987 year = {1990}, 27988 volume = {132}, 27989 pages = {1--63} 27990} 27991 27992@Article{ eaves:basic, 27993 author = {B. C. Eaves}, 27994 title = {On the Basic Theorem of Complementarity}, 27995 journal = {Mathematical Programming}, 27996 year = {1971}, 27997 volume = {1}, 27998 pages = {68--87} 27999} 28000 28001@Article{ eaves:computing, 28002 author = {B. C. Eaves}, 28003 title = {Computing Stationary Points}, 28004 journal = {Mathematical Programming Study}, 28005 year = {1978}, 28006 volume = {7}, 28007 pages = {1--14} 28008} 28009 28010@InCollection{ eaves:computing*1, 28011 author = {B. C. Eaves}, 28012 title = {Computing Stationary Points, Again}, 28013 pages = {391--405}, 28014 crossref = {mangasarian.meyer.ea:nonlinear*3} 28015} 28016 28017@Article{ eaves:homotopies, 28018 author = {B. C. Eaves}, 28019 title = {Homotopies for Computation of Fixed Points}, 28020 journal = {Mathematical Programming}, 28021 year = {1972}, 28022 volume = {3}, 28023 pages = {1--22} 28024} 28025 28026@Article{ eaves:linear, 28027 author = {B. C. Eaves}, 28028 title = {The Linear Complementarity Problem}, 28029 journal = {Management Science}, 28030 year = {1971}, 28031 volume = {17}, 28032 pages = {612--634} 28033} 28034 28035@Article{ eaves:quadratic, 28036 author = {B. C. Eaves}, 28037 title = {On Quadratic Programming}, 28038 journal = {Management Science}, 28039 year = {1971}, 28040 volume = {17}, 28041 pages = {698--711} 28042} 28043 28044@InProceedings{ eaves:short, 28045 author = {B. C. Eaves}, 28046 title = {A Short Course in Solving Equations with {PL} Homotopies}, 28047 booktitle = {Nonlinear Programming}, 28048 organization = {American Mathematical Society}, 28049 year = {1976}, 28050 editor = {R. W. Cottle and C. E. Lemke}, 28051 publisher = {SIAM--AMS Proceedings}, 28052 address = {Providence, RI}, 28053 pages = {73--143} 28054} 28055 28056@InCollection{ ebiefung.kostreva:global, 28057 author = {A. A. Ebiefung and M. M. Kostreva}, 28058 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 28059 Class of Polynomial Complementarity Problems}, 28060 editors = {C. Floudas and P. Pardalos}, 28061 booktitle = {Recent Advances in Global Optimization}, 28062 publisher = {Princeton University Press}, 28063 pages = {102--124}, 28064 year = {1991} 28065} 28066 28067@TechReport{ ebiefung.kostreva:z-matrices, 28068 author = {A. A. Ebiefung and M. M. Kostreva}, 28069 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 28070 institution = {Department of Mathematical Sciences, Clemson University}, 28071 year = {1991}, 28072 number = {608}, 28073 address = {Clemson, South Carolina} 28074} 28075 28076@TechReport{ eckstein.bertsekas:alternating, 28077 author = {J. Eckstein and D. P. Bertsekas}, 28078 title = {An Alternating Direction Method for Linear Programming}, 28079 institution = {Harvard Business School}, 28080 year = {1990}, 28081 type = {Working Paper}, 28082 number = {90-063}, 28083 address = {Boston, MA} 28084} 28085 28086@Article{ eckstein.bertsekas:douglas-rachford, 28087 author = {J. Eckstein and D. P. Bertsekas}, 28088 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 28089 Maximal Monotone Operators}, 28090 journal = {Mathematical Programming}, 28091 year = {1992}, 28092 pages = {293--318}, 28093 volume = {55} 28094} 28095 28096@Article{ eckstein.bertsekas:douglas-rachford*1, 28097 author = {J. Eckstein and D. P. Bertsekas}, 28098 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 28099 for Maximal Monotone Operators}, 28100 journal = {Mathematical Programming}, 28101 year = {1991}, 28102 note = {To appear} 28103} 28104 28105@TechReport{ eckstein.ferris:operator, 28106 author = {J. Eckstein and M. C. Ferris}, 28107 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 28108 institution = {Thinking Machines Corporation}, 28109 year = {1992}, 28110 address = {Cambridge, MA 02142}, 28111 number = {239}, 28112 type = {TMC}, 28113 key = {26} 28114} 28115 28116@Article{ eckstein.ferris:operator*1, 28117 author = {J. Eckstein and M. C. Ferris}, 28118 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 28119 Parallel Application to Optimal Control}, 28120 volume = {10}, 28121 pages = {218--235}, 28122 year = {1998}, 28123 journal = {INFORMS Journal on Computing}, 28124 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 28125 key = {44} 28126} 28127 28128@Article{ eckstein.ferris:smooth, 28129 author = {J. Eckstein and M. C. Ferris}, 28130 title = {Smooth Methods of Multipliers for Complementarity Problems}, 28131 key = {58}, 28132 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 28133 year = {1999}, 28134 journal = {Mathematical Programming}, 28135 volume = {86}, 28136 pages = {65--90} 28137} 28138 28139@InProceedings{ eckstein.hart.ea:resource, 28140 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 28141 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 28142 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 28143 year = {1997}, 28144 note = {www.cs.sandia.gov/ISUG97} 28145} 28146 28147@Article{ eckstein:alternating, 28148 author = {J. Eckstein}, 28149 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 28150 CM-2}}, 28151 journal = {ORSA Journal on Computing}, 28152 year = {to appear} 28153} 28154 28155@Article{ eckstein:approximate, 28156 author = {J. Eckstein}, 28157 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 28158 year = {1998}, 28159 journal = {Mathematical Programming}, 28160 volume = {83}, 28161 pages = {113--124} 28162} 28163 28164@Article{ eckstein:communication, 28165 author = {J. Eckstein}, 28166 title = {How Much Communication Does Parallel Branch and Bound Need}, 28167 journal = {{INFORMS} Journal on Computing}, 28168 volume = {9}, 28169 year = {1997}, 28170 pages = {15--29} 28171} 28172 28173@Article{ eckstein:distributed, 28174 author = {J. Eckstein}, 28175 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 28176 Integer Programming on the {CM}-5}, 28177 journal = {Computational Optimization and Applications}, 28178 volume = {7}, 28179 pages = {199--220}, 28180 year = {1997} 28181} 28182 28183@TechReport{ eckstein:lions-mercier, 28184 author = {J. Eckstein}, 28185 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 28186 as instances of the Proximal Point Algorithm}, 28187 institution = {MIT}, 28188 year = {1988}, 28189 address = {Cambridge, Massachusetts}, 28190 number = {LIDS-P-1769} 28191} 28192 28193@Article{ eckstein:nonlinear, 28194 author = {J. Eckstein}, 28195 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 28196 to Convex Programming}, 28197 journal = {Mathematics of Operations Research}, 28198 year = {1993}, 28199 pages = {202--226}, 28200 volume = {18} 28201} 28202 28203@Article{ eckstein:parallel, 28204 author = {J. Eckstein}, 28205 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 28206 {CM}-5}, 28207 journal = {SIAM Journal on Optimization}, 28208 volume = {4}, 28209 pages = {794--814}, 28210 year = {1994} 28211} 28212 28213@TechReport{ eckstein:smooth, 28214 author = {J. Eckstein}, 28215 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 28216 institution = {Rutgers Center for Operations Research, Rutgers University}, 28217 address = {New Brunswick, New Jersey}, 28218 year = {1996}, 28219 type = {Research Report}, 28220 number = {27-96} 28221} 28222 28223@PhDThesis{ eckstein:splitting, 28224 author = {J. Eckstein}, 28225 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 28226 Optimization}, 28227 school = {Massachusetts Institute of Technology}, 28228 year = {1989}, 28229 address = {Cambridge, MA}, 28230 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 28231} 28232 28233@Article{ eglese:simulated, 28234 author = {R. W. Eglese}, 28235 title = {Simulated Annealing: {A} Tool for Operational Research}, 28236 journal = {European Journal of Operations Research}, 28237 year = {1990}, 28238 volume = {46}, 28239 pages = {271--281} 28240} 28241 28242@Book{ ekeland.temam:convex, 28243 author = {I. Ekeland and R. Temam}, 28244 title = {Convex Analysis and Variational Problems}, 28245 year = {1976}, 28246 publisher = {North--Holland}, 28247 address = {Amsterdam} 28248} 28249 28250@Article{ ekeland:variational, 28251 author = {I. Ekeland}, 28252 title = {On the Variational Principle}, 28253 journal = {Journal of Mathematical Analysis and Applications}, 28254 year = {1974}, 28255 volume = {47}, 28256 pages = {324--353} 28257} 28258 28259@TechReport{ el-bakry.tapia.ea:formulation, 28260 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 28261 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 28262 for nonlinear programming}, 28263 type = {{Technical Report TR92-40}}, 28264 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 28265 year = {1992} 28266} 28267 28268@Article{ eldersveld.saunders:block, 28269 author = {S. K. Eldersveld and M. A. Saunders}, 28270 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 28271 journal = {SIAM Journal on Matrix Analysis and Applications}, 28272 year = {1992}, 28273 volume = {13}, 28274 pages = {191--201} 28275} 28276 28277@Article{ elster.neumaier:grid, 28278 author = {C. Elster and A. Neumaier}, 28279 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 28280 journal = {{IMA} Journal of Numerical Analysis}, 28281 year = {1995}, 28282 volume = {15}, 28283 pages = {585--608} 28284} 28285 28286@Article{ epema.livny.ea:worldwide, 28287 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 28288 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 28289 journal = {Journal on Future Generations of Computer Systems}, 28290 year = {1996}, 28291 volume = {12}, 28292 pages = {53--65} 28293} 28294 28295@Book{ ermoliev.editors:numerical, 28296 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 28297 title = {Numerical Techniques for Stochastic Optimization Problems}, 28298 year = {1988}, 28299 publisher = {Springer-Verlag}, 28300 address = {Berlin} 28301} 28302 28303@TechReport{ evett.spiehler:rule, 28304 author = {I. W. Evett and E. J. Spiehler}, 28305 title = {Rule Induction in Forensic Science}, 28306 institution = {Central Research Establishment, Home Office Forensic Science Service}, 28307 year = {1987}, 28308 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 28309 type = {Technical Report} 28310} 28311 28312@Article{ evtushenko.purtov:sufficient, 28313 author = {Y. G. Evtushenko and V. A. Purtov}, 28314 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 28315 journal = {Soviet Mathematics Doklady}, 28316 year = {1984}, 28317 volume = {30}, 28318 pages = {313--316} 28319} 28320 28321@Article{ facchinei.fischer.ea:regularity, 28322 author = {F. Facchinei and A. Fischer and C. Kanzow}, 28323 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 28324 journal = {SIAM Journal on Optimization}, 28325 year = {1998}, 28326 volume = {8}, 28327 pages = {850--869} 28328} 28329 28330@Article{ facchinei.fischer.ea:semismooth, 28331 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 28332 Constraints}, 28333 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 28334 journal = {Complementarity and Variational Problems: State of the Art}, 28335 volume = {92}, 28336 pages = {76}, 28337 year = {1997} 28338} 28339 28340@TechReport{ facchinei.fischer.ea:simply, 28341 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 28342 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 28343 Variational Inequalities}, 28344 institution = {University of Hamburg}, 28345 year = {1996} 28346} 28347 28348@Article{ facchinei.jiang.ea:smoothing, 28349 author = {F. Facchinei and H. Jiang and L. Qi}, 28350 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 28351 year = {1999}, 28352 journal = {Mathematical Programming}, 28353 volume = {85}, 28354 pages = {107--134} 28355} 28356 28357@Article{ facchinei.kanzow:nonsmooth, 28358 author = {F. Facchinei and C. Kanzow}, 28359 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 28360 Complementarity Problems}, 28361 year = {1997}, 28362 journal = {Mathematical Programming}, 28363 volume = {76}, 28364 pages = {493--512} 28365} 28366 28367@Article{ facchinei.kanzow:unconstrained, 28368 author = {F. Facchinei and C. Kanzow}, 28369 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 28370 {L}agrangian}, 28371 year = {1997}, 28372 journal = {Journal of Optimization Theory and Applications}, 28373 volume = {92}, 28374 pages = {99--115} 28375} 28376 28377@TechReport{ facchinei.pang:total, 28378 author = {F. Facchinei and J. S. Pang}, 28379 title = {Total stability of variational inequalities}, 28380 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 28381 year = {1988}, 28382 type = {Manuscript}, 28383 address = {Roma, Italy} 28384} 28385 28386@Article{ facchinei.soares:merit, 28387 author = {F. Facchinei and J. Soares}, 28388 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 28389 Algorithm}, 28390 journal = {SIAM Journal on Optimization}, 28391 year = {1997}, 28392 volume = {7}, 28393 pages = {225--247} 28394} 28395 28396@InCollection{ facchinei.soares:testing, 28397 author = {F. Facchinei and J. Soares}, 28398 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 28399 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 28400 publisher = {Plenum Press}, 28401 address = {New York}, 28402 editor = {F. Giannessi and A. Maugeri}, 28403 year = {1995}, 28404 pages = {69--83} 28405} 28406 28407@InProceedings{ fahlman.lebiere:cascade-correlation, 28408 author = {S. E. Fahlman and C. Lebiere}, 28409 title = {The cascade-correlation learning architecture}, 28410 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 28411 year = {1990}, 28412 editor = {D. S. Touretzky}, 28413 publisher = {Morgan Kaufmann}, 28414 address = {San Mateo, California}, 28415 pages = {524--532} 28416} 28417 28418@InProceedings{ fang.geiser.ea:software, 28419 author = {G. Fang and B. Geiser and T. R. Mackie}, 28420 title = {Software system for {UW}/{GE} tomotherapy prototype}, 28421 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 28422 Radiation Therapy, Salt Lake City}, 28423 year = {1997}, 28424 editor = {D. D. Leavitt and G. Starkshall}, 28425 publisher = {Medical Physics Publishing}, 28426 address = {St. Louis, Missouri}, 28427 pages = {332--334} 28428} 28429 28430@Book{ fang.puthenpura:linear, 28431 author = {S.--C. Fang and S. Puthenpura}, 28432 title = {Linear Optimization and Extensions}, 28433 year = {1993}, 28434 publisher = {Prentice-Hall, Inc}, 28435 address = {Englewood Cliffs, New Jersey} 28436} 28437 28438@Article{ fayard.plateau:algorithm, 28439 author = {D. Fayard and G. Plateau}, 28440 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 28441 journal = {Computing}, 28442 year = {1982}, 28443 volume = {28}, 28444 pages = {269--287} 28445} 28446 28447@Book{ feller:introduction, 28448 author = {W. Feller}, 28449 title = {An Introduction to Probability Theory and its Applications}, 28450 publisher = {John Wiley \& Sons}, 28451 year = {1968}, 28452 address = {New York} 28453} 28454 28455@Article{ ferris.fourer.ea:expressing, 28456 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 28457 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 28458 journal = {SIAM Journal on Optimization}, 28459 volume = {9}, 28460 pages = {991--1009}, 28461 year = {1999}, 28462 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 28463 key = {65}, 28464 institution = {Computer Sciences Department, University of Wisconsin}, 28465 address = {Madison, Wisconsin}, 28466 number = {98-02}, 28467 type = {Mathematical Programming Technical Report} 28468} 28469 28470@TechReport{ ferris.horn:nlp2mcp, 28471 author = {M. C. Ferris and J. D. Horn}, 28472 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 28473 problems}, 28474 year = {1998}, 28475 institution = {Computer Sciences Department, University of Wisconsin}, 28476 note = {In preparation} 28477} 28478 28479@Article{ ferris.horn:partitioning, 28480 author = {M. C. Ferris and J. D. Horn}, 28481 title = {Partitioning Mathematical Programs for Parallel Solution}, 28482 year = {1998}, 28483 volume = {80}, 28484 pages = {35--62}, 28485 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 28486 journal = {Mathematical Programming}, 28487 key = {40} 28488} 28489 28490@Article{ ferris.kanzow.ea:feasible, 28491 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 28492 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 28493 year = {1999}, 28494 journal = {Mathematical Programming}, 28495 volume = {86}, 28496 pages = {475--497}, 28497 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 28498 key = {67} 28499} 28500 28501@InCollection{ ferris.kanzow:complementarity, 28502 author = {M. C. Ferris and C. Kanzow}, 28503 title = {Complementarity and Related Problems: {A} Survey}, 28504 booktitle = {Handbook of Applied Optimization, forthcoming}, 28505 key = {74}, 28506 publisher = {Oxford University Press}, 28507 year = {2000}, 28508 editor = {P. M. Pardalos and M. G. C. Resende}, 28509 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 28510 institution = {Computer Sciences Department, University of Wisconsin}, 28511 address = {Madison, Wisconsin}, 28512 number = {98-17}, 28513 type = {Mathematical Programming Technical Report} 28514} 28515 28516@Article{ ferris.lucidi.ea:nonmonotone, 28517 author = {M. C. Ferris and S. Lucidi and M. Roma}, 28518 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 28519 journal = {Computational Optimization and Applications}, 28520 volume = {6}, 28521 pages = {117--136}, 28522 year = {1996}, 28523 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 28524 key = {43} 28525} 28526 28527@TechReport{ ferris.lucidi:globally, 28528 author = {M. C. Ferris and S. Lucidi}, 28529 title = {Globally Convergent Methods for Nonlinear Equations}, 28530 institution = {Computer Sciences Department, University of Wisconsin}, 28531 year = {1991}, 28532 address = {Madison, Wisconsin}, 28533 number = {1030}, 28534 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 28535 key = {21} 28536} 28537 28538@Article{ ferris.lucidi:nonmonotone, 28539 author = {M. C. Ferris and S. Lucidi}, 28540 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 28541 journal = {Journal of Optimization Theory and Applications}, 28542 year = {1994}, 28543 volume = {81}, 28544 pages = {53--71}, 28545 key = {30} 28546} 28547 28548@Article{ ferris.mangasarian:breast, 28549 author = {M. C. Ferris and O. L. Mangasarian}, 28550 title = {Breast Cancer Diagnosis via Linear Programming}, 28551 key = {50}, 28552 journal = {{IEEE} Computational Science and Engineering}, 28553 year = {1995}, 28554 volume = {2}, 28555 pages = {70--71} 28556} 28557 28558@Article{ ferris.mangasarian:error, 28559 author = {M. C. Ferris and O. L. Mangasarian}, 28560 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 28561 Inequalities}, 28562 journal = {Annals of Operations Research}, 28563 year = {1993}, 28564 volume = {47}, 28565 pages = {293--305}, 28566 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 28567 key = {24} 28568} 28569 28570@Article{ ferris.mangasarian:finite, 28571 author = {M. C. Ferris and O. L. Mangasarian}, 28572 title = {Finite Perturbation of Convex Programs}, 28573 journal = {Applied Mathematics and Optimization}, 28574 year = {1991}, 28575 volume = {23}, 28576 pages = {263--273}, 28577 key = {08} 28578} 28579 28580@Book{ ferris.mangasarian:linear, 28581 author = {M. C. Ferris and O. L. Mangasarian}, 28582 title = {Linear Programming via {MATLAB}}, 28583 publisher = {in preparation}, 28584 year = {1995}, 28585 address = {Madison, Wisconsin} 28586} 28587 28588@Article{ ferris.mangasarian:minimum, 28589 author = {M. C. Ferris and O. L. Mangasarian}, 28590 title = {Minimum Principle Sufficiency}, 28591 journal = {Mathematical Programming}, 28592 year = {1992}, 28593 volume = {57}, 28594 pages = {1--14}, 28595 key = {11} 28596} 28597 28598@Article{ ferris.mangasarian:parallel, 28599 author = {M. C. Ferris and O. L. Mangasarian}, 28600 title = {Parallel Constraint Distribution}, 28601 journal = {SIAM Journal on Optimization}, 28602 year = {1991}, 28603 volume = {1}, 28604 pages = {487--500}, 28605 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 28606 key = {18} 28607} 28608 28609@Article{ ferris.mangasarian:parallel*1, 28610 author = {M. C. Ferris and O. L. Mangasarian}, 28611 title = {Parallel Variable Distribution}, 28612 journal = {SIAM Journal on Optimization}, 28613 year = {1994}, 28614 volume = {4}, 28615 pages = {815--832}, 28616 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 28617 key = {31} 28618} 28619 28620@Article{ ferris.meeraus.ea:computing, 28621 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 28622 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 28623 journal = {Optimization Methods and Software}, 28624 year = {1999}, 28625 volume = {10}, 28626 pages = {669--685}, 28627 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 28628 key = {45} 28629} 28630 28631@Article{ ferris.mesnier.ea:neos, 28632 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 28633 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 28634 {I}nternet}, 28635 year = {2000}, 28636 journal = {{ACM} Transactions on Mathematical Software}, 28637 key = {54}, 28638 volume = {26}, 28639 pages = {1--18}, 28640 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 28641 institution = {Computer Sciences Department, University of Wisconsin}, 28642 address = {Madison, Wisconsin}, 28643 number = {96-08}, 28644 type = {Mathematical Programming Technical Report}, 28645 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 28646 Argonne National Laboratory}, 28647 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 28648 1996} 28649} 28650 28651@InCollection{ ferris.meyer:models, 28652 author = {M. C. Ferris and R. R. Meyer}, 28653 title = {Models and Solution for On-Demand Data Delivery Problems}, 28654 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 28655 key = {80}, 28656 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 28657 Problems}, 28658 editor = {P. M. Pardalos}, 28659 series = {Nonconvex Optimization and its Applications}, 28660 volume = {42}, 28661 address = {Dordrect}, 28662 year = {2000}, 28663 pages = {175--188}, 28664 publisher = {Kluwer}, 28665 type = {Mathematical Programming Technical Report}, 28666 institution = {Computer Sciences Department, University of Wisconsin}, 28667 number = {99-04} 28668} 28669 28670@InProceedings{ ferris.munson.ea:homotopy, 28671 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 28672 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 28673 booktitle = {Numerical Analysis 1999}, 28674 key = {88}, 28675 year = {2000}, 28676 editor = {D. F. Griffiths and G. A. Watson}, 28677 series = {Research Notes in Mathematics}, 28678 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 28679 address = {London}, 28680 pages = {143--167}, 28681 publisher = {Chapman and Hall}, 28682 institution = {Computer Sciences Department, University of Wisconsin}, 28683 number = {99-09}, 28684 type = {Mathematical Programming Technical Report} 28685} 28686 28687@TechReport{ ferris.munson.ea:practical, 28688 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 28689 title = {A Practical Approach to Sample-Path Simulation Optimization}, 28690 type = {Data Mining Institute Technical Report}, 28691 institution = {Computer Sciences Department, University of Wisconsin}, 28692 address = {Madison, Wisconsin}, 28693 year = {2000}, 28694 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 28695 number = {00-03}, 28696 key = {92}, 28697 annote = {To appear in WSC 2000} 28698} 28699 28700@InCollection{ ferris.munson:case, 28701 author = {M. C. Ferris and T. S. Munson}, 28702 title = {Case Studies in Complementarity: Improving Model Formulation}, 28703 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 28704 key = {73}, 28705 pages = {79--98}, 28706 publisher = {Springer Verlag}, 28707 year = {1999}, 28708 editor = {M. Th\'{e}ra and R. Tichatschke}, 28709 number = {477}, 28710 series = {Lecture Notes in Economics and Mathematical Systems}, 28711 address = {Berlin}, 28712 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 28713 type = {Mathematical Programming Technical Report}, 28714 institution = {Computer Sciences Department, University of Wisconsin} 28715} 28716 28717@Article{ ferris.munson:complementarity, 28718 author = {M. C. Ferris and T. S. Munson}, 28719 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 28720 year = {2000}, 28721 volume = {24}, 28722 pages = {165--188}, 28723 journal = {Journal of Economic Dynamics and Control}, 28724 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 28725 key = {70}, 28726 type = {Mathematical Programming Technical Report}, 28727 institution = {Computer Sciences Department, University of Wisconsin}, 28728 address = {Madison, Wisconsin}, 28729 number = {98-12} 28730} 28731 28732@Misc{ ferris.munson:condor, 28733 author = {M. C. Ferris and T. S. Munson}, 28734 title = {Condor Modeling Language Interface}, 28735 organization = {Computer Sciences Department, University of Wisconsin}, 28736 address = {Madison, Wisconsin}, 28737 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 28738} 28739 28740@Manual{ ferris.munson:gams, 28741 author = {M. C. Ferris and T. S. Munson}, 28742 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 28743 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 28744} 28745 28746@Article{ ferris.munson:interfaces, 28747 author = {M. C. Ferris and T. S. Munson}, 28748 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 28749 journal = {Computational Optimization and Applications}, 28750 volume = {12}, 28751 pages = {207--227}, 28752 year = {1999}, 28753 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 28754 key = {63}, 28755 institution = {Computer Sciences Department, University of Wisconsin}, 28756 address = {Madison, Wisconsin}, 28757 number = {97-12}, 28758 type = {Mathematical Programming Technical Report} 28759} 28760 28761@TechReport{ ferris.munson:interior, 28762 author = {M. C. Ferris and T. S. Munson}, 28763 title = {Interior Point Methods for Massive Support Vector Machines}, 28764 institution = {Computer Sciences Department, University of Wisconsin}, 28765 year = {2000}, 28766 key = {94}, 28767 type = {Data Mining Institute Technical Report}, 28768 number = {00-05}, 28769 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 28770 address = {Madison, Wisconsin}, 28771 annote = {Submitted to SIOPT} 28772} 28773 28774@Article{ ferris.munson:linear, 28775 author = {M. C. Ferris and T. S. Munson}, 28776 title = {Linear Programming for Emergency Broadcast Systems}, 28777 year = {1999}, 28778 journal = {{SIAG/OPT} Newsletter}, 28779 volume = {10}, 28780 pages = {6--8}, 28781 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 28782 key = {76}, 28783 type = {Mathematical Programming Technical Report}, 28784 institution = {Computer Sciences Department, University of Wisconsin}, 28785 address = {Madison, Wisconsin}, 28786 number = {98-20} 28787} 28788 28789@Article{ ferris.munson:modeling, 28790 author = {M. C. Ferris and T. S. Munson}, 28791 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 28792 year = {2000}, 28793 journal = {Mathematical Programming}, 28794 volume = {88}, 28795 pages = {487--506}, 28796 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 28797 key = {71}, 28798 type = {Mathematical Programming Technical Report}, 28799 institution = {Computer Sciences Department, University of Wisconsin}, 28800 address = {Madison, Wisconsin}, 28801 number = {98-13} 28802} 28803 28804@TechReport{ ferris.munson:preprocessing, 28805 author = {M. C. Ferris and T. S. Munson}, 28806 title = {Preprocessing Complementarity Problems}, 28807 type = {Mathematical Programming Technical Report}, 28808 institution = {Computer Sciences Department, University of Wisconsin}, 28809 address = {Madison, Wisconsin}, 28810 year = {1999}, 28811 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 28812 number = {99-07}, 28813 key = {86}, 28814 annote = {Submitted to ICCP 99} 28815} 28816 28817@TechReport{ ferris.munson:semismooth, 28818 author = {M. C. Ferris and T. S. Munson}, 28819 title = {Semismooth Support Vector Machines}, 28820 institution = {Computer Sciences Department, University of Wisconsin}, 28821 year = {2000}, 28822 key = {97}, 28823 type = {Data Mining Institute Technical Report}, 28824 number = {00-09}, 28825 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 28826 address = {Madison, Wisconsin}, 28827 annote = {Submitted to Math Prog B} 28828} 28829 28830@Article{ ferris.pang:engineering, 28831 author = {M. C. Ferris and J. S. Pang}, 28832 title = {Engineering and Economic Applications of Complementarity Problems}, 28833 year = {1997}, 28834 journal = {SIAM Review}, 28835 volume = {39}, 28836 pages = {669--713}, 28837 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 28838 key = {46} 28839} 28840 28841@Article{ ferris.pang:nondegenerate, 28842 author = {M. C. Ferris and J. S. Pang}, 28843 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 28844 journal = {SIAM Journal on Control and Optimization}, 28845 year = {1996}, 28846 volume = {34}, 28847 pages = {244--263}, 28848 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 28849 key = {35} 28850} 28851 28852@Article{ ferris.philpott:affine, 28853 author = {M. C. Ferris and A. B. Philpott}, 28854 title = {On Affine Scaling and Semi--Infinite Programming}, 28855 journal = {Mathematical Programming}, 28856 year = {1992}, 28857 volume = {56}, 28858 pages = {361--364}, 28859 key = {15} 28860} 28861 28862@Article{ ferris.philpott:interior, 28863 author = {M. C. Ferris and A. B. Philpott}, 28864 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 28865 journal = {Mathematical Programming}, 28866 year = {1989}, 28867 volume = {43}, 28868 pages = {257--276}, 28869 key = {04} 28870} 28871 28872@Article{ ferris.philpott:performance, 28873 author = {M. C. Ferris and A. B. Philpott}, 28874 title = {On the Performance of {K}armarkar's Algorithm}, 28875 journal = {Journal of the Operational Research Society}, 28876 year = {1988}, 28877 volume = {39}, 28878 pages = {257--270}, 28879 key = {03} 28880} 28881 28882@InCollection{ ferris.ralph:projected, 28883 author = {M. C. Ferris and D. Ralph}, 28884 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 28885 Maps}, 28886 booktitle = {Recent Advances in Nonsmooth Optimization}, 28887 publisher = {World Scientific Publishers}, 28888 year = {1995}, 28889 pages = {57--87}, 28890 editor = {D. Du and L. Qi and R. Womersley}, 28891 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 28892 key = {41} 28893} 28894 28895@Article{ ferris.ruszczynski:robust, 28896 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 28897 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 28898 year = {2000}, 28899 journal = {Networks}, 28900 volume = {35}, 28901 pages = {181--194}, 28902 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 28903 key = {60} 28904} 28905 28906@InCollection{ ferris.rutherford:accessing, 28907 author = {M. C. Ferris and T. F. Rutherford}, 28908 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 28909 booktitle = {Nonlinear Optimization and Applications}, 28910 key = {48}, 28911 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 28912 editor = {G. Di Pillo and F. Giannessi}, 28913 year = {1996}, 28914 pages = {141--153}, 28915 publisher = {Plenum Press}, 28916 address = {New York} 28917} 28918 28919@InCollection{ ferris.shepard:optimizing, 28920 author = {M. C. Ferris and D. M. Shepard}, 28921 title = {Optimization of Gamma Knife Radiosurgery}, 28922 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 28923 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 28924 publisher = {AMS}, 28925 year = {2000}, 28926 optseries = {DIMACS}, 28927 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 28928 key = {91}, 28929 type = {Data Mining Institute Technical Report}, 28930 institution = {Computer Sciences Department, University of Wisconsin}, 28931 address = {Madison, Wisconsin}, 28932 number = {00-01} 28933} 28934 28935@InCollection{ ferris.sinapiromsaran:formulating, 28936 author = {M. C. Ferris and K. Sinapiromsaran}, 28937 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 28938 booktitle = {Optimization}, 28939 key = {77}, 28940 publisher = {Springer-Verlag}, 28941 year = {2000}, 28942 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 28943 volume = {481}, 28944 series = {Lecture Notes in Economics and Mathematical Systems}, 28945 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 28946 type = {Mathematical Programming Technical Report}, 28947 institution = {Computer Sciences Department, University of Wisconsin}, 28948 address = {Madison, Wisconsin}, 28949 number = {98-21} 28950} 28951 28952@Article{ ferris.tin-loi:limit, 28953 author = {M. C. Ferris and F. Tin-Loi}, 28954 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 28955 Complementarity Constraints}, 28956 year = {2001}, 28957 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 28958 key = {78}, 28959 journal = {International Journal of Mechanical Sciences}, 28960 pages = {209--224}, 28961 volume = {43}, 28962 type = {Mathematical Programming Technical Report}, 28963 institution = {Computer Sciences Department, University of Wisconsin}, 28964 address = {Madison, Wisconsin}, 28965 number = {99-01} 28966} 28967 28968@Article{ ferris.tin-loi:nonlinear, 28969 author = {M. C. Ferris and F. Tin-Loi}, 28970 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 28971 Elastoplasticity}, 28972 year = {1998}, 28973 key = {64}, 28974 volume = {6}, 28975 pages = {857--870}, 28976 journal = {Structural Engineering and Mechanics} 28977} 28978 28979@Article{ ferris.tin-loi:solution, 28980 author = {M. C. Ferris and F. Tin-Loi}, 28981 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 28982 and Complementarity Constraints}, 28983 year = {1999}, 28984 journal = {Computer Methods in Applied Mechanics and Engineering}, 28985 volume = {174}, 28986 pages = {107--120}, 28987 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 28988 key = {66} 28989} 28990 28991@Article{ ferris.vlach:scheduling, 28992 author = {M. C. Ferris and M. Vlach}, 28993 title = {Scheduling with Earliness and Tardiness Penalties}, 28994 journal = {Naval Research Logistics Quarterly}, 28995 year = {1992}, 28996 volume = {39}, 28997 pages = {229--245}, 28998 key = {13} 28999} 29000 29001@TechReport{ ferris.zavriev:linear, 29002 author = {M. C. Ferris and S. K Zavriev}, 29003 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 29004 institution = {Computer Sciences Department, University of Wisconsin}, 29005 year = {1996}, 29006 key = {56}, 29007 address = {Madison, Wisconsin}, 29008 type = {Mathematical Programming Technical Report}, 29009 number = {96--12}, 29010 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 29011} 29012 29013@Article{ ferris:finite, 29014 author = {M. C. Ferris}, 29015 title = {Finite Termination of the Proximal Point Algorithm}, 29016 journal = {Mathematical Programming}, 29017 year = {1991}, 29018 volume = {50}, 29019 pages = {359--366}, 29020 key = {06} 29021} 29022 29023@Article{ ferris:iterative, 29024 author = {M. C. Ferris}, 29025 title = {Iterative Linear Programming Solution of Convex Programs}, 29026 journal = {Journal of Optimization Theory and Applications}, 29027 year = {1990}, 29028 volume = {65}, 29029 pages = {53--65}, 29030 key = {07} 29031} 29032 29033@Article{ ferris:linear, 29034 author = {M. C. Ferris}, 29035 title = {The Linear Complementarity Problem}, 29036 journal = {Bulletin of the American Mathematical Society}, 29037 year = {1993}, 29038 volume = {28}, 29039 pages = {169--175}, 29040 key = {27} 29041} 29042 29043@MastersThesis{ ferris:linear*1, 29044 author = {M. C. Ferris}, 29045 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 29046 Solving a Class of Structural Optimization Problems}, 29047 year = {1985}, 29048 school = {University of Cambridge}, 29049 address = {England}, 29050 key = {01} 29051} 29052 29053@TechReport{ ferris:matlab, 29054 author = {M. C. Ferris}, 29055 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 29056 institution = {Computer Sciences Department, University of Wisconsin}, 29057 year = {1998}, 29058 address = {Madison, Wisconsin}, 29059 type = {Mathematical Programming Technical Report}, 29060 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 29061 number = {98-19}, 29062 key = {75} 29063} 29064 29065@Article{ ferris:parallel, 29066 author = {M. C. Ferris}, 29067 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 29068 journal = {Mathematics of Operations Research}, 29069 year = {1994}, 29070 volume = {19}, 29071 pages = {645--658}, 29072 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 29073 key = {20} 29074} 29075 29076@TechReport{ ferris:parallel*1, 29077 author = {M. C. Ferris}, 29078 title = {Parallel Solution of Extremely Large Knapsack Problems}, 29079 institution = {Computer Sciences Department, University of Wisconsin}, 29080 year = {1989}, 29081 address = {Madison, Wisconsin}, 29082 number = {842}, 29083 key = {09} 29084} 29085 29086@PhDThesis{ ferris:weak, 29087 author = {M. C. Ferris}, 29088 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29089 year = {1988}, 29090 school = {University of Cambridge}, 29091 address = {England}, 29092 key = {02} 29093} 29094 29095@TechReport{ ferris:weak*1, 29096 author = {M. C. Ferris}, 29097 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29098 institution = {Computer Sciences Department, University of Wisconsin}, 29099 year = {1988}, 29100 address = {Madison, Wisconsin}, 29101 number = {779}, 29102 key = {05} 29103} 29104 29105@Book{ fiacco.mccormick:nonlinear, 29106 author = {A. V. Fiacco and G. P. McCormick}, 29107 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 29108 year = {1968}, 29109 publisher = {John Wiley \& Sons}, 29110 address = {New York}, 29111 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 29112} 29113 29114@Book{ fiacco:introduction, 29115 author = {A. V. Fiacco}, 29116 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 29117 year = {1983}, 29118 publisher = {Academic Press}, 29119 address = {New York} 29120} 29121 29122@Article{ fiedler.ptak:matrices, 29123 author = {M. Fiedler and V. Pt\'{a}k}, 29124 title = {On matrices with nonpositive off-diagonal elements and positive principal 29125 minors}, 29126 journal = {Czechoslovak Mathematics Journal}, 29127 volume = {12}, 29128 pages = {382--400}, 29129 year = {1962} 29130} 29131 29132@Article{ fischer.kanzow:finite, 29133 author = {A. Fischer and C. Kanzow}, 29134 title = {On Finite Termination of an Iterative Method for Linear Complementarity 29135 Problems}, 29136 journal = {Mathematical Programming}, 29137 volume = {74}, 29138 pages = {279--292}, 29139 year = {1996} 29140} 29141 29142@TechReport{ fischer:constrained, 29143 author = {A. Fischer}, 29144 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 29145 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 29146 year = {1995}, 29147 type = {Technical Report}, 29148 number = {MATH-NM-10-1995}, 29149 address = {Dresden} 29150} 29151 29152@Article{ fischer:local, 29153 author = {A. Fischer}, 29154 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 29155 weak conditions}, 29156 journal = {Optimization Methods and Software}, 29157 year = {1995}, 29158 volume = {6}, 29159 pages = {83--107} 29160} 29161 29162@InCollection{ fischer:ncp-function, 29163 author = {A. Fischer}, 29164 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 29165 booktitle = {Recent Advances in Nonsmooth Optimization}, 29166 publisher = {World Scientific Publishers}, 29167 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 29168 year = {1995}, 29169 pages = {88--105} 29170} 29171 29172@Article{ fischer:newton-type, 29173 author = {A. Fischer}, 29174 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 29175 Problems}, 29176 journal = {Journal of Optimization Theory and Applications}, 29177 year = {1995}, 29178 volume = {86}, 29179 pages = {585--608} 29180} 29181 29182@Article{ fischer:solution, 29183 author = {A. Fischer}, 29184 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 29185 Functions}, 29186 year = {1997}, 29187 journal = {Mathematical Programming}, 29188 pages = {513--532} 29189} 29190 29191@Article{ fischer:special, 29192 author = {A. Fischer}, 29193 title = {A Special {N}ewton--Type Optimization Method}, 29194 journal = {Optimization}, 29195 year = {1992}, 29196 volume = {24}, 29197 pages = {269--284} 29198} 29199 29200@Article{ fisher:use, 29201 author = {R. A. Fisher}, 29202 title = {The Use of Multiple Measurements in Taxonomic Problems}, 29203 journal = {Annual Eugenics}, 29204 year = {1936}, 29205 volume = {7}, 29206 number = {Part II}, 29207 pages = {179--188} 29208} 29209 29210@Book{ fishman:principles, 29211 author = {G. Fishman}, 29212 title = {Principles of Discrete Event Simulation}, 29213 publisher = {Wiley}, 29214 address = {New York, NY}, 29215 year = {1978} 29216} 29217 29218@Article{ fitchard.aldridge.ea:registration, 29219 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 29220 title = {Registration of Synthetic Tomographic Projection Data Sets Using 29221 Cross-Correlation}, 29222 journal = {Physics in Medicine and Biology}, 29223 year = {1998}, 29224 volume = {43}, 29225 pages = {1645--1657} 29226} 29227 29228@Article{ fletcher.matthews:stable, 29229 author = {R. Fletcher and S. P. J. Matthews}, 29230 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 29231 journal = {Mathematical Programming}, 29232 year = {1984}, 29233 volume = {30}, 29234 pages = {267--284} 29235} 29236 29237@TechReport{ fletcher.maza:nonlinear, 29238 author = {R. Fletcher and E. Sainz de la Maza}, 29239 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 29240 Programming}, 29241 institution = {Department of Mathematical Sciences}, 29242 year = {1987}, 29243 address = {The University, Dundee, Scotland}, 29244 number = {NA/100}, 29245 type = {Numerical Analysis Report} 29246} 29247 29248@InCollection{ fletcher:class, 29249 author = {R. Fletcher}, 29250 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 29251 Properties}, 29252 booktitle = {Integer and Nonlinear Programming}, 29253 year = {1970}, 29254 editor = {J. Abadie}, 29255 publisher = {North--Holland}, 29256 address = {Amsterdam}, 29257 pages = {157--173} 29258} 29259 29260@Article{ fletcher:exact, 29261 author = {R. Fletcher}, 29262 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 29263 journal = {Mathematical Programming}, 29264 year = {1973}, 29265 volume = {5}, 29266 pages = {129--150} 29267} 29268 29269@Article{ fletcher:generalized, 29270 author = {R. Fletcher}, 29271 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 29272 Equations}, 29273 journal = {The Computer Journal}, 29274 year = {1968}, 29275 volume = {10}, 29276 pages = {392--399} 29277} 29278 29279@InProceedings{ fletcher:penalty, 29280 crossref = {bachem.grotschel.ea:mathematical}, 29281 author = {R. Fletcher}, 29282 title = {Penalty Functions}, 29283 pages = {87--114} 29284} 29285 29286@Book{ fletcher:practical, 29287 author = {R. Fletcher}, 29288 title = {Practical Methods of Optimization}, 29289 year = {1981}, 29290 publisher = {John Wiley \& Sons}, 29291 address = {Chichester}, 29292 volume = {1} 29293} 29294 29295@Book{ fletcher:practical*1, 29296 author = {R. Fletcher}, 29297 title = {Practical Methods of Optimization}, 29298 year = {1981}, 29299 publisher = {John Wiley \& Sons}, 29300 address = {Chichester}, 29301 volume = {2} 29302} 29303 29304@Book{ fletcher:practical*2, 29305 author = {R. Fletcher}, 29306 title = {Practical Methods of Optimization}, 29307 year = {1987}, 29308 publisher = {John Wiley \& Sons}, 29309 address = {New York}, 29310 edition = {second} 29311} 29312 29313@Unpublished{ fletcher:recent, 29314 author = {R. Fletcher}, 29315 title = {Recent Developments in Nonlinear Programming}, 29316 note = {Presentation at SOR 96, Braunchweig, Germany}, 29317 year = {1996} 29318} 29319 29320@InCollection{ fletcher:second, 29321 author = {R. Fletcher}, 29322 title = {Second Order Correction for Nondifferentiable Optimization}, 29323 booktitle = {Numerical Analysis}, 29324 year = {1982}, 29325 editor = {G. A. Watson}, 29326 publisher = {Springer-Verlag}, 29327 address = {Berlin}, 29328 pages = {85--114} 29329} 29330 29331@InCollection{ florian:mathematical, 29332 author = {M. Florian}, 29333 title = {Mathematical programming applications in national, regional, and urban planning}, 29334 editors = {M. Iri and K. Tanabe}, 29335 booktitle = {Mathematical Programming: Recent Developments and Applications}, 29336 publisher = {Kluwer Academic Publishers}, 29337 address = {Tokyo}, 29338 year = {1989} 29339} 29340 29341@Article{ florian:nonlinear, 29342 author = {M. Florian}, 29343 title = {Nonlinear Cost Network Models in Transportation Analysis}, 29344 journal = {Mathematical Programming Study}, 29345 year = {1986}, 29346 volume = {26}, 29347 pages = {167--196} 29348} 29349 29350@Article{ flynn:computer, 29351 author = {M.~J. Flynn}, 29352 title = {Some Computer Organizations and their Effectiveness}, 29353 journal = {IEEE Transactions on Computers}, 29354 year = {1972}, 29355 volume = {C-21}, 29356 pages = {948--960} 29357} 29358 29359@InProceedings{ fogarty:varying, 29360 crossref = {schaeffer:third}, 29361 author = {T. C. Fogarty}, 29362 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 29363 pages = {422--427} 29364} 29365 29366@Article{ forrest.goldfarb:steepest-edge, 29367 author = {J. J. Forrest and D. Goldfarb}, 29368 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 29369 journal = {Mathematical Programming}, 29370 year = {1992}, 29371 volume = {57}, 29372 pages = {341--374} 29373} 29374 29375@Article{ forrest.tomlin:updating, 29376 author = {J. J. H. Forrest and J. A. Tomlin}, 29377 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 29378 Simplex Method}, 29379 journal = {Mathematical Programming}, 29380 year = {1972}, 29381 volume = {2}, 29382 pages = {263--278} 29383} 29384 29385@TechReport{ forsgren.gill.ea:computing, 29386 author = {A. Forsgren and P. E. Gill and W. Murray}, 29387 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 29388 institution = {Department of Mathematics, Royal Institute of Technology}, 29389 year = {1993}, 29390 number = {TRITA-MAT-1993-9}, 29391 address = {Stockholm, Sweden} 29392} 29393 29394@TechReport{ forsgren.gill:primal-dual, 29395 author = {A. Forsgren and P. E. Gill}, 29396 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 29397 institution = {Department of Mathematics, University of California}, 29398 year = {1996}, 29399 type = {Report NA}, 29400 number = {96-3}, 29401 address = {San Diego} 29402} 29403 29404@InCollection{ fortin.glowinski:decomposition-coordination, 29405 author = {M. Fortin and R. Glowinski}, 29406 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 29407 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 29408 Problems}, 29409 publisher = {North-Holland}, 29410 year = {1983}, 29411 editor = {M. Fortin and R. Glowinski}, 29412 address = {Amsterdam} 29413} 29414 29415@Misc{ foster.kesselman:globus, 29416 author = {I. Foster and C. Kesselman}, 29417 title = {The Globus Project}, 29418 howpublished = {www.globus.org} 29419} 29420 29421@Article{ foster.kesselman:globus*1, 29422 author = {I. Foster and C. Kesselman}, 29423 title = {Globus: A Metacomputing Infrastructure Toolkit}, 29424 journal = {International Journal of Supercomputer Applications}, 29425 volume = {11}, 29426 pages = {115--128}, 29427 year = {1997} 29428} 29429 29430@Book{ foster.kesselman:grid, 29431 editor = {I. Foster and C. Kesselman}, 29432 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 29433 publisher = {Morgan Kaufmann Publishers}, 29434 year = {1999} 29435} 29436 29437@Book{ fourer.gay.ea:ampl, 29438 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29439 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 29440 year = {1993}, 29441 publisher = {Duxbury Press} 29442} 29443 29444@Article{ fourer.gay.ea:modeling, 29445 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29446 title = {A Modeling Language for Mathematical Programming}, 29447 journal = {Management Science}, 29448 year = {1990}, 29449 volume = {36}, 29450 pages = {519--554} 29451} 29452 29453@Article{ fraass:development, 29454 author = {A. Fraass}, 29455 title = {The development of conformal radiation therapy}, 29456 journal = {Medical Physics}, 29457 year = {1995}, 29458 volume = {22}, 29459 number = {11}, 29460 pages = {1911--1921} 29461} 29462 29463@TechReport{ fraley:algorithms, 29464 author = {C. Fraley}, 29465 title = {Algorithms for Nonlinear Least Squares}, 29466 institution = {Stanford University}, 29467 year = {1988}, 29468 number = {{SOL} 88.16}, 29469 type = {Technical Report} 29470} 29471 29472@InCollection{ francois.mcdonald.ea:uruguay, 29473 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29474 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 29475 booktitle = {The {U}ruguay Round and the Developing Economies}, 29476 address = {New York}, 29477 editors = {W. Martin and L. A. Winters}, 29478 publisher = {Cambridge University Press} 29479} 29480 29481@InCollection{ francois.mcdonald.ea:uruguay*1, 29482 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29483 title = {The {U}ruguay Round: {A} Global Analysis}, 29484 booktitle = {Challenges and Opportunities for East Asian Trade}, 29485 address = {Cambridge}, 29486 editors = {D. Robertson}, 29487 publisher = {Cambridge University Press} 29488} 29489 29490@Article{ frank.wolfe:algorithm, 29491 author = {M. Frank and P. Wolfe}, 29492 title = {An Algorithm for Quadratic Programming}, 29493 journal = {Naval Research Logistics Quarterly}, 29494 year = {1956}, 29495 volume = {3}, 29496 pages = {95--110} 29497} 29498 29499@Article{ freund.nachtigal:qmrpack, 29500 author = {R. W. Freund and N. M. Nachtigal}, 29501 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 29502 journal = {{ACM} Transactions on Mathematical Software}, 29503 year = {1996}, 29504 volume = {22}, 29505 pages = {46--77} 29506} 29507 29508@InProceedings{ freund.schapire:experiments, 29509 author = {Y. Freund and R. E. Schapire}, 29510 title = {Experiments with a New Boosting Algorithm}, 29511 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 29512 pages = {148--156}, 29513 year = {1996}, 29514 editor = {L. Saitta}, 29515 publisher = {Morgan Kaufmann} 29516} 29517 29518@Unpublished{ freund.todd:barrier, 29519 author = {Robert M. Freund and Michael J. Todd}, 29520 title = {Barrier functions and interior-point algorithms for linear programming with 29521 zero-, one-, or two-sided bounds on the variables}, 29522 year = {1992}, 29523 month = jul 29524} 29525 29526@Article{ friedman.chernina:iterative, 29527 author = {V. M. Friedman and V. S. Chernina}, 29528 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 29529 note = {In Russian}, 29530 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 29531 volume = {1}, 29532 pages = {116--120}, 29533 year = {1967} 29534} 29535 29536@Article{ friesz.bernstein.ea:day-to-day, 29537 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 29538 Ganjalizadeh}, 29539 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 29540 Systems}, 29541 journal = {Operations Research}, 29542 year = {1994}, 29543 volume = {42}, 29544 pages = {1120--1136} 29545} 29546 29547@Article{ friesz.tobin.ea:nonlinear, 29548 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 29549 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 29550 Derived Demand Network Equilibrium Problem}, 29551 journal = {Journal of Regional Science}, 29552 year = {1983}, 29553 volume = {23}, 29554 pages = {337--359} 29555} 29556 29557@Article{ friesz:network, 29558 author = {T. L. Friesz}, 29559 title = {Network Equilibrium, Design and Aggregation}, 29560 journal = {Transportation Research}, 29561 volume = {19A}, 29562 year = {1985}, 29563 pages = {413--427} 29564} 29565 29566@Unpublished{ frisch:logarithmic, 29567 author = {K. R. Frisch}, 29568 title = {The Logarithmic Potential Method of Convex Programming}, 29569 year = {1955}, 29570 note = {Unpublished manuscript, University Institute of Economics, Oslo} 29571} 29572 29573@Book{ fukunaga:statistical, 29574 author = {K. Fukunaga}, 29575 title = {Statistical Pattern Recognition}, 29576 year = {1990}, 29577 publisher = {Academic Press}, 29578 address = {New York} 29579} 29580 29581@Article{ fukushima.luo.ea:globally, 29582 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 29583 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 29584 Programs with Linear Complementarity Constraints}, 29585 journal = {Computational Optimization and Applications}, 29586 year = {1998}, 29587 volume = {10}, 29588 pages = {5--34} 29589} 29590 29591@Article{ fukushima:equivalent, 29592 author = {M. Fukushima}, 29593 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 29594 Asymmetric Variational Inequality Problems}, 29595 journal = {Mathematical Programming}, 29596 year = {1992}, 29597 volume = {53}, 29598 pages = {99--110} 29599} 29600 29601@Article{ fukushima:primal, 29602 author = {M. Fukushima}, 29603 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 29604 Mappings with Application to the Traffic Equilibrium Problem}, 29605 journal = {Mathematical Programming}, 29606 year = {1996}, 29607 volume = {72}, 29608 pages = {1--15} 29609} 29610 29611@Article{ gabay.mercier:dual, 29612 author = {D. Gabay and B. Mercier}, 29613 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 29614 Finite Element Approximations}, 29615 journal = {Computational Mathematics and Applications}, 29616 year = {1976}, 29617 volume = {2}, 29618 pages = {17--48} 29619} 29620 29621@InCollection{ gabay:applications, 29622 author = {D. Gabay}, 29623 title = {Applications of the Method of Multipliers to Variational Inequalities}, 29624 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 29625 Problems}, 29626 publisher = {North-Holland}, 29627 year = {1983}, 29628 editor = {M. Fortin and R. Glowinski}, 29629 address = {Amsterdam} 29630} 29631 29632@Unpublished{ gabriel.bernstein:path, 29633 author = {S. A. Gabriel and D. Berstein}, 29634 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 29635 Equilibrium Problem}, 29636 note = {Draft, 1995} 29637} 29638 29639@TechReport{ gabriel.kydes:nonlinear, 29640 author = {S. A. Gabriel and A. S. Kydes}, 29641 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 29642 System}, 29643 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 29644 year = {1995}, 29645 type = {Preprint}, 29646 number = {MCS-P504-0395}, 29647 address = {Argonne, Illinois}, 29648 month = mar 29649} 29650 29651@InProceedings{ gabriel.more:smoothing, 29652 crossref = {ferris.pang:complementarity}, 29653 author = {S. A. Gabriel and J. J. Mor\'{e}}, 29654 title = {Smoothing of Mixed Complementarity Problems} 29655} 29656 29657@Article{ gabriel.pang:inexact, 29658 author = {S. A. Gabriel and J. S. Pang}, 29659 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 29660 journal = {Computational Optimization and Applications}, 29661 year = {1992}, 29662 volume = {1}, 29663 pages = {67--91} 29664} 29665 29666@InCollection{ gabriel.pang:trust, 29667 author = {S. A. Gabriel and J. S. Pang}, 29668 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 29669 booktitle = {Large--Scale Optimization: State of the Art}, 29670 publisher = {Kluwer Academic Publishers}, 29671 year = {1994}, 29672 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 29673 pages = {159--186} 29674} 29675 29676@PhDThesis{ gabriel:algorithms, 29677 author = {S. A. Gabriel}, 29678 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 29679 Extensions}, 29680 school = {The Johns Hopkins University}, 29681 year = {1992}, 29682 address = {Baltimore, Maryland} 29683} 29684 29685@Article{ gafni.bertsekas:two-metric, 29686 author = {E. M. Gafni and D. P. Bertsekas}, 29687 title = {Two-Metric Projection Methods for Constrained Optimization}, 29688 journal = {SIAM Journal on Control and Optimization}, 29689 year = {1984}, 29690 volume = {22}, 29691 pages = {936--964} 29692} 29693 29694@InProceedings{ gaivoronski:convergence, 29695 author = {A. A. Gaivoronski}, 29696 title = {Convergence of Parallel Backpropagation for Neural Networks}, 29697 booktitle = {SIAM Journal on Optimization}, 29698 year = {1994}, 29699 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 29700 submitted} 29701} 29702 29703@Misc{ gaivoronski:private, 29704 author = {A. A. Gaivoronski}, 29705 title = {Private Communication}, 29706 year = {1992}, 29707 month = nov, 29708 address = {ITALTEL, Milan} 29709} 29710 29711@Book{ gale:theory, 29712 author = {D. Gale}, 29713 title = {The Theory of Linear Economic Models}, 29714 year = {1960}, 29715 publisher = {McGraw-Hill Book Company}, 29716 address = {New York} 29717} 29718 29719@Book{ gallant:neural, 29720 author = {S. I. Gallant}, 29721 title = {Neural Network Learning and Expert Systems}, 29722 year = {1993}, 29723 publisher = {MIT Press}, 29724 address = {Cambridge, Massachusetts} 29725} 29726 29727@InProceedings{ ganti.gehrke.ea:framework, 29728 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 29729 title = {A Framework for Measuring Changes in Data Characteristics}, 29730 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 29731 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 29732 publisher = {ACM Press}, 29733 year = {1999}, 29734 isbn = {1-58113-062-7}, 29735 pages = {126--137} 29736} 29737 29738@Book{ ganz:gamma, 29739 author = {J. C. Ganz}, 29740 title = {Gamma Knife Surgery}, 29741 publisher = {Springer-Verlag Wien}, 29742 year = {1997}, 29743 address = {Austria} 29744} 29745 29746@TechReport{ gao:nonlinear, 29747 author = {Y. Gao}, 29748 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 29749 Conditions}, 29750 type = {Manuscript}, 29751 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 29752 month = oct, 29753 year = {1994} 29754} 29755 29756@Article{ garcia-palomares.mangasarian:superlinearly, 29757 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 29758 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 29759 Optimization Problems}, 29760 journal = {Mathematical Programming}, 29761 year = {1976}, 29762 volume = {11}, 29763 pages = {1--13} 29764} 29765 29766@Article{ garcia-palomares.restuccia:global, 29767 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 29768 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 29769 journal = {Mathematical Programming}, 29770 year = {1981}, 29771 volume = {21}, 29772 pages = {290--300} 29773} 29774 29775@InProceedings{ garcia-palomares:superlinearly, 29776 author = {U. M. {Garcia--Palomares}}, 29777 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 29778 crossref = {mangasarian.meyer.ea:nonlinear*2}, 29779 pages = {101--119} 29780} 29781 29782@Article{ garcia.gould:theorem, 29783 author = {C. B. Garcia and F. J. Gould}, 29784 title = {A Theorem on Homotopy Paths}, 29785 journal = {Mathematics of Operations Research}, 29786 year = {1978}, 29787 volume = {3}, 29788 pages = {282--289} 29789} 29790 29791@Book{ garcia.zangwill:pathways, 29792 author = {C. B. Garcia and W. I. Zangwill}, 29793 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 29794 year = {1981}, 29795 publisher = {Prentice-Hall, Inc}, 29796 address = {Englewood Cliffs, New Jersey} 29797} 29798 29799@Book{ garey.johnson:computers, 29800 author = {M. R. Garey and D. S. Johnson}, 29801 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 29802 year = {1979}, 29803 publisher = {W.H. Freeman and Company}, 29804 address = {San Francisco} 29805} 29806 29807@Article{ garey.tarjan.ea:one-processor, 29808 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 29809 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 29810 journal = {Mathematics of Operations Research}, 29811 year = {1988}, 29812 volume = {13}, 29813 pages = {330--348} 29814} 29815 29816@Book{ garfinkel.nemhauser:integer, 29817 author = {R. S. Garfinkel and G. L. Nemhauser}, 29818 title = {Integer Programming}, 29819 year = {1972}, 29820 publisher = {John Wiley \& Sons}, 29821 address = {New York} 29822} 29823 29824@Book{ gass:linear, 29825 author = {S. Gass}, 29826 title = {Linear Programming Methods and Applications}, 29827 edition = {Fifth}, 29828 publisher = {Boyd and Fraser Publishing Company}, 29829 address = {Danvers, Massachusetts}, 29830 year = {1985} 29831} 29832 29833@InProceedings{ gay:combining, 29834 author = {D. M. Gay}, 29835 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 29836 booktitle = {Sparse Matrix Proceedings 1978}, 29837 editor = {I. S. Duff and G. W. Stewart}, 29838 year = {1978}, 29839 organization = {SIAM}, 29840 address = {Philadelphia, Pennsylvania}, 29841 pages = {313--334} 29842} 29843 29844@Article{ gay:electronic, 29845 author = {D. M. Gay}, 29846 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 29847 journal = {{COAL} Newsletter}, 29848 year = {1985}, 29849 volume = {13}, 29850 pages = {10--12} 29851} 29852 29853@TechReport{ gay:hooking, 29854 author = {D. M. Gay}, 29855 title = {Hooking Your Solver to {AMPL}}, 29856 year = {1997}, 29857 institution = {Bell Laboratories}, 29858 address = {Murray Hill, New Jersey}, 29859 note = {Revised 1994, 1997} 29860} 29861 29862@Article{ gay:variant, 29863 author = {D. Gay}, 29864 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 29865 Form}, 29866 journal = {Mathematical Programming}, 29867 year = {1987}, 29868 volume = {37}, 29869 pages = {81--90} 29870} 29871 29872@Article{ geiger.kanzow:resolution, 29873 author = {C. Geiger and C. Kanzow}, 29874 title = {On the Resolution of Monotone Complementarity Problems}, 29875 journal = {Computational Optimization and Applications}, 29876 volume = {5}, 29877 year = {1996}, 29878 pages = {155--173} 29879} 29880 29881@Book{ geist.beguelin.ea:pvm, 29882 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 29883 V. S. Sunderam}, 29884 title = {{PVM}: Parallel Virtual Machine}, 29885 publisher = {MIT Press}, 29886 address = {Cambridge, Massachusetts}, 29887 year = {1994} 29888} 29889 29890@Article{ gendron.crainic:parallel, 29891 author = {B. Gendron and T. G. Crainic}, 29892 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 29893 journal = {Operations Research}, 29894 year = {1994}, 29895 volume = {42}, 29896 pages = {1042--1060} 29897} 29898 29899@Article{ george:automatic, 29900 author = {A. George}, 29901 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 29902 journal = {SIAM Journal on Numerical Analysis}, 29903 vol = {17}, 29904 pages = {740--751}, 29905 year = {1980} 29906} 29907 29908@InProceedings{ georges-schleuter:asparagos, 29909 crossref = {schaeffer:third}, 29910 author = {M. Georges--Schleuter}, 29911 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 29912 pages = {416--421} 29913} 29914 29915@Article{ georgiou:comments, 29916 author = {G. M. Georgiou}, 29917 title = {Comments On Hidden Nodes in Neural Nets}, 29918 journal = {IEEE Transactions on Circuits and Systems}, 29919 year = {1991}, 29920 volume = {38}, 29921 pages = {1410} 29922} 29923 29924@TechReport{ gertz.linderoth.ea:object-oriented, 29925 author = {M. Gertz and J. Linderoth and S. Wright}, 29926 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 29927 institution = {MCS Division, Argonne National Laboratory}, 29928 year = {in preparation} 29929} 29930 29931@Article{ ghellinck.vial:polynomial, 29932 author = {G. de Ghellinck and J.--Ph. Vial}, 29933 title = {A Polynomial {N}ewton Method for Linear Programming}, 29934 journal = {Algorithmica}, 29935 year = {1986}, 29936 volume = {1}, 29937 pages = {425--453} 29938} 29939 29940@InCollection{ gilbert.ng:predicting, 29941 author = {J. R. Gilbert and E. Ng}, 29942 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 29943 year = {1993}, 29944 booktitle = {Graph Theory and Sparse Matrix Computation}, 29945 editor = {A. George and J. Gilbert and J. Liu}, 29946 publisher = {Springer-Verlag} 29947} 29948 29949@Article{ gilbert-lemarechal, 29950 author = {J. C. Gilbert and C. Lemarechal}, 29951 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 29952 journal = {Mathematical Programming}, 29953 year = {1989}, 29954 volume = {45}, 29955 pages = {407--434} 29956} 29957 29958@Article{ gill.murray.ea:computing, 29959 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29960 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 29961 journal = {SIAM Journal on Scientific and Statistical Computing}, 29962 year = {1983}, 29963 volume = {4}, 29964 pages = {310--321} 29965} 29966 29967@Article{ gill.murray.ea:maintaining, 29968 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29969 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 29970 year = {1987}, 29971 journal = {Linear Algebra and Its Applications}, 29972 volume = {88/89}, 29973 pages = {239--270} 29974} 29975 29976@Book{ gill.murray.ea:practical, 29977 author = {P. E. Gill and W. Murray and M. H. Wright}, 29978 title = {Practical Optimization}, 29979 year = {1981}, 29980 publisher = {Academic Press}, 29981 address = {London} 29982} 29983 29984@Article{ gill.murray.ea:practical*1, 29985 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29986 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 29987 journal = {Mathematical Programming}, 29988 year = {1989}, 29989 volume = {45}, 29990 pages = {437--474} 29991} 29992 29993@Article{ gill.murray.ea:projected, 29994 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 29995 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 29996 to {K}armarkar's Projective Method}, 29997 journal = {Mathematical Programming}, 29998 year = {1986}, 29999 volume = {36}, 30000 pages = {183--209} 30001} 30002 30003@Article{ gill.murray:newton-type, 30004 author = {P. E. Gill and W. Murray}, 30005 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 30006 journal = {Mathematical Programming}, 30007 year = {1974}, 30008 volume = {7}, 30009 pages = {311--350} 30010} 30011 30012@InProceedings{ gill.murray:nonlinear, 30013 author = {P. E. Gill and W. Murray}, 30014 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 30015 booktitle = {Numerical Analysis, Dundee 1975}, 30016 year = {1976}, 30017 editor = {G. A. Watson}, 30018 publisher = {Springer-Verlag}, 30019 address = {Berlin}, 30020 note = {Lecture Notes in Mathematics 506} 30021} 30022 30023@Book{ ginsburgh.waelbroeck:activity, 30024 author = {V. Ginsburgh and J. Waelbroeck}, 30025 title = {Activity Analysis and General Equilibrium Modelling}, 30026 publisher = {North--Holland}, 30027 year = {1981}, 30028 address = {Amsterdam} 30029} 30030 30031@Article{ glad.goldstein:errors, 30032 author = {T. Glad and A. Goldstein}, 30033 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 30034 journal = {BIT}, 30035 year = {1977}, 30036 volume = {17}, 30037 pages = {160--169} 30038} 30039 30040@Article{ glad.polak:multiplier, 30041 author = {T. Glad and E. Polak}, 30042 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 30043 journal = {Mathematical Programming}, 30044 year = {1979}, 30045 volume = {17}, 30046 pages = {140--155} 30047} 30048 30049@Book{ glashoff.gustafson:linear, 30050 author = {K. Glashoff and S.--\AA. Gustafson}, 30051 title = {Linear Optimization and Approximation}, 30052 year = {1983}, 30053 publisher = {Springer-Verlag}, 30054 address = {New York} 30055} 30056 30057@Article{ glover:improved, 30058 author = {F. Glover}, 30059 title = {Improved Linear Programming Models for Discriminant Analysis}, 30060 journal = {Decision Sciences}, 30061 year = {1990}, 30062 volume = {21}, 30063 pages = {771--785} 30064} 30065 30066@Book{ glasserman:gradient, 30067 author = {P. Glasserman}, 30068 title = {Gradient Estimation via Perturbation Analysis}, 30069 publisher = {Kluwer}, 30070 year = {1991}, 30071 address = {Norwell, MA} 30072} 30073 30074@Article{ glover:tabu, 30075 author = {F. Glover}, 30076 title = {Tabu Search -- Part 1}, 30077 journal = {ORSA Journal on Computing}, 30078 year = {1989}, 30079 volume = {1}, 30080 pages = {190--206} 30081} 30082 30083@Article{ glowinski.marroco:sur, 30084 author = {R. Glowinski and A. Marroco}, 30085 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 30086 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 30087 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 30088 year = {1975}, 30089 volume = {9(R-2)}, 30090 pages = {41--76} 30091} 30092 30093@TechReport{ goeleven.nguyen:convergence, 30094 author = {D. Goeleven and V. H. Nguyen}, 30095 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 30096 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 30097 year = {1992}, 30098 address = {B-5000 Namur, Belgium} 30099} 30100 30101@Book{ goldberg:genetic, 30102 author = {D. E. Goldberg}, 30103 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 30104 year = {1989}, 30105 publisher = {Addison-Wesley}, 30106 address = {Reading MA} 30107} 30108 30109@Article{ golden.skiscim:simulated, 30110 author = {B. L. Golden and C. C. Skiscim}, 30111 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 30112 journal = {Naval Research Logistics Quarterly}, 30113 year = {1989}, 30114 volume = {33}, 30115 pages = {261--279} 30116} 30117 30118@Article{ goldfarb.reid:practical, 30119 author = {D. Goldfarb and J. K. Reid}, 30120 title = {A Practical Steepest--Edge Simplex Algorithm}, 30121 journal = {Mathematical Programming}, 30122 year = {1977}, 30123 volume = {12}, 30124 pages = {361--371} 30125} 30126 30127@InProceedings{ goldman.tucker:theory, 30128 author = {A. J. Goldman and A. W. Tucker}, 30129 title = {Theory of Linear Programming}, 30130 booktitle = {Linear Inequalities and Related Systems}, 30131 year = {1956}, 30132 editor = {H. W. Kuhn and A. W. Tucker}, 30133 publisher = {Princeton University Press}, 30134 address = {Princeton, New Jersey}, 30135 pages = {53--97} 30136} 30137 30138@Book{ goldstein:constructive, 30139 author = {A. A. Goldstein}, 30140 title = {Constructive Real Analysis}, 30141 year = {1967}, 30142 publisher = {Harper and Row}, 30143 address = {New York} 30144} 30145 30146@Article{ golshtein:block, 30147 author = {Ye. G. Golshtein}, 30148 title = {The Block Method of Convex Programming}, 30149 journal = {Soviet Mathematics Doklady}, 30150 year = {1986}, 30151 volume = {33}, 30152 pages = {584--587} 30153} 30154 30155@Article{ golshtein:general, 30156 author = {Ye. G. Golshtein}, 30157 title = {A General Approach to Decomposition of Optimization Systems}, 30158 journal = {Soviet Journal of Computer and Systems Sciences}, 30159 year = {1987}, 30160 volume = {3}, 30161 pages = {105--114} 30162} 30163 30164@Article{ golub.kahan:calculating, 30165 author = {G. H. Golub and W. Kahan}, 30166 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 30167 journal = {SIAM Journal on Numerical Analysis}, 30168 year = {1965}, 30169 volume = {2}, 30170 pages = {205--224} 30171} 30172 30173@Book{ golub.vanloan:matrix, 30174 author = {G. H. Golub and C. F. {Van Loan}}, 30175 title = {Matrix Computations}, 30176 year = {1996}, 30177 publisher = {The John Hopkins University Press}, 30178 address = {Baltimore, Maryland}, 30179 edition = {Third} 30180} 30181 30182@TechReport{ gomez.barron:exponential, 30183 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 30184 title = {The Exponential Tunneling Method}, 30185 institution = {Universidad Nacional Autonoma de Mexico}, 30186 year = {1991}, 30187 type = {Serie Reportes de Investigacion}, 30188 number = {3}, 30189 address = {Mexico} 30190} 30191 30192@Article{ gondzio:multiple, 30193 author = {J. Gondzio}, 30194 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 30195 journal = {Computational Optimization and Applications}, 30196 year = {1996}, 30197 volume = {6}, 30198 pages = {137--156} 30199} 30200 30201@TechReport{ gonzaga:algorithm, 30202 author = {C. C. Gonzaga}, 30203 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 30204 operations}, 30205 institution = {Electronics Research Laboratory, University of California}, 30206 year = {1987}, 30207 address = {Berkeley, California}, 30208 number = {UCB/ERL M87/10}, 30209 type = {Memorandum} 30210} 30211 30212@Article{ gould.tolle:necessary, 30213 author = {F. J. Gould and J. W. Tolle}, 30214 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 30215 journal = {SIAM Journal on Applied Mathematics}, 30216 year = {1971}, 30217 volume = {20}, 30218 pages = {164--172} 30219} 30220 30221@InProceedings{ goux.kulkarni.ea:enabling, 30222 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 30223 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 30224 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 30225 Distributed Computing}, 30226 year = {2000} 30227} 30228 30229@Article{ gowda.pang:basic, 30230 author = {M. S. Gowda and J. S. Pang}, 30231 title = {The Basic Theorem of Complementarity Revisited}, 30232 journal = {Mathematical Programming}, 30233 year = {1993}, 30234 volume = {58}, 30235 pages = {161--178} 30236} 30237 30238@Article{ gowda.pang:boundedness, 30239 author = {M. S. Gowda and J. S. Pang}, 30240 title = {On the Boundedness and Stability of Solutions to the Affine Variational 30241 Inequality Problem}, 30242 journal = {SIAM Journal on Control and Optimization}, 30243 year = {1994}, 30244 volume = {32}, 30245 pages = {421--441} 30246} 30247 30248@Article{ gowda.pang:stability, 30249 author = {M. S. Gowda and J. S. Pang}, 30250 title = {Stability analysis of variational inequalities and nonlinear complementarity 30251 problems, via the mixed linear complementarity problem and degree theory}, 30252 journal = {Mathematics of Operations Research}, 30253 year = {1994}, 30254 volume = {19}, 30255 pages = {831--879} 30256} 30257 30258@Article{ gowda.sznajder:generalizations, 30259 author = {M. S. Gowda and R. Sznajder}, 30260 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 30261 Horizontal {LCP}s}, 30262 journal = {Linear Algebra and Its Applications}, 30263 year = {1995}, 30264 volume = {223/224}, 30265 pages = {695--715} 30266} 30267 30268@Article{ gowda.sznajder:generalized, 30269 author = {M. S. Gowda and R. Sznajder}, 30270 title = {The Generalized Order Linear Complementarity Problem}, 30271 journal = {SIAM Journal on Matrix Analysis and Applications}, 30272 year = {1994} 30273} 30274 30275@Article{ gowda:analysis, 30276 author = {M. S. Gowda}, 30277 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 30278 Function via its Recession Function}, 30279 journal = {SIAM Journal on Matrix Analysis and Applications}, 30280 year = {1996}, 30281 volume = {17}, 30282 pages = {594--609} 30283} 30284 30285@Article{ gowda:applications, 30286 author = {M. S. Gowda}, 30287 title = {Applications of Degree Theory to Linear Complementarity Problems}, 30288 journal = {Mathematics of Operations Research}, 30289 year = {1993}, 30290 volume = {18}, 30291 pages = {868--879} 30292} 30293 30294@Article{ grant.woo:clinical, 30295 author = {W. I. Grant and S. Y. Woo}, 30296 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 30297 Delivery}, 30298 journal = {Seminars in Radiation Oncology}, 30299 year = {1999}, 30300 volume = {9}, 30301 pages = {99--107} 30302} 30303 30304@Article{ greenberg.hegerich:branch, 30305 author = {H. Greenberg and R. L. Hegerich}, 30306 title = {A Branch Search Algorithm for the Knapsack Problem}, 30307 journal = {Management Science}, 30308 year = {1970}, 30309 volume = {16}, 30310 pages = {327--332} 30311} 30312 30313@InCollection{ grefenstette:incorporating, 30314 crossref = {davis:genetic}, 30315 author = {J. J. Grefenstette}, 30316 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 30317} 30318 30319@Book{ griewank.corliss:automatic, 30320 editor = {A. Griewank and G. F. Corliss}, 30321 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 30322 publisher = {SIAM}, 30323 year = {1991}, 30324 address = {Philadelphia, Pennsylvania} 30325} 30326 30327@Article{ griewank.juedes.ea:adol-c, 30328 author = {A. Griewank and D. Juedes and J. Utke}, 30329 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 30330 in {C}/{C}++}, 30331 journal = {{ACM} Transactions on Mathematical Software}, 30332 year = {1996}, 30333 volume = {22}, 30334 pages = {131--167} 30335} 30336 30337@Article{ griffith.stewart:nonlinear, 30338 author = {R. E. Griffith and R. A. Stewart}, 30339 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 30340 Systems}, 30341 journal = {Management Science}, 30342 year = {1961}, 30343 volume = {7}, 30344 pages = {379--392} 30345} 30346 30347@Article{ grinold:mathematical, 30348 author = {R. C. Grinold}, 30349 title = {Mathematical Methods for {PA}ttern Classification}, 30350 journal = {Management Science}, 30351 year = {1972}, 30352 volume = {19}, 30353 pages = {272--289} 30354} 30355 30356@Article{ grippo.lampariello.ea:class, 30357 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30358 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 30359 journal = {Numerische Mathematik}, 30360 year = {1991}, 30361 volume = {59}, 30362 pages = {779--805} 30363} 30364 30365@Article{ grippo.lampariello.ea:global, 30366 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30367 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 30368 Without Derivatives}, 30369 journal = {Journal of Optimization Theory and Applications}, 30370 year = {1988}, 30371 volume = {56}, 30372 pages = {385--406} 30373} 30374 30375@Article{ grippo.lampariello.ea:nonmonotone, 30376 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30377 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 30378 journal = {SIAM Journal on Numerical Analysis}, 30379 year = {1986}, 30380 volume = {23}, 30381 pages = {707--716} 30382} 30383 30384@Misc{ grippo:private, 30385 author = {L. Grippo}, 30386 title = {Private Communication}, 30387 year = {1992}, 30388 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 30389} 30390 30391@Article{ grotschel.lovasz.ea:ellipsoid, 30392 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 30393 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 30394 journal = {Combinatorica}, 30395 year = {1981}, 30396 volume = {1}, 30397 pages = {169--197} 30398} 30399 30400@Article{ guignard:generalized, 30401 author = {M. Guignard}, 30402 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 30403 {B}anach Space}, 30404 journal = {SIAM Journal on Control and Optimization}, 30405 year = {1969}, 30406 volume = {7}, 30407 pages = {232--241} 30408} 30409 30410@Article{ guler.ye:convergence, 30411 author = {O. G{\"{u}}ler and Y. Ye}, 30412 title = {Convergence Behavior of Interior--Point Algorithms}, 30413 journal = {Mathematical Programming}, 30414 year = {1993}, 30415 volume = {60}, 30416 pages = {215--228} 30417} 30418 30419@Article{ guler:existence, 30420 author = {O. G{\"{u}}ler}, 30421 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 30422 Complementarity Problems}, 30423 journal = {Mathematics of Operations Research}, 30424 year = {1993}, 30425 volume = {18}, 30426 pages = {128--147} 30427} 30428 30429@Article{ guler:generalized, 30430 author = {O. G{\"{u}}ler}, 30431 title = {Generalized Linear Complementarity Problems}, 30432 journal = {Mathematics of Operations Research}, 30433 year = {1995}, 30434 volume = {20}, 30435 pages = {441--448} 30436} 30437 30438@Article{ gupta.sen:minimizing, 30439 author = {S. Gupta and T. Sen}, 30440 title = {Minimizing the Range of Lateness on a Single Machine}, 30441 journal = {Journal of the Operational Research Society}, 30442 year = {1984}, 30443 volume = {35}, 30444 pages = {853--857} 30445} 30446 30447@InCollection{ gustafson:numerical, 30448 author = {S.-\AA. Gustafson}, 30449 title = {On Numerical Analysis in Semi-Infinite Programming}, 30450 booktitle = {Semi-Infinite Programming}, 30451 year = {1979}, 30452 editor = {R. Hettich}, 30453 publisher = {Springer-Verlag}, 30454 address = {Berlin} 30455} 30456 30457@Article{ gustafsson.lind.ea:simultaneous, 30458 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 30459 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 30460 or compensation filters using a generalized pencil beam algorithm}, 30461 journal = {Medical Physics}, 30462 year = {1995}, 30463 volume = {22}, 30464 number = {7}, 30465 pages = {1141--1156} 30466} 30467 30468@PhDThesis{ ha:decomposition, 30469 author = {C. D. Ha}, 30470 title = {Decomposition Methods for Structured Convex Programming}, 30471 year = {1980}, 30472 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30473} 30474 30475@TechReport{ haakonsen.mathiesen:toward, 30476 author = {L. Haakonsen and L. Mathiesen}, 30477 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 30478 institution = {NHH, Bergen}, 30479 year = {1995}, 30480 type = {Discussion Paper}, 30481 number = {3/95} 30482} 30483 30484@Article{ haaland.norman.ea:vemod, 30485 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 30486 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 30487 journal = {Scandinavian Journal of Economics}, 30488 year = {1987} 30489} 30490 30491@Article{ haarhoff.buys:method, 30492 author = {P. C. Haarhoff and J. D. Buys}, 30493 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 30494 Constraints}, 30495 journal = {Computer Journal}, 30496 year = {1970}, 30497 volume = {12}, 30498 pages = {178--184} 30499} 30500 30501@Article{ habetler.kostreva:direct, 30502 author = {G. J. Habetler and M. M. Kostreva}, 30503 title = {On a direct algorithm for nonlinear complementarity problems}, 30504 journal = {SIAM Journal on Control and Optimization}, 30505 volume = {16}, 30506 year = {1978}, 30507 pages = {504--511} 30508} 30509 30510@Book{ hadamard:cauchys, 30511 author = {J. Hadamard}, 30512 title = {Cauchy's Problem in Linear Partial Differential Equations}, 30513 year = {1923}, 30514 publisher = {Yale University Press} 30515} 30516 30517@Article{ haddock.mittenthal:simulation, 30518 author = {J. Haddock and J. Mittenthal}, 30519 title = {Simulation optimization using simulated annealing}, 30520 journal = {Comput. Ind. Eng.}, 30521 year = {1992}, 30522 volume = {22}, 30523 pages = {387--395} 30524} 30525 30526@TechReport{ hamala:general, 30527 author = {M. Hamala}, 30528 title = {A General Approach to Interior Point Methods with Linear Parameter for 30529 Mathematical Programming}, 30530 institution = {Royal Institute of Technology}, 30531 year = {1978}, 30532 number = {1978--20}, 30533 type = {Department of Mathematics Paper TRITA--MAT} 30534} 30535 30536@Article{ han.mangasarian:dual, 30537 author = {S.--P. Han and O. L. Mangasarian}, 30538 title = {A Dual Differentiable Exact Penalty Function}, 30539 journal = {Mathematical Programming}, 30540 year = {1983}, 30541 volume = {25}, 30542 pages = {293--301} 30543} 30544 30545@Article{ han.mangasarian:exact, 30546 author = {S.--P. Han and O. L. Mangasarian}, 30547 title = {Exact Penalty Functions in Nonlinear Programming}, 30548 journal = {Mathematical Programming}, 30549 year = {1979}, 30550 volume = {17}, 30551 pages = {251--269} 30552} 30553 30554@Article{ han.pang.ea:globally, 30555 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 30556 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 30557 journal = {Mathematics of Operations Research}, 30558 year = {1992}, 30559 volume = {17}, 30560 pages = {586--607} 30561} 30562 30563@Article{ han:decomposition, 30564 author = {S.--P. Han}, 30565 title = {A Decomposition Method and its Application to Convex Programming}, 30566 journal = {Mathematics of Operations Research}, 30567 year = {1989}, 30568 volume = {14}, 30569 pages = {237--248} 30570} 30571 30572@Article{ han:globally, 30573 author = {S.--P. Han}, 30574 title = {A Globally Convergent Method for Nonlinear Programming}, 30575 journal = {Journal of Optimization Theory and Applications}, 30576 year = {1977}, 30577 volume = {22}, 30578 pages = {297--309} 30579} 30580 30581@Article{ han:superlinearly, 30582 author = {S.--P. Han}, 30583 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 30584 Programming Problems}, 30585 journal = {Mathematical Programming}, 30586 year = {1976}, 30587 volume = {11}, 30588 pages = {263--282} 30589} 30590 30591@Article{ hansen.koopmans:definition, 30592 author = {T. Hansen and T. C. Koopmans}, 30593 title = {On the Definition and Computation of a Capital Stock Invariant Under 30594 Optimization}, 30595 journal = {Journal of Economic Theory}, 30596 year = {1972}, 30597 volume = {5}, 30598 pages = {487--523} 30599} 30600 30601@InCollection{ harker.pang:damped, 30602 author = {P. T. Harker and J. S. Pang}, 30603 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 30604 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 30605 publisher = {AMS}, 30606 year = {1990}, 30607 editor = {E. L. Allgower and K. Georg}, 30608 number = {26}, 30609 series = {Lectures on Applied Mathematics}, 30610 address = {Providence, Rhode Island}, 30611 pages = {265--284} 30612} 30613 30614@Article{ harker.pang:existence, 30615 author = {P. T. Harker and J. S. Pang}, 30616 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 30617 Constraints}, 30618 journal = {Operations Research Letters}, 30619 year = {1988}, 30620 volume = {7}, 30621 pages = {61--64} 30622} 30623 30624@Article{ harker.pang:finite-dimensional, 30625 author = {P. T. Harker and J. S. Pang}, 30626 title = {Finite--dimensional variational inequality and nonlinear complementarity 30627 problems: {A} survey of theory, algorithms and applications}, 30628 journal = {Mathematical Programming}, 30629 year = {1990}, 30630 volume = {48}, 30631 pages = {161--220} 30632} 30633 30634@Article{ harker.xiao:newtons, 30635 author = {P. T. Harker and B. Xiao}, 30636 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 30637 {B}--Differentiable Equation Approach}, 30638 journal = {Mathematical Programming}, 30639 year = {1990}, 30640 volume = {48}, 30641 pages = {339--358} 30642} 30643 30644@Article{ harker:accelerating, 30645 author = {P. T. Harker}, 30646 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 30647 Finite--Dimensional Variational Inequalities}, 30648 journal = {Mathematical Programming}, 30649 year = {1988}, 30650 volume = {41}, 30651 pages = {29--50} 30652} 30653 30654@Article{ harker:generalized, 30655 author = {P. T. Harker}, 30656 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 30657 journal = {European Journal of Operations Research}, 30658 volume = {54}, 30659 pages = {81--94}, 30660 year = {1987} 30661} 30662 30663@Book{ harker:lectures, 30664 author = {P. T. Harker}, 30665 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 30666 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 30667 year = {1993}, 30668 series = {CORE Lecture Series} 30669} 30670 30671@Article{ harris:pivot, 30672 author = {P. M. J. Harris}, 30673 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 30674 journal = {Mathematical Programming}, 30675 year = {1973}, 30676 volume = {5}, 30677 pages = {1--28} 30678} 30679 30680@InCollection{ harrison.kristrom:carbon, 30681 author = {G. W. Harrison and B. Kristrom}, 30682 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 30683 booktitle = {Environment and Transport in Economic Modelling}, 30684 publisher = {Kluwer Academic Publishers}, 30685 year = {1997}, 30686 editor = {R. Roson and K. A. Small}, 30687 address = {Amsterdam} 30688} 30689 30690@Article{ harrison.rutherford.ea:increased, 30691 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30692 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 30693 journal = {Journal of Economic Integration}, 30694 year = {1996}, 30695 volume = {11}, 30696 pages = {332--365} 30697} 30698 30699@Article{ harrison.rutherford.ea:liberalizing, 30700 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 30701 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 30702 journal = {Journal of Policy Modeling}, 30703 year = {1995}, 30704 volume = {17} 30705} 30706 30707@Article{ harrison.rutherford.ea:quantifying, 30708 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30709 title = {Quantifying the {U}ruguay Round}, 30710 journal = {Finance and Development}, 30711 year = {1995}, 30712 volume = {32}, 30713 pages = {38--41} 30714} 30715 30716@InProceedings{ harrison.rutherford.ea:quantifying*1, 30717 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30718 title = {Quantifying the {U}ruguay Round}, 30719 year = {1996}, 30720 booktitle = {The {U}ruguay Round and the Developing Economies}, 30721 address = {New York}, 30722 editors = {W. Martin and L. A. Winters}, 30723 publisher = {Cambridge University Press} 30724} 30725 30726@Article{ harrison.rutherford.ea:quantifying*2, 30727 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30728 title = {Quantifying the {U}ruguay Round}, 30729 journal = {The Economic Journal}, 30730 year = {1997}, 30731 volume = {107}, 30732 pages = {1405--1430} 30733} 30734 30735@Article{ harrison.rutherford.ea:trade, 30736 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30737 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 30738 journal = {The World Bank Economic Review}, 30739 year = {1993}, 30740 volume = {7}, 30741 pages = {191--217} 30742} 30743 30744@Article{ hartman.stampacchia:nonlinear, 30745 author = {P. Hartman and G. Stampacchia}, 30746 title = {On some nonlinear differential-functional equations}, 30747 journal = {Acta Mathematica}, 30748 year = {1966}, 30749 volume = {115}, 30750 pages = {271--310} 30751} 30752 30753@Book{ harvey:forecasting, 30754 author = {Andrew C. Harvey}, 30755 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 30756 publisher = {Cambridge University Press}, 30757 address = {New York, NY}, 30758 year = {1989} 30759} 30760 30761@Article{ haurie.marcotte:relationship, 30762 author = {A. Haurie and P. Marcotte}, 30763 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 30764 journal = {Networks}, 30765 year = {1985}, 30766 volume = {15}, 30767 pages = {295--308} 30768} 30769 30770@Article{ hearn.lawphongpanich.ea:restricted, 30771 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 30772 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 30773 journal = {Mathematical Programming Study}, 30774 year = {1987}, 30775 volume = {31}, 30776 pages = {99--118} 30777} 30778 30779@Article{ hearn:gap, 30780 author = {D. W. Hearn}, 30781 title = {The Gap Function of a Convex Program}, 30782 journal = {Operations Research Letters}, 30783 year = {1982}, 30784 volume = {1}, 30785 pages = {67--71} 30786} 30787 30788@Article{ hedlund.gustavsson:design, 30789 author = {P. Hedlund and A. Gustavsson}, 30790 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 30791 Ability}, 30792 journal = {Analytica Chimica Acta}, 30793 year = {1992}, 30794 volume = {259}, 30795 pages = {243--256} 30796} 30797 30798@Article{ helgason.kennington.ea:parallelization, 30799 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 30800 title = {A Parallelization of the Simplex Method}, 30801 journal = {Annals of Operations Research}, 30802 year = {1988}, 30803 volume = {14}, 30804 pages = {17--40} 30805} 30806 30807@Article{ helgason.kennington.ea:polynomially, 30808 author = {Richard Helgason and James Kennington and H. Lall}, 30809 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 30810 journal = {Mathematical Programming}, 30811 year = {1980}, 30812 volume = {18}, 30813 pages = {338--343} 30814} 30815 30816@Book{ henderson.quandt:microeconomic, 30817 author = {J. M. Henderson and R. E. Quandt}, 30818 title = {Microeconomic Theory}, 30819 publisher = {McGraw--Hill}, 30820 address = {New York}, 30821 year = {1980}, 30822 edition = {Third} 30823} 30824 30825@TechReport{ hendrickson.leland:chaco, 30826 author = {B. Hendrickson and R. Leland}, 30827 title = {The {C}haco User's Guide: Version 2}, 30828 institution = {Sandia National Laboratories}, 30829 type = {Technical Report}, 30830 number = {SAND94-2692}, 30831 address = {Albuquerque, New Mexico}, 30832 year = {1994} 30833} 30834 30835@InProceedings{ hendrickson.leland:multilevel, 30836 author = {B. Hendrickson and R. Leland}, 30837 title = {A Multilevel Algorithm for Partitioning Graphs}, 30838 booktitle = {Proceedings of Supercomputing '95}, 30839 year = {1995} 30840} 30841 30842@Book{ hertz.krogh.ea:introduction, 30843 author = {J. Hertz and A. Krogh and R. G. Palmer}, 30844 title = {Introduction to the Theory of Neural Computation}, 30845 year = {1991}, 30846 publisher = {Addison-Wesley}, 30847 address = {Redwood City, California} 30848} 30849 30850@Article{ hertz.werra:tabu, 30851 author = {A. Hertz and D. de Werra}, 30852 title = {Using {T}abu Search techniques for Graph Coloring}, 30853 journal = {Computing}, 30854 year = {1987}, 30855 volume = {29}, 30856 pages = {345--351} 30857} 30858 30859@InCollection{ hettich:review, 30860 author = {R. Hettich}, 30861 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 30862 booktitle = {Semi-Infinite Programming and Applications}, 30863 year = {1983}, 30864 editor = {A. V. Fiacco and K. O. Kortanek}, 30865 publisher = {Springer-Verlag}, 30866 address = {Berlin} 30867} 30868 30869@Article{ highleyman:note, 30870 author = {W. H. Highleyman}, 30871 title = {A Note on Linear Separation}, 30872 journal = {IRE Transactions on Electronic Computers}, 30873 year = {1961}, 30874 volume = {10}, 30875 pages = {777--778} 30876} 30877 30878@Article{ hildreth:quadratic, 30879 author = {C. Hildreth}, 30880 title = {A Quadratic Programming Procedure}, 30881 journal = {Naval Research Logistics Quarterly}, 30882 year = {1957}, 30883 volume = {4}, 30884 pages = {79--85}, 30885 note = {Erratum, p. 361} 30886} 30887 30888@Book{ himmelblau:applied, 30889 author = {D. M. Himmelblau}, 30890 title = {Applied Nonlinear Programming}, 30891 year = {1972}, 30892 publisher = {McGraw--Hill}, 30893 address = {New York} 30894} 30895 30896@Book{ hiriart-urruty.lemarechal:convex, 30897 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 30898 title = {Convex Analysis and Minimization Algorithms {I}}, 30899 year = {1993}, 30900 publisher = {Springer Verlag}, 30901 address = {Berlin}, 30902 volume = {305}, 30903 series = {Grundlehren der mathematischen Wissenschaften} 30904} 30905 30906@TechReport{ hironaka:introduction, 30907 author = {H. Hironaka}, 30908 title = {Introduction to real-analytic sets and real-analytic maps}, 30909 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 30910 year = {1973}, 30911 type = {Technical Report}, 30912 address = {Pisa, Italy} 30913} 30914 30915@Article{ ho.lee.ea:decomposition, 30916 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 30917 title = {Decomposition of Linear Programs Using Parallel Computation}, 30918 journal = {Mathematical Programming}, 30919 year = {1988}, 30920 volume = {42}, 30921 pages = {391--405} 30922} 30923 30924@Article{ ho.loute:computational, 30925 author = {J. K. Ho and E. Loute}, 30926 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 30927 for Linear Programming}, 30928 journal = {Mathematical Programming}, 30929 year = {1983}, 30930 volume = {27}, 30931 pages = {283--290} 30932} 30933 30934@Book{ hock.schittkowski:test, 30935 author = {W. Hock and K. Schittkowski}, 30936 title = {Test Examples for Nonlinear Programming Codes}, 30937 volume = {187}, 30938 series = {Lecture Notes in Economics and Mathematical Systems}, 30939 year = {1981}, 30940 publisher = {Springer Verlag}, 30941 address = {Berlin, Germany} 30942} 30943 30944@Book{ hockney.jesshope:parallel, 30945 author = {R. W. Hockney and C. R. Jesshope}, 30946 title = {Parallel Computers 2}, 30947 publisher = {Adam Hilger}, 30948 year = {1988}, 30949 address = {Bristol} 30950} 30951 30952@Article{ hoffman:approximate, 30953 author = {A. J. Hoffman}, 30954 title = {On Approximate Solutions of Systems of Linear Inequalities}, 30955 journal = {Journal of Research of the National Bureau of Standards}, 30956 year = {1952}, 30957 volume = {49}, 30958 pages = {263--265} 30959} 30960 30961@Article{ hogan:comments, 30962 author = {W. W. Hogan}, 30963 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 30964 for the {USA}}, 30965 journal = {The Energy Journal}, 30966 year = {1990}, 30967 volume = {11}, 30968 pages = {75--84} 30969} 30970 30971@Article{ hogan:energy, 30972 author = {W. W. Hogan}, 30973 title = {Energy Policy Models for {P}roject {I}ndependence}, 30974 journal = {Computers \& Operations Research}, 30975 year = {1975}, 30976 volume = {2}, 30977 pages = {251--271} 30978} 30979 30980@Book{ holland:adaptation, 30981 author = {J. Holland}, 30982 title = {Adaptation in Natural and Artificial Systems}, 30983 year = {1975}, 30984 publisher = {The University of Michigan Press}, 30985 address = {Ann Arbor, Michigan} 30986} 30987 30988@Article{ holmes.mackie:comparison, 30989 author = {T. Holmes and T. R. Mackie}, 30990 title = {A comparison of three inverse treatment planning algorithms}, 30991 journal = {Physics in Medicine and Biology}, 30992 year = {1994}, 30993 volume = {39}, 30994 number = {1}, 30995 pages = {91--106} 30996} 30997 30998@Article{ holmes.mackie:filtered, 30999 author = {T. Holmes and T. R. Mackie}, 31000 title = {A filtered backprojection dose calculation method for inverse treatment 31001 planning}, 31002 journal = {Medical Physics}, 31003 year = {1994}, 31004 volume = {21}, 31005 number = {2}, 31006 pages = {303--313} 31007} 31008 31009@Article{ hooke.jeeves:direct, 31010 author = {R. Hooke and T. A. Jeeves}, 31011 title = {Direct Search Solution of Numerical and Statistical Problems}, 31012 journal = {Journal of Associated Computing Machinery}, 31013 year = {1961}, 31014 volume = {8}, 31015 pages = {212--229} 31016} 31017 31018@Article{ hoppe.mittelmann:multi-grid, 31019 author = {R. H. W. Hoppe and H. D. Mittelmann}, 31020 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 31021 Inequalities}, 31022 journal = {Journal of Computational and Applied Mathematics}, 31023 year = {1989}, 31024 volume = {26}, 31025 pages = {35--46} 31026} 31027 31028@Book{ horn.johnson:matrix, 31029 author = {R. A. Horn and C. R. Johnson}, 31030 title = {Matrix Anaysis}, 31031 publisher = {Cambridge University Press}, 31032 year = {1985}, 31033 address = {Cambridge, England} 31034} 31035 31036@Article{ hornik.stinchcombe.ea:multilayer, 31037 author = {K. Hornik and M. Stinchcombe and H. White}, 31038 title = {Multilayer Feedforward Networks are Universal Approximators}, 31039 journal = {Neural Networks}, 31040 year = {1989}, 31041 volume = {2}, 31042 pages = {359--366} 31043} 31044 31045@Article{ horowitz.sahni:computing, 31046 author = {E. Horowitz and S. Sahni}, 31047 title = {Computing Partitions with Applications to the Knapsack Problem}, 31048 journal = {jacm}, 31049 year = {1974}, 31050 volume = {21}, 31051 pages = {277--292} 31052} 31053 31054@Article{ hristov.fallone:continuous, 31055 author = {D. H. Hristov and B. G. Fallone}, 31056 title = {A continuous penalty function method for inverse treatment planning}, 31057 journal = {Medical Physics}, 31058 year = {1998}, 31059 volume = {25}, 31060 number = {2}, 31061 pages = {208--223} 31062} 31063 31064@Article{ hu.cheng.ea:numerical, 31065 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 31066 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 31067 analysis}, 31068 journal = {Transactions of the {ASME}}, 31069 volume = {116}, 31070 year = {1994}, 31071 pages = {470--478} 31072} 31073 31074@InProceedings{ hua.sheu:skyscraper, 31075 author = {K. A. Hua and S. Sheu}, 31076 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 31077 Video-On-Demand Systems}, 31078 year = {1997}, 31079 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 31080 address = {Cannes, France}, 31081 pages = {89--100} 31082} 31083 31084@Article{ huang.pang:option, 31085 author = {J. Huang and J. S. Pang}, 31086 title = {Option Pricing and Linear Complementarity}, 31087 journal = {Journal of Computational Finance}, 31088 volume = {2}, 31089 year = {1998}, 31090 pages = {31--60} 31091} 31092 31093@InCollection{ huard:resolution, 31094 author = {P. Huard}, 31095 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 31096 of Centers}, 31097 booktitle = {Nonlinear Programming}, 31098 year = {1967}, 31099 editor = {J. Abadie}, 31100 publisher = {North--Holland}, 31101 address = {Amsterdam}, 31102 pages = {207--219} 31103} 31104 31105@Book{ huber:robust, 31106 author = {P. J. Huber}, 31107 title = {Robust Statistics}, 31108 year = {1981}, 31109 publisher = {John Wiley}, 31110 address = {New York} 31111} 31112 31113@Book{ hudson:piecewise, 31114 author = {J. F. P. Hudson}, 31115 title = {Piecewise Linear Topology}, 31116 publisher = {Benjamin}, 31117 address = {New York}, 31118 year = {1969} 31119} 31120 31121@InCollection{ hunter.markusen.ea:north, 31122 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 31123 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 31124 booktitle = {Modeling North American Economic Integration}, 31125 publisher = {Kluwer Academic Publishers}, 31126 year = {1995}, 31127 editor = {T. Kehoe and P. Kehoe}, 31128 pages = {117--130} 31129} 31130 31131@Article{ ibarra.kim:fast, 31132 author = {O. H. Ibarra and C. E. Kim}, 31133 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 31134 journal = {jacm}, 31135 year = {1975}, 31136 volume = {22}, 31137 pages = {463--468} 31138} 31139 31140@Article{ ijiri:fundamental, 31141 author = {Y. Ijiri}, 31142 title = {Fundamental Queries in Aggregation Theory}, 31143 journal = {Journal of the American Statistical Association}, 31144 year = {1971}, 31145 volume = {66}, 31146 pages = {766--782} 31147} 31148 31149@Article{ ingargiola.korsh:reduction, 31150 author = {G. P. Ingargiola and J. F. Korsh}, 31151 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 31152 journal = {Management Science}, 31153 year = {1973}, 31154 volume = {20}, 31155 pages = {460--463} 31156} 31157 31158@Article{ ioffe:variational, 31159 author = {A. D. Ioffe}, 31160 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 31161 Second--Order Directional Derivative}, 31162 journal = {Journal of Mathematical Analysis and its Applications}, 31163 year = {1993} 31164} 31165 31166@Article{ iri.imai:multiplicative, 31167 author = {M. Iri and H. Imai}, 31168 title = {A Multiplicative Barrier Function Method for Linear Programming}, 31169 journal = {Algorithmica}, 31170 year = {1986}, 31171 volume = {1}, 31172 pages = {455--482} 31173} 31174 31175@Article{ isac.goeleven:implicit, 31176 author = {G. Isac and D. Goeleven}, 31177 title = {The Implicit General Order Complementarity Problem, Models and Iterative 31178 Methods}, 31179 journal = {Annals of Operations Research}, 31180 year = {1993} 31181} 31182 31183@Article{ isac.kostreva:generalized, 31184 author = {G. Isac and M. M. Kostreva}, 31185 title = {The Generalized Order Complementarity Problem}, 31186 journal = {Journal of Optimization Theory and Applications}, 31187 volume = {19}, 31188 pages = {227--232}, 31189 year = {1991} 31190} 31191 31192@Book{ isac:complementarity, 31193 author = {G. Isac}, 31194 title = {Complementarity Problems}, 31195 publisher = {Springer-Verlag}, 31196 year = {1992}, 31197 series = {Lecture Notes in Mathematics}, 31198 address = {New York} 31199} 31200 31201@Article{ iusem.svaiter:variant, 31202 author = {A. N. Iusem and B. F. Svaiter}, 31203 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 31204 Search Strategy}, 31205 journal = {Optimization}, 31206 year = {1997}, 31207 volume = {42}, 31208 pages = {309--321} 31209} 31210 31211@Article{ iusem:convergence, 31212 author = {A. N. Iusem}, 31213 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 31214 Problems}, 31215 journal = {Mathematical Programming}, 31216 year = {1993}, 31217 volume = {59}, 31218 pages = {33--48} 31219} 31220 31221@Article{ jackson.kutcher.ea:probability, 31222 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 31223 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 31224 Architecture subject to Non-Uniform Irradiation}, 31225 journal = {Medical Physics}, 31226 year = {1993}, 31227 volume = {20}, 31228 pages = {613--625} 31229} 31230 31231@Article{ jackson:optimization, 31232 author = {A. Jackson and X. H. Wang and R. Mohan}, 31233 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 31234 (abstract)}, 31235 journal = {Medical Physics}, 31236 year = {1994}, 31237 volume = {21}, 31238 pages = {1006} 31239} 31240 31241@TechReport{ jackson:scheduling, 31242 author = {J. R. Jackson}, 31243 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 31244 institution = {University of California}, 31245 year = {1955}, 31246 address = {Los Angeles}, 31247 number = {43}, 31248 type = {Research Report} 31249} 31250 31251@Article{ jansen.roos.ea:polynomiality, 31252 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 31253 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 31254 Complementarity Problems}, 31255 journal = {Mathematical Programming}, 31256 volume = {78}, 31257 pages = {315--346}, 31258 year = {1997} 31259} 31260 31261@Article{ jiang.fukushima.ea:trust, 31262 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 31263 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 31264 journal = {SIAM Journal on Optimization}, 31265 volume = {8}, 31266 pages = {140--157}, 31267 year = {1998} 31268} 31269 31270@Article{ jiang.qi:nonsmooth, 31271 author = {H. Jiang and L. Qi}, 31272 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 31273 journal = {SIAM Journal on Control and Optimization}, 31274 volume = {35}, 31275 pages = {178--193}, 31276 year = {1997} 31277} 31278 31279@TechReport{ jiang.ralph:qpecgen, 31280 author = {H. Jiang and D. Ralph}, 31281 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 31282 Objectives and Affine Variational Inequality Constraints}, 31283 year = {1997}, 31284 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31285 address = {Australia} 31286} 31287 31288@TechReport{ jiang.ralph:smooth, 31289 author = {H. Jiang and D. Ralph}, 31290 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 31291 Constraints}, 31292 year = {1997}, 31293 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31294 address = {Australia} 31295} 31296 31297@Article{ jiang:unconstrained, 31298 author = {H. Jiang}, 31299 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 31300 journal = {Journal of Global Optimization, forthcoming}, 31301 year = {1997} 31302} 31303 31304@Article{ jittorntrum.osborne:strong, 31305 author = {K. Jittorntrum and M. R. Osborne}, 31306 title = {Strong uniqueness and second order convergence in nonlinear discrete 31307 approximation}, 31308 journal = {Numerische Mathematik}, 31309 year = {1980}, 31310 volume = {34}, 31311 pages = {439--455} 31312} 31313 31314@InProceedings{ jog.suh.ea:effects, 31315 crossref = {schaeffer:third}, 31316 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31317 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 31318 Genetic Algorithm for the Travelling Salesman Problem}, 31319 pages = {110--115} 31320} 31321 31322@Article{ jog.suh.ea:parallel, 31323 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31324 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 31325 journal = {SIAM Journal on Optimization}, 31326 year = {1991}, 31327 volume = {1} 31328} 31329 31330@Article{ johansson.klarbring:rigid, 31331 author = {L. Johansson and A. Klarbring}, 31332 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 31333 Complementarity}, 31334 journal = {Mechanics of Structures \& Machines}, 31335 volume = {20}, 31336 pages = {293--319}, 31337 year = {1992} 31338} 31339 31340@Article{ johnson.aragon.ea:optimization, 31341 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 31342 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 31343 Partitioning}, 31344 journal = {Operations Research}, 31345 year = {1989}, 31346 volume = {37}, 31347 pages = {865--892} 31348} 31349 31350@Article{ johnson:optimally, 31351 author = {R. Johnson}, 31352 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 31353 journal = {Management Science}, 31354 year = {1988}, 31355 volume = {34}, 31356 pages = {240--253} 31357} 31358 31359@Article{ johnsson:solving, 31360 author = {S. L. Johnsson}, 31361 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 31362 journal = {SIAM Journal on Scientific and Statistical Computing}, 31363 year = {1987}, 31364 volume = {8}, 31365 pages = {475--489} 31366} 31367 31368@Article{ jorgenson.wilcoxen:reducing, 31369 author = {D. W. Jorgenson and P. J. Wilcoxen}, 31370 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 31371 journal = {Resource and Energy Economics}, 31372 year = {1993}, 31373 volume = {15}, 31374 pages = {7--25} 31375} 31376 31377@TechReport{ josephy:hogans, 31378 author = {N. H. Josephy}, 31379 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 31380 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31381 year = {1979}, 31382 address = {Madison, Wisconsin}, 31383 number = {1972}, 31384 type = {Technical Summary Report} 31385} 31386 31387@TechReport{ josephy:newton, 31388 author = {N. H. Josephy}, 31389 title = {A {N}ewton Method for the {PIES} Energy Model}, 31390 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31391 year = {1979}, 31392 address = {Madison, Wisconsin}, 31393 number = {1971}, 31394 type = {Technical Summary Report} 31395} 31396 31397@PhDThesis{ josephy:newtons, 31398 author = {N. H. Josephy}, 31399 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 31400 year = {1979}, 31401 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 31402} 31403 31404@TechReport{ josephy:newtons*1, 31405 author = {N. H. Josephy}, 31406 title = {{N}ewton's Method for Generalized Equations}, 31407 institution = {Mathematics Research Center, University of Wisconsin}, 31408 year = {1979}, 31409 address = {Madison, Wisconsin}, 31410 number = {1965}, 31411 type = {Technical Summary Report} 31412} 31413 31414@TechReport{ josephy:quasi-newton, 31415 author = {N. H. Josephy}, 31416 title = {Quasi--{N}ewton Methods for Generalized Equations}, 31417 institution = {Mathematics Research Center, University of Wisconsin}, 31418 year = {1979}, 31419 address = {Madison, Wisconsin}, 31420 number = {1966}, 31421 type = {Technical Summary Report} 31422} 31423 31424@PhDThesis{ kabbadj:methodes, 31425 author = {S. Kabbadj}, 31426 title = {Methodes Proximales Entropiques}, 31427 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 31428 year = {1994}, 31429 type = {Doctoral Thesis} 31430} 31431 31432@Book{ kall.wallace:stochastic, 31433 author = {P. Kall and S. W. Wallace}, 31434 title = {Stochastic Programming}, 31435 publisher = {John Wiley \& Sons}, 31436 year = {1994}, 31437 address = {Chichester} 31438} 31439 31440@Article{ kallman.agren.ea:tumor, 31441 author = {P. Kallman and A. Agren and A. Brahme}, 31442 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 31443 journal = {International Journal of Radiation Biology}, 31444 year = {1992}, 31445 volume = {62}, 31446 pages = {249--262} 31447} 31448 31449@Misc{ kalvelagen:gams, 31450 author = {Erwin Kalvelagen}, 31451 title = {The {GAMS} {I/O} Library}, 31452 howpublished = {mimeo, GAMS Development Corporation}, 31453 year = {1992}, 31454 note = {Preliminary Version} 31455} 31456 31457@Article{ kaneko:complete, 31458 author = {I. Kaneko}, 31459 title = {Complete solution of a class of elastic-plastic structures}, 31460 journal = {Computer Methods in Applied Mechanics and Engineering}, 31461 volume = {21}, 31462 year = {1980}, 31463 pages = {193--209} 31464} 31465 31466@Article{ kaneko:mathematical, 31467 author = {I. Kaneko}, 31468 title = {A mathematical programming method for the inelastic analysis of reinforced 31469 concrete frames}, 31470 journal = {International Journal for Numerical Methods in Engineering}, 31471 volume = {11}, 31472 year = {1977}, 31473 pages = {1137--1154} 31474} 31475 31476@Article{ kaneko:piecewise, 31477 author = {I. Kaneko}, 31478 title = {Piecewise linear elastic-plastic analysis}, 31479 journal = {International Journal for Numerical Methods in Engineering}, 31480 volume = {14}, 31481 year = {1979}, 31482 pages = {757--767} 31483} 31484 31485@Article{ kanet:minimizing, 31486 author = {J. J. Kanet}, 31487 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 31488 Date}, 31489 journal = {Naval Research Logistics Quarterly}, 31490 year = {1981}, 31491 volume = {28}, 31492 pages = {643--651} 31493} 31494 31495@Article{ kantorovich:mathematical, 31496 author = {L. V. Kantorovich}, 31497 title = {Mathematical Methods in the Organization and Planning of Production}, 31498 journal = {Management Science}, 31499 year = {1960}, 31500 volume = {6}, 31501 pages = {366--422}, 31502 note = {English translation, Russian version 1939} 31503} 31504 31505@Article{ kanzow.fukushima:equivalence, 31506 author = {C. Kanzow and M. Fukushima}, 31507 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 31508 Unconstrained Minimization}, 31509 journal = {Journal of Optimization Theory and Applications}, 31510 year = {1996}, 31511 volume = {90}, 31512 pages = {581--603} 31513} 31514 31515@Article{ kanzow.fukushima:theoretical, 31516 author = {C. Kanzow and M. Fukushima}, 31517 title = {Theoretical and Numerical Investigation of the {D}-gap function for 31518 Box-Constrained Variational Inequalities}, 31519 journal = {Mathematical Programming}, 31520 year = {1998}, 31521 volume = {83}, 31522 pages = {55--88} 31523} 31524 31525@Article{ kanzow.jiang:continuation, 31526 author = {C. Kanzow and H. Jiang}, 31527 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 31528 journal = {Mathematical Programming}, 31529 year = {1998}, 31530 volume = {81}, 31531 pages = {103--125} 31532} 31533 31534@Article{ kanzow.kleinmichel:class, 31535 author = {C. Kanzow and H. Kleinmichel}, 31536 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 31537 Optimization}, 31538 journal = {Optimization Methods and Software}, 31539 year = {1995}, 31540 volume = {5}, 31541 pages = {173--198} 31542} 31543 31544@Article{ kanzow.kleinmichel:new, 31545 author = {C. Kanzow and H. Kleinmichel}, 31546 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 31547 Problems}, 31548 journal = {Computational Optimization and Applications}, 31549 volume = {11}, 31550 pages = {227--251}, 31551 year = {1998} 31552} 31553 31554@Article{ kanzow.pieper:jacobian, 31555 author = {C. Kanzow and H. Pieper}, 31556 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 31557 journal = {SIAM Journal on Optimization}, 31558 year = {1999}, 31559 volume = {9}, 31560 pages = {342--373} 31561} 31562 31563@Article{ kanzow.qi:qp-free, 31564 author = {C. Kanzow and H. -D. Qi}, 31565 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 31566 problems}, 31567 journal = {Mathematical Programming}, 31568 year = {1999}, 31569 volume = {85}, 31570 pages = {81--106} 31571} 31572 31573@Article{ kanzow.yamashita.ea:ncp-functions, 31574 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 31575 title = {New {NCP}-functions and their properties}, 31576 journal = {Journal of Optimization Theory and Applications}, 31577 year = {1997}, 31578 volume = {94}, 31579 pages = {115--135} 31580} 31581 31582@TechReport{ kanzow.zupke:inexact, 31583 author = {C. Kanzow and M. Zupke}, 31584 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 31585 year = {1997}, 31586 institution = {Institute of Applied Mathematics, University of Hamburg}, 31587 type = {Preprint}, 31588 number = {127}, 31589 address = {Hamburg, Germany} 31590} 31591 31592@Article{ kanzow:approach, 31593 author = {C. Kanzow}, 31594 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 31595 {P}-Functions}, 31596 journal = {Operations Research Letters}, 31597 volume = {20}, 31598 year = {1997}, 31599 pages = {85--92} 31600} 31601 31602@Article{ kanzow:equation-based, 31603 author = {C. Kanzow}, 31604 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 31605 journal = {Optimization Methods and Software}, 31606 year = {1994}, 31607 volume = {3}, 31608 pages = {327--340} 31609} 31610 31611@Article{ kanzow:global, 31612 author = {C. Kanzow}, 31613 title = {Global Convergence Properties of Some Iterative Methods for Linear 31614 Complementarity Problems}, 31615 journal = {SIAM Journal on Optimization}, 31616 year = {1996}, 31617 volume = {6}, 31618 pages = {326--341} 31619} 31620 31621@Article{ kanzow:inexact, 31622 author = {C. Kanzow}, 31623 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 31624 journal = {Numerische Mathematik, forthcoming}, 31625 year = {1999} 31626} 31627 31628@Article{ kanzow:noninterior, 31629 author = {C. Kanzow}, 31630 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 31631 journal = {SIAM Journal on Matrix Analysis and Applications}, 31632 volume = {17}, 31633 pages = {851--868}, 31634 year = {1996} 31635} 31636 31637@Article{ kanzow:nonlinear, 31638 author = {C. Kanzow}, 31639 title = {Nonlinear Complementarity as Unconstrained Optimization}, 31640 journal = {Journal of Optimization Theory and Applications}, 31641 year = {1996}, 31642 volume = {88}, 31643 pages = {139--155} 31644} 31645 31646@TechReport{ kanzow:semismooth, 31647 author = {C. Kanzow}, 31648 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 31649 Problems}, 31650 institution = {Institute of Applied Mathematics, University of Hamburg}, 31651 year = {1997}, 31652 type = {Preprint}, 31653 address = {Hamburg, Germany} 31654} 31655 31656@TechReport{ kanzow:tools, 31657 annote = {This should be replaced by kanzow:noninterior}, 31658 author = {C. Kanzow}, 31659 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 31660 institution = {Institute of Applied Mathematics, University of Hamburg}, 31661 year = {1994}, 31662 address = {Germany} 31663} 31664 31665@Article{ kaplan.meier:nonparametric, 31666 author = {E. L. Kaplan and P. Meier}, 31667 title = {Nonparametric Estimation from Incomplete Observations}, 31668 journal = {J. Am. Stat. Assoc.}, 31669 year = {1958}, 31670 volume = {53}, 31671 pages = {457--481} 31672} 31673 31674@Article{ karamardian:complementarity, 31675 author = {S. Karamardian}, 31676 title = {The Complementarity Problem}, 31677 journal = {Mathematical Programming}, 31678 year = {1972}, 31679 volume = {2}, 31680 pages = {107--129} 31681} 31682 31683@Article{ karamardian:complementarity*1, 31684 author = {S. Karamardian}, 31685 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 31686 journal = {Journal of Optimization Theory and Applications}, 31687 year = {1976}, 31688 volume = {18}, 31689 pages = {445--454} 31690} 31691 31692@Article{ karamardian:generalized, 31693 author = {S. Karamardian}, 31694 title = {Generalized Complementarity Problem}, 31695 journal = {Journal of Optimization Theory and Applications}, 31696 year = {1971}, 31697 volume = {8}, 31698 pages = {161--167} 31699} 31700 31701@Article{ karmarkar.karp.ea:probabilistic, 31702 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 31703 title = {Probabilistic Analysis of Optimum Partitioning}, 31704 journal = {Journal of Applied Probability}, 31705 year = {1986}, 31706 volume = {23}, 31707 pages = {626--645} 31708} 31709 31710@Article{ karmarkar:polynomial, 31711 author = {N. Karmarkar}, 31712 title = {A New Polynomial Time Algorithm for Linear Programming}, 31713 journal = {Combinatorica}, 31714 year = {1984}, 31715 volume = {4}, 31716 pages = {373--395} 31717} 31718 31719@Unpublished{ karp:probabilistic, 31720 author = {R. M. Karp}, 31721 title = {Probabilistic Analysis of Algorithms}, 31722 note = {(Lecture Notes)} 31723} 31724 31725@InCollection{ karp:reducibility, 31726 author = {R. M. Karp}, 31727 title = {Reducibility among Combinatorial Problems}, 31728 booktitle = {Complexity of Computer Computations}, 31729 year = {1972}, 31730 editor = {R. E. Miller and J. W. Thatcher}, 31731 publisher = {Plenum Press}, 31732 address = {New York}, 31733 pages = {85--103} 31734} 31735 31736@MastersThesis{ karush:minima, 31737 author = {W. Karush}, 31738 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 31739 year = {1939}, 31740 school = {Department of Mathematics, University of Chicago} 31741} 31742 31743@TechReport{ karypis.kumar:metis, 31744 author = {G. Karypis and V. Kumar}, 31745 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 31746 Version 2.0}, 31747 institution = {University of Minnesota, Department of Computer Science}, 31748 type = {Technical Report}, 31749 address = {Minnesota}, 31750 year = {1995} 31751} 31752 31753@TechReport{ karypis.kumar:multilevel, 31754 author = {G. Karypis and V. Kumar}, 31755 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 31756 institution = {University of Minnesota, Department of Computer Science}, 31757 type = {Technical Report}, 31758 number = {95-064}, 31759 address = {Minnesota}, 31760 year = {1995} 31761} 31762 31763@Article{ katukani:generalization, 31764 author = {S. Katukani}, 31765 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 31766 journal = {Duke Mathematical Journal}, 31767 year = {1941}, 31768 volume = {8}, 31769 pages = {457--459} 31770} 31771 31772@Article{ keifer.wolfowitz:stochastic, 31773 author = {J. Keifer and J. Wolfowitz}, 31774 title = {Stochastic Estimation of the Maximum of a Regression Function}, 31775 journal = {Annals of Mathematical Statistics}, 31776 year = {1952}, 31777 volume = {23}, 31778 pages = {462--466} 31779} 31780 31781@InCollection{ kellog.li.ea:method, 31782 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 31783 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 31784 booktitle = {Computing Fixed Points with Applications}, 31785 year = {1977}, 31786 editor = {S. Karamardian}, 31787 publisher = {Academic Press}, 31788 pages = {133--147} 31789} 31790 31791@Book{ kennington.helgason:algorithms, 31792 author = {J. L. Kennington and R. V. Helgason}, 31793 title = {Algorithms for Network Programming}, 31794 year = {1980}, 31795 publisher = {John Wiley \& Sons}, 31796 address = {New York} 31797} 31798 31799@Article{ kernighan.lin:efficient, 31800 author = {B. W. Kernighan and S. Lin}, 31801 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 31802 journal = {The Bell System Technical Journal}, 31803 pages = {291--307}, 31804 volume = {29}, 31805 year = {1970} 31806} 31807 31808@Article{ khachian:polynomial, 31809 author = {L. G. Khachian}, 31810 title = {A Polynomial Algorithm for Linear Programming}, 31811 journal = {Soviet Mathematics Doklady}, 31812 year = {1979}, 31813 volume = {20}, 31814 pages = {191--194} 31815} 31816 31817@Article{ khobotov:modification, 31818 author = {E. N. Khobotov}, 31819 title = {A Modification of the Extragradient Method for the Solution of Variational 31820 Inequalities and some Optimization Problems}, 31821 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 31822 year = {1987}, 31823 volume = {27}, 31824 pages = {1462--1473} 31825} 31826 31827@Book{ khuri.cornell:response, 31828 author = {A. I. Khuri and J. A. Cornell}, 31829 title = {Response Surfaces: Designs and Analyses}, 31830 publisher = {Marcel Dekker}, 31831 year = {1987}, 31832 address = {New York} 31833} 31834 31835@Article{ kibardin:decomposition, 31836 author = {V. M. Kibardin}, 31837 title = {Decomposition into Functions in the Minimization Problems}, 31838 journal = {Automation and Remote Control}, 31839 year = {1980}, 31840 volume = {40}, 31841 pages = {1311--1323} 31842} 31843 31844@TechReport{ king:sposl, 31845 author = {A. J. King}, 31846 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 31847 institution = {IBM T.J. Watson Research Center}, 31848 year = {1994}, 31849 number = {RC 19757}, 31850 address = {Yorktown Heights, New York} 31851} 31852 31853@Article{ kirkpatrick.gelatt.ea:optimization, 31854 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 31855 title = {Optimization by Simulated Annealing}, 31856 journal = {Science}, 31857 year = {1983}, 31858 volume = {220}, 31859 pages = {671--680} 31860} 31861 31862@Book{ kiwiel:methods, 31863 author = {K. C. Kiwiel}, 31864 title = {Methods of Descent for Nondifferentiable Optimization}, 31865 year = {1985}, 31866 publisher = {Springer-Verlag}, 31867 address = {Berlin}, 31868 series = {Lecture Notes in Mathematics}, 31869 number = {1133} 31870} 31871 31872@Article{ kiwiel:twice, 31873 author = {K. C. Kiwiel}, 31874 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 31875 journal = {Journal of Optimization Theory and Applications}, 31876 year = {1996}, 31877 volume = {88}, 31878 pages = {233--236} 31879} 31880 31881@Article{ klarbring.bjorkman:mathematical, 31882 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31883 title = {A mathematical programming approach to contact problems with friction and varying 31884 contact surface}, 31885 journal = {Computers \& Structures}, 31886 volume = {30}, 31887 year = {1988}, 31888 pages = {1185--1198} 31889} 31890 31891@Article{ klarbring.bjorkman:solution, 31892 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31893 title = {Solution of large displacement contact problems with friction using {N}ewton's 31894 method for generalized equations}, 31895 journal = {International Journal for Numerical Methods in Engineering}, 31896 volume = {34}, 31897 year = {1992}, 31898 pages = {249--269} 31899} 31900 31901@Article{ klarbring.pang:existence, 31902 author = {A. Klarbring and J. S. Pang}, 31903 title = {Existence of solution to discrete semicoercive frictional contact problems}, 31904 journal = {{SIAM} Journal on Optimization, under review}, 31905 year = {1996} 31906} 31907 31908@Article{ klarbring:discrete, 31909 author = {A. Klarbring}, 31910 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 31911 (Stability, Uniqueness and Variational Principles)}, 31912 journal = {International Journal on Solids and Structures}, 31913 volume = {24}, 31914 pages = {459--479}, 31915 year = {1988} 31916} 31917 31918@TechReport{ klarbring:large, 31919 author = {A. Klarbring}, 31920 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 31921 Discretization}, 31922 number = {LiTH-IKP-R-798}, 31923 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 31924 address = {Link{\"o}ping}, 31925 year = {1994} 31926} 31927 31928@Article{ klarbring:mathematical, 31929 author = {A. Klarbring}, 31930 title = {A mathematical programming approach to three dimensional contact problems with 31931 friction}, 31932 journal = {Computer Methods in Applied Mechanics and Engineering}, 31933 volume = {58}, 31934 year = {1986}, 31935 pages = {175--200} 31936} 31937 31938@InCollection{ klarbring:mathematical*1, 31939 author = {A. Klarbring}, 31940 title = {Mathematical programming and augmented {L}agrangian methods for frictional 31941 contact problems}, 31942 editor = {A. Curnier}, 31943 booktitle = {Proceedings Contact Mechanics International Symposium}, 31944 publisher = {Presse Polytechniques et Universitaires Romandes}, 31945 address = {Lausanne}, 31946 year = {1992}, 31947 pages = {409--422} 31948} 31949 31950@InCollection{ klarbring:mathematical*2, 31951 author = {A. Klarbring}, 31952 title = {Mathematical programming in contact problems}, 31953 editors = {M. H. Aliabadi and C. A. Brebbia}, 31954 booktitle = {Computational Methods for Contact Problems}, 31955 publisher = {Computational Mechanics Publications}, 31956 address = {Southampton}, 31957 year = {1993}, 31958 pages = {233--264} 31959} 31960 31961@Article{ klarbring:quadratic, 31962 author = {A. Klarbring}, 31963 title = {A quadratic program in frictionless contact problems}, 31964 journal = {International Journal of Engineering Science}, 31965 volume = {24}, 31966 pages = {1207--1217}, 31967 year = {1986} 31968} 31969 31970@InCollection{ klee.minty:how, 31971 author = {V. Klee and G. J. Minty}, 31972 title = {How Good is the Simplex Algorithm?}, 31973 booktitle = {Inequalities--III}, 31974 year = {1972}, 31975 publisher = {Academic Press}, 31976 pages = {159--175} 31977} 31978 31979@Article{ kleywegt.shapiro:sample, 31980 author = {A. Kleywegt and A. Shapiro}, 31981 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 31982 journal = {Stochastic Programming E-Print Series}, 31983 year = {1999}, 31984 note = {Available from dochost.rz.hu-berlin.de/speps} 31985} 31986 31987@Book{ knuth:art, 31988 author = {D. E. Knuth}, 31989 title = {The Art of Computer Programming}, 31990 publisher = {Addison-Wesley Longman Inc.}, 31991 address = {Reading, Massachusetts}, 31992 year = {1998}, 31993 edition = {Third}, 31994 volume = {2} 31995} 31996 31997@InProceedings{ kocvara.outrata:nonsmooth, 31998 author = {M. Ko\v{c}vara and J. V. Outrata}, 31999 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 32000 crossref = {ferris.pang:complementarity}, 32001 pages = {148--164} 32002} 32003 32004@Article{ kocvara.outrata:optimization, 32005 author = {M. Ko\v{c}vara and J. V. Outrata}, 32006 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 32007 volume = {15}, 32008 journal = {Numerical Fucntional Analysis and Optimization}, 32009 year = {1994}, 32010 pages = {869--887} 32011} 32012 32013@InCollection{ kocvara.outrata:solution, 32014 author = {M. Ko\v{c}vara and J. V. Outrata}, 32015 title = {On the solution of optimum design problems with variational inequalities}, 32016 editors = {D. Z. Du and L. Qi and R. Womersley}, 32017 booktitle = {Recent Advances in Nonsmooth Optimization}, 32018 publisher = {World Scientific Publishers}, 32019 address = {Singapore}, 32020 year = {1995}, 32021 pages = {172--192} 32022} 32023 32024@Article{ kojima.hirabayashi:homotopy, 32025 author = {M. Kojima and R. Hirabayashi}, 32026 title = {Continuous deformation of nonlinear programs}, 32027 journal = {Mathematical Programming Study}, 32028 editor = {A.~V. Fiacco}, 32029 publisher = {North--Holland}, 32030 address = {Amsterdam}, 32031 year = {1984}, 32032 volume = {21}, 32033 pages = {150--198} 32034} 32035 32036@Article{ kojima.megiddo.ea:homotopy, 32037 author = {M. Kojima and N. Megiddo and T. Noma}, 32038 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 32039 journal = {Mathematics of Operations Research}, 32040 year = {1991}, 32041 volume = {16}, 32042 pages = {754--774} 32043} 32044 32045@TechReport{ kojima.megiddo.ea:primal-dual, 32046 author = {M. Kojima and N. Megiddo and S. Mizuno}, 32047 title = {A primal-dual exterior point algorithm for linear programming}, 32048 institution = {IBM Alamaden Research Center}, 32049 year = {1991}, 32050 number = {RJ 8500}, 32051 address = {San Jose, California} 32052} 32053 32054@Book{ kojima.megiddo.ea:unified, 32055 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 32056 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 32057 Problems}, 32058 year = {1991}, 32059 publisher = {Springer-Verlag}, 32060 address = {Berlin}, 32061 volume = {538}, 32062 series = {Lecture Notes in Computer Science} 32063} 32064 32065@Article{ kojima.mizuno.ea:continuation, 32066 author = {M. Kojima and S. Mizuno and T. Noma}, 32067 title = {A New Continuation Method for Complementarity Problems with Uniform 32068 {P}-function}, 32069 journal = {Mathematical Programming}, 32070 year = {1989}, 32071 volume = {43}, 32072 pages = {107--113} 32073} 32074 32075@TechReport{ kojima.mizuno.ea:infeasible, 32076 author = {M. Kojima and S. Mizuno and M. Todd}, 32077 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 32078 programming}, 32079 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 32080 year = {1992}, 32081 number = {1023}, 32082 address = {Ithaca, New York}, 32083 month = aug 32084} 32085 32086@Article{ kojima.mizuno.ea:onl, 32087 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32088 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 32089 complementarity problems}, 32090 journal = {Mathematical Programming}, 32091 year = {1991}, 32092 volume = {50}, 32093 pages = {331--342} 32094} 32095 32096@Article{ kojima.mizuno.ea:polynomial-time, 32097 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32098 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 32099 journal = {Mathematical Programming}, 32100 year = {1989}, 32101 volume = {44}, 32102 pages = {1--20} 32103} 32104 32105@Article{ kojima.noma.ea:global, 32106 author = {M. Kojima and T. Noma and A. Yoshise}, 32107 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 32108 journal = {Mathematical Programming}, 32109 volume = {65}, 32110 pages = {43--72}, 32111 year = {1994} 32112} 32113 32114@Article{ kojima.shindo.ea:interior-point, 32115 author = {M. Kojima and S. Shindo and S. Hara}, 32116 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 32117 Problem in Symmetric Matrices}, 32118 journal = {SIAM Journal on Optimization}, 32119 volume = {7}, 32120 pages = {86--125} 32121} 32122 32123@Article{ kojima.shindo:extensions, 32124 author = {M. Kojima and S. Shindo}, 32125 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 32126 Equations}, 32127 journal = {Journal of Operations Research Society of Japan}, 32128 year = {1986}, 32129 volume = {29}, 32130 pages = {352--374} 32131} 32132 32133@Article{ kojima:computational, 32134 author = {M. Kojima}, 32135 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 32136 journal = {Keio Engineering Reports}, 32137 year = {1974}, 32138 volume = {27}, 32139 pages = {1--41} 32140} 32141 32142@Article{ kojima:recent, 32143 author = {M. Kojima}, 32144 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 32145 continuation methods}, 32146 journal = {Systems and Control}, 32147 year = {1981}, 32148 volume = {25}, 32149 pages = {421--430} 32150} 32151 32152@Article{ kolesar:branch, 32153 author = {P. J. Kolesar}, 32154 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 32155 journal = {Management Science}, 32156 year = {1967}, 32157 volume = {13}, 32158 pages = {723--735} 32159} 32160 32161@Book{ kolman.beck:elementary, 32162 author = {B. Kolman and R. E. Beck}, 32163 title = {Elementary Linear Programming with Applications}, 32164 year = {1980}, 32165 publisher = {Academic Press} 32166} 32167 32168@Book{ koopmans:activity, 32169 editor = {T. C. Koopmans}, 32170 title = {Activity Analysis of Production and Allocation}, 32171 publisher = {John Wiley}, 32172 address = {New York}, 32173 year = {1951} 32174} 32175 32176@Article{ korpelevich:extragradient, 32177 author = {G. M. Korpelevich}, 32178 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 32179 journal = {Matecon}, 32180 year = {1976}, 32181 volume = {12}, 32182 pages = {747--756} 32183} 32184 32185@Article{ kortanek.shi:convergence, 32186 author = {K. O. Kortanek and M. Shi}, 32187 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 32188 Algorithm}, 32189 journal = {European Journal of Operational Research}, 32190 year = {1987}, 32191 volume = {32}, 32192 pages = {47--61} 32193} 32194 32195@TechReport{ kortanek.shi:remarks, 32196 author = {K. O. Kortanek and M. Shi}, 32197 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 32198 Hybrid Algorithm 1985-6'}, 32199 institution = {College of Business Administration, University of Iowa}, 32200 year = {1987}, 32201 address = {Iowa City}, 32202 number = {87--1}, 32203 type = {Working Paper} 32204} 32205 32206@TechReport{ kortanek:vector-supercomputer, 32207 author = {K. O. Kortanek}, 32208 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 32209 institution = {College of Business Administration, University of Iowa}, 32210 year = {1987}, 32211 address = {Iowa City}, 32212 number = {87--2}, 32213 type = {Working Paper} 32214} 32215 32216@Article{ kostreva:block, 32217 author = {M. M. Kostreva}, 32218 title = {Block Pivot Methods for Solving the Complementarity Problem}, 32219 journal = {Linear Algebra and Its Applications}, 32220 volume = {21}, 32221 pages = {207--215}, 32222 year = {1978} 32223} 32224 32225@Article{ kostreva:elasto-hydrodynamic, 32226 author = {M. M. Kostreva}, 32227 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 32228 journal = {International Journal for Numerical Methods in Fluids}, 32229 year = {1984}, 32230 volume = {4}, 32231 pages = {377--397} 32232} 32233 32234@Article{ kostreva:recent, 32235 author = {M. M. Kostreva}, 32236 title = {Recent Results on Complementarity Models for Engineering and Economics}, 32237 journal = {Infor, Journal of the Canadian {OR} Society}, 32238 year = {1990}, 32239 volume = {28}, 32240 pages = {324--334} 32241} 32242 32243@Article{ kotiah.steinberg:occurrences, 32244 author = {T. C. T. Kotiah and D. I. Steinberg}, 32245 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 32246 Programming Models}, 32247 journal = {Communications of the ACM}, 32248 volume = {20}, 32249 year = {1977}, 32250 pages = {107--112} 32251} 32252 32253@Article{ kotiah.steinberg:possibility, 32254 author = {T. C. T. Kotiah and D. I. Steinberg}, 32255 title = {On the Possibility of Cycling with the Simplex Method}, 32256 journal = {Operations Research}, 32257 volume = {26}, 32258 year = {1978}, 32259 pages = {374--376} 32260} 32261 32262@InCollection{ kuhn.tucker:nonlinear, 32263 author = {H. W. Kuhn and A. W. Tucker}, 32264 title = {Nonlinear Programming}, 32265 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 32266 Probability}, 32267 year = {1951}, 32268 editor = {J. Neyman}, 32269 publisher = {University of California Press}, 32270 address = {Berkeley and Los Angeles}, 32271 pages = {481--492} 32272} 32273 32274@Article{ kummer:metric, 32275 author = {B. Kummer}, 32276 title = {Metric regularity: characterizations, nonsmooth variations, and successive 32277 approximation}, 32278 journal = {Journal of Mathematical Analysis and its Applications}, 32279 year = {}, 32280 optkey = {}, 32281 optvolume = {}, 32282 optnumber = {}, 32283 optpages = {}, 32284 optmonth = {}, 32285 optnote = {}, 32286 optannote = {} 32287} 32288 32289@InCollection{ kummer:newtons, 32290 author = {B. Kummer}, 32291 title = {{N}ewton's Method for Non--Differentiable Functions}, 32292 booktitle = {Advances in Mathematical Optimization}, 32293 publisher = {Akademie--Verlag}, 32294 year = {1988}, 32295 editors = {J. Guddat et al.}, 32296 pages = {114--125}, 32297 address = {Berlin} 32298} 32299 32300@Unpublished{ kuntsevich.kappel:solvopt, 32301 author = {A. Kuntsevich and F. Kappel}, 32302 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 32303 year = {1997}, 32304 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 32305 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 32306} 32307 32308@Book{ kushner.clark:stochastic, 32309 author = {H. J. Kushner and D. S. Clark}, 32310 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 32311 publisher = {Springer-Verlag}, 32312 year = {1978}, 32313 address = {New York} 32314} 32315 32316@Article{ kutcher.burman.ea:histogram, 32317 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 32318 title = {Histogram reduction method for calculating complication probabilities for 32319 three-dimensional treatment planning evaluation}, 32320 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32321 year = {1991}, 32322 optvolume = {21}, 32323 optpages = {137-146} 32324} 32325 32326@Article{ kutcher.burman:calculation, 32327 author = {G. J. Kutcher and C. Burman}, 32328 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 32329 Irradiation: The Effective Volume Method}, 32330 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32331 year = {1989}, 32332 volume = {16}, 32333 pages = {1623--1630} 32334} 32335 32336@Article{ kwak.lee:complementarity, 32337 author = {B. M. Kwak and B. C. Lee.}, 32338 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 32339 Problem}, 32340 journal = {Computers and Structures}, 32341 volume = {18}, 32342 pages = {469--480}, 32343 year = {1988} 32344} 32345 32346@Article{ kwak:complementarity, 32347 author = {B. M. Kwak}, 32348 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 32349 journal = {Journal of Applied Mechanics}, 32350 volume = {58}, 32351 pages = {134--140}, 32352 year = {1991} 32353} 32354 32355@Article{ lagarias.reeds.ea:convergence, 32356 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 32357 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 32358 journal = {SIAM Journal on Optimization}, 32359 year = {1998}, 32360 volume = {9}, 32361 pages = {112--147} 32362} 32363 32364@Article{ lahaye:methode, 32365 author = {E. Lahaye}, 32366 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 32367 transcendantes}, 32368 journal = {C. R. Acad. Sci. Paris}, 32369 year = {1934}, 32370 volume = {198}, 32371 pages = {1840--1842} 32372} 32373 32374@Article{ lahaye:solution, 32375 author = {E. Lahaye}, 32376 title = {Solution of Systems of Transcendental Equations}, 32377 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 32378 year = {1948}, 32379 volume = {5}, 32380 pages = {805--822} 32381} 32382 32383@Article{ lahenbruch.mickey:estimation, 32384 author = {P. A. Lahenbruch and R. M. Mickey}, 32385 title = {Estimation of Error Rates in Discriminant Analysis}, 32386 journal = {Technometrics}, 32387 year = {1968}, 32388 volume = {10}, 32389 pages = {1--11} 32390} 32391 32392@Article{ lakshminarayan.lakshmanan.ea:optimal, 32393 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 32394 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 32395 journal = {Operations Research}, 32396 year = {1978}, 32397 volume = {26}, 32398 pages = {1079--1082} 32399} 32400 32401@Article{ land.doig:automatic, 32402 author = {A. H. Land and A. G. Doig}, 32403 title = {An Automatic Method for Solving Discrete Programming Problems}, 32404 journal = {Econometrica}, 32405 volume = {28}, 32406 year = {1960}, 32407 pages = {497-520} 32408} 32409 32410@Article{ langer.morrill:comparison, 32411 author = {M. Langer and S. Morrill}, 32412 title = {A comparison of mixed integer programming and fast simulated annealing for 32413 optimized beam weights in radiation therapy}, 32414 journal = {Medical Physics}, 32415 year = {1996}, 32416 volume = {23}, 32417 number = {6}, 32418 pages = {957--964} 32419} 32420 32421@Article{ larsson.patriksson:class, 32422 author = {T. Larsson and M. Patriksson}, 32423 title = {A Class of Gap Functions for Variational Inequalities}, 32424 journal = {Mathematical Programming}, 32425 year = {1994}, 32426 volume = {64}, 32427 pages = {53--79} 32428} 32429 32430@Article{ lasdon.waren.ea:solving, 32431 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 32432 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 32433 Linear Programming Algorithms}, 32434 journal = {ACM SIGMAP Bulletin}, 32435 year = {1979}, 32436 volume = {27}, 32437 pages = {9--15} 32438} 32439 32440@TechReport{ lawler.lenstra.ea:sequencing, 32441 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 32442 title = {Sequencing and Scheduling: Algorithms and Complexity}, 32443 institution = {Centre for Mathematics and Computer Science}, 32444 year = {1989}, 32445 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 32446 number = {BS--R89xx} 32447} 32448 32449@Article{ lawler:fast, 32450 author = {E. L. Lawler}, 32451 title = {Fast Approximations Algorithms for Knapsack Problems}, 32452 journal = {Mathematics of Operations Research}, 32453 year = {1979}, 32454 volume = {4}, 32455 pages = {339--356} 32456} 32457 32458@Book{ lawless:statistical, 32459 author = {J. F. Lawless}, 32460 title = {Statistical Models and Methods for Lifetime Data}, 32461 year = {1982}, 32462 publisher = {John Wiley and Sons}, 32463 address = {New York, NY} 32464} 32465 32466@Article{ lawrence.spingarn:fixed, 32467 author = {J. Lawrence and J. E. Spingarn}, 32468 title = {On fixed points of non-expansive piecewise isometric mappings}, 32469 journal = {Proceedings of the London Mathematical Society}, 32470 year = {1987}, 32471 volume = {55}, 32472 number = {3}, 32473 pages = {605--624} 32474} 32475 32476@Article{ leavitt.martin.ea:dynamic, 32477 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 32478 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 32479 dose delivery}, 32480 journal = {Medical Physics}, 32481 year = {1990}, 32482 volume = {17}, 32483 number = {1}, 32484 pages = {87--92} 32485} 32486 32487@Article{ leblanc.morlok.ea:efficient, 32488 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 32489 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 32490 Problem}, 32491 journal = {Transportation Research}, 32492 volume = {9}, 32493 year = {1975}, 32494 pages = {309--318} 32495} 32496 32497@Article{ lee:computational, 32498 author = {S. S. Lee}, 32499 title = {A computational method for frictional contact problem using finite element 32500 method}, 32501 journal = {International Journal for Numerical Methods in Engineering}, 32502 volume = {37}, 32503 year = {1994}, 32504 pages = {217--228} 32505} 32506 32507@PhDThesis{ lee:military, 32508 author = {D. K. Lee}, 32509 title = {Military Force Planning Problems Under Uncertainty}, 32510 school = {University of Wisconsin -- Madison}, 32511 year = {1996}, 32512 address = {Madison, Wisconsin} 32513} 32514 32515@Article{ leibel.kutcher.ea:improved, 32516 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 32517 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 32518 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 32519 the Nasopharynx}, 32520 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32521 year = {1991}, 32522 volume = {20}, 32523 pages = {823--833} 32524} 32525 32526@Article{ lee.gallagher.ea:treatment, 32527 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 32528 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 32529 Computational Approaches and Experiments with Permanent Prostate Implant 32530 Planning}, 32531 journal = {Physics in Medicine and Biology}, 32532 year = {1999}, 32533 volume = {44}, 32534 pages = {145--165} 32535} 32536 32537@Article{ lemarechal.nemirovskii.ea:variants, 32538 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 32539 title = {New Variants of Bundle Methods}, 32540 year = {1995}, 32541 journal = {Mathematical Programming}, 32542 volume = {69}, 32543 pages = {111--147} 32544} 32545 32546@InCollection{ lemarechal.strodiot.ea:bundle, 32547 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 32548 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 32549 booktitle = {Nonlinear Programming}, 32550 year = {1981}, 32551 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 32552 publisher = {Academic Press}, 32553 pages = {245--282}, 32554 volume = {4} 32555} 32556 32557@Article{ lemke.howson:equilibrium, 32558 author = {C. E. Lemke and J. T. Howson}, 32559 title = {Equilibrium Points of Bimatrix Games}, 32560 journal = {SIAM Journal on Applied Mathematics}, 32561 year = {1964}, 32562 volume = {12}, 32563 pages = {413--423} 32564} 32565 32566@Article{ lemke:bimatrix, 32567 author = {C. E. Lemke}, 32568 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 32569 journal = {Management Science}, 32570 year = {1965}, 32571 volume = {11}, 32572 pages = {681--689} 32573} 32574 32575@InCollection{ lemke:complementary, 32576 author = {C. E. Lemke}, 32577 title = {On Complementary Pivot Theory}, 32578 booktitle = {Mathematics of the Decision Sciences: Part 1}, 32579 publisher = {American Mathematical Society}, 32580 year = {1968}, 32581 editor = {G. B. Dantzig and A. F. Veinott}, 32582 volume = {11}, 32583 series = {Lectures in Applied Mathematics}, 32584 address = {Providence}, 32585 pages = {95--114} 32586} 32587 32588@Article{ levenberg:method, 32589 author = {K. Levenberg}, 32590 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 32591 journal = {Quarterly Applied Mathematics}, 32592 year = {1944}, 32593 volume = {2}, 32594 pages = {164--168} 32595} 32596 32597@Article{ levitin.polyak:constrained, 32598 author = {E. S. Levitin and B. T. Polyak}, 32599 title = {Constrained minimization methods}, 32600 journal = {Computational Mathematics and Mathematical Physics}, 32601 year = {1968}, 32602 volume = {6}, 32603 pages = {1--50}, 32604 note = {Translated from Russian} 32605} 32606 32607@Article{ li.swetis:linear, 32608 author = {W. Li and J. J. Swetits}, 32609 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 32610 journal = {SIAM Journal on Optimization}, 32611 volume = {8}, 32612 pages = {457-475}, 32613 year = {1998} 32614} 32615 32616@TechReport{ li:error, 32617 author = {W. Li}, 32618 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 32619 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32620 year = {1993}, 32621 address = {Norfolk, VA 23529}, 32622 number = {TR93-1}, 32623 note = {SIAM Journal on Control and Optimization, to appear} 32624} 32625 32626@TechReport{ li:linearly, 32627 author = {W. Li}, 32628 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 32629 Quadratic Splines}, 32630 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32631 year = {1993}, 32632 address = {Norfolk, VA 23529}, 32633 number = {TR93-3}, 32634 note = {Journal of Optimization Theory and Applications, to appear} 32635} 32636 32637@InProceedings{ li:merit, 32638 author = {W. Li}, 32639 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 32640 Problems}, 32641 crossref = {ferris.pang:complementarity} 32642} 32643 32644@Article{ li:remarks, 32645 author = {W. Li}, 32646 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 32647 Complementarity Problem}, 32648 journal = {SIAM Journal on Optimization}, 32649 year = {1993}, 32650 volume = {3}, 32651 pages = {155--163} 32652} 32653 32654@TechReport{ li:sharp, 32655 author = {W. Li}, 32656 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 32657 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32658 year = {1991}, 32659 address = {Norfolk, VA 23529}, 32660 number = {TR91-13}, 32661 note = {SIAM Journal on Control and Optimization, to appear} 32662} 32663 32664@Article{ lin.kernighan:efficient, 32665 author = {S. Lin and B. W. Kernighan}, 32666 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 32667 journal = {Operations Research}, 32668 year = {1973}, 32669 volume = {21}, 32670 pages = {498--516} 32671} 32672 32673@Article{ lin.pang:iterative, 32674 author = {Y. Y. Lin and J. S. Pang}, 32675 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 32676 journal = {SIAM Journal on Control and Optimization}, 32677 year = {1987}, 32678 volume = {25}, 32679 pages = {383--411} 32680} 32681 32682@Unpublished{ linderoth:branch, 32683 author = {J. Linderoth}, 32684 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 32685 institution = {Argonne National Laboratories}, 32686 year = {2000}, 32687 note = {Working Paper} 32688} 32689 32690@Article{ lions.stampacchia:variational, 32691 author = {J. L. Lions and G. Stampacchia}, 32692 title = {Variational Inequalities}, 32693 journal = {Communications on Pure and Applied Math}, 32694 year = {1967}, 32695 volume = {20}, 32696 pages = {493--19} 32697} 32698 32699@Article{ lions.mercier:splitting, 32700 author = {P.--L. Lions and B. Mercier}, 32701 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 32702 journal = {SIAM Journal on Numerical Analysis}, 32703 year = {1979}, 32704 volume = {16}, 32705 pages = {964--979} 32706} 32707 32708@Article{ lions:methode, 32709 author = {P.--L. Lions}, 32710 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 32711 journal = {Israel Journal of Mathematics}, 32712 year = {1978}, 32713 volume = {31}, 32714 number = {2}, 32715 pages = {204--208} 32716} 32717 32718@InProceedings{ litzkow.livny.ea:condor, 32719 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 32720 title = {Condor: {A} Hunter of Idle Workstations}, 32721 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 32722 Systems}, 32723 year = {1988}, 32724 pages = {104--111}, 32725 month = jun 32726} 32727 32728@Article{ liu.nocedal:limited, 32729 author = {D. C. Liu and J. Nocedal}, 32730 title = {On the Limited Memory Method for Large Scale Optimization}, 32731 journal = {Mathematical Programming}, 32732 year = {1989}, 32733 volume = {45}, 32734 pages = {503--528} 32735} 32736 32737@InBook{ livny.raman:high, 32738 author = {M. Livny and R. Raman}, 32739 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 32740 chapter = {High Throughput Resource Management}, 32741 publisher = {Morgan Kaufmann Publishers}, 32742 year = {1999}, 32743 pages = {311--337} 32744} 32745 32746@Article{ llacer:inverse, 32747 author = {J. Llacer}, 32748 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 32749 Method}, 32750 journal = {Medical Physics}, 32751 year = {1997}, 32752 volume = {24}, 32753 number = {11}, 32754 pages = {1751--1764} 32755} 32756 32757@Book{ lojasiewicz:ensembles, 32758 author = {M. S. Lojasiewicz}, 32759 title = {Ensembles semi-analytiques}, 32760 publisher = {Institut des Hautes Etudes Scientifiques}, 32761 year = {1964}, 32762 address = {Bures-sur-Yvette} 32763} 32764 32765@Article{ lootsma:logarithmic, 32766 author = {F. A. Lootsma}, 32767 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 32768 journal = {Phillips Research Reports}, 32769 year = {1967}, 32770 volume = {22}, 32771 pages = {329--344} 32772} 32773 32774@InCollection{ lootsma:survey, 32775 author = {F. A. Lootsma}, 32776 title = {A Survey of Methods for Solving Constrained Minimization Problems via 32777 Unconstrained Minimization}, 32778 booktitle = {Numerical Methods for Nonlinear Optimization}, 32779 year = {1972}, 32780 editor = {F. A. Lootsma}, 32781 publisher = {Academic Press}, 32782 address = {London} 32783} 32784 32785@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 32786 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32787 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 32788 Regional Trade Blocks}, 32789 institution = {National Bureau of Economic Research, Inc.}, 32790 year = {1993}, 32791 number = {4512}, 32792 address = {Cambridge, Massechusetts} 32793} 32794 32795@InCollection{ lopezdesilanes.markusen.ea:auto, 32796 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32797 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 32798 year = {1994}, 32799 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 32800 publisher = {Cambridge University Press}, 32801 editor = {C. Shields and J. Francois} 32802} 32803 32804@Article{ lopezdesilanes.markusen.ea:complementarity, 32805 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32806 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 32807 journal = {Journal of Development Economics}, 32808 year = {1994}, 32809 volume = {45}, 32810 pages = {133--151} 32811} 32812 32813@Article{ lopezdesilanes.markusen.ea:trade, 32814 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32815 title = {Trade Policy Subtleties with Multinational Firms}, 32816 journal = {European Economic Review}, 32817 year = {1996} 32818} 32819 32820@Article{ lotstedt:coulomb, 32821 author = {P. L{\"{o}}tstedt}, 32822 title = {Coulomb friction in two-dimensional rigid body systems}, 32823 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 32824 volume = {61}, 32825 year = {1981}, 32826 pages = {605--615} 32827} 32828 32829@Article{ lotstedt:mechanical, 32830 author = {P. L{\"{o}}tstedt}, 32831 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 32832 journal = {SIAM Journal on Applied Mathematics}, 32833 volume = {42}, 32834 year = {1982}, 32835 pages = {281--296} 32836} 32837 32838@Book{ luenberger:linear, 32839 author = {D. G. Luenberger}, 32840 title = {Linear and Nonlinear Programming}, 32841 year = {1984}, 32842 publisher = {Addison-Wesley}, 32843 edition = {Second} 32844} 32845 32846@Book{ luenberger:optimization, 32847 author = {D. G. Luenberger}, 32848 title = {Optimization by Vector Space Methods}, 32849 year = {1969}, 32850 publisher = {John Wiley \& Sons}, 32851 address = {New York} 32852} 32853 32854@Article{ lundy.mees:convergence, 32855 author = {M. Lundy and A. Mees}, 32856 title = {Convergence of an Annealing Algorithm}, 32857 journal = {Mathematical Programming}, 32858 year = {1986}, 32859 volume = {34}, 32860 pages = {111--124} 32861} 32862 32863@Article{ luo.luo:extension, 32864 author = {X.-D. Luo and Z.-Q. Luo}, 32865 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 32866 journal = {SIAM Journal on Optimization}, 32867 year = {1994}, 32868 volume = {4}, 32869 pages = {383--392} 32870} 32871 32872@Article{ luo.mangasarian.ea:error, 32873 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 32874 title = {New Error Bounds for the Linear Complementarity Problem}, 32875 journal = {Mathematics of Operations Research}, 32876 year = {1994}, 32877 pages = {880--892}, 32878 volume = {19} 32879} 32880 32881@Article{ luo.pang.ea:exact, 32882 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 32883 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 32884 Equilibrium Constraints}, 32885 journal = {Mathematical Programming}, 32886 volume = {75}, 32887 pages = {19--76}, 32888 year = {1996} 32889} 32890 32891@Book{ luo.pang.ea:mathematical, 32892 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 32893 title = {Mathematical Programs with Equilibrium Constraints}, 32894 publisher = {Cambridge University Press}, 32895 year = {1996} 32896} 32897 32898@Article{ luo.pang:error, 32899 author = {Z.-Q. Luo and J. S. Pang}, 32900 title = {Error Bounds for Analytic Systems and their Applications}, 32901 journal = {Mathematical Programming}, 32902 year = {1994}, 32903 volume = {67}, 32904 pages = {1--28} 32905} 32906 32907@Article{ luo.shu.ea:optimizing, 32908 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 32909 title = {Optimizing computerized treatment planning for the Gamma Knife by source 32910 culling}, 32911 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32912 year = {1999}, 32913 volume = {45}, 32914 number = {5}, 32915 pages = {1339--1346} 32916} 32917 32918@InProceedings{ luo.tseng:class, 32919 author = {Z.-Q. Luo and P. Tseng}, 32920 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 32921 crossref = {ferris.pang:complementarity}, 32922 pages = {204--225} 32923} 32924 32925@Article{ luo.tseng:convergence, 32926 author = {Z.-Q. Luo and P. Tseng}, 32927 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 32928 Minimization}, 32929 journal = {Journal of Optimization Theory and Applications}, 32930 year = {1992}, 32931 volume = {72}, 32932 pages = {7--35} 32933} 32934 32935@Article{ luo.tseng:convergence*1, 32936 author = {Z.-Q. Luo and P. Tseng}, 32937 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 32938 Linear Complementarity Problem}, 32939 journal = {SIAM Journal on Control and Optimization}, 32940 year = {1991}, 32941 volume = {29}, 32942 pages = {1037--1060} 32943} 32944 32945@Article{ luo.tseng:convergence*2, 32946 author = {Z.-Q. Luo and P. Tseng}, 32947 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 32948 journal = {Mathematics of Operations Research}, 32949 year = {1993}, 32950 volume = {18}, 32951 pages = {846--867} 32952} 32953 32954@Article{ luo.tseng:error, 32955 author = {Z.--Q. Luo and P. Tseng}, 32956 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 32957 Affine Variational Inequality Problem}, 32958 journal = {SIAM Journal on Optimization}, 32959 year = {1992}, 32960 volume = {2}, 32961 pages = {43--54} 32962} 32963 32964@Article{ luo.tseng:error*1, 32965 author = {Z.-Q. Luo and P. Tseng}, 32966 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 32967 Over a Polyhedral Set}, 32968 journal = {SIAM Journal on Optimization}, 32969 year = {1993}, 32970 volume = {3}, 32971 pages = {43--59} 32972} 32973 32974@Article{ luo.tseng:error*2, 32975 author = {Z.-Q. Luo and P. Tseng}, 32976 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 32977 Approach}, 32978 journal = {Annals of Operations Research}, 32979 year = {1993}, 32980 volume = {46}, 32981 pages = {157--178} 32982} 32983 32984@Article{ luo.tseng:global, 32985 author = {Z.-Q. Luo and P. Tseng}, 32986 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 32987 Problems}, 32988 journal = {Operations Research Letters}, 32989 year = {1992}, 32990 volume = {11}, 32991 pages = {159--165} 32992} 32993 32994@Article{ luo.tseng:linear, 32995 author = {Z.-Q. Luo and P. Tseng}, 32996 title = {On the linear convergence of descent methods for convex essentially smooth 32997 minimization}, 32998 journal = {SIAM Journal on Control and Optimization}, 32999 year = {1992}, 33000 volume = {30}, 33001 pages = {408--425} 33002} 33003 33004@TechReport{ luo:convergence, 33005 author = {Z.-Q. Luo}, 33006 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 33007 Quadratic Programs}, 33008 institution = {Communications Research Laboratory, McMaster University}, 33009 year = {1992}, 33010 address = {Hamilton, Ontario} 33011} 33012 33013@Article{ lustig.marsten.ea:computational, 33014 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 33015 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 33016 Programming}, 33017 journal = {Linear Algebra and Its Applications}, 33018 year = {1991}, 33019 volume = {152}, 33020 pages = {191--222} 33021} 33022 33023@Article{ lustig.marsten.ea:implementing, 33024 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 33025 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 33026 programming}, 33027 journal = {SIAM Journal on Optimization}, 33028 year = {1992}, 33029 volume = {2}, 33030 pages = {435--449} 33031} 33032 33033@Article{ lustig.marsten.ea:interior-point, 33034 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 33035 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 33036 journal = {ORSA Journal on Computing}, 33037 year = {1994}, 33038 volume = {6}, 33039 number = {1}, 33040 pages = {1--38} 33041} 33042 33043@Article{ lyman.wolbarst:optimization, 33044 author = {J. T. Lyman and A. B. Wolbarst}, 33045 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 33046 Algorithm}, 33047 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33048 year = {1989}, 33049 volume = {17}, 33050 pages = {433--436} 33051} 33052 33053@Article{ mackie.holmes.ea:tomotherapy*1, 33054 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 33055 J. Yang and B. Paliwal and T. Kinsella}, 33056 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 33057 journal = {Medical Physics}, 33058 year = {1993}, 33059 volume = {20}, 33060 number = {6}, 33061 pages = {1709--1719} 33062} 33063 33064@Article{ mackie.holmes.ea:tomotherapy*2, 33065 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 33066 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 33067 journal = {Int. J. of Imaging Systems and Technology}, 33068 year = {1995}, 33069 volume = {6}, 33070 pages = {43--55} 33071} 33072 33073@Article{ mackie.scrimger.ea:convolution, 33074 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 33075 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 33076 journal = {Medical Physics}, 33077 year = {1985}, 33078 volume = {12}, 33079 pages = {188--196} 33080} 33081 33082@Article{ mackinnon:technique, 33083 author = {James G. Mac{K}innon}, 33084 title = {A Technique for the Solution of Spatial Equilibrium Models}, 33085 journal = {Journal of Regional Science}, 33086 year = {1976}, 33087 volume = {16}, 33088 pages = {293--307} 33089} 33090 33091@PhDThesis{ madsen:minimization, 33092 author = {K. Madsen}, 33093 title = {Minimization of Nonlinear Approximation Functions}, 33094 year = {1985}, 33095 address = {Lyngby, Denmark}, 33096 school = {Institute of Numerical Analysis, Technical University of Denmark}, 33097 annote = {Dissertation} 33098} 33099 33100@Book{ magill.quinzii:theory, 33101 author = {M. Magill and M. Quinzii}, 33102 title = {Theory of Incomplete Markets}, 33103 publisher = {MIT Press}, 33104 year = {1996} 33105} 33106 33107@InCollection{ magnanti:models, 33108 author = {T. L. Magnanti}, 33109 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 33110 booktitle = {Transportation Planning Models}, 33111 year = {1984}, 33112 editor = {M. Florian}, 33113 publisher = {North Holland}, 33114 pages = {153--186} 33115} 33116 33117@InCollection{ maguregui:modified, 33118 author = {J. Maguregui}, 33119 title = {A modified {N}ewton algorithm for functions over convex sets}, 33120 crossref = {mangasarian.meyer.ea:nonlinear*3}, 33121 pages = {461--473} 33122} 33123 33124@PhDThesis{ maguregui:regular, 33125 author = {J. Maguregui}, 33126 title = {Regular Multivalued Functions and Algorithmic Applications}, 33127 year = {1977}, 33128 address = {Madison, Wisconsin}, 33129 school = {Computer Sciences Department, University of Wisconsin} 33130} 33131 33132@Article{ mahey.oualibouch.ea:proximal, 33133 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 33134 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 33135 journal = {SIAM Journal on Optimization}, 33136 year = {1995}, 33137 volume = {5}, 33138 pages = {454--466} 33139} 33140 33141@Article{ mahey.pham:partial, 33142 author = {P. Mahey and D. T. Pham}, 33143 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 33144 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 33145 year = {1993}, 33146 volume = {27}, 33147 pages = {375--392} 33148} 33149 33150@InCollection{ maier.novati:shakedown, 33151 author = {G. Maier and G. Novati}, 33152 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 33153 geometric effects with reference to discrete structural models}, 33154 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 33155 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 33156 publisher = {Pineridge Press}, 33157 address = {Swansea}, 33158 year = {1990}, 33159 pages = {451--471} 33160} 33161 33162@Article{ maier:incremental, 33163 author = {G. Maier}, 33164 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 33165 Instabilizing Effects}, 33166 journal = {International Journal of Solids and Structures}, 33167 volume = {7}, 33168 year = {1971}, 33169 pages = {345--372} 33170} 33171 33172@InCollection{ maier:inverse, 33173 author = {G. Maier}, 33174 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 33175 booktitle = {Serie VIII}, 33176 publisher = {Academia Nazionale dei Lincei}, 33177 year = {1981}, 33178 volume = {LXX}, 33179 pages = {203--209} 33180} 33181 33182@Article{ maier:matrix, 33183 author = {G. Maier}, 33184 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 33185 yield planes}, 33186 journal = {Meccanica}, 33187 volume = {5}, 33188 year = {1970}, 33189 pages = {54--66} 33190} 33191 33192@Article{ maier:quadratic, 33193 author = {G. Maier}, 33194 title = {A quadratic programming approach for certain classes of nonlinear structural 33195 problems}, 33196 journal = {Meccanica}, 33197 volume = {3}, 33198 year = {1968}, 33199 pages = {121--130} 33200} 33201 33202@Book{ manber:introduction, 33203 author = {U. Manber}, 33204 title = {Introduction to Algorithms: {A} Creative Approach}, 33205 year = {1989}, 33206 publisher = {Addison-Wesley} 33207} 33208 33209@Article{ mangasarian.deleone:error, 33210 author = {O. L. Mangasarian and R. {De~Leone}}, 33211 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 33212 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 33213 journal = {Applied Mathematics and Optimization}, 33214 year = {1988}, 33215 volume = {17}, 33216 pages = {1--14} 33217} 33218 33219@Article{ mangasarian.deleone:parallel, 33220 author = {O. L. Mangasarian and R. {De~Leone}}, 33221 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 33222 Problems and Linear Programs}, 33223 journal = {Journal of Optimization Theory and Applications}, 33224 year = {1987}, 33225 volume = {54}, 33226 pages = {437--446} 33227} 33228 33229@Article{ mangasarian.fromovitz:fritz, 33230 author = {O. L. Mangasarian and S. Fromovitz}, 33231 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 33232 and inequality constraints}, 33233 journal = {Journal of Mathematical Analysis and its Applications}, 33234 year = {1967}, 33235 volume = {17}, 33236 pages = {37--47} 33237} 33238 33239@Article{ mangasarian.mclinden:simple, 33240 author = {O. L. Mangasarian and L. McLinden}, 33241 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 33242 Programs}, 33243 journal = {Mathematical Programming}, 33244 year = {1985}, 33245 volume = {32}, 33246 pages = {32--40} 33247} 33248 33249@Article{ mangasarian.meyer:nonlinear, 33250 author = {O. L. Mangasarian and R. R. Meyer}, 33251 title = {Nonlinear Perturbation of Linear Programs}, 33252 journal = {SIAM Journal on Control and Optimization}, 33253 year = {1979}, 33254 volume = {17}, 33255 pages = {745--752} 33256} 33257 33258@TechReport{ mangasarian.musicant:active, 33259 author = {O. L. Mangasarian and David R. Musicant}, 33260 title = {Active Set Support Vector Machine Classification}, 33261 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33262 year = {2000}, 33263 number = {00-04}, 33264 address = {Madison, Wisconsin} 33265} 33266 33267@TechReport{ mangasarian.musicant:lagrangian, 33268 author = {O. L. Mangasarian and D. R. Musicant}, 33269 title = {Lagrangian Support Vector Machines}, 33270 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33271 year = {2000}, 33272 number = {00-06}, 33273 address = {Madison, Wisconsin} 33274} 33275 33276@TechReport{ mangasarian.musicant:robust, 33277 author = {O. L. Mangasarian and David R. Musicant}, 33278 title = {Robust Linear and Support Vector Regression}, 33279 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33280 year = {1999}, 33281 number = {99-09}, 33282 address = {Madison, Wisconsin} 33283} 33284 33285@Article{ mangasarian.musicant:successive, 33286 author = {O. L. Mangasarian and David R. Musicant}, 33287 title = {Successive Overrelaxation for Support Vector Machines}, 33288 journal = {IEEE Transactions on Neural Networks}, 33289 volume = {10}, 33290 year = {1999}, 33291 pages = {1032-1037} 33292} 33293 33294@Article{ mangasarian.pang:exact, 33295 author = {O. L. Mangasarian and J. S. Pang}, 33296 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 33297 Constraints}, 33298 journal = {Optimization}, 33299 year = {1997}, 33300 volume = {42}, 33301 pages = {1--8} 33302} 33303 33304@Article{ mangasarian.pang:extended, 33305 author = {O. L. Mangasarian and J. S. Pang}, 33306 title = {The Extended Linear Complementarity Problem}, 33307 journal = {SIAM Journal on Matrix Analysis and Applications}, 33308 year = {1994}, 33309 volume = {16} 33310} 33311 33312@Article{ mangasarian.ren:error, 33313 author = {O. L. Mangasarian and J. Ren}, 33314 title = {New error bounds for the nonlinear complementarity problem}, 33315 year = {1994}, 33316 volume = {1}, 33317 pages = {49--56}, 33318 journal = {Communications on Applied Nonlinear Analysis} 33319} 33320 33321@Article{ mangasarian.ren:improved, 33322 author = {O. L. Mangasarian and J. Ren}, 33323 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 33324 year = {1994}, 33325 volume = {66}, 33326 journal = {Mathematical Programming}, 33327 pages = {241--255} 33328} 33329 33330@InProceedings{ mangasarian.setiono.ea:pattern, 33331 crossref = {coleman.li:large-scale}, 33332 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 33333 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 33334 Diagnosis}, 33335 pages = {22--31} 33336} 33337 33338@Article{ mangasarian.shiau:error, 33339 author = {O. L. Mangasarian and T.--H. Shiau}, 33340 title = {Error Bounds for Monotone Linear Complementarity Problems}, 33341 journal = {Mathematical Programming}, 33342 year = {1986}, 33343 volume = {36}, 33344 pages = {81--89} 33345} 33346 33347@Article{ mangasarian.shiau:lipschitz, 33348 author = {O. L. Mangasarian and T.--H. Shiau}, 33349 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 33350 Complementarity Problems}, 33351 journal = {SIAM Journal on Control and Optimization}, 33352 year = {1987}, 33353 volume = {25}, 33354 pages = {583--595} 33355} 33356 33357@Article{ mangasarian.solodov:nonlinear, 33358 author = {O. L. Mangasarian and M. V. Solodov}, 33359 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 33360 journal = {Mathematical Programming}, 33361 year = {1993}, 33362 volume = {62}, 33363 pages = {277--298} 33364} 33365 33366@Article{ mangasarian.solodov:serial, 33367 author = {O. L. Mangasarian and M. V. Solodov}, 33368 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 33369 Minimization}, 33370 year = {1994}, 33371 journal = {Optimization Methods and Software}, 33372 volume = {4}, 33373 pages = {103--116} 33374} 33375 33376@Article{ mangasarian.street.ea:breast, 33377 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 33378 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 33379 journal = {Operations Research}, 33380 year = {1995}, 33381 volume = {43}, 33382 pages = {570--577} 33383} 33384 33385@Article{ mangasarian.wolberg:cancer, 33386 author = {O. L. Mangasarian and W. H. Wolberg}, 33387 title = {Cancer Diagnosis via Linear Programming}, 33388 journal = {SIAM News}, 33389 year = {1990}, 33390 volume = {23}, 33391 pages = {1 \& 18} 33392} 33393 33394@InCollection{ mangasarian:applications, 33395 author = {O. L. Mangasarian}, 33396 title = {Some Applications of Penalty Functions in Mathematical Programming}, 33397 booktitle = {Optimization and Related Fields}, 33398 year = {1986}, 33399 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 33400 publisher = {Springer-Verlag}, 33401 address = {Heidelberg}, 33402 pages = {307--329}, 33403 note = {Lecture Notes in Mathematics 1190} 33404} 33405 33406@Article{ mangasarian:characterization, 33407 author = {O. L. Mangasarian}, 33408 title = {Characterization of linear complementarity problems as linear programs}, 33409 journal = {Mathematical Programming Study}, 33410 year = {1978}, 33411 volume = {7}, 33412 pages = {74--87} 33413} 33414 33415@InProceedings{ mangasarian:condition, 33416 author = {O. L. Mangasarian}, 33417 title = {A condition number for linear inequalities and linear programs}, 33418 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 33419 1981}, 33420 year = {1981}, 33421 editor = {G. Bamberg and O. Opitz}, 33422 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 33423 address = {Konigstein}, 33424 pages = {3--15} 33425} 33426 33427@Article{ mangasarian:convergence, 33428 author = {O. L. Mangasarian}, 33429 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 33430 Symmetric Monotone Linear Complementarity Problem}, 33431 journal = {SIAM Journal on Optimization}, 33432 volume = {1}, 33433 pages = {114--122}, 33434 year = {1991} 33435} 33436 33437@Article{ mangasarian:equivalence, 33438 author = {O. L. Mangasarian}, 33439 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 33440 journal = {SIAM Journal on Applied Mathematics}, 33441 year = {1976}, 33442 volume = {31}, 33443 pages = {89--92} 33444} 33445 33446@Article{ mangasarian:error, 33447 author = {O. L. Mangasarian}, 33448 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 33449 journal = {ORSA Journal on Computing}, 33450 volume = {15}, 33451 pages = {187--192}, 33452 year = {1994} 33453} 33454 33455@Article{ mangasarian:error*1, 33456 author = {O. L. Mangasarian}, 33457 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 33458 journal = {Mathematical Programming}, 33459 year = {1990}, 33460 volume = {48}, 33461 pages = {437--445} 33462} 33463 33464@Article{ mangasarian:generalized, 33465 author = {O. L. Mangasarian}, 33466 title = {Generalized Linear Complementarity Problems as Linear Programs}, 33467 journal = {Methods of Operations Research}, 33468 year = {1979}, 33469 editor = {W. Oettli and F. Steffens}, 33470 volume = {31}, 33471 pages = {393--402} 33472} 33473 33474@InCollection{ mangasarian:generalized*1, 33475 author = {O. L. Mangasarian}, 33476 title = {Generalized Support Vector Machines}, 33477 year = {2000}, 33478 pages = {135-146}, 33479 booktitle = {Advances in Large Margin Classifiers}, 33480 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 33481 publisher = {MIT Press}, 33482 address = {Cambridge, MA} 33483} 33484 33485@Article{ mangasarian:global, 33486 author = {O. L. Mangasarian}, 33487 title = {Global error bounds for monotone affine variational inequality problems}, 33488 journal = {Linear Algebra and Its Applications}, 33489 year = {1992}, 33490 pages = {153--164} 33491} 33492 33493@InCollection{ mangasarian:least, 33494 author = {O. L. Mangasarian}, 33495 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 33496 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 33497 year = {1990}, 33498 publisher = {Oxford University Press}, 33499 address = {New York}, 33500 pages = {217--221} 33501} 33502 33503@Article{ mangasarian:least-norm, 33504 author = {O. L. Mangasarian}, 33505 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 33506 Problem}, 33507 journal = {Journal of Mathematical Analysis and Applications}, 33508 year = {1983}, 33509 volume = {92}, 33510 pages = {240--251} 33511} 33512 33513@Article{ mangasarian:linear, 33514 author = {O. L. Mangasarian}, 33515 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 33516 journal = {Mathematical Programming}, 33517 year = {1976}, 33518 volume = {10}, 33519 pages = {263--270} 33520} 33521 33522@Article{ mangasarian:linear*1, 33523 author = {O. L. Mangasarian}, 33524 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 33525 journal = {Operations Research}, 33526 year = {1965}, 33527 volume = {13}, 33528 pages = {444--452} 33529} 33530 33531@Article{ mangasarian:locally, 33532 author = {O. L. Mangasarian}, 33533 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 33534 Complementarity Problems}, 33535 journal = {Mathematical Programming}, 33536 year = {1980}, 33537 volume = {19}, 33538 pages = {200--212} 33539} 33540 33541@InCollection{ mangasarian:machine, 33542 author = {O. L. Mangasarian}, 33543 title = {Machine Learning via Polyhedral Concave Minimization}, 33544 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 33545 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 33546 pages = {175-188}, 33547 year = {1996}, 33548 address = {Heidelberg}, 33549 publisher = {Physica-Verlag A Springer-Verlag Company} 33550} 33551 33552@Article{ mangasarian:mathematical, 33553 author = {O. L. Mangasarian}, 33554 title = {Mathematical Programming in Neural Networks}, 33555 journal = {ORSA Journal on Computing}, 33556 volume = {5}, 33557 pages = {349--360}, 33558 year = {1993} 33559} 33560 33561@InProceedings{ mangasarian:mathematical*1, 33562 author = {O. L. Mangasarian}, 33563 title = {Mathematical Programming in Machine Learning}, 33564 booktitle = {Nonlinear Optimization and Applications}, 33565 editor = {G. Di Pillo and F. Giannessi}, 33566 publisher = {Plenum Publishing}, 33567 address = {New York}, 33568 pages = {283--295}, 33569 year = {1996} 33570} 33571 33572@Article{ mangasarian:mathematical*2, 33573 author = {O. L. Mangasarian}, 33574 title = {Mathematical Programming in Data Mining}, 33575 journal = {Data Mining and Knowledge Discovery}, 33576 volume = {1}, 33577 year = {1997}, 33578 pages = {183-201} 33579} 33580 33581@Article{ mangasarian:multi-surface, 33582 author = {O. L. Mangasarian}, 33583 title = {Multi-surface Method of Pattern Separation}, 33584 journal = {IEEE Transactions on Information Theory}, 33585 year = {1968}, 33586 volume = {IT-14}, 33587 pages = {801--807} 33588} 33589 33590@Book{ mangasarian:nonlinear, 33591 author = {O. L. Mangasarian}, 33592 title = {Nonlinear Programming}, 33593 year = {1969}, 33594 publisher = {McGraw--Hill}, 33595 address = {New York}, 33596 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 33597} 33598 33599@Article{ mangasarian:normal, 33600 author = {O. L. Mangasarian}, 33601 title = {Normal Solutions of Linear Programs}, 33602 journal = {Mathematical Programming Study}, 33603 year = {1984}, 33604 volume = {22}, 33605 pages = {206--216} 33606} 33607 33608@Article{ mangasarian:optimal, 33609 author = {O. L. Mangasarian}, 33610 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 33611 Linear Programs}, 33612 journal = {Journal of Optimization Theory and Applications}, 33613 year = {1981}, 33614 volume = {35}, 33615 pages = {123--128} 33616} 33617 33618@Article{ mangasarian:parallel, 33619 author = {O. L. Mangasarian}, 33620 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 33621 journal = {SIAM Journal on Control and Optimization}, 33622 volume = {33}, 33623 pages = {1916--1925}, 33624 year = {1995} 33625} 33626 33627@TechReport{ mangasarian:regularized, 33628 author = {O. L. Mangasarian}, 33629 title = {Regularized Linear Programs with Equilibrium Constraints}, 33630 institution = {Computer Sciences Department, University of Wisconsin}, 33631 year = {1997}, 33632 address = {Madison, Wisconsin}, 33633 type = {Mathematical Programming Technical Report}, 33634 number = {97--13}, 33635 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 33636} 33637 33638@Article{ mangasarian:simple, 33639 author = {O. L. Mangasarian}, 33640 title = {A Simple Characterization of Solution Sets of Convex Programs}, 33641 journal = {Operations Research Letters}, 33642 year = {1988}, 33643 volume = {7}, 33644 pages = {21--26} 33645} 33646 33647@Article{ mangasarian:solution, 33648 author = {O. L. Mangasarian}, 33649 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 33650 journal = {Journal of Optimization Theory and Applications}, 33651 year = {1977}, 33652 month = aug, 33653 volume = {22}, 33654 pages = {465--485} 33655} 33656 33657@Article{ mangasarian:stable, 33658 author = {O. L. Mangasarian}, 33659 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 33660 journal = {Linear Algebra and Its Applications}, 33661 year = {1981}, 33662 volume = {41}, 33663 pages = {209--223} 33664} 33665 33666@Article{ mangasarian:sufficiency, 33667 author = {O. L. Mangasarian}, 33668 title = {Sufficiency of Exact Penalty Minimization}, 33669 journal = {SIAM Journal on Control and Optimization}, 33670 year = {1985}, 33671 month = jan, 33672 volume = {23}, 33673 pages = {30--37} 33674} 33675 33676@Article{ mangasarian:unconstrained, 33677 author = {O. L. Mangasarian}, 33678 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 33679 journal = {SIAM Journal on Control and Optimization}, 33680 year = {1975}, 33681 volume = {13}, 33682 pages = {772--791} 33683} 33684 33685@Book{ manne.richels:buying, 33686 author = {A. S. Manne and R. G. Richels}, 33687 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 33688 publisher = {MIT Press}, 33689 year = {1992}, 33690 address = {Cambridge MA} 33691} 33692 33693@Article{ manne.richels:global, 33694 author = {A. S. Manne and R. G. Richels}, 33695 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 33696 journal = {The Energy Journal}, 33697 year = {1991}, 33698 volume = {12}, 33699 pages = {87--107} 33700} 33701 33702@Article{ manne.richels:international, 33703 author = {A. S. Manne and R. G. Richels}, 33704 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 33705 journal = {Economic Review}, 33706 year = {1991}, 33707 volume = {81}, 33708 pages = {135--139} 33709} 33710 33711@Article{ manne.rutherford:international, 33712 author = {A. S. Manne and T. F. Rutherford}, 33713 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 33714 General Equilibrium Model}, 33715 journal = {The Energy Journal}, 33716 year = {1993}, 33717 volume = {14}, 33718 pages = {1--20} 33719} 33720 33721@InCollection{ manne:eta-macro, 33722 author = {A. S. Manne}, 33723 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 33724 booktitle = {Modeling Energy-Economy Interactions}, 33725 year = {1977}, 33726 editor = {C. J. Hitch}, 33727 publisher = {Resources for the Future}, 33728 address = {Washington DC} 33729} 33730 33731@PhDThesis{ maratos:exact, 33732 author = {N. Maratos}, 33733 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 33734 Problems}, 33735 year = {1978}, 33736 school = {Imperial College, University of London} 33737} 33738 33739@Article{ marcotte.dussault:note, 33740 author = {P. Marcotte and J.--P. Dussault}, 33741 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 33742 Inequalities}, 33743 journal = {Operations Research Letters}, 33744 year = {1987}, 33745 volume = {6}, 33746 pages = {35--42} 33747} 33748 33749@Article{ marcotte.zhu:exact, 33750 author = {P. Marcotte and D. L. Zhu}, 33751 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 33752 Problem}, 33753 journal = {Mathematical Programming}, 33754 year = {1996}, 33755 volume = {74}, 33756 pages = {141--158} 33757} 33758 33759@Article{ marcotte:algorithm, 33760 author = {P. Marcotte}, 33761 title = {A New Algorithm for Solving Variational Inequalities with Application to the 33762 Traffic Assignment Problem}, 33763 journal = {Mathematical Programming}, 33764 year = {1985}, 33765 volume = {33}, 33766 pages = {339--351} 33767} 33768 33769@Article{ marcotte:application, 33770 author = {P. Marcotte}, 33771 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 33772 Equilibrium Problems}, 33773 journal = {Information Systems and Operational Research}, 33774 year = {1991}, 33775 volume = {29}, 33776 pages = {258--270} 33777} 33778 33779@Article{ marcotte:network, 33780 author = {P. Marcotte}, 33781 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 33782 journal = {Mathematical Programming}, 33783 year = {1986}, 33784 volume = {34}, 33785 pages = {142--162} 33786} 33787 33788@Article{ markusen.rutherford.ea:el, 33789 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33790 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 33791 journal = {Cuadernos Economicos de Ice}, 33792 year = {1995}, 33793 volume = {59}, 33794 pages = {57--68} 33795} 33796 33797@Article{ markusen.rutherford.ea:trade, 33798 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33799 title = {Trade liberalization in a multinational-dominated industry}, 33800 journal = {Journal of International Economics}, 33801 year = {1995}, 33802 volume = {38}, 33803 pages = {95--118} 33804} 33805 33806@Article{ markusen.rutherford:discrete, 33807 author = {J. R. Markusen and T. F. Rutherford}, 33808 title = {Discrete plant-location decisions in an applied general equilibrium model of 33809 trade liberalization}, 33810 journal = {Weltwirtshchaftliches Archiv}, 33811 year = {1994} 33812} 33813 33814@Article{ markusen.wigle:nash, 33815 author = {J. Markusen and R. Wigle}, 33816 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 33817 Country Size, Scale Economies and Capital Mobility}, 33818 journal = {Journal of Political Mobility}, 33819 year = {1989}, 33820 volume = {97}, 33821 pages = {368--386} 33822} 33823 33824@Article{ marquardt:algorithm, 33825 author = {D. W. Marquardt}, 33826 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 33827 journal = {SIAM Journal on Applied Mathematics}, 33828 year = {1963}, 33829 volume = {11}, 33830 pages = {431--441} 33831} 33832 33833@Article{ martello.toth:algorithm, 33834 author = {S. Martello and P. Toth}, 33835 title = {A New Algorithm for the 0--1 Knapsack Problem}, 33836 journal = {Management Science}, 33837 year = {1988}, 33838 volume = {34}, 33839 pages = {633--644} 33840} 33841 33842@InCollection{ martello.toth:algorithms, 33843 author = {S. Martello and P. Toth}, 33844 title = {Algorithms for Knapsack Problems}, 33845 booktitle = {Surveys in Combinatorial Optimization}, 33846 year = {1987}, 33847 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 33848 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 33849 address = {Amsterdam} 33850} 33851 33852@Article{ martello.toth:mixture, 33853 author = {S. Martello and P. Toth}, 33854 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 33855 Problem}, 33856 journal = {Management Science}, 33857 year = {1984}, 33858 volume = {30}, 33859 pages = {765--771} 33860} 33861 33862@Article{ martello.toth:worst-case, 33863 author = {S. Martello and P. Toth}, 33864 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 33865 journal = {Mathematical Programming}, 33866 year = {1984}, 33867 volume = {28}, 33868 pages = {198--205} 33869} 33870 33871@Article{ martinet:regularisation, 33872 author = {Bernard Martinet}, 33873 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 33874 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 33875 year = {1970}, 33876 volume = {4}, 33877 pages = {154--159} 33878} 33879 33880@Article{ maskin.tirole:theory, 33881 author = {E. Maskin and J. Tirole}, 33882 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 33883 fixed costs}, 33884 journal = {Econometrica}, 33885 volume = {56}, 33886 year = {1988}, 33887 pages = {549--569} 33888} 33889 33890@Article{ maskin.tirole:theory*1, 33891 author = {E. Maskin and J. Tirole}, 33892 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 33893 Edgeworth cycles}, 33894 journal = {Econometrica}, 33895 volume = {56}, 33896 year = {1988}, 33897 pages = {571--579} 33898} 33899 33900@Article{ maskus.rutherford.ea:economic, 33901 author = {K. Maskus and T. F. Rutherford and S. Selby}, 33902 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 33903 {M}exico}, 33904 journal = {North American Journal of Economics and Finance}, 33905 year = {1996} 33906} 33907 33908@Article{ mastor:experimental, 33909 author = {A. A. Mastor}, 33910 title = {An Experimental Investigation and Comparative Evaluation of Production Line 33911 Balancing Techniques}, 33912 journal = {Management Science}, 33913 year = {1970}, 33914 volume = {16}, 33915 pages = {728--746} 33916} 33917 33918@Article{ mathias.pang:error, 33919 author = {R. Mathias and J. S. Pang}, 33920 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 33921 journal = {Linear Algebra and Its Applications}, 33922 year = {1990}, 33923 volume = {132}, 33924 pages = {123--136} 33925} 33926 33927@Article{ mathiesen:algorithm, 33928 author = {L. Mathiesen}, 33929 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 33930 {W}alrasian Equilibrium Model: An Example}, 33931 journal = {Mathematical Programming}, 33932 year = {1987}, 33933 volume = {37}, 33934 pages = {1--18} 33935} 33936 33937@Article{ mathiesen:computation, 33938 author = {L. Mathiesen}, 33939 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 33940 Problems}, 33941 journal = {Mathematical Programming Study}, 33942 year = {1985}, 33943 volume = {23}, 33944 pages = {144--162} 33945} 33946 33947@Article{ mathiesen:computational, 33948 author = {L. Mathiesen}, 33949 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 33950 Complementarity Problems}, 33951 journal = {Operations Research}, 33952 year = {1985}, 33953 volume = {33}, 33954 pages = {1225--1250} 33955} 33956 33957@Book{ matlab:users, 33958 author = {{MATLAB}}, 33959 title = {User's Guide}, 33960 year = {1992}, 33961 publisher = {The MathWorks, Inc.} 33962} 33963 33964@Book{ mcclelland.rummelhart:explorations, 33965 author = {J. L. McClelland and D. E. Rummelhart}, 33966 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 33967 Programs, and Exercises}, 33968 year = {1987}, 33969 publisher = {MIT Press}, 33970 address = {Cambridge, Massachusetts} 33971} 33972 33973@Article{ mccormick:modification, 33974 author = {G. P. McCormick}, 33975 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 33976 journal = {Mathematical Programming}, 33977 year = {1977}, 33978 volume = {13}, 33979 pages = {111--115} 33980} 33981 33982@Book{ mccormick:nonlinear, 33983 author = {G. P. McCormick}, 33984 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 33985 year = {1983}, 33986 publisher = {John Wiley \& Sons}, 33987 address = {New York} 33988} 33989 33990@Article{ mcculloch.pitts:logical, 33991 author = {W. McCulloch and W. Pitts}, 33992 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 33993 journal = {Bulletin of Mathematical Biophysics}, 33994 year = {1943}, 33995 volume = {7}, 33996 pages = {115--133} 33997} 33998 33999@TechReport{ mckenna.zenios:optimal, 34000 author = {M. McKenna and S. A. Zenios}, 34001 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 34002 institution = {Thinking Machines Corporation}, 34003 year = {1990}, 34004 type = {Working Paper}, 34005 address = {Cambridge, MA} 34006} 34007 34008@Article{ mckinnon:convergence, 34009 author = {K. I. M. McKinnon}, 34010 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 34011 journal = {SIAM Journal on Optimization}, 34012 year = {1998}, 34013 volume = {9}, 34014 pages = {148--158} 34015} 34016 34017@Article{ mcshane.monma.ea:implementation, 34018 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 34019 title = {An implementation of a primal-dual interior point method for linear programming}, 34020 journal = {ORSA Journal of Computing}, 34021 year = {1989}, 34022 volume = {1}, 34023 pages = {70--83} 34024} 34025 34026@PhDThesis{ medhi:decomposition, 34027 author = {D. Medhi}, 34028 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 34029 Optimization}, 34030 school = {Computer Sciences Department, University of Wisconsin}, 34031 year = {1987}, 34032 address = {Madison, Wisconsin}, 34033 note = {Technical Report 718} 34034} 34035 34036@Article{ medhi:parallel, 34037 author = {D. Medhi}, 34038 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 34039 Programming Problems}, 34040 journal = {Annals of Operations Research}, 34041 year = {1990}, 34042 volume = {22}, 34043 pages = {101--127} 34044} 34045 34046@Article{ megiddo:complexity, 34047 author = {N. Megiddo}, 34048 title = {On the complexity of polyhedral separability}, 34049 journal = {Discrete and Computational Geometry}, 34050 year = {1988}, 34051 volume = {3}, 34052 pages = {325--337} 34053} 34054 34055@Article{ megiddo:finding, 34056 author = {N. Megiddo}, 34057 title = {On Finding Primal-- and Dual--Optimal Bases}, 34058 journal = {ORSA Journal on Computing}, 34059 year = {1991}, 34060 volume = {3}, 34061 pages = {63--65} 34062} 34063 34064@Article{ mehrotra:implementation, 34065 author = {S. Mehrotra}, 34066 title = {On the implementation of a primal-dual interior point method}, 34067 journal = {SIAM Journal on Optimization}, 34068 year = {1992}, 34069 volume = {2}, 34070 pages = {575--601} 34071} 34072 34073@PhDThesis{ merrill:applications, 34074 author = {O. H. Merrill}, 34075 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 34076 Semicontinuous Point to Set Mappings}, 34077 year = {1972}, 34078 school = {University of Michigan} 34079} 34080 34081@Article{ merten.muller:variance, 34082 author = {A. G. Merten and M. E. Muller}, 34083 title = {Variance Minimization in Single Machine Sequencing Problems}, 34084 journal = {Management Science}, 34085 year = {1972}, 34086 volume = {18}, 34087 pages = {518--528} 34088} 34089 34090@TechReport{ meyer:continuity, 34091 author = {R. R. Meyer}, 34092 title = {Continuity Properties of Linear Programs}, 34093 institution = {Computer Sciences Department, University of Wisconsin}, 34094 year = {1979}, 34095 address = {Madison, Wisconsin}, 34096 number = {373} 34097} 34098 34099@Article{ miersemann.mittelmann:continuation, 34100 author = {E. Miersemann and H. D. Mittelmann}, 34101 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 34102 journal = {Journal of Computational and Applied Mathematics}, 34103 year = {1989}, 34104 volume = {26}, 34105 pages = {23--34} 34106} 34107 34108@Article{ mifflin:semismooth, 34109 author = {R. Mifflin}, 34110 title = {Semismooth and semiconvex functions in constrained optimization}, 34111 journal = {SIAM Journal on Control and Optimization}, 34112 year = {1977}, 34113 volume = {15}, 34114 pages = {957--972} 34115} 34116 34117@Article{ mifflin:stable, 34118 author = {R. Mifflin}, 34119 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 34120 journal = {Mathematical Programming}, 34121 vol = {16}, 34122 pages = {141--158}, 34123 year = {1979} 34124} 34125 34126@Book{ miller:survival, 34127 author = {Jr. R. G. Miller}, 34128 title = {Survival Analysis}, 34129 year = {1981}, 34130 publisher = {John Wiley \& Sons}, 34131 address = {New York} 34132} 34133 34134@Book{ minsky.papert:perceptrons, 34135 author = {M. Minsky and S. Papert}, 34136 title = {Perceptrons: An Introduction to Computational Geometry}, 34137 year = {1969}, 34138 publisher = {MIT Press}, 34139 address = {Cambridge, Massachusetts} 34140} 34141 34142@Article{ minty:monotone, 34143 author = {G. J. Minty}, 34144 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 34145 journal = {Duke Mathematics Journal}, 34146 year = {1962}, 34147 volume = {29}, 34148 pages = {341--346} 34149} 34150 34151@Article{ minty:monotonicity, 34152 author = {G. J. Minty}, 34153 title = {On the Monotonicity of the Gradient of a Convex Function}, 34154 journal = {Pacific Journal of Mathematics}, 34155 year = {1964}, 34156 volume = {14}, 34157 pages = {243--247} 34158} 34159 34160@TechReport{ mizuno.jarre.ea:unified, 34161 author = {S. Mizuno and F. Jarre and J. Stoer}, 34162 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 34163 linear complementarity problems}, 34164 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 34165 address = {W{\"{u}}rzburg, Germany}, 34166 year = {1994}, 34167 number = {Nr. 213}, 34168 type = {Preprint} 34169} 34170 34171@TechReport{ mizuno:polynomiality, 34172 author = {S. Mizuno}, 34173 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 34174 for linear programming}, 34175 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 34176 year = {1993}, 34177 number = {1006}, 34178 address = {Ithaca, New York}, 34179 month = jan 34180} 34181 34182@Article{ mohan.mageras.ea:clinically, 34183 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 34184 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 34185 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 34186 journal = {Medical Physics}, 34187 year = {1992}, 34188 volume = {19}, 34189 number = {4}, 34190 pages = {933--944} 34191} 34192 34193@Article{ mohan:field, 34194 author = {R. Mohan}, 34195 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 34196 Collimation}, 34197 journal = {Seminars in Radiation Oncology}, 34198 year = {1995}, 34199 volume = {5}, 34200 number = {2}, 34201 pages = {86--99} 34202} 34203 34204@Article{ monteiro.pang.ea:positive, 34205 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 34206 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 34207 journal = {SIAM Journal on Optimization}, 34208 year = {1995}, 34209 volume = {5}, 34210 pages = {129--148} 34211} 34212 34213@Article{ monteiro.tsuchiya:limiting, 34214 author = {R. D. C. Monteiro and T. Tsuchiya}, 34215 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 34216 Monotone Horizontal Linear Complementarity Problem}, 34217 year = {1996}, 34218 journal = {Mathematics of Operations Research}, 34219 pages = {793--814}, 34220 volume = {21} 34221} 34222 34223@Article{ monteiro.wright:local, 34224 author = {R. D. C. Monteiro and S. J. Wright}, 34225 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 34226 journal = {Computational Optimization and Applications}, 34227 year = {1994}, 34228 volume = {3}, 34229 pages = {131--155} 34230} 34231 34232@Article{ monteiro.wright:superlinear, 34233 author = {R. D. C. Monteiro and S. J. Wright}, 34234 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 34235 year = {1996}, 34236 journal = {SIAM Journal on Optimization}, 34237 volume = {6}, 34238 pages = {1--18} 34239} 34240 34241@Article{ monteiro.wright:superlinear*1, 34242 author = {R. D. C. Monteiro and S. J. Wright}, 34243 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 34244 journal = {Mathematical Programming}, 34245 year = {1995}, 34246 volume = {69}, 34247 pages = {311--333} 34248} 34249 34250@Article{ more.garbow.ea:testing, 34251 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 34252 title = {Testing Unconstrained Optimization Software}, 34253 journal = {ACM Transactions on Mathematical Software}, 34254 year = {1981}, 34255 volume = {7}, 34256 pages = {17--41} 34257} 34258 34259@Article{ more.rheinboldt:p, 34260 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 34261 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 34262 Mappings}, 34263 journal = {Linear Algebra and Its Applications}, 34264 year = {1973}, 34265 volume = {6}, 34266 pages = {45--68} 34267} 34268 34269@Article{ more.sorensen:use, 34270 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34271 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 34272 journal = {Mathematical Programming}, 34273 year = {1979}, 34274 volume = {16}, 34275 pages = {1--20} 34276} 34277 34278@Article{ more.sorensen:computing, 34279 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34280 title = {Computing a Trust Region Step}, 34281 journal = {SIAM Journal on Scientific and Statistical Computing}, 34282 year = {1983}, 34283 volume = {4}, 34284 pages = {553--572} 34285} 34286 34287@Article{ more.toraldo:solution, 34288 author = {J. J. Mor\'e and G. Toraldo}, 34289 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 34290 journal = {SIAM Journal on Optimization}, 34291 year = {1991}, 34292 volume = {1}, 34293 pages = {93--113} 34294} 34295 34296@TechReport{ more.vavasis:solution, 34297 author = {J. J. Mor\'{e} and S. A. Vavasis}, 34298 title = {On the Solution of Concave Knapsack Problems}, 34299 institution = {Argonne National Laboratory}, 34300 year = {1988}, 34301 address = {Argonne, Illinois}, 34302 number = {ANL/MCS--P40--1288}, 34303 type = {Mathematics and Computer Science Division Report} 34304} 34305 34306@Book{ more.wright:optimization, 34307 author = {J. J. Mor\'{e} and S. J. Wright}, 34308 title = {Optimization Software Guide}, 34309 publisher = {SIAM}, 34310 address = {Philadelphia, Pennsylvania}, 34311 series = {Frontiers in Applied Mathematics}, 34312 number = {14}, 34313 year = {1993} 34314} 34315 34316@TechReport{ more.wu:global, 34317 author = {J. J. Mor\'{e} and Z. Wu}, 34318 title = {Global Continuation for Distance Geometry Problems}, 34319 institution = {Argonne National Laboratory}, 34320 year = {1995}, 34321 type = {Preprint}, 34322 number = {MCS-P505-0395}, 34323 address = {Argonne, Illinois} 34324} 34325 34326@TechReport{ more.wu:issues, 34327 author = {J. J. Mor\'{e} and Z. Wu}, 34328 title = {Issues in Large-Scale Global Molecular Optimization}, 34329 institution = {Argonne National Laboratory}, 34330 year = {1995}, 34331 type = {Preprint}, 34332 number = {MCS-P539-1095}, 34333 address = {Argonne, Illinois} 34334} 34335 34336@TechReport{ more:collection, 34337 author = {J. J. Mor\'e}, 34338 title = {A Collection of Nonlinear Model Problems}, 34339 institution = {Argonne National Laboratory}, 34340 year = {1989}, 34341 type = {Preprint}, 34342 address = {Argonne, Illinois}, 34343 number = {MCS-P60-0289} 34344} 34345 34346@Article{ more:global, 34347 author = {J. J. Mor\'e}, 34348 title = {Global Methods for Nonlinear Complementarity Problems}, 34349 year = {1996}, 34350 journal = {Mathematics of Operations Research}, 34351 pages = {589--614}, 34352 volume = {21} 34353} 34354 34355@Article{ moreau:proximite, 34356 author = {J.--J. Moreau}, 34357 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 34358 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 34359 year = {1965}, 34360 volume = {93}, 34361 pages = {273--299} 34362} 34363 34364@Article{ morrill.lane.ea:dose-volume, 34365 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 34366 title = {Dose-volume considerations with linear programming}, 34367 journal = {Medical Physics}, 34368 year = {1991}, 34369 volume = {18}, 34370 number = {6}, 34371 pages = {1201--1210} 34372} 34373 34374@Article{ morrill:very, 34375 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 34376 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 34377 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34378 year = {1995}, 34379 volume = {31}, 34380 pages = {179--188} 34381} 34382 34383@TechReport{ morshedi.tapia:karmarkar, 34384 author = {A. M. Morshedi and R. A. Tapia}, 34385 title = {Karmarkar as a Classical Method}, 34386 institution = {Department of Mathematical Sciences, Rice University}, 34387 year = {1987}, 34388 number = {87--7}, 34389 type = {Technical Report} 34390} 34391 34392@Article{ mosco:dual, 34393 author = {U. Mosco}, 34394 title = {Dual Variational Inequalities}, 34395 journal = {Journal of Mathematical Analysis and its Applications}, 34396 year = {1972}, 34397 volume = {40}, 34398 pages = {202--206} 34399} 34400 34401@Article{ motzkin.schoenberg:relaxation, 34402 author = {T. S. Motzkin and I. J. Schoenberg}, 34403 title = {The relaxation method for linear inequalities}, 34404 journal = {Canadian Journal of Mathematics}, 34405 year = {1954}, 34406 volume = {6}, 34407 pages = {393--404} 34408} 34409 34410@InProceedings{ muhlenbein:parallel, 34411 crossref = {schaeffer:third}, 34412 author = {H. M{\"{}u}hlenbein}, 34413 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 34414 pages = {416--421} 34415} 34416 34417@Article{ mukhopadhyay.roy.ea:polynomial, 34418 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 34419 title = {A polynomial time algorithm for generating neural networks for pattern 34420 classification: Its stability properties and some test results}, 34421 journal = {Neural Computation}, 34422 year = {1993}, 34423 volume = {5}, 34424 pages = {317--330} 34425} 34426 34427@Article{ mulvey.ruszczynski:diagonal, 34428 author = {J. M. Mulvey and A. Ruszczynski}, 34429 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 34430 journal = {Operations Research Letters}, 34431 year = {1992}, 34432 volume = {12}, 34433 pages = {205--215} 34434} 34435 34436@TechReport{ mulvey.ruszczynski:scenario, 34437 author = {J. M. Mulvey and A. Ruszczynski}, 34438 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 34439 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 34440 year = {1991}, 34441 address = {Princeton, New Jersey}, 34442 number = {SOR 91-19}, 34443 type = {Technical Report} 34444} 34445 34446@PhDThesis{ munson:algorithms, 34447 author = {T. S. Munson}, 34448 title = {Algorithms and Environments for Complementarity}, 34449 school = {University of Wisconsin--Madison}, 34450 year = {2000}, 34451 address = {Madison, Wisconsin}, 34452 month = aug, 34453 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 34454} 34455 34456@Article{ munson.facchinei.ea:semismooth, 34457 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 34458 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 34459 journal = {INFORMS Journal on Computing}, 34460 year = {2001}, 34461 volume = {forthcoming} 34462} 34463 34464@Article{ murchland:braess, 34465 author = {J. D. Murchland}, 34466 title = {Braess' Paradox of Traffic Flow}, 34467 journal = {Transportation Research}, 34468 year = {1970}, 34469 volume = {4}, 34470 pages = {391--394} 34471} 34472 34473@Unpublished{ murphy.aha:uci, 34474 author = {P. M. Murphy and D. W. Aha}, 34475 title = {{UCI} Repository of Machine Learning Databases}, 34476 year = {1992}, 34477 note = {Department of Information and Computer Science, University of California, Irvine, 34478 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 34479} 34480 34481@Book{ murphy.lawrence.ea:american, 34482 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 34483 title = {American Cancer Society Textbook of Clinical Oncology}, 34484 publisher = {The American Cancer Society, Inc.}, 34485 address = {Atlanta, Georgia}, 34486 year = {1995} 34487} 34488 34489@Article{ murphy.sherali.ea:mathematical, 34490 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 34491 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 34492 Equilibrium}, 34493 journal = {Mathematical Programming}, 34494 year = {1982}, 34495 volume = {24}, 34496 pages = {92--106} 34497} 34498 34499@TechReport{ murtagh.saunders:minos, 34500 author = {B. A. Murtagh and M. A. Saunders}, 34501 title = {{MINOS} 5.0 User's Guide}, 34502 institution = {Stanford University}, 34503 address = {Stanford, California}, 34504 year = {1983}, 34505 number = {{SOL} 83.20}, 34506 type = {Technical Report} 34507} 34508 34509@InProceedings{ murthy.kasif.ea:oc1, 34510 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 34511 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 34512 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 34513 year = {1993}, 34514 publisher = {The AAAI Press/The MIT Press}, 34515 address = {Cambridge, MA 02142}, 34516 pages = {322--327} 34517} 34518 34519@Book{ murty:linear, 34520 author = {K. G. Murty}, 34521 title = {Linear Complementarity, Linear and Nonlinear Programming}, 34522 year = {1988}, 34523 publisher = {Helderman-Verlag}, 34524 address = {Berlin} 34525} 34526 34527@Book{ murty:linear*1, 34528 author = {K. G. Murty}, 34529 title = {Linear Programming}, 34530 year = {1983}, 34531 publisher = {John Wiley \& Sons}, 34532 address = {New York} 34533} 34534 34535@Article{ murty:number, 34536 author = {K. G. Murty}, 34537 title = {On the number of solutions of the complementarity problem and spanning properties 34538 of cones}, 34539 journal = {Linear Algebra and Its Applications}, 34540 year = {1972}, 34541 volume = {5}, 34542 pages = {65--108} 34543} 34544 34545@Book{ murty:linear*2, 34546 author = {K. G. Murty}, 34547 title = {Linear and Combinatorial Programming}, 34548 year = {1976}, 34549 publisher = {John Wiley \& Sons}, 34550 address = {New York} 34551} 34552 34553@Book{ nagurney:network, 34554 author = {A. Nagurney}, 34555 title = {Network Economics -- {A} Variational Inequality Approach}, 34556 publisher = {Kluwer Academic Publishers}, 34557 year = {1993}, 34558 address = {Dordrecht, The Netherlands} 34559} 34560 34561@Article{ nash.nocedal:numerical, 34562 author = {S. G. Nash and J. Nocedal}, 34563 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 34564 Method for Large Scale Optimization}, 34565 journal = {SIAM Journal on Optimization}, 34566 year = {1991}, 34567 volume = {3}, 34568 pages = {358--372} 34569} 34570 34571@Article{ nash:equilibrium, 34572 author = {J. F. Nash}, 34573 title = {Equilibrium Points in {N}--Person Games}, 34574 journal = {Proceedings of the National Academy of Sciences}, 34575 year = {1950}, 34576 volume = {36}, 34577 pages = {48--49} 34578} 34579 34580@Article{ nash:non-cooperative, 34581 author = {J. F. Nash}, 34582 title = {Non-cooperative games}, 34583 journal = {Annals of Mathematics}, 34584 year = {1951}, 34585 volume = {54}, 34586 pages = {286--295} 34587} 34588 34589@Article{ nash:newton-type, 34590 author = {S. G. Nash}, 34591 title = {{N}ewton--Type Minimization via {L}anczos Method}, 34592 journal = {SIAM Journal on Numerical Analysis}, 34593 year = {1984}, 34594 volume = {21}, 34595 pages = {770--788} 34596} 34597 34598@Article{ nauss:efficient, 34599 author = {R. M. Nauss}, 34600 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 34601 journal = {Management Science}, 34602 year = {1976}, 34603 volume = {23}, 34604 pages = {27--31} 34605} 34606 34607@Book{ nazareth:computer, 34608 author = {J. L. Nazareth}, 34609 title = {Computer Solution of Linear Programs}, 34610 year = {1987}, 34611 publisher = {Oxford University Press}, 34612 address = {Oxford} 34613} 34614 34615@Article{ nelder.mead:simplex, 34616 title = {A Simplex Method for Function Minimization}, 34617 author = {J. A. Nelder and R. Mead}, 34618 journal = {Computer Journal}, 34619 volume = {7}, 34620 pages = {308--313}, 34621 year = {1965} 34622} 34623 34624@Article{ nemhauser.savelsbergh.ea:minto, 34625 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 34626 title = {{MINTO}, {A} Mixed Integer Optimizer}, 34627 journal = {Operations Research Letters}, 34628 year = {1994}, 34629 optkey = {}, 34630 optvolume = {15}, 34631 optnumber = {}, 34632 optpages = {47--58}, 34633 optmonth = {}, 34634 optnote = {}, 34635 optannote = {} 34636} 34637 34638@Book{ nemhauser.wolsey:integer, 34639 author = {G. L. Nemhauser and L. A. Wolsey}, 34640 title = {Integer and Combinatorial Optimization}, 34641 publisher = {John Wiley \& Sons}, 34642 year = {1988}, 34643 address = {New York, NY} 34644} 34645 34646@Article{ nestor.pasurka:alternative, 34647 author = {D. Vaughn Nestor and C. Pasurka}, 34648 title = {Alternative Specifications for Environmental Control Costs in a General 34649 Equilibrium Framework}, 34650 journal = {Economics Letters}, 34651 year = {1995}, 34652 volume = {48}, 34653 pages = {273--280} 34654} 34655 34656@Article{ nestor.pasurka:cge, 34657 author = {D. Vaughn Nestor and C. Pasurka}, 34658 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 34659 of Environmental Policy}, 34660 journal = {Economic Modelling}, 34661 year = {1995}, 34662 volume = {12}, 34663 pages = {53--59} 34664} 34665 34666@Article{ newman.shapiro:theorems, 34667 author = {D. J. Newman and H. S. Shapiro}, 34668 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 34669 journal = {Duke Mathematical Journal}, 34670 year = {1963}, 34671 volume = {30}, 34672 pages = {673--682} 34673} 34674 34675@Article{ ng.peyton:block, 34676 author = {E. Ng and B. Peyton}, 34677 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 34678 journal = {SIAM Journal on Scientific and Statistical Computing}, 34679 year = {1993}, 34680 volume = {14}, 34681 pages = {1034--1056} 34682} 34683 34684@TechReport{ nielsen.zenios:solving, 34685 author = {S. S. Nielsen and S. A. Zenios}, 34686 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 34687 Algorithms}, 34688 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 34689 year = {1992}, 34690 address = {Philadelphia}, 34691 number = {92-01-05} 34692} 34693 34694@Article{ niemierko:optimization, 34695 author = {A. Niemierko}, 34696 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 34697 Points and Constraints}, 34698 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34699 year = {1992}, 34700 volume = {23}, 34701 pages = {99--108} 34702} 34703 34704@InCollection{ niemierko:treatment, 34705 author = {A. Niemierko}, 34706 title = {Treatment Plan Optimization}, 34707 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 34708 editor = {J. A. Purdy and B. Emami}, 34709 publisher = {Medical Physics Publishing}, 34710 year = {1993}, 34711 pages = {49--55}, 34712 address = {St. Louis, Missouri} 34713} 34714 34715@Article{ niemireko:optimization, 34716 author = {A. Niemierko}, 34717 title = {Optimization of intensity modulated beams: Local or global optimum?}, 34718 journal = {Medical Physics}, 34719 year = {1996}, 34720 optvolume = {23}, 34721 optpages = {1072} 34722} 34723 34724@Manual{ nih:radiation, 34725 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 34726 author = {N. C. I. National Institutes of Health}, 34727 organization = {NIH Publication}, 34728 address = {Bethesda, Maryland}, 34729 edition = {97-2227}, 34730 year = {1997} 34731} 34732 34733@Book{ nilsson:learning, 34734 author = {N. J. Nilsson}, 34735 title = {Learning Machines}, 34736 year = {1966}, 34737 publisher = {MIT Press}, 34738 address = {Cambridge, Massachusetts} 34739} 34740 34741@Article{ nocedal:theory, 34742 author = {J. Nocedal}, 34743 title = {Theory of Algorithms for Unconstrained Optimization}, 34744 journal = {Acta Numerica}, 34745 year = {1992}, 34746 pages = {199--242} 34747} 34748 34749@InProceedings{ noyes:neural, 34750 author = {J. L. Noyes}, 34751 title = {Neural Network Optimization Methods}, 34752 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 34753 Processing}, 34754 year = {1991}, 34755 publisher = {Indiana-Purdue University}, 34756 address = {Fort Wayne, Indiana}, 34757 pages = {1--12} 34758} 34759 34760@Article{ nygard.juell.ea:neural, 34761 author = {K. E. Nygard and P. Juell and N. Kadaba}, 34762 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 34763 journal = {ORSA Journal on Computing}, 34764 year = {1990}, 34765 volume = {4}, 34766 pages = {353--364} 34767} 34768 34769@Article{ oh.goenka:elastohydrodynamic, 34770 author = {K. P. Oh and P. K. Goenka}, 34771 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 34772 journal = {Transactions of the {ASME}, Journal of Tribology}, 34773 volume = {107}, 34774 year = {1985}, 34775 pages = {389--395} 34776} 34777 34778@Article{ oh.li.ea:elastohydrodynamic, 34779 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 34780 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 34781 journal = {Transactions of the {ASME}, Journal of Tribology}, 34782 volume = {109}, 34783 pages = {356--362}, 34784 year = {1987} 34785} 34786 34787@Article{ oh:analysis, 34788 author = {K. P. Oh}, 34789 title = {Analysis of a Needle Bearing}, 34790 journal = {Transactions of the {ASME}, Journal of Tribology}, 34791 volume = {106}, 34792 pages = {78--87}, 34793 year = {1984} 34794} 34795 34796@Article{ oh:formulation, 34797 author = {K. P. Oh}, 34798 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 34799 Complementarity Problem}, 34800 journal = {Transactions of the {ASME}, Journal of Tribology}, 34801 volume = {108}, 34802 year = {1986}, 34803 pages = {598--604} 34804} 34805 34806@Article{ oh:numerical, 34807 author = {K. P. Oh}, 34808 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 34809 Nonlinear Complementarity Problem}, 34810 journal = {Transactions of the {ASME}, Journal of Tribology}, 34811 volume = {106}, 34812 year = {1984}, 34813 pages = {88--95} 34814} 34815 34816@Article{ olivera.shepard.ea:maximum, 34817 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 34818 and E. E. Fitchard and T. R. Mackie}, 34819 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 34820 journal = {Physics in Medicine and Biology}, 34821 year = {1998}, 34822 pages = {3277--3294} 34823} 34824 34825@Article{ opial:weak, 34826 author = {Z. Opial}, 34827 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 34828 Mappings}, 34829 journal = {Bulletin of the American Mathematical Society}, 34830 year = {1967}, 34831 volume = {73}, 34832 pages = {591--597} 34833} 34834 34835@Book{ orchard-hays:advanced, 34836 author = {W. Orchard--Hays}, 34837 title = {Advanced Linear Programming Computing Techniques}, 34838 year = {1968}, 34839 publisher = {McGraw--Hill}, 34840 address = {New York} 34841} 34842 34843@Article{ orourke.taylor.ea:factor, 34844 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 34845 title = {Factor price convergence in the late nineteenth century}, 34846 journal = {International Economic Review}, 34847 year = {1996} 34848} 34849 34850@Article{ orourke.williamson:open, 34851 author = {K. O'Rourke and J. G. Williamson}, 34852 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 34853 accounting}, 34854 journal = {Scandinavian Economic and Social History}, 34855 year = {1995}, 34856 volume = {XLIII}, 34857 pages = {171--203} 34858} 34859 34860@Article{ orourke:costs, 34861 author = {K. O'Rourke}, 34862 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 34863 journal = {Research in Economic History}, 34864 year = {1995}, 34865 volume = {15}, 34866 pages = {215--259} 34867} 34868 34869@Article{ orourke:industrial, 34870 author = {K. O'Rourke}, 34871 title = {Industrial policy, employment policy and the non-traded sector}, 34872 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 34873 year = {1996} 34874} 34875 34876@Article{ orourke:measuring, 34877 author = {K. O'Rourke}, 34878 title = {Measuring protection: a cautionary tale}, 34879 journal = {Journal of Development Economics}, 34880 year = {1996} 34881} 34882 34883@Book{ ortega.rheinboldt:iterative, 34884 author = {J. M. Ortega and W. C. Rheinboldt}, 34885 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 34886 year = {1970}, 34887 publisher = {Academic Press}, 34888 address = {San Diego, California} 34889} 34890 34891@Book{ ortega:introduction, 34892 author = {J. M. Ortega}, 34893 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 34894 year = {1988}, 34895 publisher = {Plenum Press}, 34896 address = {New York} 34897} 34898 34899@Book{ ortega:numerical, 34900 author = {J. M. Ortega}, 34901 title = {Numerical Analysis, {A} Second Course}, 34902 year = {1972}, 34903 publisher = {Academic Press} 34904} 34905 34906@Article{ osborne.womersley:strong, 34907 author = {M. R. Osborne and R. S. Womersley}, 34908 title = {Strong uniqueness in sequential linear programming}, 34909 journal = {Journal of the Australian Mathematical Society, Series B}, 34910 year = {1990}, 34911 volume = {31}, 34912 pages = {379--384} 34913} 34914 34915@InCollection{ osborne:strong, 34916 author = {M. R. Osborne}, 34917 title = {Strong uniqueness in nonlinear approximation}, 34918 booktitle = {The numerical solution of nonlinear problems}, 34919 year = {1981}, 34920 editor = {C. T. H. Baker and C. Phillips}, 34921 publisher = {Clarendon Press}, 34922 address = {Oxford} 34923} 34924 34925@Book{ outrata.kocvara.ea:nonsmooth, 34926 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 34927 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 34928 publisher = {Kluwer Academic Publishers}, 34929 year = {1998}, 34930 address = {Dordrecht, The Netherlands} 34931} 34932 34933@Article{ outrata.zowe:numerical, 34934 author = {J. V. Outrata and J. Zowe}, 34935 title = {A Numerical Approach to Optimization Problems with Variational Inequality 34936 Constraints}, 34937 journal = {Mathematical Programming}, 34938 year = {1995}, 34939 volume = {68}, 34940 pages = {105--130} 34941} 34942 34943@Article{ outrata:necessary, 34944 author = {J. V. Outrata}, 34945 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 34946 journal = {Journal of Optimization Theory and Applications}, 34947 volume = {76}, 34948 year = {1993}, 34949 pages = {305--320} 34950} 34951 34952@Article{ outrata:numerical, 34953 author = {J. V. Outrata}, 34954 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 34955 journal = {Zeitschrift f{\"{u}}r Operations Research}, 34956 volume = {4}, 34957 year = {1990}, 34958 pages = {255--278} 34959} 34960 34961@Article{ outrata:optimization, 34962 author = {J. V. Outrata}, 34963 title = {On Optimization Problems with Variational Inequality Constraints}, 34964 journal = {SIAM Journal on Optimization}, 34965 volume = {4}, 34966 year = {1994}, 34967 pages = {340--357} 34968} 34969 34970@Article{ paige.saunders:lsqr, 34971 author = {C. C. Paige and M. A. Saunders}, 34972 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 34973 journal = {{ACM} Transactions on Mathematical Software}, 34974 year = {1982}, 34975 volume = {8}, 34976 pages = {43--71} 34977} 34978 34979@Article{ paige.saunders:solution, 34980 author = {C. C. Paige and M. A. Saunders}, 34981 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 34982 journal = {SIAM Journal on Numerical Analysis}, 34983 year = {1975}, 34984 volume = {12}, 34985 pages = {617--629} 34986} 34987 34988@Article{ palacios-gomez.lasdon.ea:nonlinear, 34989 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 34990 title = {Nonlinear Optimization by Successive Linear Programming}, 34991 journal = {Management Science}, 34992 year = {1982}, 34993 volume = {28}, 34994 pages = {1106--1120} 34995} 34996 34997@Article{ palomares.mangasarian:superlinearly, 34998 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 34999 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 35000 Optimization Problems}, 35001 journal = {Mathematical Programming}, 35002 year = {1976}, 35003 volume = {11}, 35004 pages = {1--13} 35005} 35006 35007@Article{ panagiotopoulos.al-fahed:robot, 35008 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 35009 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 35010 journal = {The International Journal of Robotics Research}, 35011 year = {1994}, 35012 volume = {13}, 35013 pages = {127--136} 35014} 35015 35016@Book{ panagiotopoulos:hemivariational, 35017 author = {P. D. Panagiotopoulos}, 35018 title = {Hemivariational Inequalities}, 35019 publisher = {Springer-Verlag}, 35020 address = {Berlin}, 35021 year = {1993} 35022} 35023 35024@Book{ panagiotopoulos:inequality, 35025 author = {P. D. Panagiotopoulos}, 35026 title = {Inequality Problems in Mechanics and Applications}, 35027 publisher = {Birkh{\"{a}}user}, 35028 address = {Boston}, 35029 year = {1985} 35030} 35031 35032@Article{ pang.chan:iterative, 35033 author = {J. S. Pang and D. Chan}, 35034 title = {Iterative Methods for Variational and Complementarity Problems}, 35035 journal = {Mathematical Programming}, 35036 year = {1982}, 35037 volume = {24}, 35038 pages = {284--313} 35039} 35040 35041@Article{ pang.gabriel:nesqp, 35042 author = {J. S. Pang and S. A. Gabriel}, 35043 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 35044 journal = {Mathematical Programming}, 35045 year = {1993}, 35046 volume = {60}, 35047 pages = {295--338} 35048} 35049 35050@Article{ pang.han.ea:minimization, 35051 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 35052 title = {Minimization of Locally {L}ipschitzian Functions}, 35053 journal = {SIAM Journal on Optimization}, 35054 year = {1991}, 35055 volume = {1}, 35056 pages = {57--82} 35057} 35058 35059@Article{ pang.qi:nonsmooth, 35060 author = {J. S. Pang and L. Qi}, 35061 title = {Nonsmooth Equations: Motivation and Algorithms}, 35062 journal = {SIAM Journal on Optimization}, 35063 year = {1993}, 35064 volume = {3}, 35065 pages = {443--465} 35066} 35067 35068@Article{ pang.trinkle.ea:complementarity, 35069 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 35070 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 35071 journal = {Computational Optimization and Applications}, 35072 volume = {5}, 35073 pages = {97--138}, 35074 year = {1996} 35075} 35076 35077@Article{ pang.trinkle:complementarity, 35078 author = {J. S. Pang and J. C. Trinkle}, 35079 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 35080 Contact Problems with {C}oulomb Friction}, 35081 year = {1996}, 35082 journal = {Mathematical Programming}, 35083 volume = {73}, 35084 pages = {199--226} 35085} 35086 35087@TechReport{ pang.wang:embedding, 35088 author = {J. S. Pang and Z. P. Wang}, 35089 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 35090 Problems}, 35091 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35092 year = {1990}, 35093 address = {Baltimore, Maryland} 35094} 35095 35096@TechReport{ pang.yang:parallel, 35097 author = {J. S. Pang and J. M. Yang}, 35098 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 35099 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35100 year = {1987}, 35101 address = {Baltimore, Maryland}, 35102 type = {Manuscript} 35103} 35104 35105@Article{ pang.yu:linearized, 35106 author = {J. S. Pang and C. S. Yu}, 35107 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 35108 Networks}, 35109 journal = {Networks}, 35110 volume = {14}, 35111 pages = {427--438}, 35112 year = {1984} 35113} 35114 35115@Article{ pang:b-differentiable, 35116 author = {J. S. Pang}, 35117 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 35118 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 35119 Inequality Problems}, 35120 journal = {Mathematical Programming}, 35121 year = {1991}, 35122 volume = {51}, 35123 pages = {101--132} 35124} 35125 35126@InCollection{ pang:complementarity, 35127 author = {J. S. Pang}, 35128 title = {Complementarity Problems}, 35129 booktitle = {Handbook in Global Optimization}, 35130 publisher = {Kluwer Academic Publishers}, 35131 year = {1994}, 35132 editor = {R. Horst and P. Pardalos}, 35133 address = {Boston} 35134} 35135 35136@Article{ pang:convergence, 35137 author = {J. S. Pang}, 35138 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 35139 Problem}, 35140 journal = {Journal of Optimization Theory and Applications}, 35141 year = {1982}, 35142 volume = {37}, 35143 pages = {149--162} 35144} 35145 35146@Article{ pang:convergence*1, 35147 author = {J. S. Pang}, 35148 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 35149 Application of some Sensitivity Results}, 35150 journal = {Mathematical Programming}, 35151 year = {1993}, 35152 volume = {58}, 35153 pages = {149--160} 35154} 35155 35156@Article{ pang:inexact, 35157 author = {J. S. Pang}, 35158 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 35159 journal = {Mathematical Programming}, 35160 year = {1986}, 35161 volume = {36}, 35162 pages = {54--71} 35163} 35164 35165@Article{ pang:more, 35166 author = {J. S. Pang}, 35167 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 35168 Complementarity Problem}, 35169 journal = {Journal of Optimization Theory and Applications}, 35170 year = {1986}, 35171 volume = {49}, 35172 pages = {107--134} 35173} 35174 35175@Article{ pang:more*1, 35176 author = {J. S. Pang}, 35177 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 35178 Complementarity Problems}, 35179 journal = {Journal of Optimization Theory and Applications}, 35180 year = {1986}, 35181 volume = {49}, 35182 pages = {107--134} 35183} 35184 35185@Article{ pang:necessary, 35186 author = {J. S. Pang}, 35187 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 35188 the Linear Complementarity Problem}, 35189 journal = {Journal of Optimization Theory and Applications}, 35190 year = {1984}, 35191 volume = {42}, 35192 pages = {1--17} 35193} 35194 35195@Article{ pang:newtons, 35196 author = {J. S. Pang}, 35197 title = {{N}ewton's Method for {B}--Differentiable Equations}, 35198 journal = {Mathematics of Operations Research}, 35199 year = {1990}, 35200 volume = {15}, 35201 pages = {311--341} 35202} 35203 35204@Article{ pang:posteriori, 35205 author = {J. S. Pang}, 35206 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 35207 Problem}, 35208 journal = {Mathematics of Operations Research}, 35209 year = {1987}, 35210 volume = {12}, 35211 pages = {474--484} 35212} 35213 35214@Article{ pantoja.mayne:sequential, 35215 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 35216 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 35217 with Control Inequality Constraints}, 35218 journal = {International Journal on Control}, 35219 year = {1991}, 35220 volume = {53}, 35221 pages = {823--836} 35222} 35223 35224@Book{ papadimitriou.steiglitz:combinatorial, 35225 author = {C. H. Papadimitriou and K. Steiglitz}, 35226 title = {Combinatorial Optimization: Algorithms and Complexity}, 35227 year = {1982}, 35228 publisher = {Prentice-Hall, Inc}, 35229 address = {Englewood Cliffs, New Jersey} 35230} 35231 35232@Article{ papanikolau.mackie.ea:investigation, 35233 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 35234 Reckwerdt}, 35235 title = {Investigation of the convolution method for polyenergetic spectra}, 35236 journal = {Medical Physics}, 35237 year = {1993}, 35238 volume = {20}, 35239 number = {5}, 35240 pages = {1327--1336} 35241} 35242 35243@Article{ parisot:resolution, 35244 author = {G. R. Parisot}, 35245 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 35246 Lin\'{e}aire par Application de la Programmation Logarithmique}, 35247 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 35248 year = {1961}, 35249 volume = {20}, 35250 pages = {227--259} 35251} 35252 35253@Article{ parker.cave.ea:comparison, 35254 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 35255 title = {Comparison of Simplex Algorithms}, 35256 journal = {Analytica Chimica Acta}, 35257 year = {1985}, 35258 volume = {175}, 35259 pages = {231--237} 35260} 35261 35262@InProceedings{ parker:optimal, 35263 author = {D. Parker}, 35264 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 35265 Second Order Hebbian Learning}, 35266 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 35267 II}, 35268 year = {1987}, 35269 address = {San Diego:IEEE}, 35270 pages = {593--600} 35271} 35272 35273@Book{ pascali.sburlan:nonlinear, 35274 author = {D. Pascali and S. Sburlan}, 35275 title = {Nonlinear Mappings of Monotone Type}, 35276 publisher = {Editura Academeie}, 35277 year = {1978} 35278} 35279 35280@Article{ passty:ergodic, 35281 author = {G. B. Passty}, 35282 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 35283 space}, 35284 journal = {Journal of Mathematical Analysis and Applications}, 35285 year = {1979}, 35286 volume = {72}, 35287 pages = {383--390} 35288} 35289 35290@Article{ peaceman.rachford:numerical, 35291 author = {D. W. Peaceman and H. H. Rachford}, 35292 title = {The numerical solution of parabolic and elliptic differential equations}, 35293 journal = {SIAM Journal}, 35294 year = {1955}, 35295 volume = {3}, 35296 pages = {28--41} 35297} 35298 35299@Book{ peck.tiesberg:global, 35300 author = {S. Peck and T. Tiesberg}, 35301 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 35302 {CETA}}, 35303 publisher = {The Electric Power Institute}, 35304 year = {1992}, 35305 address = {Paolo Alto CA} 35306} 35307 35308@TechReport{ peng:convexity, 35309 author = {J. -M. Peng}, 35310 title = {The Convexity of the Implicit {L}agrangian}, 35311 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35312 year = {1995}, 35313 type = {Technical Report}, 35314 address = {Beijing} 35315} 35316 35317@Article{ peng:equivalence, 35318 author = {J. -M. Peng}, 35319 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 35320 journal = {Mathematical Programming}, 35321 year = {1997}, 35322 volume = {78}, 35323 pages = {347--356} 35324} 35325 35326@Article{ pennisi:taking, 35327 author = {E. Pennisi}, 35328 title = {Taking a structured approach to understanding proteins}, 35329 journal = {Science}, 35330 year = {1998}, 35331 volume = {279}, 35332 pages = {978--979} 35333} 35334 35335@Article{ penot:regularity, 35336 author = {J. P. Penot}, 35337 title = {On regularity conditions in mathematical programming}, 35338 journal = {Mathematical Programming Study}, 35339 year = {1982}, 35340 volume = {17}, 35341 pages = {28--66} 35342} 35343 35344@Book{ perez:principles, 35345 author = {C. A. Perez and L. W. Brady}, 35346 title = {Principles and practice of radiotherapy}, 35347 publisher = {Lippincott-Raven}, 35348 year = {1998}, 35349 address = {Philadelphia}, 35350 edition = {3rd} 35351} 35352 35353@Article{ perroni.rutherford:international, 35354 author = {C. Perroni and T. Rutherford}, 35355 title = {International Trade in Carbon Emission Rights and Basic Materials: General 35356 Equilibrium Calculations for 2020}, 35357 journal = {Scandinavian Journal of Economics}, 35358 year = {1993} 35359} 35360 35361@Article{ perroni.rutherford:regular, 35362 author = {C. Perroni and T. Rutherford}, 35363 title = {Regular Flexibility of Nested {CES} Functions}, 35364 journal = {European Economic Review}, 35365 year = {1995}, 35366 volume = {39}, 35367 pages = {335--343} 35368} 35369 35370@InCollection{ perroni.wigle:environmental, 35371 author = {C. Perroni and R. M. Wigle}, 35372 title = {Environmental Policy Modeling}, 35373 booktitle = {Global Trade Analysis: Modeling and Applications}, 35374 publisher = {Cambridge University Press}, 35375 year = {1996}, 35376 editor = {T. Hertel} 35377} 35378 35379@Article{ peterson:review, 35380 author = {D. W. Peterson}, 35381 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 35382 journal = {SIAM Review}, 35383 year = {1973}, 35384 volume = {15}, 35385 pages = {639--654} 35386} 35387 35388@PhDThesis{ petersson:optimization, 35389 author = {J. Petersson}, 35390 title = {Optimization of Structures in Unilateral Contact}, 35391 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 35392 number = {397}, 35393 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 35394 University}, 35395 address = {Link{\"o}ping, Sweden}, 35396 year = {1995} 35397} 35398 35399@Book{ petri:modelling, 35400 author = {P. Petri}, 35401 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 35402 publisher = {Harvard University Press}, 35403 year = {1984} 35404} 35405 35406@InProceedings{ petrzykowski:application, 35407 author = {T. Petrzykowski}, 35408 title = {Application of the Steepest Ascent Method to Concave Programming}, 35409 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 35410 year = {1962}, 35411 publisher = {North--Holland}, 35412 address = {Amsterdam}, 35413 pages = {185--189} 35414} 35415 35416@InProceedings{ pettey.leuze.ea:parallel, 35417 crossref = {grefenstette:genetic}, 35418 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 35419 title = {A Parallel Genetic Algorithm}, 35420 pages = {155--161} 35421} 35422 35423@InProceedings{ pettey.leuze:theoretical, 35424 crossref = {schaeffer:third}, 35425 author = {C. C. Pettey and M. R. Leuze}, 35426 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 35427 pages = {398--405} 35428} 35429 35430@Book{ pfeiffer.glocker:multibody, 35431 author = {F. Pfeiffer and C. Glocker}, 35432 title = {Multibody Dynamics with Unilateral Contact}, 35433 year = {1996}, 35434 publisher = {John Wiley \& Sons} 35435} 35436 35437@TechReport{ pierro.iusem:convergence, 35438 author = {A. R. de Pierro and A. N. Iusem}, 35439 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 35440 Linear Complementarity Problems}, 35441 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 35442 year = {1990}, 35443 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 35444} 35445 35446@InCollection{ pillo.grippo.ea:class, 35447 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 35448 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 35449 booktitle = {System Modelling and Optimization}, 35450 year = {1981}, 35451 editor = {R. F. Drenick and F. Kozin}, 35452 publisher = {Springer-Verlag}, 35453 address = {Berlin} 35454} 35455 35456@Article{ pillo.grippo:augmented, 35457 author = {G. Di Pillo and L. Grippo}, 35458 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 35459 Problems}, 35460 journal = {Journal of Optimization Theory and Applications}, 35461 year = {1982}, 35462 volume = {36}, 35463 pages = {495--519} 35464} 35465 35466@Article{ pillo.grippo:class, 35467 author = {G. Di Pillo and L. Grippo}, 35468 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 35469 journal = {SIAM Journal on Control and Optimization}, 35470 year = {1979}, 35471 volume = {17}, 35472 pages = {618--628} 35473} 35474 35475@Article{ pillo.grippo:continuously, 35476 author = {G. Di Pillo and L. Grippo}, 35477 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 35478 Problems with Inequality Constraints}, 35479 journal = {SIAM Journal on Control and Optimization}, 35480 year = {1985}, 35481 volume = {23}, 35482 pages = {72--84} 35483} 35484 35485@Article{ pillo.grippo:exact, 35486 author = {G. Di Pillo and L. Grippo}, 35487 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 35488 Programming Problems}, 35489 journal = {Mathematical Programming}, 35490 year = {1986}, 35491 volume = {36}, 35492 pages = {1--18} 35493} 35494 35495@InProceedings{ plambeck.fu.ea:throughput, 35496 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35497 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 35498 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 35499 editor = {J. Schoen}, 35500 year = {1993}, 35501 publisher = {Society for Computer Simulation}, 35502 address = {San Diego, CA}, 35503 pages = {70--75} 35504} 35505 35506@Article{ plambeck.fu.ea:sample-path, 35507 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35508 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 35509 journal = {Mathematical Programming}, 35510 year = {1996}, 35511 volume = {75}, 35512 pages = {137--176} 35513} 35514 35515@InProceedings{ platt:sequential, 35516 author = {J. Platt}, 35517 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 35518 Machines}, 35519 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 35520 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 35521 publisher = {MIT Press}, 35522 pages = {185-208}, 35523 year = {1999} 35524} 35525 35526@Book{ poincare:sur, 35527 author = {H. Poincar\'{e}}, 35528 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 35529 year = {1881}, 35530 publisher = {Oeuvres I}, 35531 address = {Gauthier--Villars, Paris} 35532} 35533 35534@Article{ polak.ribiere:note, 35535 author = {E. Polak and G. Ribi\`{e}re}, 35536 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 35537 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 35538 year = {1969}, 35539 volume = {16-R1}, 35540 pages = {35--43} 35541} 35542 35543@Book{ polak:computational, 35544 author = {E. Polak}, 35545 title = {Computational Methods in Optimization; {A} Unified Approach}, 35546 year = {1971}, 35547 publisher = {Academic Press}, 35548 address = {New York} 35549} 35550 35551@Article{ polak:global, 35552 author = {E. Polak}, 35553 title = {On the Global Stabilization of Locally Convergent Algorithms}, 35554 journal = {Automatica}, 35555 year = {1976}, 35556 volume = {12}, 35557 pages = {337--349} 35558} 35559 35560@Article{ polyak.tretiyakov:concerning, 35561 author = {B. T. Polyak and N. V. Tretiyakov}, 35562 title = {Concerning an Iterative Method for Linear Programming and its Economic 35563 Interpretation}, 35564 journal = {Economics and Mathematical Methods}, 35565 year = {1972}, 35566 volume = {8}, 35567 pages = {740--751}, 35568 note = {(Russian)} 35569} 35570 35571@Article{ polyak.tretiyakov:method, 35572 author = {B. T. Polyak and N. V. Tretiyakov}, 35573 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 35574 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 35575 year = {1973}, 35576 volume = {13}, 35577 pages = {42--58} 35578} 35579 35580@Article{ polyak:conjugate, 35581 author = {B. T. Polyak}, 35582 title = {The conjugate gradient method in extremal problems}, 35583 journal = {USSR Computational Mathematics and Mathematical Physics}, 35584 year = {1969}, 35585 volume = {9}, 35586 pages = {94--112}, 35587 note = {Translated from Russian} 35588} 35589 35590@Book{ polyak:introduction, 35591 author = {B. T. Polyak}, 35592 title = {Introduction to Optimization}, 35593 year = {1987}, 35594 publisher = {Optimization Software, Inc.}, 35595 address = {Publications Division, New York} 35596} 35597 35598@Unpublished{ polyak:methods, 35599 author = {R. A. Polyak}, 35600 title = {On the Methods of Centers}, 35601 year = {1988}, 35602 note = {Unpublished manuscript} 35603} 35604 35605@Unpublished{ polyak:sharp, 35606 author = {B. T. Polyak}, 35607 title = {Sharp Minima}, 35608 year = {1979}, 35609 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 35610 Applications, {IIASA}, Laxenburg, Austria} 35611} 35612 35613@InProceedings{ polyak:smooth, 35614 author = {R. A. Polyak}, 35615 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 35616 Problems with Constraints}, 35617 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 35618 Programming}, 35619 year = {1982}, 35620 address = {Bonn} 35621} 35622 35623@Article{ polychronopoulos.tsitsiklis:analysis, 35624 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 35625 title = {Stochastic Shortest Path Problems with Recourse}, 35626 journal = {Networks}, 35627 year = {1996}, 35628 volume = {27}, 35629 pages = {133--143} 35630} 35631 35632@TechReport{ potra.bonnans:infeasible, 35633 author = {F. A. Potra and J. F. Bonnans}, 35634 title = {Infeasible path following algorithms for linear complementarity problems}, 35635 institution = {INRIA}, 35636 year = {1994}, 35637 month = dec, 35638 number = {RR--2445}, 35639 type = {Research Report} 35640} 35641 35642@Article{ potra.sheng:large-step, 35643 author = {F. A. Potra and R. Sheng}, 35644 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 35645 year = {1997}, 35646 journal = {SIAM Journal on Optimization}, 35647 volume = {7}, 35648 pages = {318--335} 35649} 35650 35651@Article{ potra:infeasible, 35652 author = {F. A. Potra}, 35653 title = {An infeasible interior-point predictor-corrector algorithm for linear 35654 programming}, 35655 journal = {SIAM Journal on Optimization}, 35656 year = {1996}, 35657 volume = {6}, 35658 pages = {19--32} 35659} 35660 35661@TechReport{ potra:onl, 35662 author = {F. A. Potra}, 35663 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 35664 convergence.}, 35665 institution = {Department of Mathematics, The University of Iowa}, 35666 address = {Iowa City, Iowa}, 35667 year = {1994}, 35668 number = {50}, 35669 type = {Reports on Computational Mathematics} 35670} 35671 35672@TechReport{ potra:predictor-corrector, 35673 author = {F. A. Potra}, 35674 title = {On a predictor-corrector method for solving linear programs from infeasible 35675 starting points}, 35676 institution = {Department of Mathematics, University of Iowa}, 35677 address = {Iowa City, Iowa}, 35678 year = {1992}, 35679 number = {34}, 35680 type = {Reports on Computational Mathematics} 35681} 35682 35683@TechReport{ potra:quadratically, 35684 author = {F. A. Potra}, 35685 title = {A quadratically convergent infeasible interior-point algorithm for linear 35686 programming}, 35687 institution = {Department of Mathematics, University of Iowa}, 35688 year = {1992}, 35689 number = {28}, 35690 address = {Iowa City, Iowa}, 35691 month = jul 35692} 35693 35694@InCollection{ powell:convergence, 35695 author = {M. J. D. Powell}, 35696 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 35697 Optimization Calculations}, 35698 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35699 pages = {27--63} 35700} 35701 35702@InProceedings{ powell:direct, 35703 author = {M. J. D. Powell}, 35704 title = {A Direct Search Optimization Method that Models the Objective and Constraint 35705 Functions by Linear Interpolation}, 35706 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 35707 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 35708 volume = {275}, 35709 year = {1994}, 35710 publisher = {Kluwer Academic Publishers}, 35711 pages = {51--67}, 35712 address = {Dordrecht, The Netherlands} 35713} 35714 35715@Article{ powell:efficient, 35716 author = {M. J. D. Powell}, 35717 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 35718 without Calculating Derivatives}, 35719 journal = {Computer Journal}, 35720 year = {1964}, 35721 volume = {17}, 35722 pages = {155--162} 35723} 35724 35725@InCollection{ powell:general, 35726 author = {M. J. D. Powell}, 35727 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 35728 booktitle = {Approximation Theory IV}, 35729 year = {1983}, 35730 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 35731 publisher = {Academic Press}, 35732 address = {New York}, 35733 pages = {187--218} 35734} 35735 35736@InCollection{ powell:hybrid, 35737 author = {M. J. D. Powell}, 35738 title = {A hybrid method for nonlinear equations}, 35739 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 35740 publisher = {Gordon and Breach}, 35741 year = {1970}, 35742 editor = {P. Rabinowitz} 35743} 35744 35745@TechReport{ powell:karmarkars, 35746 author = {M. J. D. Powell}, 35747 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 35748 institution = {Department of Applied Mathematics and Theoretical Physics, University of 35749 Cambridge}, 35750 year = {1989}, 35751 month = nov, 35752 address = {Cambridge, CB3 9EW, England} 35753} 35754 35755@InCollection{ powell:method, 35756 author = {M. J. D. Powell}, 35757 title = {A Method for Nonlinear Constraints in Minimization Problems}, 35758 booktitle = {Optimization}, 35759 year = {1969}, 35760 editor = {R. Fletcher}, 35761 publisher = {Academic Press}, 35762 address = {London}, 35763 pages = {283--298} 35764} 35765 35766@Book{ prekopa:stochastic, 35767 author = {A. Pr{\'{e}}kopa}, 35768 title = {Stochastic Programming}, 35769 publisher = {Kluwer Academic Publishers}, 35770 year = {1995}, 35771 address = {Dordrecht, The Netherlands} 35772} 35773 35774@Book{ press.flannery.ea:numerical, 35775 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 35776 Vetterling}, 35777 title = {Numerical Recipes : the Art of Scientific Computing}, 35778 publisher = {Cambridge University Press}, 35779 year = {1988} 35780} 35781 35782@Article{ pruyne.livny:interfacing, 35783 author = {J. Pruyne and M. Livny}, 35784 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 35785 journal = {Journal on Future Generations of Computer Systems}, 35786 volume = {12}, 35787 year = {1996}, 35788 pages = {67--85} 35789} 35790 35791@InCollection{ pruyne.livny:parallel, 35792 author = {J. Pruyne and M. Livny}, 35793 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 35794 booktitle = {Job Scheduling Strategies for Parallel Processing}, 35795 publisher = {Springer-Verlag}, 35796 year = {1995}, 35797 editor = {D. G. Feitelson and L. Rudolph}, 35798 volume = {949}, 35799 series = {Lecture Notes in Computer Science} 35800} 35801 35802@PhDThesis{ pruyne:resource, 35803 author = {J. C. Pruyne}, 35804 title = {Resource Management Services for Parallel Applications}, 35805 school = {University of Wisconsin--Madison}, 35806 year = {1996}, 35807 address = {Madison, Wisconsin} 35808} 35809 35810@Book{ pshenichny.danilin:numerical, 35811 author = {B. N. Pshenichny and Yu. M. Danilin}, 35812 title = {Numerical Methods in Extremal Problems}, 35813 year = {1978}, 35814 publisher = {MIR Publishers}, 35815 address = {Moscow} 35816} 35817 35818@TechReport{ qi.chen:globally, 35819 author = {L. Qi and X. Chen}, 35820 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 35821 institution = {School of Mathematics, University of New South Wales}, 35822 year = {1993}, 35823 annote = {revised}, 35824 address = {Sydney} 35825} 35826 35827@Article{ qi.jiang:semismooth, 35828 author = {L. Qi and H. Jiang}, 35829 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 35830 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 35831 journal = {Mathematics of Operations Research}, 35832 volume = {22}, 35833 pages = {301--325}, 35834 year = {1997} 35835} 35836 35837@TechReport{ qi.peng:unconstrained, 35838 author = {H. -D. Qi and J. -M. Peng}, 35839 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 35840 Problems}, 35841 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35842 year = {1996}, 35843 type = {Technical Report}, 35844 address = {Beijing} 35845} 35846 35847@InCollection{ qi.sun:survey, 35848 author = {L. Qi and D. Sun}, 35849 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 35850 year = {1999}, 35851 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 35852 booktitle = {Progress in Optimization}, 35853 pages = {121--146}, 35854 series = {Applied Optimization}, 35855 volume = {30}, 35856 publisher = {Kluwer Academic Publishers}, 35857 address = {Dordrecht} 35858} 35859 35860@Article{ qi.sun:nonsmooth, 35861 author = {L. Qi and J. Sun}, 35862 title = {A Nonsmooth Version of {N}ewton's Method}, 35863 journal = {Mathematical Programming}, 35864 year = {1993}, 35865 volume = {58}, 35866 pages = {353--368} 35867} 35868 35869@Article{ qi:convergence, 35870 author = {L. Qi}, 35871 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 35872 journal = {Mathematics of Operations Research}, 35873 year = {1993}, 35874 volume = {18}, 35875 pages = {227--244} 35876} 35877 35878@TechReport{ qi:regular, 35879 author = {L. Qi}, 35880 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 35881 convergent generalized {N}ewton methods for complementarity and variational 35882 inequality problems}, 35883 institution = {School of Mathematics, University of New South Wales}, 35884 year = {1997}, 35885 type = {Applied Mathematics Report}, 35886 number = {AMR 97/14}, 35887 address = {Sydney, Australia} 35888} 35889 35890@Article{ radner:competitive, 35891 author = {R. Radner}, 35892 title = {Competitive Equilibrium under Uncertainty}, 35893 journal = {Econometrica}, 35894 year = {1968}, 35895 volume = {36}, 35896 pages = {31--58} 35897} 35898 35899@Article{ radstrom:embedding, 35900 author = {H. R{\aa}dstr{\"{o}}m}, 35901 title = {An embedding theorem for spaces of convex sets}, 35902 journal = {Proc. Amer. Math. Soc.}, 35903 year = {1952}, 35904 volume = {3}, 35905 pages = {165--169} 35906} 35907 35908@Article{ raghavachari:connections, 35909 author = {M. Raghavachari}, 35910 title = {On Connections between Zero--One Integer Programming and Concave Programming 35911 Under Linear Constraints}, 35912 journal = {Operations Research}, 35913 year = {1969}, 35914 volume = {17}, 35915 pages = {680--684} 35916} 35917 35918@Article{ rajan.burridge.ea:dynamics, 35919 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 35920 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 35921 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 35922 month = mar, 35923 year = {1987}, 35924 pages = {671--677} 35925} 35926 35927@Article{ ralph:branching, 35928 author = {D. Ralph}, 35929 title = {On Branching Numbers of Normal Manifolds}, 35930 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 35931 volume = {22}, 35932 pages = {1041--1050}, 35933 year = {1994} 35934} 35935 35936@Article{ ralph:global, 35937 author = {D. Ralph}, 35938 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 35939 Path Search}, 35940 journal = {Mathematics of Operations Research}, 35941 year = {1994}, 35942 volume = {19}, 35943 pages = {352--389} 35944} 35945 35946@InProceedings{ ralph:piecewise, 35947 author = {D. Ralph}, 35948 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 35949 with Linear Complementarity Constraints}, 35950 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 35951 Applications (CTAC95)}, 35952 year = {1996} 35953} 35954 35955@PhDThesis{ raman:integration, 35956 author = {R. Raman}, 35957 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 35958 for process systems.}, 35959 address = {Pittsburgh, Pennsylvania}, 35960 year = {1993}, 35961 school = {Department of Chemical Engineering, Carnegie Mellon University} 35962} 35963 35964@PhDThesis{ rangaraj:nonsmooth, 35965 author = {Narayan Rangaraj}, 35966 title = {Nonsmooth Optimization: Algorithms and Applications}, 35967 year = {1990}, 35968 address = {Baltimore, MD}, 35969 school = {Department of Mathematical Sciences, The Johns Hopkins University} 35970} 35971 35972@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 35973 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 35974 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 35975 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35976 Radiation Therapy, Salt Lake City}, 35977 year = {1997}, 35978 editor = {D. D. Leavitt and G. Starkshall}, 35979 publisher = {Medical Physics Publishing}, 35980 address = {St. Louis, Missouri}, 35981 pages = {420--422} 35982} 35983 35984@Article{ reid:sparsity-exploiting, 35985 author = {J. K. Reid}, 35986 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear 35987 Programming Bases}, 35988 journal = {Mathematical Programming}, 35989 year = {1982}, 35990 volume = {24}, 35991 pages = {55--69} 35992} 35993 35994@Book{ reingold.nievergelt.ea:combinatorial, 35995 author = {E. Reingold and J. Nievergelt and N. Deo}, 35996 title = {Combinatorial Algorithms: Theory and Practice}, 35997 publisher = {Prentice-Hall, Inc}, 35998 address = {Englewood Cliffs, New Jersey} 35999} 36000 36001@PhDThesis{ reinoza:degree, 36002 author = {J. A. Reinoza}, 36003 title = {A Degree for Generalized Equations}, 36004 year = {1979}, 36005 address = {Madison, Wisconsin}, 36006 school = {University of Wisconsin} 36007} 36008 36009@Article{ reinoza:solving, 36010 author = {A. Reinoza}, 36011 title = {Solving Generalized Equations via Homotopies}, 36012 journal = {Mathematical Programming}, 36013 year = {1985}, 36014 volume = {31}, 36015 pages = {307--320} 36016} 36017 36018@PhDThesis{ ren:computable, 36019 author = {J. Ren}, 36020 title = {Computable Error Bounds in Mathematical Programming}, 36021 school = {Computer Sciences Department, University of Wisconsin}, 36022 year = {1993}, 36023 address = {Madison, Wisconsin}, 36024 note = {Technical Report 1173} 36025} 36026 36027@Article{ renegar:polynomial-time, 36028 author = {J. Renegar}, 36029 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 36030 Programming}, 36031 journal = {Mathematical Programming}, 36032 year = {1988}, 36033 volume = {40}, 36034 pages = {59--94} 36035} 36036 36037@Article{ robbins.monro:stochastic, 36038 author = {H. Robbins and S. Monro}, 36039 title = {A Stochastic Approximation Method}, 36040 journal = {Annals of Mathematical Statistics}, 36041 year = {1951}, 36042 volume = {22}, 36043 pages = {400--407} 36044} 36045 36046@Article{ robinson:analysis, 36047 author = {S. M. Robinson}, 36048 title = {Analysis of Sample-Path Optimization}, 36049 journal = {Mathematics of Operations Research}, 36050 year = {1996}, 36051 volume = {21}, 36052 pages = {513--528} 36053} 36054 36055@InCollection{ robinson:bundle-based, 36056 author = {S. M. Robinson}, 36057 title = {Bundle-Based Decomposition: Conditions for Convergence}, 36058 booktitle = {Analyse Non Lin\'{e}aire}, 36059 year = {1989}, 36060 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 36061 publisher = {Gauthier-Villaars}, 36062 address = {Paris}, 36063 pages = {435--447} 36064} 36065 36066@InCollection{ robinson:bundle-based*1, 36067 author = {S. M. Robinson}, 36068 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 36069 booktitle = {System Modeling and Optimization}, 36070 year = {1986}, 36071 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 36072 publisher = {Springer-Verlag}, 36073 address = {Berlin}, 36074 pages = {751--756}, 36075 volume = {84}, 36076 series = {Lecture Notes in Control and Information Sciences} 36077} 36078 36079@Article{ robinson:continuity, 36080 author = {S. M. Robinson}, 36081 title = {Some Continuity Properties of Polyhedral Multifunctions}, 36082 journal = {Mathematical Programming Study}, 36083 year = {1981}, 36084 volume = {14}, 36085 pages = {206--214} 36086} 36087 36088@Article{ robinson:extension, 36089 author = {S. M. Robinson}, 36090 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 36091 journal = {Numerische Mathematik}, 36092 year = {1972}, 36093 volume = {19}, 36094 pages = {341--347} 36095} 36096 36097@InCollection{ robinson:generalized, 36098 crossref = {bachem.grotschel.ea:mathematical}, 36099 author = {S. M. Robinson}, 36100 title = {Generalized Equations}, 36101 pages = {346--367} 36102} 36103 36104@Article{ robinson:generalized*1, 36105 author = {S. M. Robinson}, 36106 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 36107 journal = {Mathematical Programming Study}, 36108 year = {1979}, 36109 volume = {10}, 36110 pages = {128--141} 36111} 36112 36113@InCollection{ robinson:homeomorphism, 36114 author = {S. M. Robinson}, 36115 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 36116 booktitle = {Optimization and Nonlinear Analysis}, 36117 year = {1992}, 36118 editor = {A. Ioffe and M. Marcus and S. Reich}, 36119 publisher = {Longman}, 36120 address = {Harlow, Essex, England}, 36121 pages = {240--248}, 36122 series = {Pitman Research Notes in Mathematics Series No. 244} 36123} 36124 36125@Article{ robinson:implicit-function, 36126 author = {S. M. Robinson}, 36127 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 36128 journal = {Mathematics of Operations Research}, 36129 year = {1991}, 36130 volume = {16}, 36131 pages = {292--309} 36132} 36133 36134@Article{ robinson:local*1, 36135 author = {S. M. Robinson}, 36136 title = {Local Epi--Continuity and Local Optimization}, 36137 journal = {Mathematical Programming}, 36138 year = {1987}, 36139 volume = {37}, 36140 pages = {208--222} 36141} 36142 36143@Article{ robinson:local*2, 36144 author = {S. M. Robinson}, 36145 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 36146 Nondegeneracy}, 36147 journal = {Mathematical Programming Study}, 36148 year = {1984}, 36149 volume = {22}, 36150 pages = {217--230} 36151} 36152 36153@Article{ robinson:local*3, 36154 author = {S. M. Robinson}, 36155 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 36156 Stability and Sensitivity}, 36157 journal = {Mathematical Programming Study}, 36158 year = {1987}, 36159 volume = {30}, 36160 pages = {45--66} 36161} 36162 36163@Article{ robinson:mathematical, 36164 author = {S. M. Robinson}, 36165 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 36166 journal = {Mathematical Programming}, 36167 year = {1990}, 36168 volume = {48}, 36169 pages = {221--229} 36170} 36171 36172@Article{ robinson:newtons, 36173 author = {S. M. Robinson}, 36174 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 36175 journal = {Set Valued Analysis}, 36176 year = {1994}, 36177 volume = {2}, 36178 pages = {291--305} 36179} 36180 36181@Article{ robinson:nonsingularity, 36182 author = {S. M. Robinson}, 36183 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 36184 journal = {Mathematical Programming}, 36185 year = {1993}, 36186 volume = {62}, 36187 pages = {415--425} 36188} 36189 36190@InCollection{ robinson:nonsmooth, 36191 author = {S. M. Robinson}, 36192 title = {Nonsmooth Continuation for Generalized Equations}, 36193 year = {1997}, 36194 pages = {282--291}, 36195 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 36196 booktitle = {Recent Advances in Optimization}, 36197 series = {Lecture Notes in Economics and Mathematical Systems}, 36198 volume = {452}, 36199 publisher = {Springer-Verlag}, 36200 address = {Heidelberg} 36201} 36202 36203@Article{ robinson:normal, 36204 author = {S. M. Robinson}, 36205 title = {Normal Maps Induced by Linear Transformations}, 36206 journal = {Mathematics of Operations Research}, 36207 year = {1992}, 36208 volume = {17}, 36209 pages = {691--714} 36210} 36211 36212@Article{ robinson:normed, 36213 author = {S. M. Robinson}, 36214 title = {Normed Convex Processes}, 36215 journal = {Transactions of the American Mathematical Society}, 36216 year = {1972}, 36217 volume = {174}, 36218 pages = {127--140} 36219} 36220 36221@Article{ robinson:reduction, 36222 author = {S. M. Robinson}, 36223 title = {A reduction method for variational inequalities}, 36224 journal = {Mathematical Programming}, 36225 year = {1998}, 36226 volume = {80}, 36227 pages = {161--169} 36228} 36229 36230@Article{ robinson:regularity, 36231 author = {S. M. Robinson}, 36232 title = {Regularity and stability for convex multivalued functions}, 36233 journal = {Mathematics of Operations Research}, 36234 year = {1976}, 36235 volume = {1}, 36236 pages = {130--143} 36237} 36238 36239@Unpublished{ robinson:shadow, 36240 author = {S. M. Robinson}, 36241 title = {Shadow {JUNK} for biblio file}, 36242 year = {1800} 36243} 36244 36245@Article{ robinson:shadow*1, 36246 author = {S. M. Robinson}, 36247 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 36248 journal = {Operations Research}, 36249 year = {1993}, 36250 volume = {41}, 36251 pages = {518--535} 36252} 36253 36254@Article{ robinson:shadow*2, 36255 author = {S. M. Robinson}, 36256 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 36257 journal = {Operations Research}, 36258 year = {1993}, 36259 volume = {41}, 36260 pages = {536--548} 36261} 36262 36263@Unpublished{ robinson:stability, 36264 author = {S. M. Robinson}, 36265 title = {Stability {JUNK} for biblio file}, 36266 year = {1800} 36267} 36268 36269@Article{ robinson:stability*1, 36270 author = {S. M. Robinson}, 36271 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 36272 journal = {SIAM Journal on Numerical Analysis}, 36273 year = {1975}, 36274 volume = {12}, 36275 pages = {754--769} 36276} 36277 36278@Article{ robinson:stability*2, 36279 author = {S. M. Robinson}, 36280 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 36281 Nonlinear Systems}, 36282 journal = {SIAM Journal on Numerical Analysis}, 36283 year = {1976}, 36284 volume = {13}, 36285 pages = {497--513} 36286} 36287 36288@Article{ robinson:strongly, 36289 author = {S. M. Robinson}, 36290 title = {Strongly Regular Generalized Equations}, 36291 journal = {Mathematics of Operations Research}, 36292 year = {1980}, 36293 volume = {5}, 36294 pages = {43--62} 36295} 36296 36297@Article{ rockafellar.wets:generalized, 36298 author = {R. T. Rockafellar and R. J.--B. Wets}, 36299 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 36300 Control in Discrete Time}, 36301 journal = {SIAM Journal on Control and Optimization}, 36302 year = {1990}, 36303 volume = {28}, 36304 pages = {810--822} 36305} 36306 36307@Article{ rockafellar.wets:lagrangian, 36308 author = {R. T. Rockafellar and R. J.--B. Wets}, 36309 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 36310 in Stochastic Programming}, 36311 journal = {Mathematical Programming Study}, 36312 year = {1986}, 36313 volume = {28}, 36314 pages = {63--93} 36315} 36316 36317@InCollection{ rockafellar.wets:linear-quadratic, 36318 author = {R. T. Rockafellar and R. J.--B. Wets}, 36319 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 36320 Generation Algorithm}, 36321 booktitle = {Stochastic Optimization}, 36322 publisher = {Springer-Verlag}, 36323 year = {1987}, 36324 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 36325 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 36326 pages = {545--560}, 36327 address = {New York, Berlin} 36328} 36329 36330@Article{ rockafellar.wets:scenarios, 36331 author = {R. T. Rockafellar and R. J.--B. Wets}, 36332 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 36333 journal = {Mathematics of Operations Research}, 36334 year = {1991}, 36335 volume = {10}, 36336 pages = {119--147} 36337} 36338 36339@InProceedings{ rockafellar:applications, 36340 author = {R. T. Rockafellar}, 36341 title = {New Applications of Duality in Convex Programming}, 36342 booktitle = {Proceedings of the Fourth Conference on Probability}, 36343 year = {1971}, 36344 address = {Brasov, Romania} 36345} 36346 36347@Article{ rockafellar:augmented, 36348 author = {R. T. Rockafellar}, 36349 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 36350 journal = {SIAM Journal on Control and Optimization}, 36351 year = {1974}, 36352 volume = {12}, 36353 pages = {268--285} 36354} 36355 36356@Article{ rockafellar:augmented*1, 36357 author = {R. T. Rockafellar}, 36358 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 36359 Convex Programming}, 36360 journal = {Mathematics of Operations Research}, 36361 year = {1976}, 36362 volume = {1}, 36363 pages = {97--116} 36364} 36365 36366@Article{ rockafellar:characterization, 36367 author = {R. T. Rockafellar}, 36368 title = {Characterization of the subdifferentials of convex functions}, 36369 journal = {Pacific Journal of Mathematics}, 36370 year = {1966}, 36371 volume = {17}, 36372 number = {3}, 36373 pages = {497--510} 36374} 36375 36376@Article{ rockafellar:computational, 36377 author = {R. T. Rockafellar}, 36378 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 36379 Programming}, 36380 journal = {Mathematical Programming}, 36381 year = {1990}, 36382 volume = {48}, 36383 pages = {447--474} 36384} 36385 36386@Book{ rockafellar:conjugate, 36387 author = {R. T. Rockafellar}, 36388 title = {Conjugate Duality and Optimization}, 36389 year = {1974}, 36390 publisher = {SIAM}, 36391 address = {Philadelphia, Pennsylvania}, 36392 volume = {16}, 36393 series = {Conference Board of the Mathematical Sciences} 36394} 36395 36396@Book{ rockafellar:convex, 36397 author = {R. T. Rockafellar}, 36398 title = {Convex Analysis}, 36399 year = {1970}, 36400 publisher = {Princeton University Press}, 36401 address = {Princeton, New Jersey} 36402} 36403 36404@Article{ rockafellar:first-, 36405 author = {R. T. Rockafellar}, 36406 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 36407 journal = {Transactions of the American Mathematical Society}, 36408 year = {1988}, 36409 volume = {307}, 36410 pages = {75--108} 36411} 36412 36413@InProceedings{ rockafellar:generalized, 36414 author = {R. T. Rockafellar}, 36415 title = {A Generalized Approach to Linear-Quadratic Programming}, 36416 booktitle = {Proceedings of the International Conference on Numerical Optimization and 36417 Applications}, 36418 year = {1986}, 36419 pages = {58--66}, 36420 note = {(Xi'an, China)} 36421} 36422 36423@InProceedings{ rockafellar:generalized*1, 36424 crossref = {bachem.grotschel.ea:mathematical}, 36425 author = {R. T. Rockafellar}, 36426 title = {Generalized Subgradients in Mathematical Programming}, 36427 pages = {368--390} 36428} 36429 36430@InCollection{ rockafellar:large-scale, 36431 author = {R. T. Rockafellar}, 36432 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 36433 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 36434 chapter = {15}, 36435 year = {1991}, 36436 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 36437 publisher = {SIAM Publications}, 36438 pages = {247--261} 36439} 36440 36441@Article{ rockafellar:linear-quadratic, 36442 author = {R. T. Rockafellar}, 36443 title = {Linear-Quadratic Programming and Optimal Control}, 36444 journal = {SIAM Journal on Control and Optimization}, 36445 year = {1987}, 36446 volume = {25}, 36447 pages = {781--814} 36448} 36449 36450@Article{ rockafellar:maximality, 36451 author = {R. T. Rockafellar}, 36452 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 36453 journal = {Transactions of the American Mathematical Society}, 36454 year = {1970}, 36455 volume = {149}, 36456 pages = {75--88} 36457} 36458 36459@InCollection{ rockafellar:monotone, 36460 author = {R. T. Rockafellar}, 36461 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 36462 crossref = {mangasarian.meyer.ea:nonlinear*3}, 36463 pages = {1--26} 36464} 36465 36466@Article{ rockafellar:monotone*1, 36467 author = {R. T. Rockafellar}, 36468 title = {Monotone Operators and the Proximal Point Algorithm}, 36469 journal = {SIAM Journal on Control and Optimization}, 36470 year = {1976}, 36471 volume = {14}, 36472 pages = {877--898} 36473} 36474 36475@Article{ rockafellar:multiplier, 36476 author = {R. T. Rockafellar}, 36477 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 36478 journal = {Journal of Optimization Theory and Applications}, 36479 year = {1973}, 36480 volume = {12}, 36481 pages = {555--562} 36482} 36483 36484@Article{ rockafellar:multistage, 36485 author = {R. T. Rockafellar}, 36486 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 36487 journal = {Control and Cybernetics}, 36488 year = {1988}, 36489 volume = {17}, 36490 number = {2-3}, 36491 pages = {225--245} 36492} 36493 36494@Book{ rockafellar:network, 36495 author = {R. T. Rockafellar}, 36496 title = {Network Flows and Monotropic Optimization}, 36497 publisher = {John Wiley}, 36498 year = {1984}, 36499 address = {New York} 36500} 36501 36502@Article{ rodrigues:mixed, 36503 author = {H. C. Rodrigues}, 36504 title = {A mixed variational formulation for shape optimization of solids with contact 36505 conditions}, 36506 journal = {Structural Optimization}, 36507 volume = {6}, 36508 year = {1993}, 36509 pages = {19--28} 36510} 36511 36512@Book{ rodrigues:obstacle, 36513 author = {J. F. Rodrigues}, 36514 title = {Obstacle Problems in Mathematical Physics}, 36515 publisher = {Elsevier Publishing Company}, 36516 address = {Amsterdam}, 36517 year = {1987} 36518} 36519 36520@Book{ roos.terlaky.ea:theory, 36521 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 36522 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 36523 publisher = {John Wiley \& Sons}, 36524 year = {1997}, 36525 address = {Chichester} 36526} 36527 36528@TechReport{ rosa:decomposition, 36529 author = {C. H. Rosa}, 36530 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 36531 institution = {IIASA}, 36532 year = {1996}, 36533 number = {WP-96-013}, 36534 address = {A-2361 Laxenburg, Austria} 36535} 36536 36537@Article{ rosen.lane.ea:treatment, 36538 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 36539 title = {Treatment Plan Optimization Using Linear Programming}, 36540 journal = {Medical Physics}, 36541 year = {1990}, 36542 volume = {18}, 36543 number = {2}, 36544 pages = {141--152} 36545} 36546 36547@TechReport{ rosenblatt:perceptron-a, 36548 author = {F. Rosenblatt}, 36549 title = {The perceptron--a perceiving and recognizing automaton}, 36550 institution = {Cornell Aeronautical Laboratory}, 36551 year = {1957}, 36552 month = jan, 36553 address = {Ithaca, New York}, 36554 number = {85-460-1} 36555} 36556 36557@Book{ rosenblatt:principles, 36558 author = {F. Rosenblatt}, 36559 title = {Principles of Neurodynamics}, 36560 year = {1962}, 36561 publisher = {Spartan Books}, 36562 address = {New York} 36563} 36564 36565@InProceedings{ rosenblatt:two, 36566 author = {F. Rosenblatt}, 36567 title = {Two theorems of statistical separability in the perceptron}, 36568 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 36569 year = {1959}, 36570 publisher = {{HMS} Stationery Office}, 36571 address = {London}, 36572 volume = {1} 36573} 36574 36575@Article{ rosenbrock:automatic, 36576 author = {H. H. Rosenbrock}, 36577 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 36578 journal = {Computer Journal}, 36579 year = {1960}, 36580 volume = {3}, 36581 pages = {175--184} 36582} 36583 36584@Article{ roy.mukhopadhyay:pattern, 36585 author = {A. Roy and S. Mukhopadhyay}, 36586 title = {Pattern Classification Using Linear Programming}, 36587 journal = {ORSA Journal on Computing}, 36588 year = {1990}, 36589 volume = {3}, 36590 pages = {66--80} 36591} 36592 36593@Book{ rubinstein:monte, 36594 author = {R. Rubinstein}, 36595 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 36596 Networks}, 36597 publisher = {Wiley}, 36598 address = {New York, NY}, 36599 year = {1986} 36600} 36601 36602@Article{ ruchala.olivera.ea:comparison, 36603 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 36604 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 36605 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 36606 journal = {Physics in Medicine and Biology, forthcoming}, 36607 year = {1999} 36608} 36609 36610@Book{ rudin:principles, 36611 author = {W. Rudin}, 36612 title = {Principles of Mathematical Analysis}, 36613 year = {1976}, 36614 publisher = {McGraw--Hill}, 36615 address = {Tokyo, Japan}, 36616 edition = {Third} 36617} 36618 36619@Book{ rudin:real, 36620 author = {W. Rudin}, 36621 title = {Real and Complex Analysis}, 36622 year = {1974}, 36623 publisher = {McGraw--Hill}, 36624 address = {Tokyo, Japan}, 36625 edition = {Second} 36626} 36627 36628@InProceedings{ rumelhart.hinton.ea:learning, 36629 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 36630 title = {Learning Internal Representations by Error Propagation}, 36631 booktitle = {Parallel Distributed Processing}, 36632 year = {1986}, 36633 editor = {D. E. Rumelhart and J. L. McClelland}, 36634 publisher = {MIT Press}, 36635 address = {Cambridge, Massachusetts}, 36636 pages = {318--362} 36637} 36638 36639@Book{ rumelhart.mcclelland:parallel, 36640 author = {D. E. Rumelhart and J. L. McClelland}, 36641 title = {Parallel Distributed Processing}, 36642 year = {1986}, 36643 publisher = {MIT Press}, 36644 address = {Cambridge, Massachusetts} 36645} 36646 36647@InCollection{ ruszczynski:regularized, 36648 author = {A. Ruszczynski}, 36649 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 36650 year = {1995}, 36651 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 36652 editor = {K. Marti and P. Kall}, 36653 publisher = {Springer-Verlag}, 36654 address = {Berlin}, 36655 volume = {425}, 36656 series = {Lecture Notes in Control and Information Sciences}, 36657 pages = {93--108} 36658} 36659 36660@Article{ rutherford.rutstrom.ea:lacord, 36661 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 36662 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 36663 quantitative}, 36664 journal = {Revue d' Economie du developpement}, 36665 year = {1994} 36666} 36667 36668@InCollection{ rutherford.tarr:blueprints, 36669 author = {T. Rutherford and D. Tarr}, 36670 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 36671 Open Economy}, 36672 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 36673 publisher = {Cambridge University Press}, 36674 year = {1997}, 36675 editor = {R. Baldwin and J. Francois}, 36676 address = {New York} 36677} 36678 36679@Article{ rutherford:applied, 36680 author = {T. F. Rutherford}, 36681 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 36682 Overview of the Modeling Framework and Syntax}, 36683 year = {1999}, 36684 volume = {14}, 36685 pages = {1--46}, 36686 journal = {Computational Economics} 36687} 36688 36689@PhDThesis{ rutherford:applied*1, 36690 author = {T. F. Rutherford}, 36691 title = {Applied General Equilibrium Modeling}, 36692 school = {Stanford University}, 36693 year = {1987} 36694} 36695 36696@Article{ rutherford:extensions, 36697 author = {T. F. Rutherford}, 36698 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 36699 Analysis}, 36700 journal = {Journal of Economic Dynamics and Control}, 36701 volume = {19}, 36702 pages = {1299--1324}, 36703 year = {1995} 36704} 36705 36706@Misc{ rutherford:gnuplot, 36707 author = {T. F. Rutherford}, 36708 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 36709 organization = {Department of Economics, University of Colorado}, 36710 address = {Boulder, Colorado}, 36711 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 36712} 36713 36714@Unpublished{ rutherford:miles, 36715 author = {T. F. Rutherford}, 36716 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 36717 year = {1993}, 36718 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 36719} 36720 36721@TechReport{ rutherford:modeling, 36722 author = {T. F. Rutherford}, 36723 title = {A Modeling System for Applied General Equilibrium Analysis}, 36724 type = {Cowles Foundation Discussion Paper}, 36725 number = {836}, 36726 institution = {Yale University}, 36727 year = {1987} 36728} 36729 36730@TechReport{ rutherford:mpsge, 36731 author = {T. F. Rutherford}, 36732 title = {{MPSGE}}, 36733 institution = {University of Western Ontario}, 36734 year = {1988}, 36735 address = {London, Ontario} 36736} 36737 36738@Article{ rykov:simplex, 36739 author = {A. S. Rykov}, 36740 title = {Simplex Direct Search Algorithms}, 36741 journal = {Automation and Remote Control}, 36742 year = {1980}, 36743 volume = {41}, 36744 pages = {784--793} 36745} 36746 36747@Article{ saad.schultz:gmres, 36748 author = {Y. Saad and M. Schultz}, 36749 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 36750 Linear Systems}, 36751 journal = {SIAM Journal on Scientific and Statistical Computing}, 36752 year = {1986}, 36753 volume = {44}, 36754 pages = {856--869} 36755} 36756 36757@Book{ saad:iterative, 36758 author = {Y. Saad}, 36759 title = {Iterative Methods for Sparse Linear Systems}, 36760 year = {1996}, 36761 publisher = {PWS Publishing Company}, 36762 address = {Boston, Massachusetts} 36763} 36764 36765@Article{ sahni:approximate, 36766 author = {S. Sahni}, 36767 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 36768 journal = {jacm}, 36769 year = {1975}, 36770 volume = {22}, 36771 pages = {115--124} 36772} 36773 36774@InProceedings{ sauer.shepard.ea:comparison, 36775 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 36776 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 36777 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36778 Radiation Therapy, Salt Lake City}, 36779 year = {1997}, 36780 editor = {D. D. Leavitt and G. Starkshall}, 36781 publisher = {Medical Physics Publishing}, 36782 address = {St. Louis, Missouri} 36783} 36784 36785@Article{ sauer.xu:multivariate, 36786 author = {Th. Sauer and Y. Xu}, 36787 title = {On Multivariate {L}agrange Interpolation}, 36788 journal = {Mathematics of Computation}, 36789 year = {1995}, 36790 volume = {64}, 36791 pages = {1147--1170} 36792} 36793 36794@Article{ savelsbergh:preprocessing, 36795 author = {M. W. P. Savelsbergh}, 36796 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 36797 journal = {ORSA Journal on Computing}, 36798 year = {1994}, 36799 volume = {6}, 36800 pages = {445--454} 36801} 36802 36803@Article{ scarf:approximation, 36804 author = {H. E. Scarf}, 36805 title = {The Approximation of Fixed Points of a Continuous Mapping}, 36806 journal = {SIAM Journal on Applied Mathematics}, 36807 year = {1967}, 36808 volume = {15}, 36809 pages = {1328--1343} 36810} 36811 36812@Book{ scarf:computation, 36813 author = {H. E. Scarf}, 36814 title = {The Computation of Economic Equilibria}, 36815 year = {1973}, 36816 publisher = {Yale University Press}, 36817 address = {New Haven, Connecticut} 36818} 36819 36820@TechReport{ scheel.scholtes:mathematical, 36821 author = {H. Scheel and S. Scholtes}, 36822 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 36823 and Sensitivity}, 36824 institution = {Judge Institute of Management Studies, University of Cambridge}, 36825 year = {1998}, 36826 type = {Technical Report}, 36827 address = {Cambridge, England} 36828} 36829 36830@Article{ schlick:modified, 36831 author = {T. Schlick}, 36832 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 36833 journal = {SIAM Journal on Scientific Computing}, 36834 year = {1993}, 36835 volume = {14}, 36836 pages = {424--445} 36837} 36838 36839@Article{ schnabel.eskow:modified, 36840 author = {R. B. Schnabel and E. Eskow}, 36841 title = {A New Modified {C}holesky Factorization}, 36842 journal = {SIAM Journal on Scientific and Statistical Computing}, 36843 year = {1991}, 36844 volume = {11}, 36845 pages = {1136--1158} 36846} 36847 36848@Article{ schneider.zenios:comparative, 36849 author = {M. H. Schneider and S. A. Zenios}, 36850 title = {A Comparative Study of Algorithms for Matrix Balancing}, 36851 journal = {Operations Research}, 36852 year = {1990}, 36853 volume = {38}, 36854 pages = {439--455} 36855} 36856 36857@Book{ scholkopf.burges.ea:advances, 36858 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 36859 title = {Advances in Kernel Methods: Support Vector Machines}, 36860 publisher = {MIT Press}, 36861 address = {Cambridge, MA }, 36862 year = {1998}, 36863 isbn = {0-262-19416-3} 36864} 36865 36866@Article{ scholtes.stohr:exact, 36867 author = {S. Scholtes and M. St{\"{o}}hr}, 36868 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 36869 journal = {SIAM Journal on Control and Optimization}, 36870 volume = {37}, 36871 pages = {617--652}, 36872 year = {1999} 36873} 36874 36875@TechReport{ scholtes:introduction, 36876 author = {S. Scholtes}, 36877 title = {Introduction to piecewise differentiable equations}, 36878 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 36879 Universit{\"{a}}t Karlsruhe}, 36880 year = {1994}, 36881 type = {Preprint}, 36882 number = {No. 53/1994}, 36883 address = {Karlsruhe, Germany} 36884} 36885 36886@Article{ schramm.zowe:version, 36887 author = {H. Schramm and J. Zowe}, 36888 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 36889 Idea, Convergence Analysis, Numerical Results}, 36890 journal = {SIAM Journal on Optimization}, 36891 year = {1992}, 36892 volume = {2}, 36893 pages = {121--152} 36894} 36895 36896@Article{ schultz.meyer:interior, 36897 author = {G. L. Schultz and R. R. Meyer}, 36898 title = {An Interior Point Method for Block Angular Optimization}, 36899 journal = {SIAM Journal on Optimization}, 36900 year = {1991}, 36901 volume = {1}, 36902 pages = {583--602} 36903} 36904 36905@InProceedings{ sekiguchi.sato.ea:ninf, 36906 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 36907 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 36908 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 36909 year = {1996}, 36910 address = {Santa Fe} 36911} 36912 36913@InCollection{ sellami.robinson:homotopies, 36914 author = {H. Sellami and S. M. Robinson}, 36915 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 36916 Inequalities}, 36917 booktitle = {Nonlinear Optimization and Applications}, 36918 editor = {G. Di Pillo and F. Giannessi}, 36919 year = {1996}, 36920 pages = {327--343}, 36921 publisher = {Plenum Press}, 36922 address = {New York} 36923} 36924 36925@Article{ sellami.robinson:implementation, 36926 author = {H. Sellami and S. M. Robinson}, 36927 title = {Implementation of a Continuation Method for Normal Maps}, 36928 journal = {Mathematical Programming}, 36929 year = {1997}, 36930 volume = {76}, 36931 pages = {563--578} 36932} 36933 36934@PhDThesis{ sellami:continuation, 36935 author = {H. Sellami}, 36936 title = {A Continuation Method for Normal Maps}, 36937 school = {University of Wisconsin -- Madison}, 36938 year = {1994}, 36939 address = {Madison, Wisconsin} 36940} 36941 36942@Article{ sellami:homotopy, 36943 author = {H. Sellami}, 36944 title = {A Homotopy Continuation Method for Normal Maps}, 36945 journal = {Mathematical Programming}, 36946 vol = {82}, 36947 year = {1998}, 36948 pages = {317--337} 36949} 36950 36951@Book{ seuss:one, 36952 author = {{Dr.} A. Seuss}, 36953 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 36954 year = {1960}, 36955 publisher = {Beginner Books}, 36956 address = {New York}, 36957 series = {Beginner Books, B13}, 36958 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 36959 Yink, Yop, Gack, and the Zeds} 36960} 36961 36962@Article{ seyfferth.pfeiffer:dynamics, 36963 author = {W. Seyfferth and F. Pfeiffer}, 36964 title = {Dynamics of Assembly Processes With a Manipulator}, 36965 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 36966 and Systems}, 36967 year = {1992}, 36968 pages = {1303--1310} 36969} 36970 36971@Article{ shanno.simantiraki:infeasible, 36972 author = {D. Shanno and E. Simantiraki}, 36973 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 36974 year = {1997}, 36975 journal = {SIAM Journal on Optimization}, 36976 volume = {7}, 36977 pages = {620--640} 36978} 36979 36980@InProceedings{ shanno.simantiraki:interior, 36981 author = {D. Shanno and E. Simantiraki}, 36982 title = {Interior Point Methods for Linear and Nonlinear Programming}, 36983 booktitle = {State of the Art in Numerical Analysis}, 36984 year = {1997}, 36985 editor = {I. S. Duff and G. A. Watson}, 36986 publisher = {Oxford University Press}, 36987 address = {Oxford} 36988} 36989 36990@Article{ shannon:introduction, 36991 author = {R. E. Shannon}, 36992 title = {Introduction to the Art and Science of simulation}, 36993 journal = {WSC98 1998 Winter simulation conference proceedings}, 36994 year = {1998}, 36995 volume = {1}, 36996 pages = {7--14} 36997} 36998 36999@TechReport{ shapiro:concepts, 37000 author = {A. Shapiro}, 37001 title = {On Concepts of Directional Differentiability}, 37002 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 37003 year = {1988}, 37004 address = {Pretoria, South Africa}, 37005 number = {73/88(18)}, 37006 type = {Research Report} 37007} 37008 37009@Book{ shavlik.editors:readings, 37010 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 37011 title = {Readings in Machine Learning}, 37012 year = {1990}, 37013 publisher = {Morgan Kaufman}, 37014 address = {San Mateo, California} 37015} 37016 37017@Article{ shavlik.mooney.ea:symbolic, 37018 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 37019 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 37020 journal = {Machine Learning}, 37021 year = {1991}, 37022 volume = {6}, 37023 pages = {111--143} 37024} 37025 37026@Book{ sheffi:urban, 37027 author = {Y. Sheffi}, 37028 title = {Urban Transportation Networks}, 37029 publisher = {Prentice-Hall, Inc}, 37030 year = {1985}, 37031 address = {Englewood Cliffs, New Jersey} 37032} 37033 37034@Article{ sheng.potra:quadratically, 37035 author = {R. Sheng and F. A. Potra}, 37036 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 37037 Polynomial {CO}mplexity}, 37038 journal = {SIAM Journal on Optimization}, 37039 year = {1997}, 37040 volume = {7}, 37041 pages = {304--317} 37042} 37043 37044@InProceedings{ shepard.angelos.ea:simple, 37045 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 37046 title = {A Simple Model for Examining Radiotherapy Optimization}, 37047 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 37048 Radiation Therapy, Salt Lake City}, 37049 year = {1997}, 37050 editor = {D. D. Leavitt and G. Starkshall}, 37051 publisher = {Medical Physics Publishing}, 37052 address = {St. Louis, Missouri} 37053} 37054 37055@Article{ shepard.ferris.ea:inverse, 37056 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 37057 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 37058 journal = {Medical Physics}, 37059 volume = {27}, 37060 pages = {12}, 37061 year = {2000}, 37062 key = {93} 37063} 37064 37065@Article{ shepard.ferris.ea:optimizing, 37066 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 37067 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 37068 journal = {SIAM Review}, 37069 volume = {41}, 37070 pages = {721--744}, 37071 year = {1999}, 37072 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 37073 key = {68}, 37074 institution = {Computer Sciences Department, University of Wisconsin}, 37075 address = {Madison, Wisconsin}, 37076 number = {98-07}, 37077 type = {Mathematical Programming Technical Report} 37078} 37079 37080@Article{ sherali.shetty:finitely, 37081 author = {H. D. Sherali and C. M. Shetty}, 37082 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 37083 Cuts and Disjunctive Face Cuts}, 37084 journal = {Mathematical Programming}, 37085 year = {1980}, 37086 volume = {19}, 37087 pages = {14--31} 37088} 37089 37090@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 37091 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 37092 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 37093 journal = {Operations Research}, 37094 year = {1983}, 37095 volume = {31}, 37096 pages = {253--276} 37097} 37098 37099@Article{ shi.olafsson.ea:hybrid, 37100 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 37101 title = {A New Hybrid Optimization Algorithm}, 37102 journal = {Computers and Industrial Engineering}, 37103 year = {1999}, 37104 volume = {36}, 37105 pages = {409--426} 37106} 37107 37108@PhDThesis{ shiau:iterative, 37109 author = {T.--H. Shiau}, 37110 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 37111 school = {Computer Sciences Department, University of Wisconsin}, 37112 year = {1983}, 37113 address = {Madison, Wisconsin}, 37114 note = {Technical Report 507} 37115} 37116 37117@InProceedings{ shor:generalized, 37118 crossref = {bachem.grotschel.ea:mathematical}, 37119 author = {N. Z. Shor}, 37120 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 37121 Dilation Operations}, 37122 pages = {501--529} 37123} 37124 37125@Book{ shor:minimization, 37126 author = {N. Z. Shor}, 37127 title = {Minimization Methods for Nondifferentiable Functions}, 37128 year = {1985}, 37129 publisher = {Springer-Verlag}, 37130 address = {Berlin} 37131} 37132 37133@Article{ shoven.whalley:applied, 37134 author = {J. Shoven and J. Whalley}, 37135 title = {Applied General Equilibrium Models of Taxation and International Trade: 37136 Introduction and Survey}, 37137 journal = {Journal of Economic Literature}, 37138 year = {1984}, 37139 volume = {22}, 37140 pages = {1007--1051} 37141} 37142 37143@Article{ shultz.meyer:interior, 37144 author = {G. L. Shultz and R. R. Meyer}, 37145 title = {An Interior Point Method for Block Angular Optimization}, 37146 journal = {SIAM Journal on Optimization}, 37147 year = {1991}, 37148 volume = {1}, 37149 pages = {583--602} 37150} 37151 37152@Article{ shultz.schnabel.ea:family, 37153 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 37154 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 37155 journal = {SIAM Journal on Numerical Analysis}, 37156 year = {1985}, 37157 volume = {22}, 37158 pages = {44--67} 37159} 37160 37161@Article{ sibony:methodes, 37162 author = {M. Sibony}, 37163 title = {Methodes iteratives pur les equations et inequations aux derives partielles 37164 nonlineaires de type monotone}, 37165 journal = {Calcolo}, 37166 year = {1970}, 37167 volume = {7}, 37168 pages = {65--183} 37169} 37170 37171@Article{ sidney:optimal, 37172 author = {J. B. Sidney}, 37173 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 37174 journal = {Operations Research}, 37175 year = {1977}, 37176 volume = {25}, 37177 pages = {62--69} 37178} 37179 37180@Book{ siegel:corba, 37181 author = {J. Siegel}, 37182 title = {{CORBA} - Fundamentals and Programming}, 37183 publisher = {John Wiley \& Sons}, 37184 year = {1996}, 37185 address = {New York, New York} 37186} 37187 37188@TechReport{ simantiraki.shanno:infeasible-interior-point, 37189 author = {E. Simantiraki and D. F. Shanno}, 37190 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 37191 type = {Research Report}, 37192 number = {7-95}, 37193 institution = {Rutgers Center for Operations Research, Rutgers University}, 37194 address = {New Brunswick, New Jersey}, 37195 year = {1995} 37196} 37197 37198@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 37199 author = {E. Simantiraki and D. F. Shanno}, 37200 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 37201 Problems}, 37202 crossref = {ferris.pang:complementarity}, 37203 pages = {386--404} 37204} 37205 37206@Book{ simpson:artificial, 37207 author = {P. K. Simpson}, 37208 title = {Artificial Neural Systems}, 37209 year = {1990}, 37210 publisher = {Pergamon Press}, 37211 address = {New York} 37212} 37213 37214@Article{ smeers:computable, 37215 author = {Y. Smeers}, 37216 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 37217 and Gas Markets}, 37218 journal = {The Energy Journal}, 37219 year = {1997}, 37220 optkey = {}, 37221 optvolume = {18}, 37222 optnumber = {}, 37223 optmonth = {}, 37224 optpages = {1--32}, 37225 optnote = {}, 37226 optannote = {} 37227} 37228 37229@Article{ smith:design, 37230 author = {F. W. Smith}, 37231 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 37232 Procedures}, 37233 journal = {IEEE Transactions on Computers}, 37234 year = {1969}, 37235 volume = {18}, 37236 pages = {367--372} 37237} 37238 37239@Article{ smith:existence, 37240 author = {M. J. Smith}, 37241 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 37242 journal = {Transportation Research}, 37243 year = {1979}, 37244 volume = {13B}, 37245 pages = {295--304} 37246} 37247 37248@Article{ smith:existence*1, 37249 author = {M. J. Smith}, 37250 title = {The existence and calculation of traffic equilibria}, 37251 journal = {Transportation Research}, 37252 volume = {17B}, 37253 year = {1983}, 37254 pages = {291--303} 37255} 37256 37257@Article{ smith:pattern, 37258 author = {F. W. Smith}, 37259 title = {Pattern Classifier Design by Linear Programming}, 37260 journal = {IEEE Transactions on Computers}, 37261 year = {1968}, 37262 volume = {C-17}, 37263 pages = {367--372} 37264} 37265 37266@Article{ solodov.svaiter:projection, 37267 author = {M. V. Solodov and B. F. Svaiter}, 37268 title = {A New Projection Method for Variational Inequality Problems}, 37269 journal = {SIAM Journal on Control and Optimization}, 37270 volume = {37}, 37271 pages = {765--776}, 37272 year = {1999} 37273} 37274 37275@Article{ solodov.tseng:modified, 37276 author = {M. V. Solodov and P. Tseng}, 37277 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 37278 year = {1996}, 37279 journal = {SIAM Journal on Control and Optimization}, 37280 pages = {1814--1830}, 37281 volume = {34} 37282} 37283 37284@Article{ solodov:stationary, 37285 author = {M. V. Solodov}, 37286 title = {Stationary Points of Bound Constrained Minimization Reformulations of 37287 Complementarity Problems}, 37288 journal = {Journal of Optimization Theory and Applications, forthcoming}, 37289 year = {1997} 37290} 37291 37292@Article{ spendley.hext.ea:sequential, 37293 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 37294 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 37295 Operation}, 37296 journal = {Technometrics}, 37297 year = {1962}, 37298 pages = {441--461}, 37299 volume = {4} 37300} 37301 37302@Article{ spingarn:applications, 37303 author = {J. E. Spingarn}, 37304 title = {Applications of the Method of Partial Inverses to Convex Programming}, 37305 journal = {Mathematical Programming}, 37306 year = {1985}, 37307 volume = {32}, 37308 pages = {199--223} 37309} 37310 37311@Book{ srinivasan.whalley:general, 37312 author = {T. Srinivasan and J. Whalley}, 37313 title = {General Equilibrium Trade Policy Modelling}, 37314 publisher = {MIT Press}, 37315 year = {1986}, 37316 address = {Boston} 37317} 37318 37319@Book{ stackelberg:theory, 37320 author = {H. Van Stackelberg}, 37321 title = {The Theory of Market Economy}, 37322 publisher = {Oxford University Press}, 37323 year = {1952} 37324} 37325 37326@Article{ stavroulakis.panagiotopoulos.ea:rigid, 37327 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 37328 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 37329 Applications}, 37330 journal = {Computers \& Structures}, 37331 volume = {40}, 37332 year = {1991}, 37333 pages = {599--614} 37334} 37335 37336@Article{ stavroulakis:optimal, 37337 author = {G. E. Stavroulakis}, 37338 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 37339 optimal control problem for variational inequalities}, 37340 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 37341 year = {1996} 37342} 37343 37344@Article{ stavroulakis:optimal*1, 37345 author = {G. E. Stavroulakis}, 37346 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 37347 journal = {Archives of Applied Mechanics, forthcoming}, 37348 year = {1996} 37349} 37350 37351@Book{ steenbrink:optimization, 37352 author = {P. A. Steenbrink}, 37353 title = {Optimization of Transport Networks}, 37354 publisher = {John Wiley \& Sons}, 37355 address = {London, England}, 37356 year = {1974} 37357} 37358 37359@Article{ stephens:asymptotic, 37360 author = {M. A. Stephens}, 37361 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 37362 journal = {Annals of Statistics}, 37363 year = {1976}, 37364 volume = {4}, 37365 pages = {357--369} 37366} 37367 37368@Article{ stephens:edf, 37369 author = {M. A. Stephens}, 37370 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 37371 journal = {Journal of the American Statistical Association}, 37372 year = {1974}, 37373 volume = {69}, 37374 pages = {730--737} 37375} 37376 37377@Article{ stevens:location, 37378 author = {B. H. Stevens}, 37379 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 37380 journal = {Papers of the Regional Science Association}, 37381 year = {1968}, 37382 volume = {21}, 37383 pages = {19--34} 37384} 37385 37386@Article{ stewart.trinkle:implicit, 37387 author = {D. E. Stewart and J. C. Trinkle}, 37388 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 37389 Collisions and {C}oulomb Friction}, 37390 journal = {International Journal for Numerical Methods in Engineering}, 37391 year = {1996}, 37392 volume = {39}, 37393 pages = {2673--2691} 37394} 37395 37396@Book{ stoer.bulirsch:introduction, 37397 author = {J. Stoer and R. Bulirsch}, 37398 title = {Introduction to Numerical Analysis}, 37399 year = {1980}, 37400 publisher = {Springer-Verlag}, 37401 address = {New York} 37402} 37403 37404@Article{ stoer:complexity, 37405 author = {J. Stoer}, 37406 title = {The complexity of an infeasible interior--point path--following method for the 37407 solution of linear programs}, 37408 journal = {Optimization Methods and Software}, 37409 year = {1994}, 37410 volume = {3}, 37411 pages = {1--12} 37412} 37413 37414@Article{ stone:cross-validatory, 37415 author = {M. Stone}, 37416 title = {Cross-validatory choice and assessment of statistical predictions}, 37417 journal = {Journal of the Royal Statistical Society}, 37418 year = {1974}, 37419 volume = {36}, 37420 pages = {111--147} 37421} 37422 37423@Article{ stone.smith.ea:inverse, 37424 author = {R. A. Stone and V. Smith and L. Verhey}, 37425 title = {Inverse Planning for the {G}amma {K}nife}, 37426 journal = {Medical Physics}, 37427 year = {1993}, 37428 volume = {20}, 37429 pages = {865} 37430} 37431 37432@Book{ strang:linear, 37433 author = {G. Strang}, 37434 title = {Linear Algebra and its Applications}, 37435 year = {1980}, 37436 publisher = {Academic Press}, 37437 address = {New York}, 37438 edition = {Second} 37439} 37440 37441@InProceedings{ street.wolberg.ea:nuclear, 37442 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 37443 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 37444 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 37445 year = {1993}, 37446 publisher = {SPIE--The International Society for Optical Engineering}, 37447 address = {San Jose, California}, 37448 pages = {861--870}, 37449 volume = {1905} 37450} 37451 37452@Article{ subramanian:gauss-newton, 37453 author = {P. K. Subramanian}, 37454 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 37455 journal = {Journal of Optimization Theory and Applications}, 37456 year = {1993}, 37457 volume = {77}, 37458 pages = {467--482} 37459} 37460 37461@PhDThesis{ subramanian:iterative, 37462 author = {P. K. Subramanian}, 37463 title = {Iterative Methods of Solution for Complementarity Problems}, 37464 year = {1985}, 37465 address = {Madison, Wisconsin}, 37466 school = {Computer Sciences Department, University of Wisconsin} 37467} 37468 37469@TechReport{ subramanian:note, 37470 author = {P. K. Subramanian}, 37471 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 37472 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 37473 year = {1985}, 37474 address = {Madison, Wisconsin}, 37475 number = {2844}, 37476 type = {Technical Summary Report} 37477} 37478 37479@TechReport{ suh.gucht:distributed, 37480 author = {J. Y. Suh and D. Van Gucht}, 37481 title = {Distributed Genetic Algorithms}, 37482 institution = {Computer Science Department, Indiana University}, 37483 year = {1987}, 37484 address = {Bloomington}, 37485 number = {225} 37486} 37487 37488@Article{ sun.natori.ea:computational, 37489 author = {S. M. Sun and M. C. Natori and K. C. Park}, 37490 title = {A Computational Procedure for Flexible Beams with Frictional Contact 37491 Constraints}, 37492 journal = {International Journal for Numerical Methods in Engineering}, 37493 volume = {36}, 37494 pages = {3781--3800}, 37495 year = {1993} 37496} 37497 37498@Article{ sun.qi:ncp-functions, 37499 author = {D. Sun and L. Qi}, 37500 title = {On {NCP}-Functions}, 37501 journal = {Computational Optimization and Applications, forthcoming}, 37502 year = {1998} 37503} 37504 37505@Article{ sun.womersley:unconstrained, 37506 author = {D. Sun and R. S. Womersley}, 37507 title = {A new unconstrained differentiable merit function for box constrained variational 37508 inequality problems and a damped {G}auss-{N}ewton method}, 37509 journal = {SIAM Journal on Optimization}, 37510 year = {1999}, 37511 volume = {9}, 37512 pages = {388--413} 37513} 37514 37515@Article{ sun:class, 37516 author = {D. Sun}, 37517 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 37518 journal = {Journal of Optimization Theory and Applications}, 37519 year = {1996}, 37520 volume = {91}, 37521 pages = {123--140} 37522} 37523 37524@PhDThesis{ sun:monotropic, 37525 author = {J. Sun}, 37526 title = {On Monotropic Piecewise Quadratic Programming}, 37527 school = {University of Washington}, 37528 year = {1986}, 37529 address = {Seattle, Washington} 37530} 37531 37532@Article{ sun:thermal, 37533 author = {D. C. Sun}, 37534 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 37535 journal = {Journal of Applied Mechanics}, 37536 volume = {58}, 37537 pages = {141--153}, 37538 year = {1991} 37539} 37540 37541@Article{ sundararaghavan.ahmed:minimizing, 37542 author = {P. S. Sundararaghavan and M. U. Ahmed}, 37543 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 37544 Scheduling}, 37545 journal = {Naval Research Logistics Quarterly}, 37546 year = {1984}, 37547 volume = {31}, 37548 pages = {325--333} 37549} 37550 37551@TechReport{ sznajder.gowda:generalizations, 37552 author = {R. Sznajder and M. S. Gowda}, 37553 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 37554 horizontal {LCP}s}, 37555 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 37556 year = {1992}, 37557 address = {Catonsville, Maryland}, 37558 number = {92--16}, 37559 type = {Research Report} 37560} 37561 37562@Article{ sznajder.gowda:nondegeneracy, 37563 author = {R. Sznajder and M. S. Gowda}, 37564 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 37565 journal = {Mathematics of Operations Research}, 37566 year = {1998}, 37567 volume = {23}, 37568 pages = {221--238} 37569} 37570 37571@Article{ taji.fukushima.ea:globally, 37572 author = {K. Taji and M. Fukushima and T. Ibaraki}, 37573 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 37574 Inequalities}, 37575 journal = {Mathematical Programming}, 37576 year = {1993}, 37577 volume = {58}, 37578 pages = {369--383} 37579} 37580 37581@Article{ taji.fukushima:optimization, 37582 author = {K. Taji and M. Fukushima}, 37583 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 37584 Problem}, 37585 journal = {Journal of the Operations Research Society of Japan}, 37586 year = {1994}, 37587 volume = {37}, 37588 pages = {310--331} 37589} 37590 37591@Article{ talbot.patterson.ea:comparative, 37592 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 37593 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 37594 journal = {Management Science}, 37595 year = {1986}, 37596 volume = {32}, 37597 pages = {430--454} 37598} 37599 37600@Article{ talman.yamamoto:simplicial, 37601 author = {A. J. J. Talman and Y. Yamamoto}, 37602 title = {A {S}implicial Algorithm for Stationary Point Problems}, 37603 journal = {Mathematics of Operations Research}, 37604 year = {1989}, 37605 volume = {14}, 37606 pages = {383--399} 37607} 37608 37609@InProceedings{ tanese:distributed, 37610 crossref = {schaeffer:third}, 37611 author = {R. Tanese}, 37612 title = {Distributed Genetic Algorithms}, 37613 pages = {434--439} 37614} 37615 37616@InProceedings{ tanese:parallel, 37617 crossref = {grefenstette:genetic}, 37618 author = {R. Tanese}, 37619 title = {Parallel Genetic Algorithms for a Hypercube}, 37620 pages = {177--183} 37621} 37622 37623@Article{ teboulle:entropic, 37624 author = {M. Teboulle}, 37625 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 37626 year = {1992}, 37627 journal = {Mathematics of Operations Research}, 37628 volume = {17}, 37629 pages = {670--690} 37630} 37631 37632@Article{ thuente:duality, 37633 author = {D. J. Thuente}, 37634 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 37635 journal = {Operations Research}, 37636 year = {1980}, 37637 volume = {28}, 37638 pages = {1005--1011} 37639} 37640 37641@Book{ tikhonov.arsenin:solutions, 37642 author = {A. N. Tikhonov and V. Y. Arsenin}, 37643 title = {Solutions of Ill--Posed Problems}, 37644 year = {1977}, 37645 publisher = {John Wiley \& Sons}, 37646 address = {New York} 37647} 37648 37649@InProceedings{ tin-loi.ferris:complementarity, 37650 author = {F. Tin-Loi and M. C. Ferris}, 37651 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 37652 booktitle = {Computational Mechanics for the Next Millenium}, 37653 key = {79}, 37654 pages = {1029--1036}, 37655 year = {1999}, 37656 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 37657 volume = {2}, 37658 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 37659 Mechanics}, 37660 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 37661 publisher = {Elsevier Science Ltd}, 37662 type = {Mathematical Programming Technical Report}, 37663 institution = {Computer Sciences Department, University of Wisconsin}, 37664 address = {Madison, Wisconsin}, 37665 number = {99-02} 37666} 37667 37668@InProceedings{ tin-loi.ferris:holonomic, 37669 author = {F. Tin-Loi and M. C. Ferris}, 37670 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 37671 booktitle = {Advances in Fracture Research}, 37672 year = {1997}, 37673 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 37674 volume = {2}, 37675 publisher = {Pergamon Press}, 37676 pages = {2183--2190}, 37677 key = {53} 37678} 37679 37680@InProceedings{ tin-loi.ferris:simple, 37681 author = {F. Tin-Loi and M. C. Ferris}, 37682 title = {A Simple Mathematical Programming Method for a Structural Identification 37683 Problem}, 37684 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 37685 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 37686 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 37687 publisher = {Techno-Press}, 37688 address = {Korea}, 37689 year = {1997}, 37690 pages = {511--518}, 37691 key = {59} 37692} 37693 37694@Article{ tin-loi.misa:large, 37695 author = {F. Tin-Loi and J. S. Misa}, 37696 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 37697 journal = {International Journal for Numerical Methods in Engineering}, 37698 volume = {39}, 37699 pages = {741--762}, 37700 year = {1996} 37701} 37702 37703@Article{ tin-loi.pang:elastoplastic, 37704 author = {F. Tin-Loi and J. S. Pang}, 37705 title = {Elastoplastic analysis of structures with nonlinear hardening}, 37706 journal = {Computer Methods in Applied Mechanics and Engineering}, 37707 volume = {107}, 37708 year = {1993}, 37709 pages = {299--312} 37710} 37711 37712@Article{ tin-loi.vimonsatit:nonlinear, 37713 author = {F. Tin-Loi and V. Vimonsatit}, 37714 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 37715 journal = {Engineering Structures}, 37716 volume = {18}, 37717 year = {1996}, 37718 pages = {115--124} 37719} 37720 37721@Article{ tobin:uniqueness, 37722 author = {R. L. Tobin}, 37723 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 37724 journal = {Annals of Operations Research}, 37725 volume = {34}, 37726 year = {1992}, 37727 pages = {21--36} 37728} 37729 37730@Article{ tobin:variable, 37731 author = {R. L. Tobin}, 37732 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 37733 Problem}, 37734 journal = {Mathematical Programming}, 37735 year = {1988}, 37736 volume = {40}, 37737 pages = {33--51} 37738} 37739 37740@Article{ todd.burrell:extension, 37741 author = {M. J. Todd and B. P. Burrell}, 37742 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 37743 Variables}, 37744 journal = {Algorithmica}, 37745 year = {1986}, 37746 volume = {1}, 37747 pages = {409--424} 37748} 37749 37750@Book{ todd:computation, 37751 author = {M. J. Todd}, 37752 title = {Computation of Fixed Points and Applications}, 37753 publisher = {Springer-Verlag}, 37754 year = {1976}, 37755 volume = {124}, 37756 series = {Lecture Notes in Economics and Mathematical Systems}, 37757 address = {Heidelberg} 37758} 37759 37760@Article{ todd:note, 37761 author = {M. J. Todd}, 37762 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 37763 Production}, 37764 journal = {Journal of Mathematical Economics}, 37765 year = {1976}, 37766 volume = {6}, 37767 pages = {135--144} 37768} 37769 37770@Article{ toint:assesment, 37771 author = {Ph. L. Toint}, 37772 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37773 Optimization}, 37774 year = {1996}, 37775 journal = {SIAM Journal on Scientific Computing}, 37776 volume = {17}, 37777 pages = {725=-739} 37778} 37779 37780@TechReport{ toint:assesment*1, 37781 author = {Ph. L. Toint}, 37782 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37783 Optimization: The Complete Numerical Results}, 37784 institution = {Department of Mathematics, FUNDP}, 37785 year = {1994}, 37786 number = {94/15}, 37787 address = {Namur, Belgium} 37788} 37789 37790@Article{ toint:global, 37791 author = {Ph. L. Toint}, 37792 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 37793 in a {H}ilbert Space}, 37794 journal = {IMA Journal of Numerical Analysis}, 37795 year = {1988}, 37796 volume = {8}, 37797 pages = {231--252} 37798} 37799 37800@Article{ toint:non-monotone, 37801 author = {Ph. L. Toint}, 37802 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 37803 Convex Constraints}, 37804 year = {1997}, 37805 journal = {Mathematical Programming}, 37806 volume = {77}, 37807 pages = {69--94} 37808} 37809 37810@InCollection{ toint:transportation, 37811 author = {Ph. L. Toint}, 37812 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 37813 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 37814 Management}, 37815 publisher = {Springer-Verlag}, 37816 series = {NATO ASI Series F}, 37817 year = {1997}, 37818 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 37819} 37820 37821@Article{ tomlin.welch:finding, 37822 author = {J. Tomlin and J. Welch}, 37823 title = {Finding Duplicate Rows in a Linear Programming Model}, 37824 journal = {Operations Research Letters}, 37825 year = {1986}, 37826 volume = {5}, 37827 number = {1}, 37828 pages = {7--11} 37829} 37830 37831@Article{ torczon:convergence, 37832 author = {V. Torczon}, 37833 title = {On the Convergence of the Multidirectional Search Algorithm}, 37834 journal = {SIAM Journal on Optimization}, 37835 year = {1991}, 37836 volume = {1}, 37837 pages = {123--145} 37838} 37839 37840@Article{ torczon:convergence*1, 37841 author = {V. Torczon}, 37842 title = {On the Convergence of Pattern Search Algorithms}, 37843 journal = {SIAM Journal on Optimization}, 37844 year = {1997}, 37845 volume = {7}, 37846 pages = {1--25} 37847} 37848 37849@Misc{ torma.rutherford:general, 37850 author = {H. Torma and T. Rutherford}, 37851 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 37852 year = {1992}, 37853 howpublished = {Working Paper 15/1992}, 37854 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 37855} 37856 37857@Article{ trinkle.pang.ea:dynamic, 37858 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 37859 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 37860 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 37861 year = {1997}, 37862 pages = {267--279}, 37863 volume = {77} 37864} 37865 37866@InProceedings{ trinkle.pang:dynamic, 37867 author = {J. C. Trinkle and J. S. Pang}, 37868 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 37869 book = {{IEEE} International Conference on Robotics and Automation}, 37870 pages = {2276--2281}, 37871 year = {1997} 37872} 37873 37874@TechReport{ tseng.bertsekas:convergence, 37875 author = {P. Tseng and D. P. Bertsekas}, 37876 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 37877 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 37878 Technology}, 37879 year = {1990}, 37880 type = {technical report}, 37881 number = {LIDS-P-1995}, 37882 address = {Cambridge, MA} 37883} 37884 37885@Article{ tseng.yamashita.ea:equivalence, 37886 author = {P. Tseng and N. Yamashita and M. Fukushima}, 37887 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 37888 Approach}, 37889 year = {1996}, 37890 journal = {SIAM Journal on Optimization}, 37891 volume = {6}, 37892 pages = {446--460} 37893} 37894 37895@Article{ tseng:applications, 37896 author = {P. Tseng}, 37897 title = {Applications of a splitting algorithm to decomposition in convex programming and 37898 variational inequalities}, 37899 journal = {SIAM Journal on Control and Optimization}, 37900 year = {1991}, 37901 volume = {29}, 37902 pages = {119--138} 37903} 37904 37905@Article{ tseng:dual, 37906 author = {P. Tseng}, 37907 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 37908 Constraints: a Unified Approach}, 37909 journal = {SIAM Journal on Control and Optimization}, 37910 year = {1990}, 37911 volume = {28}, 37912 pages = {214--242} 37913} 37914 37915@Article{ tseng:dual*1, 37916 author = {P. Tseng}, 37917 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 37918 Unified Approach}, 37919 journal = {SIAM Journal on Control and Optimization}, 37920 year = {1990}, 37921 volume = {28}, 37922 pages = {214--242} 37923} 37924 37925@Article{ tseng:dual*2, 37926 author = {P. Tseng}, 37927 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 37928 journal = {Mathematical Programming}, 37929 year = {1993}, 37930 volume = {59}, 37931 pages = {231--248} 37932} 37933 37934@Article{ tseng:fortified-descent, 37935 author = {P. Tseng}, 37936 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 37937 journal = {SIAM Journal on Optimization}, 37938 volume = {10}, 37939 pages = {269--288}, 37940 year = {2000} 37941} 37942 37943@Article{ tseng:growth, 37944 author = {P. Tseng}, 37945 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 37946 Problem}, 37947 journal = {Journal of Optimization Theory and Applications}, 37948 volume = {89}, 37949 year = {1996}, 37950 pages = {17--37} 37951} 37952 37953@Unpublished{ tseng:matlab, 37954 author = {P. Tseng}, 37955 title = {Matlab Implementations of Complementarity Codes}, 37956 year = {1995}, 37957 note = {Private Communication} 37958} 37959 37960@Article{ ursescu:multifunctions, 37961 author = {C. Ursescu}, 37962 title = {Multifunctions with closed convex graph}, 37963 journal = {Czech. Math. J.}, 37964 year = {1975}, 37965 volume = {35}, 37966 pages = {438--441} 37967} 37968 37969@TechReport{ vaidya:algorithm, 37970 author = {P. M. Vaidya}, 37971 title = {An Algorithm for Linear Programming which Requires 37972 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 37973 institution = {AT\&T Bell Laboratories}, 37974 year = {1987}, 37975 address = {Murray Hill, New Jersey} 37976} 37977 37978@Article{ val:unloading, 37979 author = {P. Du Val}, 37980 title = {The Unloading Problem for Plane Curves}, 37981 journal = {American Journal of Mathematics}, 37982 year = {1940}, 37983 volume = {62}, 37984 pages = {307--311} 37985} 37986 37987@InCollection{ valentine:problem, 37988 author = {F. A. Valentine}, 37989 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 37990 Conditions}, 37991 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 37992 year = {1937}, 37993 publisher = {University of Chicago Press}, 37994 address = {Chicago}, 37995 pages = {407--448} 37996} 37997 37998@Article{ valle.poch.ea:comparison, 37999 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 38000 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 38001 Flow-Injection Systems}, 38002 journal = {Analytica Chimica Acta}, 38003 year = {1990}, 38004 volume = {241}, 38005 pages = {31--42} 38006} 38007 38008@Article{ vandenberghe.demoor.ea:generalized, 38009 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 38010 title = {The generalized linear complementarity problem applied to the complete analysis 38011 of resistive piecewise-linear circuits}, 38012 journal = {IEEE Transactions on Circuits and Systems}, 38013 volume = {36}, 38014 year = {1989}, 38015 pages = {1382--1391} 38016} 38017 38018@Article{ vanderbei.meketon.ea:modification, 38019 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 38020 title = {A Modification of {K}armarkar's Algorithm}, 38021 journal = {Algorithmica}, 38022 year = {1986}, 38023 volume = {1}, 38024 pages = {395--407} 38025} 38026 38027@Article{ vanderbei:affine-scaling, 38028 author = {R. J. Vanderbei}, 38029 title = {Affine--Scaling for Linear Programs with Free Variables}, 38030 journal = {Mathematical Programming}, 38031 year = {1989}, 38032 volume = {43}, 38033 pages = {31--44} 38034} 38035 38036@Article{ vanroy.wolsey:solving, 38037 author = {T. J. Van~Roy and L. A. Wolsey}, 38038 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 38039 journal = {Operations Research}, 38040 volume = {35}, 38041 pages = {45--57}, 38042 year = {1987} 38043} 38044 38045@Book{ vapnik:nature, 38046 author = {V. N. Vapnik}, 38047 title = {The Nature of Statistical Learning Theory}, 38048 publisher = {John Wiley \& Sons}, 38049 address = {New York}, 38050 year = {1996} 38051} 38052 38053@Book{ varian:microeconomic, 38054 author = {Hal R. Varian}, 38055 title = {Microeconomic Analysis}, 38056 year = {1978}, 38057 publisher = {W.W. Norton \& Company}, 38058 address = {New York, New York} 38059} 38060 38061@Article{ verhey:immobilizing, 38062 author = {L. J. Verhey}, 38063 title = {Immobilizing and Positioning Patients for Radiotherapy}, 38064 journal = {Seminars in Radiation Oncology}, 38065 year = {1995}, 38066 volume = {5}, 38067 number = {2}, 38068 pages = {100--113} 38069} 38070 38071@Article{ vinante.pintos:differentiable, 38072 author = {C. Vinante and S. Pintos}, 38073 title = {On Differentiable Exact Penalty Functions}, 38074 journal = {Journal of Optimization Theory and Applications}, 38075 year = {1986}, 38076 volume = {50}, 38077 pages = {479--493} 38078} 38079 38080@Article{ vlach:scheduling, 38081 author = {M. Vlach}, 38082 title = {On Scheduling with Earliness and Tardiness Penalties}, 38083 journal = {Methods of Operations Research}, 38084 year = {1983}, 38085 volume = {45}, 38086 pages = {367--375} 38087} 38088 38089@InCollection{ wacker:summary, 38090 author = {H.--J. Wacker}, 38091 title = {A Summary of the Developments on Imbedding Methods}, 38092 booktitle = {Continuation Methods}, 38093 year = {1978}, 38094 editor = {H.--J. Wacker}, 38095 publisher = {Academic Press}, 38096 address = {New York}, 38097 pages = {1--35} 38098} 38099 38100@Article{ wakefield.tin-loi:large, 38101 author = {R. R. Wakefield and F. Tin-Loi}, 38102 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 38103 Formulation}, 38104 journal = {Computer Methods in Applied Mechanics and Engineering}, 38105 volume = {84}, 38106 year = {1990}, 38107 pages = {229--242} 38108} 38109 38110@Article{ wakefield.tin-loi:large*1, 38111 author = {R. R. Wakefield and F. Tin-Loi}, 38112 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 38113 Approach}, 38114 journal = {International Journal Mechanical Science}, 38115 volume = {33}, 38116 year = {1991}, 38117 pages = {379--391} 38118} 38119 38120@Article{ walker:implementation, 38121 author = {H. F. Walker}, 38122 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 38123 journal = {SIAM Journal on Scientific Computing}, 38124 volume = {9}, 38125 year = {1988}, 38126 pages = {152--163} 38127} 38128 38129@Book{ wall.schwartz:programming, 38130 author = {L. Wall and R. L. Schwartz}, 38131 title = {Programming Perl}, 38132 publisher = {O'Reilly and Associates, Inc.}, 38133 address = {Sebastopol, CA}, 38134 year = {1991} 38135} 38136 38137@Book{ walras:elements, 38138 author = {L. Walras}, 38139 title = {Elements of Pure Economics}, 38140 publisher = {Allen and Unwin}, 38141 year = {1954}, 38142 address = {London} 38143} 38144 38145@Article{ wang.monteiro.ea:interior, 38146 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 38147 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 38148 journal = {Mathematical Programming}, 38149 volume = {74}, 38150 pages = {159--196}, 38151 year = {1996} 38152} 38153 38154@Article{ wardi:stochastic, 38155 author = {Y. Wardi}, 38156 title = {A Stochastic Steepest-Descent Algorithm}, 38157 journal = {Journal of Optimization Theory and Applications}, 38158 year = {1988}, 38159 volume = {59}, 38160 pages = {307--323} 38161} 38162 38163@Article{ wardi:stochastic*1, 38164 author = {Y. Wardi}, 38165 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 38166 journal = {Journal of Optimization Theory and Applications}, 38167 year = {1990}, 38168 volume = {64}, 38169 pages = {399--417} 38170} 38171 38172@Article{ wardrop:theoretical, 38173 author = {J. G. Wardrop}, 38174 title = {Some Theoretical Aspects of Road Traffic Research}, 38175 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 38176 year = {1952}, 38177 pages = {325--378} 38178} 38179 38180@Article{ warga:minimizing, 38181 author = {J. Warga}, 38182 title = {Minimizing certain convex functions}, 38183 journal = {Journal of SIAM on Applied Mathematics}, 38184 year = {1963}, 38185 volume = {11}, 38186 pages = {588--593} 38187} 38188 38189@Article{ watson.billups.ea:hompack, 38190 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 38191 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 38192 Algorithms}, 38193 journal = {{ACM} Transactions on Mathematical Software}, 38194 year = {1987}, 38195 volume = {13}, 38196 pages = {281--310} 38197} 38198 38199@Article{ watson.billups.ea:slow, 38200 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 38201 title = {Slow Viscous Flow in a Syringe}, 38202 journal = {Journal of Biomechanical Engineering}, 38203 year = {1986}, 38204 volume = {108}, 38205 pages = {317--323} 38206} 38207 38208@Article{ watson:discrete, 38209 author = {G. A. Watson}, 38210 title = {Discrete $\ell_1$ approximation by rational functions}, 38211 journal = {IMA Journal of Numerical Analysis}, 38212 year = {1984}, 38213 volume = {4}, 38214 pages = {275--288} 38215} 38216 38217@Article{ watson:solving, 38218 author = {L. T. Watson}, 38219 title = {Solving the nonlinear complementarity problem by a homotopy method}, 38220 journal = {SIAM Journal on Control and Optimization}, 38221 year = {1979}, 38222 volume = {17}, 38223 pages = {36--46} 38224} 38225 38226@Article{ webb:optimum, 38227 author = {S. Webb}, 38228 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 38229 Heterogeneity}, 38230 journal = {Physics in Medicine and Biology}, 38231 year = {1994}, 38232 volume = {39}, 38233 pages = {1895--1914} 38234} 38235 38236@Book{ webb:physics, 38237 author = {S. Webb}, 38238 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 38239 publisher = {Institute of Physics Publishing Ltd.}, 38240 year = {1997}, 38241 optaddress = {Philadelphia} 38242} 38243 38244@InBook{ webb:theory, 38245 author = {S. Webb}, 38246 editor = {E. Sternick}, 38247 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 38248 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 38249 publisher = {Advanced Medical Publishing}, 38250 year = {1997} 38251} 38252 38253@Book{ weiss.kulikowski:computer, 38254 author = {S. M. Weiss and C. A. Kulikowski}, 38255 title = {Computer Systems that Learn}, 38256 year = {1991}, 38257 publisher = {Morgan Kaufmann Publishers, Inc}, 38258 address = {San Mateo, California} 38259} 38260 38261@PhDThesis{ werbos:beyond, 38262 author = {P. J. Werbos}, 38263 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 38264 Sciences}, 38265 year = {1974}, 38266 school = {Harvard University} 38267} 38268 38269@InCollection{ wets:convergence, 38270 author = {R. J.-B. Wets}, 38271 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 38272 Problems}, 38273 booktitle = {Variational Inequalites and Complementarity Problems}, 38274 year = {1980}, 38275 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 38276 publisher = {John Wiley \& Sons}, 38277 address = {New York}, 38278 pages = {375--403} 38279} 38280 38281@InCollection{ wets:large, 38282 author = {R. J.-B. Wets}, 38283 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 38284 booktitle = {Numerical Techniques for Stochastic Optimization}, 38285 publisher = {Springer-Verlag}, 38286 year = {1988}, 38287 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 38288 address = {Berlin}, 38289 pages = {65--93} 38290} 38291 38292@Article{ white:asymptotic, 38293 author = {H. White}, 38294 title = {Some asymptotic results for learning in single hidden-layer feedforward network 38295 models}, 38296 journal = {Journal of the American Stattistical Association}, 38297 year = {1989}, 38298 volume = {84}, 38299 number = {408}, 38300 pages = {1003--1013} 38301} 38302 38303@Article{ white:learning, 38304 author = {H. White}, 38305 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 38306 journal = {Neural Computation}, 38307 year = {1989}, 38308 volume = {1}, 38309 pages = {425--461} 38310} 38311 38312@InProceedings{ whitley.starkweather.ea:scheduling, 38313 crossref = {schaeffer:third}, 38314 author = {D. Whitley and T. Starkweather and D. Fuquay}, 38315 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 38316 Operator}, 38317 pages = {133--140} 38318} 38319 38320@Book{ williams:model, 38321 author = {H. P. Williams}, 38322 title = {Model Building in Mathematical Programming}, 38323 publisher = {John Wiley \& Sons}, 38324 year = {1990}, 38325 edition = {Third} 38326} 38327 38328@Book{ wilmott.dewynne.ea:option, 38329 author = {P. Wilmott and J. Dewynne and S. Howison}, 38330 title = {Option Pricing}, 38331 publisher = {Oxford Financial Press}, 38332 year = {1993}, 38333 address = {Oxford, England} 38334} 38335 38336@PhDThesis{ wilson:simplicial, 38337 author = {R. B. Wilson}, 38338 title = {A Simplicial Algorithm for Concave Programming}, 38339 year = {1963}, 38340 address = {Boston, MA}, 38341 school = {Graduate School of Business Administration, Harvard University} 38342} 38343 38344@TechReport{ wolberg.bennett.ea:breast, 38345 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 38346 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 38347 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 38348 Wisconsin}, 38349 year = {1992}, 38350 address = {Madison, WI 53706}, 38351 type = {Manuscript} 38352} 38353 38354@Article{ wolberg.mangasarian:multisurface, 38355 author = {W. H. Wolberg and O. L. Mangasarian}, 38356 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 38357 Cytology}, 38358 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 38359 year = {1990}, 38360 volume = {87}, 38361 pages = {9193--9196} 38362} 38363 38364@Unpublished{ wolberg.mangasarian:wbcd, 38365 author = {W. H. Wolberg and O. L. Mangasarian}, 38366 title = {{WBCD: Wisconsin Breast Cancer Database}}, 38367 year = {1991}, 38368 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 38369 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 38370} 38371 38372@Article{ wolberg.street.ea:breast, 38373 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38374 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 38375 journal = {Analytical and Quantitative Cytology and Histology}, 38376 year = {1993}, 38377 volume = {15}, 38378 number = {6}, 38379 pages = {396--404} 38380} 38381 38382@Unpublished{ wolberg.street.ea:wdbc, 38383 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38384 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 38385 year = {1995}, 38386 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38387 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 38388} 38389 38390@Unpublished{ wolberg.street.ea:wpbc, 38391 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38392 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 38393 year = {1995}, 38394 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38395 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 38396} 38397 38398@Book{ wolsey:integer, 38399 author = {L. A. Wolsey}, 38400 title = {Integer Programming}, 38401 publisher = {John Wiley \& Sons}, 38402 year = {1998}, 38403 address = {New York, NY} 38404} 38405 38406@Article{ womersley:local, 38407 author = {R. S. Womersley}, 38408 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 38409 journal = {Mathematical Programming}, 38410 year = {1985}, 38411 volume = {32}, 38412 pages = {69--89} 38413} 38414 38415@Article{ woo.sanders.ea:peacock, 38416 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 38417 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 38418 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38419 year = {1994}, 38420 volume = {29}, 38421 number = {1}, 38422 pages = {213--214} 38423} 38424 38425@Article{ wright.ralph:superlinear, 38426 author = {S. J. Wright and D. Ralph}, 38427 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 38428 Problems}, 38429 year = {1996}, 38430 journal = {Mathematics of Operations Research}, 38431 volume = {21}, 38432 pages = {815--838} 38433} 38434 38435@TechReport{ wright.zhang:superquadratic, 38436 author = {S. J. Wright and Y. Zhang}, 38437 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 38438 problems}, 38439 institution = {Argonne National Laboratory}, 38440 year = {1994}, 38441 annote = {revised}, 38442 number = {MCS--P418--0294}, 38443 address = {Argonne, Illinois}, 38444 type = {Preprint} 38445} 38446 38447@TechReport{ wright:dynfgm, 38448 author = {S. E. Wright}, 38449 title = {{DYNFGM}: Dynamic Finite Generation Method}, 38450 institution = {Department of Mathematics, University of Washington}, 38451 year = {1989}, 38452 address = {Seattle, Washington} 38453} 38454 38455@Article{ wright:infeasible-interior-point, 38456 author = {S. J. Wright}, 38457 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 38458 journal = {Mathematical Programming}, 38459 volume = {67}, 38460 pages = {29--51}, 38461 year = {1994} 38462} 38463 38464@Article{ wright:path-following, 38465 author = {S. J. Wright}, 38466 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 38467 Complementarity Problems}, 38468 journal = {Optimization Methods and Software}, 38469 year = {1993}, 38470 volume = {2}, 38471 pages = {79--106} 38472} 38473 38474@TechReport{ wright:path-following*1, 38475 author = {S. J. Wright}, 38476 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 38477 Problems}, 38478 institution = {Argonne National Laboratory}, 38479 year = {1993}, 38480 number = {MCS--P401--1293}, 38481 address = {Argonne, Illinois} 38482} 38483 38484@Book{ wright:primal-dual, 38485 author = {S. J. Wright}, 38486 title = {Primal--Dual Interior--Point Methods}, 38487 year = {1997}, 38488 publisher = {SIAM}, 38489 address = {Philadelphia, Pennsylvania} 38490} 38491 38492@TechReport{ wright:reduced, 38493 author = {S. J. Wright}, 38494 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 38495 institution = {Argonne National Laboratory}, 38496 year = {2000}, 38497 number = {MCS--P808--0400}, 38498 address = {Argonne, Illinois} 38499} 38500 38501@Article{ wright:solution, 38502 author = {S. J. Wright}, 38503 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 38504 journal = {Parallel Computing}, 38505 year = {1990}, 38506 volume = {16}, 38507 pages = {221--238} 38508} 38509 38510@Article{ wu.bourland:morphology, 38511 author = {Q. J. Wu and J. D. Bourland}, 38512 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 38513 isocenters}, 38514 journal = {Medical Physics}, 38515 year = {1999}, 38516 volume = {26}, 38517 number = {10}, 38518 pages = {2151--2160} 38519} 38520 38521@Misc{ wunderling:soplex, 38522 author = {R. Wunderling}, 38523 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 38524 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 38525} 38526 38527@Article{ xiao.harker:nonsmooth, 38528 author = {B. Xiao and P. T. Harker}, 38529 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 38530 journal = {Mathematical Programming}, 38531 year = {1994}, 38532 volume = {65}, 38533 pages = {151--194} 38534} 38535 38536@Article{ xiao.harker:nonsmooth*1, 38537 author = {B. Xiao and P. T. Harker}, 38538 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 38539 Results}, 38540 journal = {Mathematical Programming}, 38541 year = {1994}, 38542 volume = {65}, 38543 pages = {195--216} 38544} 38545 38546@Article{ xiao.zhou:nonmonotone, 38547 author = {Y. Xiao and F. J. Zhou}, 38548 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 38549 Minimization}, 38550 journal = {Computing}, 38551 year = {1992}, 38552 volume = {48}, 38553 pages = {303--317} 38554} 38555 38556@TechReport{ xiao:global, 38557 author = {B. Xiao}, 38558 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 38559 {B}-differentiable equation approach}, 38560 type = {{Ph.D. Thesis}}, 38561 year = {1990}, 38562 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 38563 address = {Philadelphia, PA} 38564} 38565 38566@Article{ xu.burke:polynomial, 38567 author = {S. Xu and J. V. Burke}, 38568 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 38569 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 38570 year = {1999}, 38571 journal = {Mathematical Programming}, 38572 volume = {86}, 38573 pages = {91--104} 38574} 38575 38576@TechReport{ xu:global, 38577 author = {S. Xu}, 38578 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 38579 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 38580 institution = {Department of Mathematics, University of Washington}, 38581 year = {1996}, 38582 type = {Technical Report}, 38583 address = {Seattle, WA} 38584} 38585 38586@Article{ yajima.konno:efficient, 38587 author = {Y. Yajima and H. Konno}, 38588 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 38589 Problems}, 38590 journal = {Journal of Global Optimization}, 38591 year = {1991}, 38592 volume = {1:1}, 38593 pages = {155--171} 38594} 38595 38596@Article{ yamamoto:path-following, 38597 author = {Y. Yamamoto}, 38598 title = {A Path--Following Algorithm for Stationary Point Problems}, 38599 journal = {Journal of Operations Society of Japan}, 38600 year = {1987}, 38601 volume = {30}, 38602 pages = {181--198} 38603} 38604 38605@Article{ yamashita.fukushima:modified, 38606 author = {N. Yamashita and M. Fukushima}, 38607 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 38608 Complementarity Problems}, 38609 journal = {Mathematical Programming}, 38610 year = {1997}, 38611 volume = {76}, 38612 pages = {469--492} 38613} 38614 38615@Article{ yamashita.fukushima:stationary, 38616 author = {N. Yamashita and M. Fukushima}, 38617 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 38618 Problems}, 38619 journal = {Journal of Optimization Theory and Applications}, 38620 volume = {84}, 38621 pages = {653--663}, 38622 year = {1995} 38623} 38624 38625@Article{ yamashita.taji.ea:unconstrained, 38626 author = {N. Yamashita and K. Taji and M. Fukushima}, 38627 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 38628 journal = {Journal of Optimization Theory and Applications}, 38629 year = {1997}, 38630 volume = {92}, 38631 pages = {439--456} 38632} 38633 38634@TechReport{ yamashita:properties, 38635 author = {N. Yamashita}, 38636 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 38637 Complementarity Problem}, 38638 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 38639 year = {1996}, 38640 type = {Technical Report}, 38641 address = {Kyoto, Japan} 38642} 38643 38644@Article{ yang.mackie.ea:investigation, 38645 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 38646 Thomadsen}, 38647 title = {An investigation of tomotherapy beam delivery}, 38648 journal = {Medical Physics}, 38649 year = {1997}, 38650 volume = {24}, 38651 number = {3}, 38652 pages = {425--436} 38653} 38654 38655@Article{ yan.shu.ea:clinical, 38656 author = {Y. Yan and H. Shu and X. Bao}, 38657 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 38658 Treatmen System}, 38659 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38660 year = {1997}, 38661 volume = {39}, 38662 pages = {247--254} 38663} 38664 38665@Article{ yau.gao:obstacle, 38666 author = {S. T. Yau and Y. Gao}, 38667 title = {Obstacle problem for von {K}arm\'an equations}, 38668 journal = {Advances in Applied Mathematics}, 38669 volume = {13}, 38670 year = {1992}, 38671 pages = {123--141} 38672} 38673 38674@Article{ ye.tse:extension, 38675 author = {Y. Ye and E. Tse}, 38676 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 38677 Programming}, 38678 journal = {Mathematical Programming}, 38679 year = {1989}, 38680 volume = {44} 38681} 38682 38683@Article{ ye:affine, 38684 author = {Y. Ye}, 38685 title = {On affine scaling algorithms for nonconvex quadratic programming}, 38686 journal = {Mathematical Programming}, 38687 year = {1992}, 38688 volume = {56}, 38689 pages = {285--300} 38690} 38691 38692@PhDThesis{ ye:interior, 38693 author = {Y. Ye}, 38694 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 38695 Programming}, 38696 year = {1987}, 38697 address = {Stanford, California}, 38698 school = {Department of Engineering--Economic Systems, Stanford University} 38699} 38700 38701@Book{ ye:interior*1, 38702 author = {Y. Ye}, 38703 title = {Interior-Point Algorithms: Theory and Analysis}, 38704 publisher = {John Wiley \& Sons}, 38705 year = {1997}, 38706 address = {New York, NY} 38707} 38708 38709@Article{ yu:convergence, 38710 author = {W. --C. Yu}, 38711 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 38712 journal = {Scientia Sinica, Special issue of Mathematics}, 38713 year = {1979}, 38714 volume = {1}, 38715 pages = {68--77} 38716} 38717 38718@Article{ yu.schell:genetic, 38719 author = {Y. Yu and M. C. Schell}, 38720 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 38721 journal = {Medical Physics}, 38722 year = {1996}, 38723 volume = {23}, 38724 pages = {2085--2091} 38725} 38726 38727@Article{ yuan:superlinear, 38728 author = {Y. Yuan}, 38729 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 38730 Optimization}, 38731 journal = {Mathematical Programming}, 38732 year = {1985}, 38733 volume = {31}, 38734 pages = {269--285} 38735} 38736 38737@Book{ zangwill:nonlinear, 38738 author = {W. I. Zangwill}, 38739 title = {Nonlinear Programming: {A} Unified Approach}, 38740 year = {1969}, 38741 publisher = {Prentice-Hall, Inc}, 38742 address = {Englewood Cliffs, New Jersey} 38743} 38744 38745@TechReport{ zangwill:nonlinear*1, 38746 author = {W. I. Zangwill}, 38747 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 38748 institution = {Center for Research in Management Science, University of California}, 38749 year = {1965}, 38750 address = {Berkeley}, 38751 number = {131}, 38752 type = {Working Paper} 38753} 38754 38755@Article{ zangwill:nonlinear*2, 38756 author = {W. I. Zangwill}, 38757 title = {Nonlinear Programming via Penalty Functions}, 38758 journal = {Management Science}, 38759 year = {1967}, 38760 volume = {13}, 38761 pages = {344--358} 38762} 38763 38764@TechReport{ zenios.censor:massively, 38765 author = {S. A. Zenios and Y. Censor}, 38766 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 38767 Problems}, 38768 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 38769 year = {1990}, 38770 type = {report}, 38771 number = {89-09-10}, 38772 address = {Philadelphia, PA} 38773} 38774 38775@Article{ zenios.lasken:nonlinear, 38776 author = {S. A. Zenios and R. A. Lasken}, 38777 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 38778 journal = {Annals of Operations Research}, 38779 year = {1988}, 38780 volume = {14}, 38781 pages = {147--163} 38782} 38783 38784@Article{ zenios.mulvey:distributed, 38785 author = {S. A. Zenios and J. M. Mulvey}, 38786 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 38787 journal = {Parallel Computing}, 38788 year = {1988}, 38789 volume = {6}, 38790 pages = {43--56} 38791} 38792 38793@TechReport{ zenios.neilsen:massively, 38794 author = {S. A. Zenios and S. Neilsen}, 38795 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 38796 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38797 year = {1990}, 38798 type = {report}, 38799 number = {90-03-01}, 38800 address = {Philadelphia, PA} 38801} 38802 38803@TechReport{ zenios.qi.ea:comparative, 38804 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 38805 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 38806 Nonlinear Network Optimization}, 38807 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38808 year = {1990}, 38809 type = {report}, 38810 number = {89-10-02}, 38811 address = {Philadelphia, PA} 38812} 38813 38814@Article{ zhang.kim.ea:improved, 38815 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 38816 title = {An Improved Successive Linear Programming Algorithm}, 38817 year = {1985}, 38818 journal = {Management Science}, 38819 volume = {31}, 38820 pages = {1312--1331} 38821} 38822 38823@Article{ zhang.tapia.ea:superlinear, 38824 author = {Y. Zhang and R. A. Tapia and F. Potra}, 38825 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 38826 of problems}, 38827 journal = {SIAM Journal on Optimization}, 38828 year = {1993}, 38829 volume = {3}, 38830 number = {?}, 38831 pages = {413--422}, 38832} 38833 38834@Article{ zhang.tapia:superlinearly, 38835 author = {Y. Zhang and R. A. Tapia}, 38836 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 38837 linear programming}, 38838 journal = {SIAM Journal on Optimization}, 38839 year = {1993}, 38840 volume = {3}, 38841 pages = {118--133} 38842} 38843 38844@TechReport{ zhang.zhang:superlinear, 38845 author = {Y. Zhang and D. Zhang}, 38846 title = {Superlinear convergence of infeasible interior-point methods for linear 38847 programming}, 38848 institution = {Department of Mathematics and Statistics, University of Maryland}, 38849 year = {1992}, 38850 number = {92-15}, 38851 address = {Baltimore County, Maryland} 38852} 38853 38854@Article{ zhang:convergence, 38855 author = {Yin Zhang}, 38856 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 38857 Horizontal Linear Complementarity Problem}, 38858 journal = {SIAM Journal on Optimization}, 38859 year = {1994}, 38860 volume = {4}, 38861 pages = {208--227} 38862} 38863 38864@Article{ zhang:convergence*1, 38865 author = {Y. Zhang}, 38866 title = {On the convergence of a class of infeasible interior-point methods for the 38867 horizontal linear complementarity problem}, 38868 journal = {SIAM Journal on Optimization}, 38869 year = {1994}, 38870 volume = {4}, 38871 pages = {208--227} 38872} 38873 38874@Article{ zhu.rockafellar:primal-dual, 38875 author = {C. Y. Zhu and R. T. Rockafellar}, 38876 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 38877 Programming}, 38878 journal = {SIAM Journal on Optimization}, 38879 year = {1993}, 38880 volume = {3}, 38881 pages = {751--783} 38882} 38883 38884@Article{ zhu:modified, 38885 author = {C. Y. Zhu}, 38886 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 38887 journal = {Computational Optimization and Applications}, 38888 year = {1992}, 38889 volume = {2}, 38890 pages = {182--205} 38891} 38892 38893@Article{ zhu:primal-dual, 38894 author = {C. Y. Zhu}, 38895 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 38896 Programming}, 38897 journal = {SIAM Journal on Optimization}, 38898 year = {1995}, 38899 volume = {5}, 38900 pages = {114--128} 38901} 38902 38903@Book{ zoutendijk:methods, 38904 author = {G. Zoutendijk}, 38905 title = {Methods of Feasible Directions}, 38906 year = {1960}, 38907 publisher = {Elsevier Publishing Company}, 38908 address = {Amsterdam} 38909} 38910 38911@Article{ zowe.kurcyusz:regularity, 38912 author = {J. Zowe and S. Kurcyusz}, 38913 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 38914 journal = {Applied Mathematics and Optimization}, 38915 year = {1979}, 38916 volume = {5}, 38917 pages = {49--62} 38918} 38919 38920@InProceedings{ zowe:nondifferentiable, 38921 author = {J. Zowe}, 38922 title = {Nondifferentiable Optimization}, 38923 booktitle = {Computational Mathematical Programming}, 38924 year = {1985}, 38925 editor = {K. Schittkowski}, 38926 publisher = {Springer-Verlag}, 38927 address = {Berlin} 38928} 38929 38930@Proceedings{ bachem.grotschel.ea:mathematical, 38931 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 38932 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 38933 year = {1983}, 38934 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 38935 publisher = {Springer Verlag}, 38936 address = {Berlin} 38937} 38938 38939@Proceedings{ belew.booker:fourth, 38940 year = {1991}, 38941 editor = {R. K. Belew and L. B. Booker}, 38942 publisher = {Morgan Kaufmann Publishers, Inc}, 38943 address = {San Mateo, California}, 38944 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 38945} 38946 38947@Proceedings{ coleman.li:large-scale, 38948 year = {1990}, 38949 editor = {T. F. Coleman and Y. Li}, 38950 publisher = {SIAM}, 38951 address = {Philadelphia, Pennsylvania}, 38952 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 38953 University, Ithaca, New York, October 19-20, 1989}, 38954 booktitle = {Large-Scale Numerical Optimization} 38955} 38956 38957@Book{ davis:genetic, 38958 title = {Genetic Algorithms and Simulated Annealing}, 38959 year = {1987}, 38960 editor = {L. D. Davis}, 38961 publisher = {Pitman}, 38962 address = {London}, 38963 booktitle = {Genetic Algorithms and Simulated Annealing} 38964} 38965 38966@Proceedings{ ferris.pang:complementarity, 38967 title = {Complementarity and Variational Problems: State of the Art}, 38968 booktitle = {Complementarity and Variational Problems: State of the Art}, 38969 year = {1997}, 38970 key = {57}, 38971 editor = {M. C. Ferris and J. S. Pang}, 38972 publisher = {SIAM Publications}, 38973 address = {Philadelphia, Pennsylvania} 38974} 38975 38976@Proceedings{ ferris.mangasarian.ea:complementarity, 38977 title = {Complementarity: Applications, Algorithms and Extensions}, 38978 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 38979 year = {2001}, 38980 key = {95}, 38981 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 38982 publisher = {Kluwer Academic Publishers}, 38983 address = {Dordrecht, The Netherlands} 38984} 38985 38986@Proceedings{ florian:traffic, 38987 title = {Traffic Equilibrium Methods}, 38988 year = {1976}, 38989 editor = {M. Florian}, 38990 publisher = {Springer-Verlag}, 38991 address = {Berlin} 38992} 38993 38994@Proceedings{ grefenstette:genetic, 38995 title = {Genetic Algorithms and their Applications: Proceedings of the Second 38996 International Conference on Genetic Algorithms}, 38997 year = {1987}, 38998 editor = {J. J. Grefenstette}, 38999 publisher = {Lawrence Erlbaum Associates}, 39000 address = {Hillsdale, New Jersey}, 39001 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 39002 International Conference on Genetic Algorithms} 39003} 39004 39005@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 39006 booktitle = {Nonlinear Programming}, 39007 volume = {2}, 39008 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 39009 publisher = {Academic Press}, 39010 address = {New York}, 39011 year = {1975} 39012} 39013 39014@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 39015 booktitle = {Nonlinear Programming}, 39016 volume = {3}, 39017 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 39018 publisher = {Academic Press}, 39019 address = {London}, 39020 year = {1978} 39021} 39022 39023@Proceedings{ robinson:local, 39024 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 39025 Regularity}, 39026 year = {1983}, 39027 editor = {V. Pereyra and A. Reinoza}, 39028 publisher = {Springer-Verlag}, 39029 address = {Berlin}, 39030 author = {S. M. Robinson}, 39031 pages = {240--251}, 39032 series = {Numerical Methods: Proceedings, Caracas 1982} 39033} 39034 39035@Proceedings{ schaeffer:third, 39036 year = {1989}, 39037 editor = {J. D. Schaeffer}, 39038 publisher = {Morgan Kaufmann Publishers, Inc}, 39039 address = {San Mateo, California}, 39040 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 39041} 39042 39043@Book{ vanderbei:linear, 39044 author = {R. J. Vanderbei}, 39045 title = {Linear Programming: Foundations and Extensions}, 39046 year = {1997}, 39047 publisher = {Kluwer Academic Publishers}, 39048 address = {Boston, Massachusetts} 39049} 39050 39051@Book{ dfobook, 39052 title = {Introduction to Derivative-Free Optimization}, 39053 publisher = {Society for Industrial and Applied Mathematics}, 39054 year = {2009}, 39055 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 39056 series = {MPS/SIAM Series on Optimization}, 39057 address = {Philadelphia, PA, USA}, 39058 isbn = {0-89871-460-5} 39059} 39060 39061@Article{ unedf0, 39062 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 39063 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 39064 title = {Nuclear Energy Density Optimization}, 39065 journal = {Physical Review C}, 39066 year = {2010}, 39067 volume = {82}, 39068 number = {2}, 39069 pages = {024313}, 39070 doi = {10.1103/PhysRevC.82.024313} 39071} 39072 39073@Article{ hestenes1969multiplier, 39074 title = {Multiplier and gradient methods}, 39075 author = {Hestenes, Magnus R}, 39076 journal = {Journal of optimization theory and applications}, 39077 volume = {4}, 39078 number = {5}, 39079 pages = {303--320}, 39080 year = {1969}, 39081 publisher = {Springer} 39082} 39083 39084@Article{ powell1969method, 39085 title = {A method for nonlinear constraints in minimization problems}, 39086 author = {Powell, Michael JD}, 39087 journal = {Optimization}, 39088 pages = {283--298}, 39089 year = {1969}, 39090 publisher = {Academic Press} 39091} 39092 39093@Book{ nocedal2006numerical, 39094 title = {Numerical optimization}, 39095 author = {Jorge Nocedal and Stephen Wright}, 39096 year = {2006}, 39097 publisher = {Springer Science \& Business Media} 39098} 39099 39100@Article{ rockafellar1974augmented, 39101 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 39102 author = {Rockafellar, R Tyrrell}, 39103 journal = {SIAM Journal on Control}, 39104 volume = {12}, 39105 number = {2}, 39106 pages = {268--285}, 39107 year = {1974}, 39108 publisher = {SIAM} 39109} 39110 39111@Article{ bacuta2006, 39112 title = {A unified approach for Uzawa algorithms}, 39113 author = {Constantin Bacuta}, 39114 journal = {SIAM Journal on Numerical Analysis}, 39115 volume = {44}, 39116 number = {6}, 39117 pages = {2633--2649}, 39118 year = {2006} 39119} 39120 39121@Article{ manteuffelrugesouthworth2018, 39122 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 39123 (AIR)}, 39124 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 39125 journal = {SIAM Journal on Scientific Computing}, 39126 volume = {40}, 39127 number = {6}, 39128 pages = {A4105--A4130}, 39129 year = {2018} 39130} 39131 39132@Article{ manteuffelmunzenmaierrugesouthworth2019, 39133 title = {Nonsymmetric reduction-based algebraic multigrid}, 39134 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 39135 journal = {SIAM Journal on Scientific Computing}, 39136 volume = {41}, 39137 number = {5}, 39138 pages = {S242--S268}, 39139 year = {2019} 39140} 39141 39142@PhDThesis{ sivas2021, 39143 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 39144 author = {Abdullah Ali Sivas}, 39145 department = {Applied Mathematics}, 39146 institution = {University of Waterloo}, 39147 year = {2021} 39148} 39149 39150@Article{ brookshughes1982, 39151 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 39152 with particular emphasis on the incompressible {Navier-Stokes} equations}, 39153 author = {Alexander N Brooks and Thomas JR Hughes}, 39154 journal = {Computer methods in applied mechanics and engineering}, 39155 volume = {32}, 39156 number = {1-3}, 39157 pages = {199--259}, 39158 year = {1982}, 39159 publisher = {Elsevier} 39160} 39161 39162@InProceedings{ suhisaac2020, 39163 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 39164 author = {Hansol Suh and Tobin Isaac}, 39165 booktitle = {SC20: International Conference for High Performance Computing, Networking, 39166 Storage and Analysis}, 39167 pages = {1--12}, 39168 year = {2020}, 39169 organization = {IEEE} 39170} 39171 39172@Misc{ alauzet2010, 39173 title = {Metric-Based Anisotropic Mesh Adaptation}, 39174 author = {Fr\'{e}d\'{e}ric Alauzet}, 39175 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 39176 year = {2010} 39177} 39178 39179@Article{ chan1994qmrcgs, 39180 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 39181 systems}, 39182 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 39183 and Tong, Charles H}, 39184 journal = {SIAM Journal on Scientific Computing}, 39185 volume = {15}, 39186 number = {2}, 39187 pages = {338--347}, 39188 year = {1994}, 39189 publisher = {SIAM} 39190} 39191 39192@Article{ ghai2019comparison, 39193 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 39194 nonsymmetric linear systems}, 39195 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 39196 journal = {Numerical Linear Algebra with Applications}, 39197 volume = {26}, 39198 number = {1}, 39199 pages = {e2215}, 39200 year = {2019}, 39201 publisher = {Wiley Online Library} 39202} 39203 39204@Article{ mishrasalacknepley2025, 39205 title = {Stencil Composition for Finite Difference Approximations of Partial Differential Equations}, 39206 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 39207 journal = {SIAM Journal on Scientific Computing}, 39208 volume = {47}, 39209 number = {2}, 39210 doi = {10.1137/23M1596478}, 39211 year = {2025} 39212} 39213 39214@Article{ nathawaniknepley2022, 39215 title = {Droplet formation simulation using mixed finite elements}, 39216 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39217 journal = {Physics of Fluids}, 39218 volume = {34}, 39219 pages = {064105}, 39220 doi = {10.1063/5.0089752}, 39221 year = {2022} 39222} 39223 39224@InProceedings{ nathawaniknepley2022b, 39225 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 39226 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39227 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 39228 (ICCFD11)}, 39229 editor = {Christoph Brehm and Shishir Pandya}, 39230 number = {4103}, 39231 year = {2022} 39232} 39233 39234@Article{ nathawaniknepley2023, 39235 title = {A one-dimensional mathematical model for shear-induced droplet formation in co-flowing fluids}, 39236 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39237 journal = {Theoretical and Computational Fluid Dynamics}, 39238 url = {https://rdcu.be/dFtlR}, 39239 doi = {10.1007/s00162-024-00690-5}, 39240 year = {2024} 39241} 39242 39243@InProceedings{ georgalisnathawaniknepleypatra2023, 39244 title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, 39245 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 39246 Patra}, 39247 booktitle = {AIAA SciTech 2024}, 39248 note = {Accepted}, 39249 year = {2023} 39250} 39251 39252@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 39253 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 39254 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 39255 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 39256 Thompson and Junchao Zhang}, 39257 doi = {10.48550/ARXIV.2204.01722}, 39258 url = {https://arxiv.org/abs/2204.01722}, 39259 publisher = {arXiv}, 39260 note = {Submitted}, 39261 year = {2022} 39262} 39263 39264@InCollection{ mayknepley2023, 39265 title = {Numerical Modeling of Subduction}, 39266 author = {Dave A. May and Matthew G. Knepley}, 39267 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 39268 editor = {João C. Duarte}, 39269 pages = {539-571}, 39270 isbn = {978-0-323-85733-8}, 39271 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 39272 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 39273 year = {2023} 39274} 39275 39276@Article{ adamswangmersonhucksknepley2024, 39277 title = {A performance portable, fully implicit {Landau} collision operator with batched linear solvers}, 39278 author = {Mark F. Adams and Peng Wang and Jacob Merson and Kevin Hucks and Matthew G. Knepley}, 39279 journal = {SIAM Journal on Scientific Computing}, 39280 volume = {47}, 39281 number = {2}, 39282 pages = {B360-B381}, 39283 doi = {10.1137/24M1640252}, 39284 url = {https://arxiv.org/abs/2209.03228}, 39285 year = {2025}, 39286 petsc_uses = {DMPlex} 39287} 39288 39289@Article{ adamsknepley2023, 39290 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 39291 plasmas in {PETSc}}, 39292 author = {Mark F. Adams and Matthew G. Knepley}, 39293 url = {https://arxiv.org/abs/2302.10242}, 39294 note = {In preparation}, 39295 year = {2023}, 39296 petsc_uses = {DMPlex} 39297} 39298 39299@Article{ finnknepleypusztayadams2023, 39300 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 39301 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 39302 url = {https://arxiv.org/abs/2303.12620}, 39303 journal = {Communications in Applied Mathematics and Computational Science}, 39304 volume = {18}, 39305 number = {1}, 39306 pages = {135--152}, 39307 doi = {10.2140/camcos.2023.18.135}, 39308 year = {2023}, 39309 petsc_uses = {DMPlex} 39310} 39311 39312@Article{ adamsfinnknepleypusztay2025, 39313 title = {A projection method for particle resampling}, 39314 author = {Mark F. Adams and Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay}, 39315 url = {https://arxiv.org/abs/2501.13681}, 39316 journal = {Computer Physics Communications}, 39317 note = {Submitted}, 39318 year = {2025}, 39319 petsc_uses = {DMPlex} 39320} 39321 39322@Article{ finnpusztayknepleyadams2025, 39323 title = {Entropy Monotonicity using {Discrete Gradients} in the {Vlasov-Poisson-Landau} System}, 39324 author = {Daniel S. Finn and Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 39325 journal = {Journal of Computational Physics}, 39326 note = {Submitted}, 39327 year = {2025}, 39328 petsc_uses = {DMPlex} 39329} 39330 39331@Article{ hamhaplaknepleymitchellsagiyama2024, 39332 title = {Efficient N-to-M Checkpointing Algorithm for Finite Element Simulations}, 39333 author = {David A. Ham and Vaclav Hapla and Matthew G. Knepley and Lawrence Mitchell and Koki Sagiyama}, 39334 journal = {SIAM Journal on Scientific Computing}, 39335 volume = {46}, 39336 number = {6}, 39337 url = {https://arXiv.org/abs/2401.05868}, 39338 doi = {10.1137/23M161372}, 39339 year = {2024}, 39340 petsc_uses = {DMPlex} 39341} 39342 39343@InProceedings{ retfalviknepleydesjardin2025, 39344 title = {Performance Modeling and Scaling of PETSc based Direct Numerical Simulations for Hybrid Rocket Boundary Layers}, 39345 author = {Kolos Retfalvi and Matthew G. Knepley and Paul E. DesJardin}, 39346 booktitle = {Proceedings of the ASME 2025, Fluids Engineering Division Summer Meeting}, 39347 note = {Accepted}, 39348 year = {2025} 39349} 39350 39351@Article{ retfalviwhitesidesmcgurnknepleydesjardin2025, 39352 title = {Direct Numerical Simulations for Hybrid Rocket Boundary Layers: Performance Modeling and Scaling}, 39353 author = {Kolos Retfalvi and Russell Whitesides and Matthew McGurn and Matthew G. Knepley and Paul E. DesJardin}, 39354 journal = {International Journal of High Performance Computing Applications}, 39355 note = {Submitted}, 39356 year = {2025} 39357} 39358 39359@Article{ knepley2025, 39360 title = {Transformations of Computational Meshes}, 39361 author = {Matthew G. Knepley}, 39362 journal = {Engineering with Computers}, 39363 note = {Accepted}, 39364 year = {2025}, 39365 petsc_uses = {DMPlex} 39366} 39367 39368@Article{ eggersdupont1994, 39369 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 39370 equation}, 39371 author = {Jens Eggers and Todd F. Dupont}, 39372 journal = {Journal of fluid mechanics}, 39373 volume = {262}, 39374 pages = {205--221}, 39375 year = {1994}, 39376 publisher = {Cambridge University Press} 39377} 39378 39379@PhDThesis{ pusztaythesis2023, 39380 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 39381 author = {Joseph V. Pusztay}, 39382 type = {{PhD} thesis}, 39383 school = {University at Buffalo, Department of Computer Science and Engineering}, 39384 address = {Buffalo, NY}, 39385 month = may, 39386 year = {2022} 39387} 39388 39389@PhDThesis{ finnthesis2023, 39390 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 39391 System}, 39392 author = {Daniel S. Finn}, 39393 type = {{PhD} thesis}, 39394 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39395 Engineering}, 39396 address = {Buffalo, NY}, 39397 month = may, 39398 year = {2023} 39399} 39400 39401@PhDThesis{ nathawanithesis2023, 39402 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 39403 author = {Darsh Kiritbhai Nathawani}, 39404 type = {{PhD} thesis}, 39405 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39406 Engineering}, 39407 address = {Buffalo, NY}, 39408 month = may, 39409 year = {2023} 39410} 39411 39412@PhDThesis{ dentonthesis2022, 39413 title = {Geometry Aware Mesh Topologies}, 39414 author = {Brandon Lee Denton}, 39415 type = {{PhD} thesis}, 39416 school = {University at Buffalo, Department of Mechanical and Aerospace Engineering}, 39417 address = {Buffalo, NY}, 39418 month = may, 39419 year = {2022} 39420} 39421 39422@Book{ glassables2003, 39423 title = {UNIX for Programmers and Users}, 39424 author = {Graham Glass and King Ables}, 39425 year = {2003}, 39426 publisher = {Pearson Education India} 39427} 39428 39429@Book{ neuenschwander2017, 39430 title = {{Emmy} {Noether's} wonderful theorem}, 39431 author = {Dwight E. Neuenschwander}, 39432 year = {2017}, 39433 publisher = {JHU Press} 39434} 39435 39436@Article{ horvath2004, 39437 title = {On the positivity of matrix-vector products}, 39438 author = {Zoltan Horvath}, 39439 journal = {Linear algebra and its applications}, 39440 volume = {393}, 39441 pages = {253--258}, 39442 year = {2004} 39443} 39444 39445@Article{ kraus2017, 39446 title = {Metriplectic integrators for the {Landau} collision operator}, 39447 author = {Michael Kraus and Eero Hirvijoki}, 39448 journal = {Physics of Plasmas}, 39449 volume = {24}, 39450 number = {10}, 39451 year = {2017} 39452} 39453 39454@Article{ ottinger2018, 39455 title = {{GENERIC} Integrators: Structure Preserving Time Integration for Thermodynamic Systems}, 39456 author = {Hans Christian {\"O}ttinger}, 39457 journal = {Journal of Non-Equilibrium Thermodynamics}, 39458 volume = {43}, 39459 issue = {2}, 39460 pages = {89--100}, 39461 doi = {10.1515/jnet-2017-0034}, 39462 issn = {14374358}, 39463 month = {4}, 39464 year = {2018} 39465} 39466 39467@Article{ sureshhuynh1997, 39468 title = {Accurate Monotonicity-Preserving Schemes with {Runge--Kutta} Time Stepping}, 39469 author = {A. Suresh and H.T. Huynh}, 39470 journal = {Journal of Computational Physics}, 39471 volume = {136}, 39472 number = {1}, 39473 pages = {83--99}, 39474 issn = {0021-9991}, 39475 doi = {10.1006/jcph.1997.5745}, 39476 year = {1997} 39477} 39478 39479@Article{ ketcheson2019, 39480 title = {Relaxation {Runge--Kutta} methods: Conservation and stability for inner-product norms}, 39481 author = {David I Ketcheson}, 39482 journal = {SIAM Journal on Numerical Analysis}, 39483 volume = {57}, 39484 number = {6}, 39485 pages = {2850--2870}, 39486 year = {2019} 39487} 39488 39489@Article{ ranochaketcheson2020, 39490 title = {Relaxation {Runge--Kutta} methods for {Hamiltonian} problems}, 39491 author = {Hendrik Ranocha and David I Ketcheson}, 39492 journal = {Journal of Scientific Computing}, 39493 volume = {84}, 39494 number = {1}, 39495 pages = {17}, 39496 year = {2020} 39497} 39498 39499@Article{ munthekaas1999, 39500 title = {High order {Runge--Kutta} methods on manifolds}, 39501 author = {Hans Munthe-Kaas}, 39502 journal = {Applied Numerical Mathematics}, 39503 volume = {29}, 39504 number = {1}, 39505 pages = {115--127}, 39506 year = {1999} 39507} 39508 39509@Article{ brower1971chiral, 39510 title = {A chiral invariant dual model}, 39511 author = {Richard C Brower}, 39512 journal = {Physics Letters B}, 39513 volume = {34}, 39514 number = {2}, 39515 pages = {143--146}, 39516 year = {1971} 39517} 39518 39519@misc{ skeelcieslinski2020, 39520 title = {On the famous unpublished preprint ``{Methods} of integration which preserve the contact transformation property of the {Hamilton} equations'' by {Ren\'e De Vogelaere}}, 39521 author = {Robert D. Skeel and Jan L. Cie{\'s}li{\'n}ski}, 39522 eprint = {2003.12268}, 39523 archivePrefix = {arXiv}, 39524 primaryClass = {math.NA}, 39525 url = {https://arxiv.org/abs/2003.12268}, 39526 year = {2020} 39527} 39528 39529@PhdThesis{ bonelle2014, 39530 title = {{Compatible Discrete Operator} schemes on polyhedral meshes for elliptic and {Stokes} equations}, 39531 author = {J{\'e}r{\^o}me Bonelle}, 39532 school = {Universit{\'e} Paris-Est}, 39533 year = {2014} 39534} 39535 39536@Article{ jansenwhitinghulbert2000, 39537 title = {A generalized-$\alpha$ method for integrating the filtered Navier--Stokes equations with a stabilized finite element method}, 39538 author = {Kenneth E Jansen and Christian H Whiting and Gregory M Hulbert}, 39539 journal = {Computer methods in applied mechanics and engineering}, 39540 volume = {190}, 39541 number = {3-4}, 39542 pages = {305--319}, 39543 year = {2000} 39544} 39545 39546@Article{ shampine1982, 39547 title = {Implementation of {Rosenbrock} methods}, 39548 author = {Lawrence F Shampine}, 39549 journal = {ACM Transactions on Mathematical Software (TOMS)}, 39550 volume = {8}, 39551 number = {2}, 39552 pages = {93--113}, 39553 year = {1982} 39554} 39555 39556@Article{ benettingiorgilli1994, 39557 title = {On the {Hamiltonian} interpolation of near-to-the identity symplectic mappings with application to symplectic integration algorithms}, 39558 author = {Giancarlo Benettin and Antonio Giorgilli}, 39559 journal = {Journal of Statistical Physics}, 39560 volume = {74}, 39561 pages = {1117--1143}, 39562 year = {1994} 39563} 39564 39565@Article{ qintang2013, 39566 title = {Why is {Boris} algorithm so good?}, 39567 author = {Hong Qin and Shuangxi Zhang and Jianyuan Xiao and Jian Liu and Yajuan Sun and William M Tang}, 39568 journal = {Physics of Plasmas}, 39569 volume = {20}, 39570 number = {8}, 39571 year = {2013} 39572} 39573 39574@Article{ gonzalez1996, 39575 title = {Time integration and discrete {Hamiltonian} systems}, 39576 author = {Oscar Gonzalez}, 39577 journal = {Journal of Nonlinear Science}, 39578 volume = {6}, 39579 pages = {449--467}, 39580 year = {1996} 39581} 39582 39583@Article{ hartenlaxvanleer1983, 39584 title = {On upstream differencing and Godunov-type schemes for hyperbolic conservation laws}, 39585 author = {Amiram Harten and Peter D Lax and Bram van Leer}, 39586 journal = {SIAM review}, 39587 volume = {25}, 39588 number = {1}, 39589 pages = {35--61}, 39590 year = {1983} 39591} 39592 39593@Article{ feinbergfriedbergleeren1984, 39594 title = {Lattice gravity near the continuum limit}, 39595 author = {Gerald Feinberg and Richard M Friedberg and Tsung-Dao Lee and Hai-Cang Ren}, 39596 journal = {Nuclear Physics B}, 39597 volume = {245}, 39598 pages = {343--368}, 39599 year = {1984} 39600} 39601 39602@Book{ zeldovichraizer2002, 39603 title = {Physics of shock waves and high-temperature hydrodynamic phenomena}, 39604 author = {Ya B Zel'Dovich and Yu P Raizer}, 39605 publisher = {Courier Corporation}, 39606 year = {2002} 39607} 39608 39609@Inbook{ shapero2025, 39610 author = {Daniel Shapero}, 39611 title = {Linear-algebraic representation and transformation of unstructured meshes}, 39612 booktitle = {Proceedings of the 2025 SIAM International Meshing Roundtable (IMR)}, 39613 chapter = {}, 39614 pages = {154--166}, 39615 doi = {10.1137/1.9781611978575.13}, 39616 URL = {https://epubs.siam.org/doi/abs/10.1137/1.9781611978575.13}, 39617 eprint = {https://epubs.siam.org/doi/pdf/10.1137/1.9781611978575.13}, 39618 year = {2025} 39619} 39620 39621@article{MckayEriksonKozdon2019, 39622 title = {A computational method for earthquake cycles within anisotropic media}, 39623 author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, 39624 journal = {Geophysical Journal International}, 39625 volume = {219}, 39626 number = {2}, 39627 pages = {816--833}, 39628 year = {2019}, 39629} 39630 39631@article{EricksonOReillyNordstrom2019, 39632 title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, 39633 author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, 39634 journal = {Journal of Scientific Computing}, 39635 volume = {81}, 39636 pages = {2356--2387}, 39637 year = {2019}, 39638} 39639 39640@article{KozdonEricksonWilcox2021, 39641 title = {Hybridized summation-by-parts finite difference methods}, 39642 author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, 39643 journal = {Journal of Scientific Computing}, 39644 volume = {87}, 39645 number = {3}, 39646 pages = {85}, 39647 year = {2021}, 39648} 39649 39650@article{SEAS2022, 39651 title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, 39652 author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, 39653 journal = {Journal of Geophysical Research: Solid Earth}, 39654 volume = {127}, 39655 number = {3}, 39656 pages = {e2021JB023519}, 39657 year = {2022}, 39658} 39659 39660@article{EricksonKozdonHarvey2022, 39661 title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, 39662 author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, 39663 journal = {Journal of Scientific Computing}, 39664 volume = {93}, 39665 number = {1}, 39666 pages = {17}, 39667 year = {2022}, 39668} 39669 39670@article{RuckerEriksonKarlstromLeeGopalakrishnan2022, 39671 title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, 39672 author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, 39673 journal = {Journal of Geophysical Research: Solid Earth}, 39674 volume = {127}, 39675 number = {9}, 39676 pages = {e2022JB024506}, 39677 year = {2022}, 39678} 39679 39680@article{HarveyEriksonKozdon2023, 39681 title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, 39682 author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, 39683 journal = {Journal of Geophysical Research: Solid Earth}, 39684 pages = {e2022JB025357}, 39685 year = {2023}, 39686} 39687 39688@article{SEAS2023, 39689 title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, 39690 author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, 39691 journal = {Bulletin of the Seismological Society of America}, 39692 volume = {113}, 39693 number = {2}, 39694 pages = {499--523}, 39695 year = {2023}, 39696} 39697 39698@article{ErwayMarcia2017, 39699 title = {On solving large-scale limited-memory quasi-{N}ewton equations}, 39700 author = {Erway, Jennifer B and Marcia, Roummel F}, 39701 journal = {Linear Algebra and its Applications}, 39702 volume = {515}, 39703 pages = {196--225}, 39704 year = {2017}, 39705 publisher = {Elsevier}, 39706} 39707 39708@article{Ritto-CorreaCamotim2008, 39709 title={On the arc-length and other quadratic control methods: Established, less known and new implementation procedures}, 39710 volume={86}, 39711 ISSN={0045-7949}, 39712 DOI={10.1016/j.compstruc.2007.08.003}, 39713 number={11}, 39714 journal={Computers & Structures}, 39715 author={Ritto-Corr{\^{e}}a, Manuel and Camotim, Dinar}, 39716 year={2008}, 39717 month=jun, 39718 pages={1353-1368}, 39719} 39720 39721 39722@article{LeonPaulinoPereiraMenezesLages_2011, 39723 title={A Unified Library of Nonlinear Solution Schemes}, 39724 volume={64}, 39725 ISSN={0003-6900, 2379-0407}, 39726 DOI={10.1115/1.4006992}, 39727 number={4}, 39728 journal={Applied Mechanics Reviews}, 39729 author={Leon, Sofie E. and Paulino, Glaucio H. and Pereira, Anderson and Menezes, Ivan F. M. and Lages, Eduardo N.}, 39730 year={2011}, 39731 month=jul, 39732 pages={040803}, 39733} 39734