1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@book{deuflhard2011, 20 title = {Newton Methods for Nonlinear Problems}, 21 author = {Peter Deuflhard}, 22 volume = {35}, 23 year = {2011}, 24 isbn = {978-3-642-23898-7}, 25 doi = {10.1007/978-3-642-23899-4}, 26 publisher = {Springer-Verlag}, 27 address = {Berlin, Heidelberg} 28} 29 30@article{ketcheson2010runge, 31 title = {Runge--Kutta methods with minimum storage implementations}, 32 author = {Ketcheson, David I}, 33 journal = {Journal of Computational Physics}, 34 volume = {229}, 35 number = {5}, 36 pages = {1763--1773}, 37 year = {2010}, 38 publisher = {Elsevier} 39} 40 41@article{WalkerNi2011, 42 title = {Anderson acceleration for fixed-point iterations}, 43 author = {Homer F Walker and Peng Ni}, 44 journal = {SIAM Journal on Numerical Analysis}, 45 volume = {49}, 46 number = {4}, 47 pages = {1715--1735}, 48 year = {2011}, 49 publisher = {SIAM} 50} 51 52@article{Hua2007, 53 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 54 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 55 journal = {AIChE Journal}, 56 volume = {53}, 57 number = {10}, 58 pages = {2534--2548}, 59 year = {2007}, 60 publisher = {Wiley Online Library} 61} 62 63@Article{ openblas, 64 title = {OpenBLAS: A High Performance BLAS Library on Loongson 3A CPU}, 65 journal = {Journal of Software}, 66 volume = {22}, 67 pages = {208--216}, 68 year = {2011}, 69 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 70 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 71} 72 73@Misc{ openblas-website, 74 title = {{OpenBLAS}}, 75 key = {OpenBLAS}, 76 howpublished = {\url{https://www.openblas.net}} 77} 78 79@Misc{ openacc-website, 80 title = {{OpenACC}}, 81 key = {OpenACC}, 82 howpublished = {\url{https://www.openacc.org}} 83} 84 85@Misc{ bueler2020petsc, 86 title = {PETSc for Partial Differential Equations: Numerical Solutions in C and Python}, 87 author = {Bueler, Ed}, 88 year = {2020}, 89 publisher = {SIAM}, 90 petsc_uses = {KSP} 91} 92 93@TechReport{ petscforgpuexascale, 94 title = {Toward Performance-Portable PETSc for GPU-based Exascale Systems}, 95 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 96 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 97 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 98 institution = {Argonne National Laboratory}, 99 number = {ANL/MCS-P9401-1020}, 100 note = {\url{https://arxiv.org/abs/2011.00715}}, 101 year = {2020}, 102 petsc_uses = {KSP} 103} 104 105@Article{ mills2021, 106 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 107 journal = {Parallel Computing}, 108 volume = {108}, 109 pages = {102831}, 110 year = {2021}, 111 issn = {0167-8191}, 112 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 113 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 114 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 115 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 116 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 117} 118 119@Article{ rupp:2016:pis:2988256.2907944, 120 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 121 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 122 journal = {ACM Trans. Math. Softw.}, 123 issue_date = {September 2016}, 124 volume = {43}, 125 number = {2}, 126 month = aug, 127 year = {2016}, 128 issn = {0098-3500}, 129 pages = {11:1--11:27}, 130 articleno = {11}, 131 numpages = {27}, 132 doi = {10.1145/2907944}, 133 acmid = {2907944}, 134 publisher = {ACM}, 135 address = {New York, NY, USA}, 136 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 137 gradient method}, 138 petsc_uses = {KSP} 139} 140 141@Article{ dalcin2011parallel, 142 title = {Parallel distributed computing using python}, 143 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 144 journal = {Advances in Water Resources}, 145 volume = {34}, 146 number = {9}, 147 pages = {1124--1139}, 148 year = {2011}, 149 publisher = {Elsevier}, 150 petsc_uses = {KSP} 151} 152 153@Article{ mendezpongaortiz2018, 154 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 155 author = {JP Mendez and M Ponga and M Ortiz}, 156 journal = {Journal of the Mechanics and Physics of Solids}, 157 year = {2018}, 158 petsc_uses = {KSP} 159} 160 161@TechReport{ morgan2020evaluation, 162 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 163 System: Part 1: Vector Node Performance}, 164 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 165 year = {2020}, 166 institution = {Argonne National Laboratory}, 167 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 168 petsc_uses = {KSP} 169} 170 171@TechReport{ pdeconstrainedspectraladjoints, 172 title = {PDE constrained optimization, error estimation and control with spectral elements 173 using PETSc and TAO}, 174 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 175 type = {Preprint}, 176 number = {ANL/MCS-P9031-1117}, 177 institution = {ANL}, 178 month = nov, 179 year = {2017}, 180 petsc_uses = {KSP} 181} 182 183@InProceedings{ asc2013, 184 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 185 title = {Evaluation of overlapping restricted additive Schwarz preconditioning for 186 parallel solution of very large power flow problems}, 187 booktitle = {HiPCNA-PG’13}, 188 year = {2013}, 189 petsc_uses = {KSP} 190} 191 192@InProceedings{ as2013, 193 author = {S. Abhyankar and B. F. Smith}, 194 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 195 Smart Grid Applications}, 196 booktitle = {Proceedings of the IEEE PES General Meeting}, 197 year = {2013}, 198 petsc_uses = {KSP} 199} 200 201@TechReport{ tspaper, 202 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 203 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 204 Barry F. Smith}, 205 type = {Preprint}, 206 number = {ANL/MCS-P5061-0114}, 207 institution = {ANL}, 208 month = jan, 209 year = {2014}, 210 petsc_uses = {KSP} 211} 212 213@TechReport{ abhyankaretal2018, 214 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 215 and Barry F. Smith and Hong Zhang}, 216 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 217 journal = {arXiv e-preprints}, 218 eprint = {1806.01437}, 219 archiveprefix = {arXiv}, 220 year = {2018}, 221 petsc_uses = {KSP} 222} 223 224@Article{ zhang2021cams, 225 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 226 author = {Hong Zhang and Emil M. Constantinescu}, 227 journal = {arXiv e-preprints}, 228 eprint = {2202.11890}, 229 archiveprefix = {arXiv}, 230 year = {2022}, 231 petsc_uses = {KSP} 232} 233 234@InProceedings{ zhangconstantinescu2021b, 235 title = {Revolve-based adjoint checkpointing for multistage time integration}, 236 author = {Hong Zhang and Emil M. Constantinescu}, 237 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 238 month = jun, 239 year = {2021}, 240 petsc_uses = {KSP} 241} 242 243@Article{ zhang2022tsadjoint, 244 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 245 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 246 Sensitivity Analysis}}, 247 journal = {SIAM Journal on Scientific Computing}, 248 volume = {44}, 249 number = {1}, 250 pages = {C1-C24}, 251 year = {2022}, 252 doi = {10.1137/21M140078X}, 253 petsc_uses = {KSP} 254} 255 256@TechReport{ bb2008, 257 author = {Tomasz Blachowicz and Bartlomiej Baron}, 258 title = {A graphical extension for the Windows version of the Parallel Finite Element 259 Micromagnetics Package (MagParExt)}, 260 url = {http://arxiv.org/abs/0807.2655}, 261 year = {2008}, 262 petsc_uses = {KSP} 263} 264 265@Article{ jacvgv2008, 266 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 267 and J L Vicent}, 268 title = {Field induced vortex dynamics in magnetic Ni nanotriangles}, 269 journal = {Nanotechnology}, 270 volume = {19}, 271 year = {2008}, 272 doi = {10.1088/0957-4484/19/28/285717}, 273 petsc_uses = {KSP} 274} 275 276@Article{ yjdwh2008, 277 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 278 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 279 journal = {Journal of the Magnetics Society of Japan}, 280 volume = {32}, 281 year = {2008}, 282 pages = {50-53}, 283 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 284 petsc_uses = {KSP} 285} 286 287@Article{ mtrtrsa2008, 288 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 289 Schrefl and M. Albrecht}, 290 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 291 journal = {J. Appl. Phys.}, 292 volume = {103}, 293 year = {2008}, 294 doi = {10.1063/1.2894587}, 295 petsc_uses = {KSP} 296} 297 298@InProceedings{ tmrttsa2008, 299 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 300 Schrefl and M. Albrecht}, 301 title = {Patterning of magnetic films by focused ion beam irradiation}, 302 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 303 year = {2008}, 304 petsc_uses = {KSP} 305} 306 307@Article{ yjdbh2007, 308 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 309 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 310 factor for the single-phase soft magnetic films}, 311 journal = {J. Magn. Magn. Mater.}, 312 volume = {320}, 313 number = {7}, 314 pages = {1393-1397}, 315 doi = {10.1016/j.jmmm.2007.11.025}, 316 petsc_uses = {KSP} 317} 318 319@Article{ lxky2007, 320 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 321 title = {Micromagnetic simulation and experimental study on microwave permeability of 322 nano-magnetic films}, 323 journal = {Transactions of Nonferrous Metals Society of China}, 324 year = {2007}, 325 pages = {756-759}, 326 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 327 petsc_uses = {KSP} 328} 329 330@Article{ yjdwh2008a, 331 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 332 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 333 journal = {Journal of the Magnetics Society of Japan}, 334 volume = {32}, 335 year = {2008}, 336 pages = {50-53}, 337 doi = {10.3379/msjmag.32.50}, 338 petsc_uses = {KSP} 339} 340 341@Article{ lylw2007, 342 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 343 title = {Micromagnetic study of magnetization reversal in patterned DyFeCo thin films}, 344 journal = {Phys. Stat. Sol.}, 345 volume = {204}, 346 number = {12}, 347 pages = {4049-4052}, 348 year = {2007}, 349 doi = {10.1002/pssa.200777359}, 350 petsc_uses = {KSP} 351} 352 353@InProceedings{ sg2007, 354 author = {Simon Greaves}, 355 title = {Micromagnetic Simulations of Magnetic Recording Media}, 356 booktitle = {High Performance Computing on Vector Systems 2007}, 357 doi = {10.1007/978-3-540-74384-2_17}, 358 petsc_uses = {KSP} 359} 360 361@Article{ bsc2007, 362 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 363 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm NiFe Nanorings}, 364 journal = {IEEE Trans. Magn.}, 365 volume = {43}, 366 year = {2007}, 367 pages = {2884-2886}, 368 doi = {10.1109/TMAG.2007.892867}, 369 petsc_uses = {KSP} 370} 371 372@Article{ ffbf, 373 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 374 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 375 Micromagnetic Simulations: Nmag.}, 376 journal = {IEEE Trans. Magn. Volume}, 377 volume = {43}, 378 pages = {2896-2898}, 379 doi = {10.1109/TMAG.2007.893843}, 380 petsc_uses = {KSP} 381} 382 383@InBook{ dfssfs2006, 384 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 385 chapter = {Computational Aspects of Micromagnetics}, 386 title = {The Science of Hysteresis}, 387 editor = { G. Bertotti and I. Mayergoyz}, 388 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 389 petsc_uses = {KSP} 390} 391 392@InBook{ fss, 393 author = {J. Fidler and T. Schrefl and W. Scholz}, 394 chapter = {Computational Micromagnetics}, 395 title = {Handbook of Theoretical and Computational Nanotechnology}, 396 editor = {M. Rieth and W. Schommers}, 397 url = {http://www.amazon.com/gp/product/158883042X}, 398 petsc_uses = {KSP} 399} 400 401@InBook{ shbsef, 402 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 403 Josef Fidler}, 404 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 405 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 406 editor = {Helmut Kronmueller and Stuart Parkin}, 407 doi = {10.1002/9780470022184.hmm203}, 408 petsc_uses = {KSP} 409} 410 411@InBook{ sfs, 412 author = {D. Suess and J. Fidler and T. Schrefl}, 413 chapter = {Micromagnetic Simulation of magnetic materials}, 414 title = {Handbook of Magnetic Materials}, 415 editor = {K. H. J. Buschow}, 416 url = {http://www.amazon.com/gp/product/0444518509}, 417 petsc_uses = {KSP} 418} 419 420@Article{ fsxzs, 421 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 422 Sharma}, 423 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 424 Recording.}, 425 journal = {IEEE Trans. Magn. Volume}, 426 volume = {43}, 427 pages = {2175-2177}, 428 doi = {10.1109/TMAG.2007.893122}, 429 petsc_uses = {KSP} 430} 431 432@Article{ sb2006, 433 author = {W. Scholz and S. Batra}, 434 title = {Effect of write current waveform on magnetization and head field dynamics of 435 perpendicular recording heads}, 436 journal = {IEEE Trans. Magn.}, 437 volume = {42}, 438 year = {2006}, 439 pages = {2264--2266}, 440 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 441 petsc_uses = {KSP} 442} 443 444@Article{ bsr2006, 445 author = {S. Batra and W. Scholz and T. Roscamp}, 446 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 447 recording system}, 448 journal = {J. Appl. Phys.}, 449 volume = {99}, 450 year = {2006}, 451 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 452 petsc_uses = {KSP} 453} 454 455@InProceedings{ japios2006, 456 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 457 Subramanian}, 458 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 459 in systems with cubic and uniaxial anisotropy.}, 460 booktitle = {Intermag 2006 Conference}, 461 petsc_uses = {KSP} 462} 463 464@Article{ kbmb2006, 465 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 466 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 467 Perpendicular Recording Heads}, 468 journal = {IEEE Trans. Magn.}, 469 volume = {42}, 470 year = {2006}, 471 pages = {2428--2430}, 472 doi = {10.1109/TMAG.2006.879430}, 473 petsc_uses = {KSP} 474} 475 476@Article{ cclcw2006, 477 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 478 title = {Control of Domain Wall Motion in Permalloy Ring}, 479 journal = {IEEE Trans. Magn.}, 480 volume = {42}, 481 year = {2006}, 482 pages = {2960--2962}, 483 doi = {10.1109/TMAG.2006.878414}, 484 petsc_uses = {KSP} 485} 486 487@Article{ bfmfzczg2007, 488 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 489 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 490 title = {Micromagnetic modelling of ferromagnetic cones}, 491 journal = {J. Magn. Magn. Mater.}, 492 volume = {312}, 493 year = {2007}, 494 pages = {234-238}, 495 url = {http://eprints.soton.ac.uk/45900/}, 496 petsc_uses = {KSP} 497} 498 499@PhDThesis{ rb2005, 500 author = {Richard Boardman}, 501 title = {Computer simulation studies of magnetic nanostructures}, 502 school = {Computational Engineering and Design Group, School of Engineering Sciences, 503 University of Southampton, United Kingdom}, 504 year = {2005}, 505 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 506 petsc_uses = {KSP} 507} 508 509@InProceedings{ cwwy2006, 510 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 511 title = {MPI Performance Analysis Tools on Blue Gene/L}, 512 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 513 year = {2006}, 514 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 515 petsc_uses = {KSP} 516} 517 518@InProceedings{ ch2006, 519 author = {I.-H. Chung and J.K. Hollingsworth}, 520 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 521 Programs}, 522 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 523 pages = {45--56}, 524 doi = {10.1109/HPDC.2006.1652135}, 525 petsc_uses = {KSP} 526} 527 528@Article{ lkpl2005, 529 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 530 title = {Multibit MRAM using a pair of memory cells}, 531 journal = {IEEE Trans. Magn.}, 532 volume = {41}, 533 year = {2005}, 534 pages = {2670-2672}, 535 doi = {10.1109/TMAG.2005.855288}, 536 petsc_uses = {KSP} 537} 538 539@Article{ gscn2005, 540 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 541 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 542 journal = {Phys. Rev. B}, 543 volume = {71}, 544 year = {2005}, 545 doi = {10.1103/PhysRevB.71.144407}, 546 petsc_uses = {KSP} 547} 548 549@PhDThesis{ mda, 550 author = {Massimiliano d'Aquino}, 551 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 552 school = { Universita di Napoli Federico II.}, 553 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 554 petsc_uses = {KSP} 555} 556 557@TechReport{ ssdfssf2003, 558 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 559 Stehno and J. Fidler}, 560 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 561 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 562 petsc_uses = {KSP} 563} 564 565@InProceedings{ sb2006a, 566 author = {W. Scholz and S. Batra}, 567 title = {Effect of write current waveform on magnetization and head field dynamics of 568 perpendicular recording heads}, 569 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 570 petsc_uses = {KSP} 571} 572 573@Article{ scholz-batra1, 574 author = {W. Scholz and S. Batra}, 575 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 576 Recording}, 577 journal = {IEEE Trans. Magn.}, 578 note = {submitted}, 579 year = {2005}, 580 petsc_uses = {KSP} 581} 582 583@Article{ scholz-batra2, 584 author = {W. Scholz and S. Batra}, 585 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 586 journal = {IEEE Trans. Magn.}, 587 volume = {41}, 588 year = {2005}, 589 pages = {702-706}, 590 petsc_uses = {KSP} 591} 592 593@Article{ daquino-scholz1, 594 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 595 title = {Micromagnetic Analysis of Fast Precessional Switching}, 596 journal = {J. Magn. Magn. Mater.}, 597 volume = {290-291}, 598 year = {2005}, 599 pages = {510-513}, 600 petsc_uses = {KSP} 601} 602 603@Article{ aq-scholz-fid, 604 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 605 title = {Numerical and analytical study of fast precessional switching}, 606 journal = {J. Appl. Phys.}, 607 volume = {95}, 608 year = {2004}, 609 pages = {7055-7057}, 610 petsc_uses = {KSP} 611} 612 613@InProceedings{ gar-tabik-gar, 614 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 615 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 616 Scatterers}, 617 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 618 (PDP'04)}, 619 year = {2004}, 620 pages = {80--}, 621 petsc_uses = {KSP} 622} 623 624@InProceedings{ aq-scholz-mia, 625 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 626 title = {Analysis of fast precessional switching in magnetic thin films}, 627 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 628 year = {2004}, 629 pages = {257-260}, 630 petsc_uses = {KSP} 631} 632 633@Article{ scholz-fid-seus, 634 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 635 Dittrich and V. Tsiantos}, 636 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 637 Axes}, 638 journal = {J. Magn. Magn. Mater.}, 639 year = {2004}, 640 pages = {1524-1525}, 641 petsc_uses = {KSP} 642} 643 644@Article{ boardman-zimmerman, 645 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 646 Peter de Groot}, 647 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 648 journal = {Journal of Applied Physics}, 649 year = {2005}, 650 petsc_uses = {KSP} 651} 652 653@Article{ lim-kim-park, 654 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 655 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 656 journal = {IEEE Trans. Magn.}, 657 note = {submitted}, 658 petsc_uses = {KSP} 659} 660 661@Article{ scholz-suess2, 662 author = {W. Scholz and D. Suess and T. Schrefl and and J. Fidler}, 663 title = {Micromagnetic simulation of magnetization reversal in small particles with 664 surface anisotropy}, 665 journal = {J. Appl. Phys.}, 666 volume = {95}, 667 year = {2004}, 668 pages = {6807-6809}, 669 petsc_uses = {KSP} 670} 671 672@Article{ scholz-schrefl1, 673 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 674 Tsiantos}, 675 title = {Micromagnetic simulation of the pinning and depinning process in permanent 676 magnets}, 677 journal = {IEEE Trans. Magn.}, 678 volume = {39}, 679 year = {2003}, 680 pages = {2920-2922}, 681 petsc_uses = {KSP} 682} 683 684@Article{ scholz-guslienko, 685 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 686 W. Chantrell and J. Fidler}, 687 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 688 nanodots}, 689 journal = {J. Magn. Magn. Mater.}, 690 volume = {266}, 691 year = {2003}, 692 pages = {155-163}, 693 petsc_uses = {KSP} 694} 695 696@Article{ scholz1, 697 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 698 Forster and V. Tsiantos}, 699 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 700 journal = {Comp. Mat. Sci}, 701 year = {2003}, 702 pages = {366--383}, 703 volume = {28}, 704 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 705 petsc_uses = {KSP} 706} 707 708@PhDThesis{ scholz2, 709 author = {W. Scholz}, 710 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 711 school = {Vienna University of Technology, Vienna, Austria}, 712 year = {2003}, 713 petsc_uses = {KSP} 714} 715 716@Article{ scholz3, 717 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 718 Forster and J. Fidler}, 719 title = {Implementation of a high performance parallel finite element micromagnetics 720 package}, 721 journal = {J. Magn. Magn. Mater.}, 722 year = {2004}, 723 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 724 petsc_uses = {KSP} 725} 726 727% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 728@InBook{ zhanggladwell1, 729 author = {W. Zhang and I. Gladwell}, 730 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 731 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 732 year = {2000}, 733 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 734 Physics, vol. 552}, 735 publisher = {Springer}, 736 pages = {4190-}, 737 petsc_uses = {KSP} 738} 739 740@Article{ wolf1, 741 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 742 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 743 thin films}, 744 journal = {Phil. Mag. A}, 745 year = {2003}, 746 lab = {ANL}, 747 petsc_uses = {KSP} 748} 749 750@Article{ wolf2, 751 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 752 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 753 grain-boundary properties}, 754 journal = {Computational Materials Science}, 755 year = {2001}, 756 volume = {23}, 757 pages = {15--32}, 758 lab = {ANL}, 759 petsc_uses = {KSP} 760} 761 762@Article{ wolf3, 763 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 764 title = {Role of grain rotation in grain growth by mesoscale simulation}, 765 journal = {Phil. Mag. A}, 766 year = {2002}, 767 volume = {82}, 768 pages = {1271--1297}, 769 lab = {ANL}, 770 petsc_uses = {KSP} 771} 772 773% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 774@Article{ saut, 775 author = { Olivier Saut}, 776 title = {Bidimensional Study of the Maxwell-Bloch Model in a Nonlinear Crystal}, 777 journal = {SIAM Journal on Scientific Computing}, 778 year = {2004}, 779 note = {submitted}, 780 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 781 petsc_uses = {KSP} 782} 783 784% LiteralHTML: 785% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 786% LiteralHTML: 787@InBook{ khanallorenziayachepennec2016, 788 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 789 of Brain Deformation in {Alzheimer's} Disease}, 790 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 791 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 792 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 793 Miller}, 794 pages = {167--176}, 795 isbn = {978-3-319-28329-6}, 796 doi = {10.1007/978-3-319-28329-6_15}, 797 publisher = {Springer International Publishing}, 798 year = {2016}, 799 petsc_uses = {KSP} 800} 801 802@Article{ ataseven, 803 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 804 title = {Parallel implementation of the accelerated BEM approach for EMSI of the human 805 brain}, 806 journal = {Medical and Biological Engineering and Computing}, 807 month = feb, 808 year = {2008}, 809 doi = {10.1007/s11517-008-0316-0}, 810 petsc_uses = {KSP} 811} 812 813@Article{ dennis-eberhart-03, 814 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 815 pages = {832-840}, 816 volume = {125}, 817 number = {6}, 818 title = {Finite-element simulation of cooling of realistic 3-D human head and neck}, 819 journal = {J Biomech Eng}, 820 year = {2003}, 821 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 822 petsc_uses = {KSP} 823} 824 825@Conference{ gu7174parallel, 826 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 827 frequency-domain small animal optical tomography}}, 828 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 829 booktitle = {Proc. of SPIE Vol}, 830 volume = {7174}, 831 number = {717406}, 832 pages = {1}, 833 petsc_uses = {KSP} 834} 835 836@Article{ barchanski2005using, 837 title = {{Using domain decomposition techniques for the calculation of low-frequency 838 electric current densities in high-resolution 3D human anatomy models}}, 839 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 840 T.}, 841 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 842 and Electronic Engineering}, 843 volume = {24}, 844 number = {2}, 845 pages = {458--467}, 846 issn = {0332-1649}, 847 year = {2005}, 848 publisher = {Emerald Group Publishing Limited}, 849 petsc_uses = {KSP} 850} 851 852@Article{ motrescurienen05, 853 author = {V. C. Motrescu and U. van Rienen}, 854 pages = {227--231}, 855 volume = {3}, 856 title = {Computation of currents induced by ELF electric fields in anisotropic human 857 tissues using the Finite Integration Technique}, 858 journal = {Advances in Radio Science}, 859 year = {2005}, 860 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 861 petsc_uses = {KSP} 862} 863 864@Article{ motrescurienen04, 865 author = {V. C. Motrescu and U. van Rienen}, 866 pages = {309--313}, 867 volume = {2}, 868 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 869 Integration Technique (FIT)}, 870 journal = {Advances in Radio Science}, 871 year = {2004}, 872 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 873 petsc_uses = {KSP} 874} 875 876@InProceedings{ dbl2, 877 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 878 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 879 booktitle = {ECCOMAS2000}, 880 year = {2000}, 881 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 882 petsc_uses = {KSP} 883} 884 885@Unpublished{ cell, 886 title = {Parallel Simulation Engines for Whole-Cell Models}, 887 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 888 Weber}, 889 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 890 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 891 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 892 year = {2001}, 893 petsc_uses = {KSP} 894} 895 896@Article{ barker2010two, 897 title = {Two-level Newton and hybrid Schwarz preconditioners for fluid-structure 898 interaction}, 899 author = {Barker, A.T. and Cai, X.C.}, 900 journal = {SIAM Journal on Scientific Computing}, 901 volume = {32}, 902 number = {4}, 903 pages = {2395--2417}, 904 year = {2010}, 905 publisher = {Society for Industrial and Applied Mathematics}, 906 petsc_uses = {KSP} 907} 908 909@Article{ barker2010scalable, 910 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 911 with application to blood flow modeling}, 912 author = {Barker, A.T. and Cai, X.C.}, 913 journal = {Journal of Computational Physics}, 914 volume = {229}, 915 number = {3}, 916 pages = {642--659}, 917 year = {2010}, 918 publisher = {Elsevier}, 919 petsc_uses = {KSP} 920} 921 922@Article{ barker2009nks, 923 title = {NKS for fully coupled fluid-structure interaction with application}, 924 author = {Barker, A.T. and Cai, X.C.}, 925 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 926 pages = {275--282}, 927 year = {2009}, 928 publisher = {Springer}, 929 petsc_uses = {KSP} 930} 931 932@Article{ mirams2013, 933 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 934 and Yi Cui and Gary R Mirams}, 935 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 936 to predict QT interval changes in the rabbit ventricular wedge}, 937 journal = {Journal of pharmacological and toxicological methods}, 938 volume = {68}, 939 number = {1}, 940 pages = {88--96}, 941 year = {2013}, 942 doi = {10.1016/j.vascn.2013.04.004}, 943 petsc_uses = {KSP} 944} 945 946% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 947% LiteralHTML: <center><img alt="" 948% LiteralHTML: src="images/spine0l.jpg"></center></p> 949% LiteralHTML: <center><img alt="" 950% LiteralHTML: src="images/vertebra.jpg"></center></p> 951% LiteralHTML:<font color="#FF0000"> 952% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 953% LiteralHTML:Understanding bone mechanical properties and how they may lead to 954% LiteralHTML:fractures is thus an important medical research activity. PETSc and 955% LiteralHTML:Prometheus have been used for extremely large scale finite element 956% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 957% LiteralHTML:team of doctors and computational scientists. This computation was 958% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 959% LiteralHTML:with over 4000 processors.</p> 960% LiteralHTML: </font> 961@Article{ arbenz2008scalable, 962 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 963 analysis of human bone structures}, 964 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 965 journal = {International Journal for Numerical Methods in Engineering}, 966 volume = {73}, 967 number = {7}, 968 pages = {927--947}, 969 year = {2008}, 970 publisher = {Wiley Online Library}, 971 petsc_uses = {KSP} 972} 973 974@InProceedings{ adams-04, 975 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 976 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 977 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 978 half a billion degrees of freedom}, 979 note = {Gordon Bell Award}, 980 year = {2004}, 981 petsc_uses = {KSP} 982} 983 984@InProceedings{ adams-03b, 985 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 986 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 987 Whole Bone Micro-Mechanics on the IBM SP}, 988 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 989 year = {2003}, 990 petsc_uses = {KSP} 991} 992 993@InProceedings{ oghattas2002, 994 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 995 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 996 booktitle = {Procceedings of SC2002}, 997 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 998 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 999 by time-dependent PDEs, and scalability results for an inverse wave propagation 1000 problem of determining the material field of an acoustic medium. Using the 1001 algorithm, they solved a synthetic inverse wave propagation problem though a 1002 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 1003 processors.}, 1004 year = {2002}, 1005 petsc_uses = {KSP} 1006} 1007 1008% LiteralHTML: <a name="biology:cardiology"> 1009% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1010% LiteralHTML: <center><img alt="" 1011% LiteralHTML: src="images/heart.jpg"> 1012% LiteralHTML: <img alt="" 1013% LiteralHTML: src="images/pump.jpg"></center></p> 1014% LiteralHTML: 1015% LiteralHTML:<font color="#FF0000"> 1016% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 1017% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 1018% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 1019% LiteralHTML: through the heart. PETSc has been used by several research groups to 1020% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 1021% LiteralHTML: fully understand the developments of arrhthmias.</p> 1022% LiteralHTML:</font> 1023@InProceedings{ oghattas2000, 1024 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1025 Walkington}, 1026 title = {A Parallel Dynamic-Mesh Lagrangian Method for Simulation of Flows with Dynamic 1027 Interfaces}, 1028 booktitle = {Procceedings of SC2000}, 1029 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1030 note = {Blood flow modeling at the microscale including effects on individual blood 1031 cells, for designing heart assist pumps, etc.}, 1032 year = {2000}, 1033 petsc_uses = {KSP} 1034} 1035 1036@InBook{ cfps2006, 1037 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1038 editor = {A. Quarteroni et al.}, 1039 title = {Complex Systems in Biomedicine}, 1040 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1041 publisher = {Springer-Verlag}, 1042 pages = {187--241}, 1043 year = {2006}, 1044 petsc_uses = {KSP} 1045} 1046 1047@InProceedings{ cfpst2007, 1048 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 1049 title = {Determining recovery times from transmembrane action potentials and unipolar 1050 electrograms in normal heart tissue}, 1051 booktitle = {FIMH07}, 1052 publisher = {Springer-Verlag}, 1053 volume = {4466}, 1054 pages = {139--149}, 1055 year = {2007}, 1056 petsc_uses = {KSP} 1057} 1058 1059@Article{ seemann2010framework, 1060 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 1061 Equations Using PETSc}}, 1062 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 1063 D{\\"o}ssel, O.}, 1064 journal = {Progress in Industrial Mathematics at ECMI 2008}, 1065 pages = {363--369}, 1066 year = {2010}, 1067 publisher = {Springer}, 1068 petsc_uses = {KSP} 1069} 1070 1071@InProceedings{ pft2005, 1072 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 1073 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 1074 Intramural Heterogeneity}, 1075 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 1076 pages = {267--277}, 1077 editors = {A. Frangi et al.}, 1078 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 1079 year = {2005}, 1080 petsc_uses = {KSP} 1081} 1082 1083@Article{ bgcp2005, 1084 author = {Boyce E. Griffith and Charles S. Peskin}, 1085 title = {On the order of accuracy of the immersed boundary method: Higher order 1086 convergence rates for sufficiently smooth problems}, 1087 journal = {Journal of Computational Physics}, 1088 year = {2005}, 1089 volume = {208}, 1090 pages = {75--105}, 1091 petsc_uses = {KSP} 1092} 1093 1094@Article{ griffith2007adaptive, 1095 title = {An adaptive, formally second order accurate version of the immersed boundary 1096 method}, 1097 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 1098 journal = {Journal of Computational Physics}, 1099 volume = {223}, 1100 number = {1}, 1101 pages = {10--49}, 1102 year = {2007}, 1103 publisher = {Elsevier}, 1104 petsc_uses = {KSP} 1105} 1106 1107@PhDThesis{ griffith05, 1108 author = {Boyce Griffith}, 1109 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 1110 parallel version of the immersed boundary method}, 1111 school = {New York University}, 1112 year = {2005}, 1113 petsc_uses = {KSP} 1114} 1115 1116@PhDThesis{ murillo, 1117 author = {Maria S. Murillo}, 1118 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 1119 Differential Equations with an Application in Computational Biology}, 1120 school = {University of Colorado at Boulder}, 1121 year = {2002}, 1122 petsc_uses = {KSP} 1123} 1124 1125@Article{ spv2004, 1126 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 1127 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 1128 journal = {IEEE Trans. Biomed. Eng}, 1129 year = {2004}, 1130 volume = {51}, 1131 pages = {1960--1968}, 1132 petsc_uses = {KSP} 1133} 1134 1135@Article{ vphl2003, 1136 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 1137 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 1138 journal = {J. Electrocardiol.}, 1139 year = {2003}, 1140 volume = {36}, 1141 pages = {69--74}, 1142 petsc_uses = {KSP} 1143} 1144 1145@InProceedings{ spbv2003, 1146 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and and E.J. Vigmond}, 1147 title = {Preconditioning Techniques for the Bidomain Equations}, 1148 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 1149 Methods}, 1150 pages = {571--580}, 1151 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 1152 note = {}, 1153 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 1154 year = {2003}, 1155 petsc_uses = {KSP} 1156} 1157 1158@Article{ franz-pavir-04, 1159 author = {P. Colli Franzone and L.~F. Pavarino}, 1160 title = {A parallel solver for reaction-diffusion systems in computational 1161 electrocardiology}, 1162 journal = {Mathematical Models and Methods in Applied Sciences}, 1163 year = {2004}, 1164 volume = {14}, 1165 number = {6}, 1166 pages = {883--912}, 1167 petsc_uses = {KSP} 1168} 1169 1170@Article{ franz-pavir-05, 1171 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 1172 title = {Simulating patterns of excitation, repolarization and action potential 1173 durationwith cardiac Bidomain and Monodomain models}, 1174 journal = {Mathematical Biosciences}, 1175 year = {2005}, 1176 volume = {197}, 1177 number = {1}, 1178 pages = {35--66}, 1179 petsc_uses = {KSP} 1180} 1181 1182@Article{ franz-pavir-06, 1183 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 1184 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 1185 the dispersion of cardiac repolarization and action potential duration: a 1186 simulation study}, 1187 journal = {Mathematical Biosciences}, 1188 year = {2006}, 1189 volume = {204}, 1190 number = {1}, 1191 pages = {132--165}, 1192 petsc_uses = {KSP} 1193} 1194 1195@InProceedings{ colli-franz-sim, 1196 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 1197 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 1198 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 1199 Mediterranean Conference on Medical and Biological Engineering}, 1200 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 1201 year = {2004}, 1202 petsc_uses = {KSP} 1203} 1204 1205@InProceedings{ pf2003, 1206 author = {Luca F. Pavarino and Piero Colli Franzone}, 1207 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 1208 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 1209 Methods}, 1210 pages = {669--776}, 1211 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 1212 note = {}, 1213 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 1214 year = {2003}, 1215 petsc_uses = {KSP} 1216} 1217 1218@Article{ maria-is04, 1219 author = {Maria Murillo and Xiao-Chuan Cai}, 1220 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 1221 activity of the heart}, 1222 journal = {Numerical Linear Algebra with Applications}, 1223 year = {2004}, 1224 volume = {11}, 1225 pages = {261 - 277}, 1226 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 1227 petsc_uses = {KSP} 1228} 1229 1230@Article{ murli2007monitoring, 1231 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 1232 Imaging in a Grid computing PSE}}, 1233 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 1234 and Lapegna, M.}, 1235 journal = {Grid-Based Problem Solving Environments}, 1236 pages = {421--432}, 1237 year = {2007}, 1238 publisher = {Springer}, 1239 petsc_uses = {KSP} 1240} 1241 1242@Article{ carracciuolo:2006:tpc, 1243 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 1244 title = {Towards a parallel component for imaging in PETSc programming environment: a case 1245 study in 3-D echocardiography}, 1246 journal = {Parallel Comput.}, 1247 volume = {32}, 1248 issue = {1}, 1249 month = jan, 1250 year = {2006}, 1251 issn = {0167-8191}, 1252 pages = {67--83}, 1253 numpages = {17}, 1254 doi = {10.1016/j.parco.2005.09.001}, 1255 acmid = {1141218}, 1256 publisher = {Elsevier Science Publishers B. V.}, 1257 address = {Amsterdam, The Netherlands, The Netherlands}, 1258 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 1259 component}, 1260 petsc_uses = {KSP} 1261} 1262 1263@Article{ damore2011integration, 1264 title = {Integration of emerging computer technologies for an efficient image sequences 1265 analysis}, 1266 journal = {Integrated Computer-Aided Engineering }, 1267 volume = {18}, 1268 number = {4}, 1269 pages = {365 - 378}, 1270 year = {2011}, 1271 note = {}, 1272 issn = {1875-8835}, 1273 doi = {10.3233/ICA-2011-0382}, 1274 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 1275 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 1276 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 1277 petsc_uses = {KSP} 1278} 1279 1280@InProceedings{ eth_biwi_00721, 1281 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and and G. 1282 Székely}, 1283 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 1284 a Schur Complement Preconditioner}, 1285 booktitle = {Euro-Par 2009 Parallel Processing}, 1286 year = {2009}, 1287 month = aug, 1288 pages = {747-759}, 1289 volume = {5704}, 1290 editor = {H. Sips and D. Epema and and H.-X. Lin}, 1291 series = {Lecture Notes in Computer Science}, 1292 publisher = {Springer}, 1293 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 1294 parallel Krylov solver}, 1295 petsc_uses = {KSP} 1296} 1297 1298% LiteralHTML: <a name="biology:imagingandsurgery"> 1299% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1300% LiteralHTML: <center><img alt="" 1301% LiteralHTML: src="images/brain.jpg"></center> 1302@Article{ ganser2004deformable, 1303 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 1304 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 1305 journal = {Medical Image Analysis}, 1306 volume = {8}, 1307 number = {1}, 1308 pages = {3--22}, 1309 year = {2004}, 1310 publisher = {Elsevier}, 1311 petsc_uses = {KSP} 1312} 1313 1314@Unpublished{ taccsurgery, 1315 title = {TACC supercomputer performs laser cancer surgery on canine}, 1316 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 1317 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 1318 Austin performed laser surgery on a dog in Houston without the intervention of a 1319 surgeon. The treatment was developed collaboratively by computational experts from 1320 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 1321 leading technologists from the M.D. Anderson Cancer Center in Houston, and 1322 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 1323 state-of-the-art thermal imaging technology, and advanced computational methods, 1324 dynamic, data-driven treatments are being pursued as a minimally invasive 1325 alternative to the standard treatment of cancer.}, 1326 petsc_uses = {KSP} 1327} 1328 1329@Article{ ffhbresso2008, 1330 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 1331 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 1332 Tinsley Oden}, 1333 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 1334 journal = {Engineering with Computers}, 1335 note = {Special issue on Computational Bioengineering}, 1336 year = {2008}, 1337 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 1338 petsc_uses = {KSP} 1339} 1340 1341@TechReport{ dobbhbbbdeffghkkps2008, 1342 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 1343 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 1344 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 1345 and S. Prudhomme and R. J. Stafford}, 1346 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 1347 Cancer}, 1348 year = {2008}, 1349 institution = {University of Texas at Austin}, 1350 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 1351 petsc_uses = {KSP} 1352} 1353 1354@Article{ ogdb2004, 1355 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 1356 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 1357 journal = {Physics in Medicine and Biology}, 1358 year = {2004}, 1359 volume = {49}, 1360 pages = {2955--2947}, 1361 petsc_uses = {KSP} 1362} 1363 1364@InProceedings{ majumdar11, 1365 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 1366 Baldridge and P. Krysl}, 1367 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 1368 booktitle = {ICCS 2005}, 1369 pages = {672--679}, 1370 editor = {V.S. Sunderam et al.}, 1371 year = {2005}, 1372 petsc_uses = {KSP} 1373} 1374 1375@Conference{ sermesant-etal:03, 1376 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 1377 Ayache, H.}, 1378 title = {A parallel implementation of non-rigid registration using a volumetric 1379 biomechanical model}, 1380 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 1381 address = {Philadelphia, PA, USA}, 1382 publisher = {Springer-Verlag}, 1383 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 1384 series = {Lecture Notes in Computer Science}, 1385 volume = {2717}, 1386 pages = {398-407}, 1387 date = {june 23-24}, 1388 year = {2003}, 1389 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 1390 petsc_uses = {KSP} 1391} 1392 1393@Conference{ sermesant-etal:04, 1394 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 1395 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 1396 title = {A Novel Nonrigid Registration Algorithm And Applications}, 1397 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 1398 address = {Philadelphia, PA, USA}, 1399 publisher = {Springer-Verlag}, 1400 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 1401 series = {Lecture Notes in Computer Science}, 1402 volume = {2208}, 1403 pages = {923}, 1404 year = {2003}, 1405 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 1406 petsc_uses = {KSP} 1407} 1408 1409@Article{ warfield-haker-talos-05, 1410 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 1411 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 1412 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 1413 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 1414 title = {Capturing intraoperative deformations: research experience at Brigham and Women's 1415 hospital}, 1416 journal = {Medical Image Analysis}, 1417 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 1418 year = {2005}, 1419 petsc_uses = {KSP} 1420} 1421 1422@Article{ brain3, 1423 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 1424 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 1425 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 1426 Deformation during Image Guided Neurosurgery}, 1427 journal = {Computing and Visualization in Science}, 1428 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 1429 year = {2002}, 1430 petsc_uses = {KSP} 1431} 1432 1433@Article{ brain2, 1434 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 1435 Kikinis and Simon K. Warfield}, 1436 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 1437 Element Biomechanical Model}, 1438 journal = {IEEE Transactions on Medical Imaging}, 1439 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 1440 year = {2001}, 1441 petsc_uses = {KSP} 1442} 1443 1444@InProceedings{ brain1, 1445 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 1446 Ferenc A. Jolesz and Ron Kikinis}, 1447 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 1448 Guided Neurosurgery}, 1449 booktitle = {Proceedings of SC2000}, 1450 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 1451 year = {2000}, 1452 petsc_uses = {KSP} 1453} 1454 1455@Article{ vanne06, 1456 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 1457 M. Lassas and M. Kalke}, 1458 title = {Parallelized Bayesian inversion for three-dimensional dental X-ray imaging}, 1459 journal = {IEEE Transactions on Medical Imaging}, 1460 volume = {25}, 1461 number = {2}, 1462 month = feb, 1463 year = {2006}, 1464 pages = {218--228}, 1465 petsc_uses = {KSP} 1466} 1467 1468@InProceedings{ knepleybardhan2015, 1469 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 1470 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 1471 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 1472 Exposition}, 1473 volume = {9}, 1474 pages = {V009T12A04}, 1475 doi = {10.1115/IMECE2015-53579}, 1476 year = {2015}, 1477 petsc_uses = {KSP} 1478} 1479 1480@InProceedings{ bardhanknepley2015, 1481 title = {Multiscale models and approximation algorithms for protein electrostatics}, 1482 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 1483 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 1484 volume = {61}, 1485 pages = {163--174}, 1486 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 1487 doi = {10.2495/BEM380131}, 1488 publisher = {WIT Press}, 1489 year = {2015}, 1490 petsc_uses = {KSP} 1491} 1492 1493% LiteralHTML: 1494% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 1495% LiteralHTML: 1496@InProceedings{ adamsbrennanknepleywang2022, 1497 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 1498 quench plasmas}, 1499 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 1500 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 1501 (IPDPS '22)}, 1502 doi = {10.1109/IPDPS53621.2022.00020}, 1503 year = {2022}, 1504 petsc_uses = {DMPlex} 1505} 1506 1507@Misc{ adamsknepleybrennan2021, 1508 title = {Runaway Electron Generation with High-Performance, Structure Preserving 1509 Discretization of Fokker-Plank-Landau}, 1510 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 1511 year = {2021}, 1512 petsc_uses = {KSP} 1513} 1514 1515@Article{ adamshirvijokiknepleybrownisaacmills2017, 1516 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 1517 Architectures}, 1518 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 1519 Isaac and Richard Mills}, 1520 journal = {SIAM Journal on Scientific Computing}, 1521 volume = {39}, 1522 number = {6}, 1523 pages = {C452--C465}, 1524 doi = {10.1137/17M1118828}, 1525 eprint = {1702.08880}, 1526 year = {2017}, 1527 petsc_uses = {KSP} 1528} 1529 1530@Article{ pusztayknepleyadams2022, 1531 title = {Conservative Projection Between FEM and Particle Bases}, 1532 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 1533 journal = {SIAM Journal on Scientific Computing}, 1534 volume = {44}, 1535 number = {4}, 1536 pages = {C310--C319}, 1537 doi = {10.1137/21M145407}, 1538 year = {2022} 1539} 1540 1541@Article{ hirvijoki2017, 1542 author = {Eero Hirvijoki and Mark F. Adams}, 1543 title = {Conservative discretization of the {Landau} collision integral}, 1544 journal = {Physics of Plasmas}, 1545 volume = {24}, 1546 number = {3}, 1547 pages = {032121}, 1548 doi = {10.1063/1.4979122}, 1549 year = {2017}, 1550 petsc_uses = {KSP} 1551} 1552 1553@Article{ mollenadamsknepleyhagerchang2021, 1554 title = {Implementation of higher-order velocity mapping between marker particles and grid 1555 in the particle-in-cell code XGC}, 1556 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 1557 S. Chang}, 1558 journal = {Journal of Plasma Physics}, 1559 eprint = {2012.11764}, 1560 doi = {10.1017/S0022377821000441}, 1561 year = {2021}, 1562 petsc_uses = {KSP} 1563} 1564 1565@Article{ lsmh2014, 1566 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 1567 title = {Comparison of particle trajectories and collision operators for collisional 1568 transport in nonaxisymmetric plasmas}, 1569 journal = { Physics of Plasmas}, 1570 volume = {21}, 1571 year = {2014}, 1572 petsc_uses = {KSP} 1573} 1574 1575@Article{ lpcep2014, 1576 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 1577 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 1578 pedestal}, 1579 journal = {Plasma Physics and Controlled Fusion}, 1580 volume = {56}, 1581 year = {2014}, 1582 petsc_uses = {KSP} 1583} 1584 1585@Article{ facets-scidac08, 1586 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 1587 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 1588 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 1589 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 1590 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 1591 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 1592 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 1593 Stotler and A. Pigarov}, 1594 journal = {J. Phys.: Conf. Ser.}, 1595 volume = {125}, 1596 year = {2008}, 1597 pages = {012040}, 1598 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 1599 petsc_uses = {KSP} 1600} 1601 1602@Article{ facets-scidac09, 1603 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 1604 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 1605 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 1606 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 1607 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 1608 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 1609 and A. Pigarov and H. Zhang}, 1610 journal = {J. Phys.: Conf. Ser.}, 1611 volume = {180}, 1612 year = {2009}, 1613 pages = {012056}, 1614 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 1615 petsc_uses = {KSP} 1616} 1617 1618@InProceedings{ facets-scidac10, 1619 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 1620 {FACETS} Code}, 1621 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 1622 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 1623 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 1624 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 1625 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 1626 Pigarov and H. Zhang}, 1627 booktitle = {Proceedings of SciDAC 2010 Conference}, 1628 year = {2010}, 1629 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 1630 petsc_uses = {KSP} 1631} 1632 1633@InProceedings{ facets-fec2010, 1634 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 1635 the {FACETS} Framework}, 1636 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 1637 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 1638 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 1639 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 1640 Republic of Korea}, 1641 year = {2010}, 1642 petsc_uses = {KSP} 1643} 1644 1645@InProceedings{ facets-epdp2010, 1646 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 1647 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 1648 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 1649 Groebner and S. Balay and L. McInnes and H. Zhang}, 1650 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 1651 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 1652 year = {2010}, 1653 petsc_uses = {KSP} 1654} 1655 1656@Article{ carlssoncary09, 1657 author = {Johan Carlsson, John R. Cary}, 1658 title = {The hypersecant Jacobian approximation for quasi-Newton solves of sparse 1659 nonlinear systems}, 1660 journal = {arXiv}, 1661 year = {2009}, 1662 note = {http://arxiv.org/abs/0905.1054}, 1663 url = {http://arxiv.org/pdf/0905.1054v1}, 1664 petsc_uses = {KSP} 1665} 1666 1667@InProceedings{ oshahjs2006, 1668 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 1669 S.J. Janhunen and T.P. Kiviniemi}, 1670 title = {Performance enhancements to ELMFIRE gyrokinetic code leading to new ranges of 1671 application}, 1672 booktitle = {33rd EPS Conference on Plasma Phys.}, 1673 year = {2006}, 1674 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 1675 note = {European fusion code}, 1676 petsc_uses = {KSP} 1677} 1678 1679@Article{ zhu2006, 1680 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 1681 title = {Intermediate nonlinear evolution of the Parker instability: Formation of 1682 convection-induced discontinuities and absence of finite-time singularities}, 1683 journal = {Phys. Rev. Lett.}, 1684 volume = {96}, 1685 number = {065001}, 1686 year = {2006}, 1687 doi = {10.1103/PhysRevLett.96.065001}, 1688 petsc_uses = {KSP} 1689} 1690 1691@InProceedings{ ppc2005, 1692 author = {B. Philip and M. Pernice and L.Chacon}, 1693 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 1694 Refinement}, 1695 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 1696 methods}, 1697 year = {2005}, 1698 lab = {LANL}, 1699 petsc_uses = {KSP} 1700} 1701 1702@Article{ pp2005, 1703 author = {M. Pernice and B. Philip}, 1704 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 1705 Refinement}, 1706 year = {2005}, 1707 journal = {SIAM J. of Sci. Comput.}, 1708 lab = {LANL}, 1709 petsc_uses = {KSP} 1710} 1711 1712@Article{ gt2004, 1713 author = {A. H. Glasser and X. Z. Tang}, 1714 title = {The SEL macroscopic modeling code}, 1715 year = {2004}, 1716 journal = {Computer Physics Communications}, 1717 pages = {237--243}, 1718 volume = {164}, 1719 lab = {LANL}, 1720 petsc_uses = {KSP} 1721} 1722 1723@Article{ nl2006, 1724 author = {Y. Nishimura and Z.Lin}, 1725 title = {A finite element mesh in a tokamak edge geometry}, 1726 year = {2006}, 1727 journal = {Contributions to Plasma Physics}, 1728 volume = {22}, 1729 lab = {PPPL}, 1730 petsc_uses = {KSP} 1731} 1732 1733@Article{ nlle2004, 1734 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 1735 title = {A finite element Poisson solver for gyrokinetic particle simulations in a global 1736 field aligned mesh}, 1737 year = {2006}, 1738 journal = {J. Comput. Phys.}, 1739 volume = {214}, 1740 pages = {657}, 1741 lab = {PPPL}, 1742 petsc_uses = {KSP} 1743} 1744 1745@InProceedings{ lnlle2004, 1746 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 1747 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 1748 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 1749 year = {2004}, 1750 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 1751 lab = {PPPL}, 1752 petsc_uses = {KSP} 1753} 1754 1755@InProceedings{ nlclew2004, 1756 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 1757 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 1758 model}, 1759 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 1760 year = {2004}, 1761 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 1762 lab = {PPPL}, 1763 petsc_uses = {KSP} 1764} 1765 1766@Article{ tb1, 1767 author = {X.~Z.~Tang and A.~H.~Boozer}, 1768 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 1769 plasma}, 1770 journal = {Physics of Plasmas}, 1771 year = {2004}, 1772 pages = {171--185}, 1773 volume = {11}, 1774 lab = {LANL}, 1775 petsc_uses = {KSP} 1776} 1777 1778@Unpublished{ nlcw, 1779 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 1780 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 1781 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 1782 Albuquerque, New Mexico, October 2003}, 1783 year = {2003}, 1784 petsc_uses = {KSP} 1785} 1786 1787@TechReport{ tang2001, 1788 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 1789 Strauss}, 1790 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 1791 year = {2001}, 1792 institution = {Princeton Plasma Physics Laboratory}, 1793 number = {PPPL-3532}, 1794 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 1795 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 1796 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 1797 March 12-14, 2001.}, 1798 lab = {PPPL}, 1799 petsc_uses = {KSP} 1800} 1801 1802% LiteralHTML: 1803% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 1804% LiteralHTML: 1805@Article{ valerathomasgarciacastillo2019, 1806 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 1807 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 1808 Coastal Ocean Model}, 1809 journal = {Journal of Marine Science and Engineering}, 1810 volume = {7}, 1811 number = {6}, 1812 article-number= {185}, 1813 url = {https://www.mdpi.com/2077-1312/7/6/185}, 1814 issn = {2077-1312}, 1815 doi = {10.3390/jmse7060185}, 1816 year = {2019}, 1817 petsc_uses = {KSP} 1818} 1819 1820@Article{ furuichimat2015, 1821 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 1822 thermal convection simulation surrounded by free surface}, 1823 author = {Mikito Furuichi and Dave A May}, 1824 journal = {Computer Physics Communications}, 1825 volume = {192}, 1826 pages = {1--11}, 1827 year = {2015}, 1828 petsc_uses = {KSP} 1829} 1830 1831@Article{ sharplesmoresivelicjadamecmay2016, 1832 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 1833 model}, 1834 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 1835 Dave A May}, 1836 journal = {Physics of the Earth and Planetary Interiors}, 1837 volume = {252}, 1838 pages = {77--90}, 1839 year = {2016}, 1840 petsc_uses = {KSP} 1841} 1842 1843@Article{ spiegelmanmaywilson2016, 1844 title = {On the solvability of incompressible Stokes with viscoplastic rheologies in 1845 geodynamics}, 1846 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 1847 journal = {Geochemistry, Geophysics, Geosystems}, 1848 volume = {17}, 1849 number = {6}, 1850 pages = {2213--2238}, 1851 year = {2016}, 1852 petsc_uses = {KSP} 1853} 1854 1855@Article{ buiteretal2016, 1856 title = {Benchmarking numerical models of brittle thrust wedges}, 1857 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 1858 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 1859 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 1860 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 1861 journal = {Journal of structural geology}, 1862 volume = {92}, 1863 pages = {140--177}, 1864 year = {2016}, 1865 petsc_uses = {KSP} 1866} 1867 1868@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 1869 title = {Modular and flexible spectral-element waveform modelling in two and three 1870 dimensions}, 1871 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 1872 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 1873 journal = {Geophysical Journal International}, 1874 volume = {216}, 1875 number = {3}, 1876 pages = {1675--1692}, 1877 doi = {10.1093/gji/ggy469}, 1878 year = {2019}, 1879 petsc_uses = {KSP} 1880} 1881 1882@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 1883 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 1884 Modeling}, 1885 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 1886 Martin van Driel and Lion Krischer and Andreas Fichtner}, 1887 journal = {SIAM Journal on Scientific Computing}, 1888 volume = {43}, 1889 number = {2}, 1890 pages = {C127--C153}, 1891 eprint = {http://arxiv.org/abs/2004.08729}, 1892 doi = {10.1137/20M1332748}, 1893 year = {2021}, 1894 petsc_uses = {KSP} 1895} 1896 1897@Article{ parsani2021, 1898 title = {High-order accurate entropy-stable discontinuous collocated Galerkin methods with 1899 the summation-by-parts property for compressible CFD frameworks: Scalable SSDC 1900 algorithms and flow solver}, 1901 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 1902 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 1903 journal = {Journal of Computational Physics}, 1904 volume = {424}, 1905 pages = {109844}, 1906 issn = {0021-9991}, 1907 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 1908 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 1909 year = {2021}, 1910 petsc_uses = {KSP} 1911} 1912 1913@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 1914 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 1915 governed by {PDEs}}, 1916 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 1917 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 1918 journal = {SIAM Journal of Scientific Computing}, 1919 volume = {42}, 1920 number = {5}, 1921 pages = {A3397--A3426}, 1922 year = {2020} 1923} 1924 1925@Article{ zampinibouakaramturkiyyahkniokeyes2022, 1926 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 1927 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 1928 Keyes}, 1929 journal = {Advances on Computational Mathematics}, 1930 note = {In press}, 1931 year = {2022} 1932} 1933 1934@Article{ dassizampiniscacchi2022, 1935 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 1936 discretizations of elliptic equations in mixed form}, 1937 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 1938 journal = {Computer Methods in Applied Mechanics and Engineering}, 1939 volume = {391}, 1940 pages = {114620}, 1941 year = {2022} 1942} 1943 1944@Article{ youngoppenheimdimant2017, 1945 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 1946 title = {Hybrid simulations of coupled Farley-Buneman/gradient drift instabilities in the 1947 equatorial E region ionosphere}, 1948 journal = {Journal of Geophysical Research: Space Physics}, 1949 volume = {122}, 1950 number = {5}, 1951 issn = {2169-9402}, 1952 doi = {10.1002/2017JA024161}, 1953 pages = {5768--5781}, 1954 year = {2017}, 1955 petsc_uses = {KSP} 1956} 1957 1958@Article{ rioussetpatylillisfillingimenglandwithershale2013, 1959 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in Mars' 1960 dynamo region}, 1961 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 1962 and Scott L England and Paul G Withers and John P M Hale}, 1963 journal = {Journal of Geophysical Research: Space Physics}, 1964 volume = {118}, 1965 number = {6}, 1966 pages = {3647--3659}, 1967 year = {2013}, 1968 publisher = {Wiley Online Library}, 1969 petsc_uses = {KSP} 1970} 1971 1972@Article{ chien2016representation, 1973 title = {Representation of topography by partial steps using the immersed boundary method 1974 in a vector vorticity equation model (VVM)}, 1975 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 1976 journal = {Journal of Advances in Modeling Earth Systems}, 1977 year = {2016}, 1978 publisher = {Wiley Online Library}, 1979 petsc_uses = {KSP} 1980} 1981 1982@Article{ berger2015parallel, 1983 title = {Parallel preconditioners for monolithic solution of shear bands}, 1984 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 1985 journal = {Journal of Computational Physics}, 1986 year = {2015}, 1987 publisher = {Elsevier}, 1988 petsc_uses = {KSP} 1989} 1990 1991@Article{ may2015496, 1992 title = {A scalable, matrix-free multigrid preconditioner for finite element 1993 discretizations of heterogeneous {S}tokes flow }, 1994 journal = {Computer Methods in Applied Mechanics and Engineering }, 1995 volume = {290}, 1996 number = {0}, 1997 pages = {496--523}, 1998 year = {2015}, 1999 issn = {0045-7825}, 2000 doi = {10.1016/j.cma.2015.03.014}, 2001 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 2002 petsc_uses = {KSP} 2003} 2004 2005@Article{ isaacknepley2017, 2006 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 2007 author = {Tobin Isaac and Matthew G. Knepley}, 2008 journal = {ACM Transaction on Mathematical Software}, 2009 eprint = {1508.02470}, 2010 note = {In review}, 2011 year = {2017}, 2012 petsc_uses = {KSP} 2013} 2014 2015@Article{ knepleylangegorman2017, 2016 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 2017 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 2018 journal = {ArXiv e-prints}, 2019 eprint = {1506.06194}, 2020 year = {2017}, 2021 petsc_uses = {DMPlex} 2022} 2023 2024@Article{ langemitchellknepleygorman2015, 2025 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2026 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2027 journal = {SIAM Journal on Scientific Computing}, 2028 volume = {38}, 2029 number = {5}, 2030 pages = {S143--S155}, 2031 eprint = {http://arxiv.org/abs/1506.07749}, 2032 doi = {10.1137/15M1026092}, 2033 year = {2016}, 2034 petsc_uses = {DMPlex} 2035} 2036 2037@InProceedings{ langeknepleygorman2015, 2038 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 2039 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 2040 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 2041 month = apr, 2042 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 2043 year = {2015}, 2044 petsc_uses = {DMPlex} 2045} 2046 2047@InProceedings{ wallworkknepleybarralpiggott2022, 2048 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 2049 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 2050 Piggott}, 2051 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 2052 editor = {Trevor Robinson}, 2053 month = jan, 2054 address = {Seattle, WA}, 2055 pages = {1--5}, 2056 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 2057 year = {2022}, 2058 petsc_uses = {DMPlex} 2059} 2060 2061@InProceedings{ timalsinaknepley2023, 2062 title = {Tetrahedralization of a Hexahedral Mesh}, 2063 author = {Aman Timalsina and Matthew G. Knepley}, 2064 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 2065 year = {2023}, 2066 petsc_uses = {DMPlex} 2067} 2068 2069@Article{ farrellknepleywechsungmitchell2020, 2070 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 2071 methods}, 2072 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 2073 Wechsung}, 2074 journal = {ACM Transaction on Mathematical Software}, 2075 eprint = {http://arxiv.org/abs/1912.08516}, 2076 volume = {47}, 2077 number = {3}, 2078 pages = {1--22}, 2079 year = {2021}, 2080 petsc_uses = {KSP,DMPlex} 2081} 2082 2083@Article{ farrellmitchellscottwechsung2022, 2084 title = {Robust multigrid methods for nearly incompressible elasticity using macro 2085 elements}, 2086 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 2087 Wechsung}, 2088 journal = {IMA Journal of Numerical Analysis}, 2089 issn = {0272-4979}, 2090 doi = {10.1093/imanum/drab083}, 2091 url = {https://doi.org/10.1093/imanum/drab083}, 2092 year = {2022}, 2093 petsc_uses = {KSP,DMPlex} 2094} 2095 2096@Misc{ firedrakeproject, 2097 title = {{The Firedrake project}}, 2098 author = {David A Ham and Firedrake Team}, 2099 url = {http://firedrakeproject.org}, 2100 year = {2022}, 2101 petsc_uses = {KSP} 2102} 2103 2104@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 2105 title = {Firedrake: automating the finite element method by composing abstractions}, 2106 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 2107 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 2108 and Paul HJ Kelly}, 2109 journal = {ACM Transactions on Mathematical Software (TOMS)}, 2110 volume = {43}, 2111 number = {3}, 2112 pages = {24}, 2113 year = {2016}, 2114 petsc_uses = {KSP} 2115} 2116 2117@Article{ mitchellmuller2016, 2118 title = {High level implementation of geometric multigrid solvers for finite element 2119 problems: Applications in atmospheric modelling}, 2120 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 2121 journal = {Journal of Computational Physics}, 2122 volume = {327}, 2123 pages = {1--18}, 2124 year = {2016}, 2125 petsc_uses = {KSP} 2126} 2127 2128@Article{ mcraeberceamitchellhamcotter2016, 2129 title = {Automated generation and symbolic manipulation of tensor product finite 2130 elements}, 2131 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 2132 and Colin J Cotter}, 2133 journal = {SIAM Journal on Scientific Computing}, 2134 volume = {38}, 2135 number = {5}, 2136 pages = {S25--S47}, 2137 year = {2016}, 2138 petsc_uses = {KSP} 2139} 2140 2141@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 2142 title = {A structure-exploiting numbering algorithm for finite elements on extruded 2143 meshes, and its performance evaluation in {Firedrake}}, 2144 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 2145 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 2146 journal = {Geoscientific Model Development}, 2147 volume = {9}, 2148 number = {10}, 2149 pages = {3803--3815}, 2150 doi = {10.5194/gmd-9-3803-2016}, 2151 year = {2016}, 2152 petsc_uses = {KSP} 2153} 2154 2155@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 2156 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 2157 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 2158 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 2159 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 2160 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 2161 publisher = {Springer Berlin Heidelberg}, 2162 pages = {279--289}, 2163 isbn = {978-3-642-38750-0}, 2164 doi = {10.1007/978-3-642-38750-0_21}, 2165 year = {2013}, 2166 petsc_uses = {KSP} 2167} 2168 2169@Article{ kirbymitchell2017, 2170 title = {Solver composition across the {PDE}/linear algebra barrier}, 2171 author = {Robert C Kirby and Lawrence Mitchell}, 2172 journal = {arXiv preprint arXiv:1706.01346}, 2173 year = {2017}, 2174 petsc_uses = {KSP} 2175} 2176 2177@Article{ saibaba2012application, 2178 title = {Application of hierarchical matrices to linear inverse problems in 2179 geostatistics}, 2180 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 2181 Peter K and Darve, Eric F}, 2182 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 2183 volume = {67}, 2184 number = {5}, 2185 pages = {857}, 2186 year = {2012}, 2187 petsc_uses = {KSP} 2188} 2189 2190@Article{ collignonkausmayfernandez14, 2191 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 2192 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 2193 journal = {Geochem Geophy Geosy}, 2194 year = {2014}, 2195 petsc_uses = {KSP} 2196} 2197 2198@Article{ fernandezkaus14, 2199 author = {Fern\'andez, N. and Kaus, B.}, 2200 title = {Fold interaction and wavelength selection in 3D models of multilayer detachment 2201 folding}, 2202 journal = {Tectonophysics}, 2203 year = {2014}, 2204 petsc_uses = {KSP} 2205} 2206 2207@Article{ baumannkauspopov14, 2208 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 2209 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 2210 journal = {Tectonophysics}, 2211 year = {2014}, 2212 petsc_uses = {KSP} 2213} 2214 2215@Article{ lechmannschmalholzhetenyimaykaus14, 2216 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 2217 J. P.}, 2218 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 2219 of the modern {India-Asia} collisional system with {3-D} numerical models}, 2220 journal = { Journal of Geophysical Research - Solid Earth}, 2221 year = {2014}, 2222 petsc_uses = {KSP} 2223} 2224 2225@InBook{ fernandezkaus14b, 2226 author = {Fern\'andez N. and Kaus B.J.P.}, 2227 title = {Analytical and numerical investigation of 3D multilayer detachment}, 2228 booktitle = {Mathematics of Planet Earth}, 2229 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 2230 and Dur\'an J.J. and Vargas-Guzman J.A.}, 2231 publisher = {Springer}, 2232 year = {2014}, 2233 petsc_uses = {KSP} 2234} 2235 2236@Article{ hossein-hsueh-etal-2014a, 2237 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 2238 journal = {J. Mech. Phys. Solids}, 2239 pages = {320--348}, 2240 title = {Effective toughness of heterogeneous media}, 2241 volume = {71}, 2242 year = {2014}, 2243 petsc_uses = {KSP} 2244} 2245 2246@Unpublished{ leon-baldelli-bourdin-2014a, 2247 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 2248 month = aug, 2249 note = {Submitted.}, 2250 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 2251 year = {2014}, 2252 petsc_uses = {KSP} 2253} 2254 2255@Article{ leon-baldelli-babadjian-etal-2013a, 2256 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 2257 Maurini, C.}, 2258 journal = {J. Mech. Phys. Solids}, 2259 pages = {15-32}, 2260 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 2261 volume = {70}, 2262 year = {2014}, 2263 petsc_uses = {KSP} 2264} 2265 2266@Article{ mesgarnejad-bourdin-etal-2014a, 2267 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 2268 journal = {Comp. Methods Appl. Mech. Engng.}, 2269 title = {Validation simulations for the variational approach to fracture}, 2270 volume = {Submitted}, 2271 year = {2014}, 2272 petsc_uses = {KSP} 2273} 2274 2275@InProceedings{ bourdin-chukwudozie-etal-2013a, 2276 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 2277 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 2278 University, Stanford, CA}, 2279 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 2280 Fracturing Under In-Situ Stresses}, 2281 year = {2013}, 2282 petsc_uses = {KSP} 2283} 2284 2285@Article{ maurini-bourdin-etal-2012a, 2286 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 2287 journal = {Int. J. Fracture}, 2288 number = {1-2}, 2289 pages = {75-91}, 2290 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 2291 capillary tube: experiments and numerical simulations using a two-dimensional 2292 variational approach}, 2293 volume = {184}, 2294 year = {2013}, 2295 petsc_uses = {KSP} 2296} 2297 2298@Article{ mesgarnejad-bourdin-etal-2013a, 2299 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 2300 journal = {J. Mech. Phys Solids}, 2301 number = {11}, 2302 pages = {2360--2379}, 2303 title = {A variational approach to the fracture of brittle thin films under out of plane 2304 loading}, 2305 volume = {61}, 2306 year = {2013}, 2307 petsc_uses = {KSP} 2308} 2309 2310@InProceedings{ bourdin-chukwudozie-etal-2012a, 2311 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 2312 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 2313 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 2314 volume = {SPE 159154}, 2315 year = {2012}, 2316 petsc_uses = {KSP} 2317} 2318 2319@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 2320 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 2321 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 2322 Langtangen}, 2323 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 2324 journal = {Advances in Water Resources}, 2325 volume = {51}, 2326 number = {0}, 2327 pages = {405--437}, 2328 year = {2013}, 2329 note = {35th Year Anniversary Issue}, 2330 issn = {0309-1708}, 2331 doi = {10.1016/j.advwatres.2012.05.008}, 2332 petsc_uses = {KSP} 2333} 2334 2335@Article{ scheltingamyerspietrzak10, 2336 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 2337 title = {A finite element sea ice model of the Canadian Arctic Archipelago}, 2338 journal = {Ocean Dynamics}, 2339 volume = {60}, 2340 number = {6}, 2341 pages = {1539-1558}, 2342 year = {2010}, 2343 issn = {1616-7341}, 2344 doi = {10.1007/s10236-010-0356-5}, 2345 publisher = {Springer-Verlag}, 2346 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 2347 Archipelago; Freshwater flux}, 2348 language = {English}, 2349 petsc_uses = {KSP} 2350} 2351 2352@InBook{ destefanoandreasisecchi13, 2353 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 2354 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 2355 inversions}, 2356 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 2357 chapter = {626}, 2358 pages = {3226--3230}, 2359 doi = {10.1190/segam2013-0244.1}, 2360 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 2361 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 2362 petsc_uses = {KSP} 2363} 2364 2365@Article{ pourhiethuetmaylabroussejolivet12, 2366 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 2367 title = {Kinematic interpretation of the 3D shapes of metamorphic core complexes}, 2368 journal = {Geochem. Geophys. Geosyst.}, 2369 volume = {13}, 2370 pages = {Q09002}, 2371 year = {2012}, 2372 doi = {10.1029/2012GC004271}, 2373 petsc_uses = {KSP} 2374} 2375 2376@Article{ lechmannmaykausschmalholz11, 2377 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 2378 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 2379 collision}, 2380 journal = {Geophysical Journal International}, 2381 volume = {187}, 2382 pages = {10--33}, 2383 year = {2011}, 2384 doi = {10.1111/j.1365-246X.2011.05164.x}, 2385 petsc_uses = {KSP} 2386} 2387 2388@Article{ stefano:r69, 2389 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 2390 Virgilio and Fred F. Snyder}, 2391 collaboration = {}, 2392 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 2393 application to subsalt imaging}, 2394 publisher = {SEG}, 2395 year = {2011}, 2396 journal = {Geophysics}, 2397 volume = {76}, 2398 number = {3}, 2399 pages = {R69-R80}, 2400 keywords = {geophysical image processing; inverse problems; seismology}, 2401 doi = {10.1190/1.3554652}, 2402 petsc_uses = {KSP} 2403} 2404 2405@Article{ stefano:806, 2406 author = {Michele De Stefano}, 2407 collaboration = {}, 2408 title = {Simultaneous joint inversion for susceptibility and velocity}, 2409 publisher = {SEG}, 2410 year = {2011}, 2411 journal = {SEG Technical Program Expanded Abstracts}, 2412 volume = {30}, 2413 number = {1}, 2414 pages = {806-810}, 2415 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 2416 doi = {10.1190/1.3628198}, 2417 petsc_uses = {KSP} 2418} 2419 2420@Article{ mayknepley2011, 2421 author = {Dave A. May and Matthew G. Knepley}, 2422 title = {Optimal, scalable forward models for computing gravity anomalies}, 2423 journal = {Geophysical Journal International}, 2424 volume = {187}, 2425 number = {1}, 2426 pages = {161--177}, 2427 url = {http://arxiv.org/abs/1107.5951}, 2428 note = {\url{http://arxiv.org/abs/1107.5951}}, 2429 year = {2011}, 2430 petsc_uses = {KSP} 2431} 2432 2433@InProceedings{ bourdinknepleymaurini2010, 2434 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 2435 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 2436 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 2437 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 2438 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 2439 address = {Stanford, CA}, 2440 year = {2010}, 2441 petsc_uses = {KSP} 2442} 2443 2444@InProceedings{ bourdinknepleymaurini2010b, 2445 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 2446 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 2447 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 2448 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 2449 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 2450 address = {Sacramento, CA}, 2451 year = {2010}, 2452 petsc_uses = {KSP} 2453} 2454 2455@Article{ chen2007full, 2456 title = {Full 3D tomography for the crustal structure of the Los Angeles region}, 2457 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 2458 journal = {Bulletin of the Seismological Society of America}, 2459 volume = {97}, 2460 number = {4}, 2461 pages = {1094}, 2462 year = {2007}, 2463 publisher = {Seismol Soc America}, 2464 petsc_uses = {KSP} 2465} 2466 2467@Article{ brown2010ens, 2468 author = {Brown, Jed}, 2469 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 2470 Zürich, Switzerland}, 2471 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 2472 journal = {Journal of Scientific Computing}, 2473 publisher = {Springer Netherlands}, 2474 issn = {0885-7474}, 2475 keyword = {Mathematics and Statistics}, 2476 pages = {48-63}, 2477 volume = {45}, 2478 issue = {1}, 2479 doi = {10.1007/s10915-010-9396-8}, 2480 year = {2010}, 2481 petsc_uses = {KSP} 2482} 2483 2484@PhDThesis{ brown2011, 2485 title = {Computational methods for ice flow simulation}, 2486 author = {Jed Brown}, 2487 school = {ETH Z{\"u}rich}, 2488 year = {2011}, 2489 petsc_uses = {KSP} 2490} 2491 2492@Article{ brown2013tmeice, 2493 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 2494 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 2495 journal = {SIAM Journal on Scientific Computing}, 2496 volume = {35}, 2497 number = {2}, 2498 year = {2013}, 2499 pages = {359--375}, 2500 doi = {10.1137/110834512}, 2501 note = {Also preprint ANL/MCS-P743-1298}, 2502 petsc_uses = {KSP} 2503} 2504 2505@InProceedings{ brown2013quasinewton, 2506 author = {Jed Brown and Peter Brune}, 2507 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 2508 methods}, 2509 year = {2013}, 2510 booktitle = {International Conference on Mathematics and Computational Methods Applied to 2511 Nuclear Science and Engineering}, 2512 pages = {2554--2565}, 2513 petsc_uses = {KSP} 2514} 2515 2516@Misc{ spiegelman-siampp10, 2517 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 2518 Earth Geodynamics}, 2519 author = {Marc Spiegelman}, 2520 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 2521 Computing}, 2522 year = {2010}, 2523 petsc_uses = {KSP} 2524} 2525 2526@Article{ schauer2011a, 2527 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 2528 Quintana-Ort\'{\i}}, 2529 title = {Large scale simulation of wave propagation in soils interacting with structures 2530 using {FEM} and {SBFEM}}, 2531 journal = {Journal of Computational Acoustics}, 2532 volume = {19}, 2533 number = {1}, 2534 pages = {75--93}, 2535 year = {2011}, 2536 doi = {10.1142/S0218396X11004316}, 2537 petsc_uses = {KSP} 2538} 2539 2540@Misc{ bsa2010, 2541 author = {J. Brown and B. Smith and A. Ahmadia}, 2542 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 2543 note = {submitted to SIAM Journal on Scientific Computing}, 2544 year = {2012}, 2545 petsc_uses = {KSP} 2546} 2547 2548@Article{ kellerkatz2016, 2549 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 2550 author = {Tobias Keller and Richard F. Katz}, 2551 journal = {Journal of Petrology}, 2552 doi = {10.1093/petrology/egw030}, 2553 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 2554 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 2555 year = {2016}, 2556 petsc_uses = {KSP} 2557} 2558 2559@Article{ weatherley12, 2560 author = {S. Weatherley and R.F. Katz}, 2561 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 2562 mantle}, 2563 journal = {Geochem.\ Geophys.\ Geosys.}, 2564 year = {2012}, 2565 volume = {13}, 2566 number = {1}, 2567 pages = {Q0AC18}, 2568 doi = {10.1029/2011GC003989}, 2569 petsc_uses = {KSP} 2570} 2571 2572@Article{ katz12, 2573 author = {R.F. Katz and S. Weatherley}, 2574 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 2575 journal = {Earth\ Planet.\ Sci.\ Lett.}, 2576 year = {2012}, 2577 doi = {10.1016/j.epsl.2012.04.042}, 2578 volume = {335-336}, 2579 pages = {226-237}, 2580 petsc_uses = {KSP} 2581} 2582 2583@Article{ katz10b, 2584 author = {R.F. Katz}, 2585 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 2586 journal = {Geochem.\ Geophys.\ Geosys.}, 2587 volume = {10}, 2588 number = {Q0AC07}, 2589 year = {2010}, 2590 doi = {10.1029/2010GC003282}, 2591 petsc_uses = {KSP} 2592} 2593 2594@Article{ england10, 2595 author = {P.C. England and R.F. Katz}, 2596 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 2597 journal = {Nature}, 2598 year = {2010}, 2599 volume = {467}, 2600 pages = {700--703}, 2601 doi = {10.1038/nature09417}, 2602 petsc_uses = {KSP} 2603} 2604 2605@Article{ weatherley10, 2606 author = {S. Weatherley and R.F. Katz}, 2607 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 2608 journal = {Geochem.\ Geophys.\ Geosys.}, 2609 year = {2010}, 2610 volume = {11}, 2611 number = {10}, 2612 doi = {10.1029/2010GC003192}, 2613 petsc_uses = {KSP} 2614} 2615 2616@Article{ katz10, 2617 author = {R.F. Katz and M.G. Worster}, 2618 title = {The stability of ice-sheet grounding lines}, 2619 journal = {Proc.~Roy.~Soc.~A}, 2620 year = {2010}, 2621 volume = {466}, 2622 pages = {1597--1620}, 2623 doi = {10.1098/rspa.2009.0434}, 2624 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 2625 petsc_uses = {KSP} 2626} 2627 2628@Article{ kyrkesmith2013stress, 2629 title = {Stress balances of ice streams in a vertically integrated, higher-order 2630 formulation}, 2631 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 2632 journal = {Journal of Glaciology}, 2633 volume = {59}, 2634 number = {215}, 2635 pages = {449--466}, 2636 year = {2013}, 2637 doi = {10.3189/2013JoG12J140}, 2638 petsc_uses = {KSP} 2639} 2640 2641@Article{ takei2013anisotropy1, 2642 author = {Takei Y. and R.F. Katz}, 2643 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 2644 Governing equations and linearised analysis}}, 2645 journal = {J.\ Fluid\ Mech.}, 2646 year = {2013}, 2647 volume = {734}, 2648 pages = {424-455}, 2649 doi = {10.1017/jfm.2013.482}, 2650 petsc_uses = {KSP} 2651} 2652 2653@Article{ katz2013anisotropy2, 2654 author = {Katz R.F. and Y. Takei}, 2655 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 2656 Numerical solutions of the full equations}}, 2657 journal = {J.\ Fluid\ Mech.}, 2658 year = {2013}, 2659 volume = {734}, 2660 pages = {456-485}, 2661 doi = {10.1017/jfm.2013.483}, 2662 petsc_uses = {KSP} 2663} 2664 2665@Article{ kyrke-smith2014subglacial, 2666 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 2667 title = {Subglacial hydrology and the formation of ice streams}, 2668 journal = {Proc.\ Roy.\ Soc.\ A}, 2669 year = {2014}, 2670 volume = {470}, 2671 number = {2161}, 2672 doi = {10.1098/rspa.2013.0494}, 2673 petsc_uses = {KSP} 2674} 2675 2676@Article{ spiegelmanwilsonvankeken2013, 2677 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 2678 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 2679 multi-physics problems in the solid Earth sciences}}, 2680 journal = {AGU Fall Meeting Abstracts}, 2681 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 2682 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 2683 year = {2013}, 2684 month = dec, 2685 pages = {A2208}, 2686 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 2687 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 2688 petsc_uses = {KSP} 2689} 2690 2691@Article{ bueler2009shallow, 2692 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 2693 ice sheet model}}, 2694 author = {Ed Bueler and Jed Brown}, 2695 journal = {Journal of Geophysical Research-Earth Surface}, 2696 volume = {114}, 2697 number = {F3}, 2698 pages = {F03008}, 2699 year = {2009}, 2700 publisher = {American Geophysical Union}, 2701 petsc_uses = {KSP} 2702} 2703 2704@Article{ bueler2007est, 2705 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 2706 effective tools for verification}}, 2707 author = {Ed Bueler and Jed Brown and Craig Lingle}, 2708 journal = {J. Glaciol}, 2709 volume = {53}, 2710 pages = {499--516}, 2711 year = {2007}, 2712 petsc_uses = {KSP} 2713} 2714 2715@Article{ bueler2007fcv, 2716 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 2717 simulations}}, 2718 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 2719 journal = {Ann. Glaciol}, 2720 volume = {46}, 2721 pages = {97--105}, 2722 year = {2007}, 2723 petsc_uses = {KSP} 2724} 2725 2726@Article{ bueler2005iso, 2727 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 2728 Latrice N. Bowman}, 2729 title = {Exact solutions and numerical verification for isothermal ice sheets}, 2730 journal = {J. Glaciol.}, 2731 volume = {51}, 2732 number = {173}, 2733 pages = {291--306}, 2734 year = {2005}, 2735 petsc_uses = {KSP} 2736} 2737 2738@Article{ chao2008programming, 2739 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 2740 author = {Chao-fan, Z. and Yao-lin, S.}, 2741 journal = {Earthquake}, 2742 year = {2008}, 2743 petsc_uses = {KSP} 2744} 2745 2746@Article{ marti2014, 2747 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 2748 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 2749 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 2750 title = {Full sphere hydrodynamic and dynamo benchmarks}, 2751 journal = {Geophysical Journal International}, 2752 year = {2014}, 2753 doi = {10.1093/gji/ggt518}, 2754 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 2755 petsc_uses = {KSP} 2756} 2757 2758@InProceedings{ ganfulukyangxueyang2013, 2759 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 2760 Guangwen}, 2761 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 2762 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 2763 Field-Programmable Custom Computing Machines}, 2764 series = {FCCM '13}, 2765 pages = {230--}, 2766 year = {2013}, 2767 isbn = {978-0-7695-4969-9}, 2768 doi = {10.1109/FCCM.2013.26}, 2769 acmid = {2495688}, 2770 publisher = {IEEE Computer Society}, 2771 petsc_uses = {KSP} 2772} 2773 2774@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 2775 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 2776 Xiaomeng Huang and Guangwen Yang}, 2777 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 2778 Conference on}, 2779 title = {A highly-efficient and green data flow engine for solving euler atmospheric 2780 equations}, 2781 year = {2014}, 2782 month = sep, 2783 pages = {1-6}, 2784 doi = {10.1109/FPL.2014.6927462}, 2785 petsc_uses = {KSP} 2786} 2787 2788%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 2789%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 2790%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 2791@Article{ aagaardknepleywilliams13, 2792 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 2793 Models of Quasi-static and Dynamic Crustal Deformation}, 2794 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 2795 journal = {Journal of Geophysical Research: Solid Earth}, 2796 volume = {118}, 2797 number = {6}, 2798 pages = {3059--3079}, 2799 issn = {2169-9356}, 2800 doi = {10.1002/jgrb.50217}, 2801 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 2802 year = {2013}, 2803 petsc_uses = {KSP} 2804} 2805 2806@InProceedings{ aagaardknepleywilliams11, 2807 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 2808 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 2809 Deformation}, 2810 booktitle = {Eos Transactions of the AGU}, 2811 organization = {American Geophysical Union}, 2812 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 2813 year = {2011}, 2814 petsc_uses = {KSP} 2815} 2816 2817@InProceedings{ knepley10b, 2818 author = {Matthew G. {Knepley}}, 2819 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 2820 booktitle = {Eos Transactions of the AGU}, 2821 organization = {American Geophysical Union}, 2822 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 2823 year = {2010}, 2824 petsc_uses = {KSP} 2825} 2826 2827@InProceedings{ mayknepleygurnis09, 2828 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 2829 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 2830 booktitle = {Eos Transactions of the AGU}, 2831 organization = {American Geophysical Union}, 2832 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 2833 year = {2009}, 2834 petsc_uses = {KSP} 2835} 2836 2837@InProceedings{ yuenknepleyerlebacherwright09, 2838 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 2839 title = {The Coming Role of {GPU} in Computational Geodynamics}, 2840 booktitle = {Eos Transactions of the AGU}, 2841 organization = {American Geophysical Union}, 2842 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 2843 year = {2009}, 2844 petsc_uses = {KSP} 2845} 2846 2847@InProceedings{ aagaardknepleywilliams08, 2848 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 2849 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 2850 Deformation}, 2851 booktitle = {Eos Transactions of the AGU}, 2852 organization = {American Geophysical Union}, 2853 volume = {89}, 2854 number = {53}, 2855 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 2856 year = {2007}, 2857 petsc_uses = {KSP} 2858} 2859 2860@InProceedings{ aagaardknepleywilliams07, 2861 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 2862 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 2863 Deformation}, 2864 booktitle = {Eos Transactions of the AGU}, 2865 organization = {American Geophysical Union}, 2866 volume = {88}, 2867 number = {52}, 2868 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 2869 year = {2007}, 2870 petsc_uses = {KSP} 2871} 2872 2873@InProceedings{ aagaardknepleywilliams05, 2874 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 2875 title = {Development of software for studying earthquakes across multiple spatial and 2876 temporal scales by coupling quasi-static and dynamic simulations}, 2877 booktitle = {Eos Transactions of the AGU}, 2878 organization = {American Geophysical Union}, 2879 volume = {86}, 2880 number = {52}, 2881 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 2882 year = {2005}, 2883 petsc_uses = {KSP} 2884} 2885 2886@InProceedings{ williamsgablehagermeadeaagaardknepley08, 2887 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 2888 Brad Aagaard and Matthew G. Knepley}, 2889 title = {Modeling of Multiple Earthquake Cycles in Southern California Using the {SCEC} 2890 Community Fault Model}, 2891 booktitle = {Proceedings of Geosciences '08}, 2892 address = {Wellington, NZ}, 2893 month = nov, 2894 year = {2008}, 2895 petsc_uses = {KSP} 2896} 2897 2898@TechReport{ zhang07, 2899 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 2900 Tsunamis}, 2901 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 2902 type = {Preprint}, 2903 number = {ANL/MCS-P1459-0907}, 2904 institution = {ANL}, 2905 month = sep, 2906 year = {2007}, 2907 petsc_uses = {KSP} 2908} 2909 2910@Article{ katz08b, 2911 author = {Richard F. Katz}, 2912 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 2913 focusing at mid-ocean ridges}, 2914 journal = {J. Petrology}, 2915 year = {2008}, 2916 volume = {49}, 2917 pages = {2099--2121}, 2918 doi = {10.1093/petrology/egn058}, 2919 petsc_uses = {KSP} 2920} 2921 2922@Article{ hgrhkjvv2008, 2923 title = {On preconditioning for a parallel solution of the Richards equation}, 2924 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 2925 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 2926 journal = {Computers and Geosciences}, 2927 volume = {34}, 2928 pages = {1958--1963}, 2929 year = {2008}, 2930 petsc_uses = {KSP} 2931} 2932 2933@Article{ maymoresi2008, 2934 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 2935 computational geodynamics}, 2936 journal = {Physics of the Earth and Planetary Interiors}, 2937 volume = {171}, 2938 number = {1-4}, 2939 pages = {33--47}, 2940 year = {2008}, 2941 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 2942 Applications}, 2943 issn = {0031-9201}, 2944 doi = {10.1016/j.pepi.2008.07.036}, 2945 author = {Dave A. May and Louis Moresi}, 2946 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 2947 petsc_uses = {KSP} 2948} 2949 2950@Article{ kausmuhlhausmay2010, 2951 title = {A stabilization algorithm for geodynamic numerical simulations with a free 2952 surface}, 2953 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 2954 journal = {Physics of the Earth and Planetary Interiors}, 2955 volume = {181}, 2956 number = {1}, 2957 pages = {12--20}, 2958 year = {2010}, 2959 petsc_uses = {KSP} 2960} 2961 2962@Article{ duretzmaygeryatackley2011, 2963 title = {Discretization errors and free surface stabilization in the finite difference and 2964 marker-in-cell method for applied geodynamics: A numerical study}, 2965 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 2966 journal = {Geochemistry, Geophysics, Geosystems}, 2967 volume = {12}, 2968 number = {7}, 2969 year = {2011}, 2970 petsc_uses = {KSP} 2971} 2972 2973@Article{ furuichimaytackley2011, 2974 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 2975 {Schur} complement approach with mixed precision arithmetic}, 2976 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 2977 journal = {Journal of Computational Physics}, 2978 volume = {230}, 2979 number = {24}, 2980 pages = {8835--8851}, 2981 year = {2011}, 2982 petsc_uses = {KSP} 2983} 2984 2985@Article{ kellermaykaus2013, 2986 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 2987 lithosphere and crust}, 2988 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 2989 journal = {Geophysical Journal International}, 2990 volume = {195}, 2991 number = {3}, 2992 pages = {1406--1442}, 2993 year = {2013}, 2994 petsc_uses = {KSP} 2995} 2996 2997@Article{ schellartfreemanstegmanmoresimay2007, 2998 title = {Evolution and diversity of subduction zones controlled by slab width}, 2999 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 3000 May}, 3001 journal = {Nature}, 3002 volume = {446}, 3003 number = {7133}, 3004 pages = {308--311}, 3005 year = {2007}, 3006 petsc_uses = {KSP} 3007} 3008 3009@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 3010 title = {A comparison of numerical surface topography calculations in geodynamic 3011 modelling: an evaluation of the sticky air method}, 3012 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 3013 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 3014 journal = {Geophysical Journal International}, 3015 volume = {189}, 3016 number = {1}, 3017 pages = {38--54}, 3018 year = {2012}, 3019 petsc_uses = {KSP} 3020} 3021 3022@Article{ stegmanfreemanschellartmoresimay2006, 3023 title = {Influence of trench width on subduction hinge retreat rates in 3-D models of slab 3024 rollback}, 3025 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 3026 May}, 3027 journal = {Geochemistry, Geophysics, Geosystems}, 3028 volume = {7}, 3029 number = {3}, 3030 year = {2006}, 3031 petsc_uses = {KSP} 3032} 3033 3034@InProceedings{ may2014ptatin, 3035 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 3036 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 3037 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 3038 Computing, Networking, Storage and Analysis}}, 3039 organization = {ACM}, 3040 pages = {274--284}, 3041 year = {2014}, 3042 doi = {10.1109/SC.2014.28}, 3043 petsc_uses = {KSP} 3044} 3045 3046@Article{ maybrownpourhiet2015, 3047 title = {A scalable, matrix-free multigrid preconditioner for finite element 3048 discretizations of heterogeneous {Stokes} flow}, 3049 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 3050 journal = {Computer Methods in Applied Mechanics and Engineering}, 3051 volume = {290}, 3052 pages = {496--523}, 3053 year = {2015}, 3054 doi = {10.1016/j.cma.2015.03.014}, 3055 petsc_uses = {KSP} 3056} 3057 3058@Article{ duretzmayyamato2016, 3059 title = {A free surface capturing discretization for the staggered grid finite difference 3060 scheme}, 3061 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 3062 journal = {Geophysical Journal International}, 3063 volume = {204}, 3064 number = {3}, 3065 pages = {1518--1530}, 3066 year = {2016}, 3067 petsc_uses = {KSP} 3068} 3069 3070@Article{ rhebergenwellskatzwathen2014, 3071 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 3072 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 3073 journal = {SIAM J. Sci. Comput.}, 3074 volume = {36}, 3075 pages = {A1960--A1977}, 3076 year = {2014}, 3077 petsc_uses = {KSP} 3078} 3079 3080@Article{ katz08a, 3081 author = {R.F. Katz and M.G. Worster}, 3082 title = {Simulation of directional solidification, thermochemical convection, and chimney 3083 formation in a {H}ele-{S}haw cell}, 3084 journal = {J. Comp. Phys.}, 3085 volume = {227}, 3086 pages = {9823-9840}, 3087 year = {2008}, 3088 doi = {10.1016/j.jcp.2008.06.039}, 3089 petsc_uses = {KSP} 3090} 3091 3092@Article{ aabg2007, 3093 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 3094 title = {Full waveform inversion for seismic velocity and anelastic losses in 3095 heterogeneous structures}, 3096 journal = {Bulletin of Seismological Society of America}, 3097 year = {2007}, 3098 volume = {97}, 3099 pages = {1990--2008}, 3100 petsc_uses = {KSP} 3101} 3102 3103@Article{ katz2006, 3104 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 3105 title = {The dynamics of melt and shear localization in partially molten aggregates}, 3106 journal = {Nature}, 3107 year = {2006}, 3108 volume = {442}, 3109 pages = {676--679}, 3110 month = aug, 3111 day = {10}, 3112 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 3113 petsc_uses = {KSP} 3114} 3115 3116@InProceedings{ mqrs2003, 3117 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 3118 year = {2003}, 3119 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 3120 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 3121 Sozopol, Bulgaria, June 4-8, 2003}, 3122 petsc_uses = {KSP} 3123} 3124 3125@InProceedings{ lichtner1, 3126 author = {Chuan Lu and Peter C. Lichtner}, 3127 year = {2005}, 3128 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 3129 Geologic Media}, 3130 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 3131 lab = {LANL}, 3132 petsc_uses = {KSP} 3133} 3134 3135@Article{ hammondlichtnermills2014, 3136 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 3137 Example with {PFLOTRAN}}, 3138 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 3139 journal = {Water Resources Research}, 3140 volume = {50}, 3141 number = {1}, 3142 pages = {208--228}, 3143 doi = {10.1002/2012WR013483}, 3144 year = {2014}, 3145 petsc_uses = {KSP} 3146} 3147 3148@Article{ smw2003, 3149 author = {R. Scheichl and R. Masson and J. Wendebourg}, 3150 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 3151 journal = {Computational Geosciences}, 3152 year = {2003}, 3153 volume = {7}, 3154 pages = {295--318}, 3155 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 3156 petsc_uses = {KSP} 3157} 3158 3159@Article{ kees-miller-03, 3160 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 3161 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 3162 journal = {Computational Geosciences}, 3163 year = {2003}, 3164 volume = {7}, 3165 pages = {91--114}, 3166 petsc_uses = {KSP} 3167} 3168 3169@Article{ bk2003, 3170 author = {JN Buur and T Kuehnel}, 3171 title = {Improving depth imaging by automated model updating}, 3172 journal = {The Leading Edge}, 3173 year = {2003}, 3174 volume = {22}, 3175 pages = {310-318}, 3176 petsc_uses = {KSP} 3177} 3178 3179@Article{ frederickbuffett2016, 3180 title = {Submarine groundwater discharge as a possible formation mechanism for 3181 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 3182 author = {Jennifer M. Frederick and Bruce A. Buffett}, 3183 journal = {Journal of Geophysical Research: Solid Earth}, 3184 volume = {121}, 3185 number = {3}, 3186 pages = {1383--1404}, 3187 issn = {2169-9356}, 3188 doi = {10.1002/2015JB012627}, 3189 year = {2016}, 3190 petsc_uses = {KSP} 3191} 3192 3193% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3194% LiteralHTML:<font color="#FF0000"> 3195% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 3196% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 3197% LiteralHTML:variety of these simulations.</p> 3198% LiteralHTML:</font> 3199% LiteralHTML: 3200@InProceedings{ appelbe1, 3201 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 3202 year = {2003}, 3203 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 3204 computational methodology}, 3205 page = {781}, 3206 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 3207 Proceedings}, 3208 publisher = {Springer-Verlag}, 3209 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 3210 petsc_uses = {KSP} 3211} 3212 3213% LiteralHTML:<a name="katz"> 3214@InProceedings{ gd1, 3215 author = {Guillaume Dumont and Michel Kern}, 3216 title = {Parallelization of a 3D Seismic Migration Code with PETSc}, 3217 year = {1999}, 3218 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 3219 Computing}, 3220 petsc_uses = {KSP} 3221} 3222 3223% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 3224% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 3225% LiteralHTML:<font color="#FF0000"> 3226% LiteralHTML: Figures from the work of Richard Katz 3227@PhDThesis{ katzthesis, 3228 author = {R.F. Katz}, 3229 title = {The deep roots of volcanoes: models of magma dynamics with applications to 3230 subduction zones}, 3231 school = {Columbia University}, 3232 year = {2005}, 3233 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 3234 petsc_uses = {KSP} 3235} 3236 3237@InCollection{ knepleykatzsmith06, 3238 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 3239 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 3240 USA}, 3241 title = {Developing a Geodynamics Simulator with {PETSc}}, 3242 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 3243 series = {Lecture Notes in Computational Science and Engineering}, 3244 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 3245 publisher = {Springer Berlin Heidelberg}, 3246 isbn = {978-3-540-31619-0}, 3247 keyword = {Mathematics and Statistics}, 3248 pages = {413-438}, 3249 volume = {51}, 3250 doi = {10.1007/3-540-31619-1_12}, 3251 year = {2006}, 3252 petsc_uses = {KSP} 3253} 3254 3255@Article{ katz04, 3256 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 3257 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 3258 the global mid-ocean ridge system}, 3259 journal = {Geophys.\ Res.\ Letts.}, 3260 year = {2004}, 3261 volume = {31}, 3262 pages = {L15605}, 3263 petsc_uses = {KSP} 3264} 3265 3266@Article{ katz07, 3267 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 3268 Ethan Coon}, 3269 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 3270 Toolkit for Scientific Computation}}, 3271 journal = {Phys. Earth Planet. In.}, 3272 volume = {163}, 3273 pages = {52--68}, 3274 year = {2007}, 3275 petsc_uses = {KSP} 3276} 3277 3278@Article{ williams2006development, 3279 title = {{Development of a package for modeling stress in the lithosphere}}, 3280 author = {Williams, CA}, 3281 journal = {Eos Trans. AGU}, 3282 volume = {87}, 3283 pages = {36}, 3284 year = {2006}, 3285 petsc_uses = {KSP} 3286} 3287 3288@Article{ goverswortel05, 3289 author = {R. Govers and M.J.R. Wortel}, 3290 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 3291 journal = {Earth and Planetary Science Letters}, 3292 volume = {236/1-2}, 3293 pages = {505-523}, 3294 year = {2005}, 3295 petsc_uses = {KSP} 3296} 3297 3298@InProceedings{ snark2, 3299 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 3300 year = {2002}, 3301 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 3302 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 3303 petsc_uses = {KSP} 3304} 3305 3306@Article{ snark1, 3307 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 3308 Tan and Feng Wang}, 3309 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 3310 journal = {Submitted to Pure and Applied Geosciences}, 3311 petsc_uses = {KSP} 3312} 3313 3314@InProceedings{ earthquake2003, 3315 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 3316 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 3317 Tiankai Tu}, 3318 year = {2003}, 3319 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 3320 booktitle = {Proceedings of SC2003}, 3321 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 3322 petsc_uses = {KSP} 3323} 3324 3325@InProceedings{ stefano12, 3326 author = {Michele De Stefano}, 3327 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 3328 booktitle = {PIERS Proceedings}, 3329 month = aug, 3330 address = {Moscow, RUSSIA}, 3331 pages = {491--495}, 3332 year = {2012}, 3333 petsc_uses = {KSP} 3334} 3335 3336%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 3337 3338% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3339% LiteralHTML: <center><img alt="" 3340% LiteralHTML: src="images/ocean.jpg"></center></p> 3341@Article{ khatiwala07, 3342 author = {Khatiwala, S.}, 3343 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 3344 journal = {Glob. Biogeochem. Cycles}, 3345 volume = {21}, 3346 doi = {10.1029/2007GB002923}, 3347 year = {2007}, 3348 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 3349} 3350 3351@Article{ dks2004, 3352 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 3353 journal = {Ocean Modelling}, 3354 year = {2004}, 3355 volume = {6(2)}, 3356 pages = {125-150}, 3357 title = {A finite-element Ocean Model: Principles and Evaluation}, 3358 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 3359 petsc_uses = {KSP} 3360} 3361 3362@Article{ danilov1, 3363 author = {S. Danilov and G. Kivman and J. Schroter}, 3364 year = {2004}, 3365 title = {Evaluation of an eddy-permitting finite-element ocean model in the North 3366 Atlantic}, 3367 journal = {Ocean Modelling}, 3368 petsc_uses = {KSP} 3369} 3370 3371@Article{ nerger1, 3372 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 3373 year = {2004}, 3374 title = {Data Assimilation with the Ensemble Kalman Filter and the SEIK Filter applied to 3375 a Finite Element Model of the North Atlantic}, 3376 journal = {Journal of marine systems}, 3377 petsc_uses = {KSP} 3378} 3379 3380@Conference{ rakowsky2003self, 3381 title = {{A self-adaptive finite element model of the atmosphere}}, 3382 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 3383 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 3384 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 3385 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 3386 pages = {279}, 3387 isbn = {981238376X}, 3388 year = {2003}, 3389 organization = {World Scientific Pub Co}, 3390 petsc_uses = {KSP} 3391} 3392 3393@Article{ lauter3, 3394 author = {M. Lauter}, 3395 year = {2004}, 3396 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 3397 AtmosphArenmodell}, 3398 journal = {Berichte zur Polar- und Meeresforschung}, 3399 petsc_uses = {KSP} 3400} 3401 3402@Article{ lauter2, 3403 author = {M. Lauter and D. Handorf and K. Dethloff}, 3404 year = {2004}, 3405 title = {Unsteady analytical solutions of the spherical shallow water equations}, 3406 journal = {Journal of computational physics}, 3407 petsc_uses = {KSP} 3408} 3409 3410@PhDThesis{ lauter1, 3411 author = {M. Lauter}, 3412 year = {2004}, 3413 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 3414 AtmosphArenmodell}, 3415 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 3416 petsc_uses = {KSP} 3417} 3418 3419@Article{ frickenhaus1, 3420 author = {S. Frickenhaus and W. Hiller and M. Best}, 3421 year = {2005}, 3422 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 3423 parallel numerical atmosphere and ocean models}, 3424 journal = {Ocean Modelling}, 3425 volume = {10}, 3426 pages = {185--191}, 3427 petsc_uses = {KSP} 3428} 3429 3430@Article{ 0266-5611-24-3-034015, 3431 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 3432 title = {A Newton-CG method for large-scale three-dimensional elastic full-waveform 3433 seismic inversion}, 3434 journal = {Inverse Problems}, 3435 volume = {24}, 3436 number = {3}, 3437 pages = {034015 (26pp)}, 3438 url = {http://stacks.iop.org/0266-5611/24/034015}, 3439 year = {2008}, 3440 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 3441 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 3442 iterations with inner conjugate gradient linear iterations, globalized by an 3443 Armijo backtracking line search, solved on a sequence of finer grids and higher 3444 frequencies to remain in the vicinity of the global optimum, inexactly terminated 3445 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 3446 variation operator to capture sharp interfaces, finely discretized by finite 3447 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 3448 implemented in matrix-free fashion with adjoint-based computation of reduced 3449 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 3450 waveform storage, and partitioned spatially across processors to parallelize the 3451 solutions of the forward and adjoint wave equations and the evaluation of 3452 gradient-like information. Several numerical examples demonstrate the grid 3453 independence of linear and nonlinear iterations, the effectiveness of the 3454 preconditioner, the ability to solve inverse problems with up to 17 million 3455 inversion parameters on up to 2048 processors, the effectiveness of multiscale 3456 continuation in keeping iterates in the basin of attraction of the global minimum, 3457 and the ability to fit the observational data while reconstructing the model with 3458 reasonable resolution and capturing sharp interfaces.}, 3459 petsc_uses = {KSP} 3460} 3461 3462% LiteralHTML: 3463% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 3464% LiteralHTML: 3465% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3466% LiteralHTML:<font color="#FF0000"> 3467% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 3468% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 3469% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 3470% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 3471% LiteralHTML:for a variety of these simulations.</p> 3472% LiteralHTML:</font> 3473% LiteralHTML: 3474@Article{ mills2009modeling, 3475 title = {Modeling subsurface reactive flows using leadership-class computing}, 3476 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 3477 Mahinthakumar, G.K. and Smith, B.F.}, 3478 journal = {Journal of Physics: Conference Series}, 3479 volume = {180}, 3480 pages = {012062}, 3481 year = {2009}, 3482 publisher = {IOP Publishing}, 3483 petsc_uses = {KSP} 3484} 3485 3486@Conference{ mills2007simulating, 3487 title = {{Simulating subsurface flow and transport on ultrascale computers using 3488 PFLOTRAN}}, 3489 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 3490 booktitle = {Journal of Physics: Conference Series}, 3491 volume = {78}, 3492 pages = {012051}, 3493 year = {2007}, 3494 organization = {IOP Publishing}, 3495 petsc_uses = {KSP} 3496} 3497 3498@InProceedings{ mills2009, 3499 title = {Modeling subsurface reactive flows using leadership-class computing}, 3500 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 3501 Mahinthakmuar, G. and Smith, B.}, 3502 booktitle = {Journal of Physics: Conference Series}, 3503 volume = {180}, 3504 pages = {102062}, 3505 year = {2009}, 3506 organization = {IOP Publishing}, 3507 petsc_uses = {KSP} 3508} 3509 3510@Article{ guo2013parallel, 3511 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 3512 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 3513 }, 3514 journal = {Advances in Water Resources }, 3515 volume = {53}, 3516 number = {0}, 3517 pages = {101 - 108}, 3518 year = {2013}, 3519 note = {}, 3520 issn = {0309-1708}, 3521 doi = {10.1016/j.advwatres.2012.10.010}, 3522 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 3523 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 3524 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 3525 preconditioner}, 3526 petsc_uses = {KSP} 3527} 3528 3529@Unpublished{ stomp, 3530 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 3531 url = {http://stomp.pnl.gov/}, 3532 petsc_uses = {KSP} 3533} 3534 3535@InProceedings{ htfc2003, 3536 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 3537 title = {Methods and Experiences For Parallelizing Flood Models}, 3538 year = {2003}, 3539 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 3540 European PVM/MPI User's Group Meeting}, 3541 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 3542 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 3543 petsc_uses = {KSP} 3544} 3545 3546@InProceedings{ hulchy-tran-astalos-fmsip, 3547 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 3548 D.Froehlich}, 3549 title = {Flood Modeling System and Its Parallelization}, 3550 year = {2002}, 3551 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 3552 Engineering}, 3553 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 3554 petsc_uses = {KSP} 3555} 3556 3557@InProceedings{ gy1, 3558 author = {J. P. Gwo and G. T. Yeh}, 3559 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 3560 Transport at Watershed Scale}, 3561 year = {2004}, 3562 booktitle = {The International Conference on Computational Methods}, 3563 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 3564 petsc_uses = {KSP} 3565} 3566 3567@Conference{ cheng2009efficient, 3568 title = {{An efficient parallel method for large-scale groundwater flow equation based on 3569 PETSc}}, 3570 author = {Cheng, T. and Ji, X. and Wang, Q.}, 3571 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 3572 Conference on}, 3573 pages = {190--193}, 3574 organization = {IEEE}, 3575 petsc_uses = {KSP} 3576} 3577 3578@Unpublished{ sfrsm, 3579 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 3580 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 3581 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 3582 its linear solves}, 3583 petsc_uses = {KSP} 3584} 3585 3586% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3587@InProceedings{ bart_omar:sc05, 3588 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 3589 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 3590 title = {Dynamic data driven inversion for terascale simulations: real-time 3591 indentification of airborne contaminants}, 3592 booktitle = {Proceedings of SC2005}, 3593 organization = {IEEE/ACM}, 3594 address = {Seattle, WA}, 3595 year = {2005}, 3596 month = nov, 3597 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 3598 lab = {SNL}, 3599 petsc_uses = {KSP} 3600} 3601 3602@InProceedings{ anton-krassimir-lscc, 3603 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 3604 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 3605 Simulations}, 3606 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 3607 volume = {2907}, 3608 year = {2003}, 3609 publisher = {Springer-Verlag}, 3610 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 3611 petsc_uses = {KSP} 3612} 3613 3614@InProceedings{ aa2001, 3615 author = {Anton Antonov}, 3616 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 3617 year = {2001}, 3618 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 3619 Sozopol, Bulgaria}, 3620 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 3621 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 3622 petsc_uses = {KSP} 3623} 3624 3625% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3626@Article{ grassley-simmons-kercher-00, 3627 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 3628 year = {2000}, 3629 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 3630 reactive transport models}, 3631 journal = {Applied Geochemistry}, 3632 volume = {17}, 3633 pages = {699--708}, 3634 lab = {LLNL} 3635} 3636 3637@Article{ glassey-nitao-03, 3638 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 3639 and Carl I. Steefel and James R. Kercher}, 3640 year = {2003}, 3641 title = {The impact of climate change on vadose zone pore waters and its implication for 3642 long-term monitoring}, 3643 journal = {Computers and Geosciences}, 3644 volume = {29}, 3645 pages = {399-411}, 3646 lab = {LLNL}, 3647 petsc_uses = {KSP} 3648} 3649 3650@Article{ steefel-depaolo-lichtner-05, 3651 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 3652 year = {2005}, 3653 title = {Reactive transport modeling: An essential tool and a new research approach for 3654 the Earth sciences}, 3655 journal = {Earth and Planetary Science Letters}, 3656 lab = {LLNL,LANL}, 3657 petsc_uses = {KSP} 3658} 3659 3660% LiteralHTML:<a name="scalinglarge"> 3661% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3662% LiteralHTML: <center><img alt="" 3663% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 3664% LiteralHTML:<font color="#FF0000"> 3665% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 3666@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 3667 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 3668 Strategies for Large-Scale Numerical Simulations}, 3669 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 3670 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 3671 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 3672 Large-Scale Systems (scalA)}, 3673 pages = {65-72}, 3674 doi = {10.1109/ScalA.2018.00012}, 3675 month = nov, 3676 year = {2018}, 3677 petsc_uses = {KSP} 3678} 3679 3680@Article{ km2004, 3681 author = {A. Keese and H. G. Matthies}, 3682 journal = {Computers and Structures}, 3683 year = {2005}, 3684 volume = {83}, 3685 pages = {1033--1047}, 3686 title = {Hierarchical parallelisation for the solution of stochastic finite element 3687 equations}, 3688 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 3689 petsc_uses = {KSP} 3690} 3691 3692@Unpublished{ hvl2002, 3693 title = {Numerical Modeling of NAPL Source Zone Treatment}, 3694 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 3695 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 3696 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 3697 year = {2002}, 3698 lab = {LANL}, 3699 petsc_uses = {KSP} 3700} 3701 3702@PhDThesis{ hammond2003, 3703 author = {Glenn E. Hammond}, 3704 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 3705 Transport on Supercomputers}, 3706 school = {University of Illinois at Urbana-Champaign}, 3707 year = {2003}, 3708 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 3709 petsc_uses = {KSP} 3710} 3711 3712@Unpublished{ uk, 3713 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 3714 Scale Environmental Flows and Transport Processes}, 3715 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 3716 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 3717 buildings and in Green Bay. Used PETSc for its linear solvers}, 3718 year = {1999}, 3719 petsc_uses = {KSP} 3720} 3721 3722@InProceedings{ hammond2002, 3723 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 3724 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 3725 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 3726 year = {2002}, 3727 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 3728 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 3729 Resources, Delft, The Netherlands.}, 3730 lab = {LANL}, 3731 petsc_uses = {KSP} 3732} 3733 3734@TechReport{ steefel1, 3735 author = {C. I. Steefel}, 3736 title = {Software for modeling multicomponent, multidimensional reactive transport}, 3737 year = {2001}, 3738 institution = {Lawrence Livermore National Laboratory}, 3739 number = {UCRL-MA-143182}, 3740 lab = {LLNL}, 3741 petsc_uses = {KSP} 3742} 3743 3744@Article{ steefel2, 3745 author = {C. I. Steefel and A. C. Lasaga}, 3746 title = {A coupled model for transport of multiple chemical-species and kinetic 3747 precipitation dissolution reactions with application to reactive flow in 3748 single-phase hydrothermal systems}, 3749 journal = {Americal Journal of Science}, 3750 year = {1994}, 3751 pages = {529-592}, 3752 volume = {294}, 3753 number = {5}, 3754 petsc_uses = {KSP} 3755} 3756 3757@TechReport{ steefel3, 3758 author = {C. I. Steefel and S. B. Yabusaki}, 3759 title = {OS3D/GIMRT, Software for Multicomponent-Multidimensional reactive transport: 3760 User's manual and programmer's guide}, 3761 year = {1996}, 3762 institution = {Pacific Northwest National Laboratory}, 3763 number = {PNNL-11166}, 3764 lab = {PNNL}, 3765 petsc_uses = {KSP} 3766} 3767 3768@Article{ 2005hvl, 3769 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 3770 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 3771 preconditioning to biogeochemical transport}, 3772 journal = {Advances in Water Resources}, 3773 year = {2005}, 3774 pages = {359--376}, 3775 volume = {28}, 3776 url = { 3777 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 3778 lab = {LANL}, 3779 petsc_uses = {KSP} 3780} 3781 3782@Article{ wang-zabar-05, 3783 author = {J Wang and N Zabaras}, 3784 journal = {Int. J. Heat and Mass Transfer}, 3785 title = {A Markov random field model of contamination source identification in porous 3786 media flow}, 3787 year = {2005}, 3788 petsc_uses = {KSP} 3789} 3790 3791@InBook{ kp1, 3792 author = {Jong G. Kim and Hyoung W. Park}, 3793 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 3794 Media}, 3795 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 3796 title = {Lecture Notes in Computer Science}, 3797 publisher = {Springer-Verlag}, 3798 volume = {3044}, 3799 year = {2004}, 3800 petsc_uses = {KSP} 3801} 3802 3803@Article{ 2001agusm...h32a06k, 3804 author = {{Kim}, J.~G. and {Kim}, J.}, 3805 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 3806 journal = {AGU Spring Meeting Abstracts}, 3807 year = {2001}, 3808 pages = {32-+}, 3809 petsc_uses = {KSP} 3810} 3811 3812@Article{ lzb2005, 3813 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 3814 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 3815 journal = {Journal of Hydraulic Engineering}, 3816 year = {2005}, 3817 volume = {131}, 3818 number = {4}, 3819 pages = {247--258}, 3820 petsc_uses = {KSP} 3821} 3822 3823@Article{ rao2005, 3824 author = {Prasada Rao}, 3825 title = {A parallel RMA2 model for simulating large-scale free surface flows}, 3826 journal = {Environmental Modelling and Software}, 3827 year = {2005}, 3828 pages = {47--53}, 3829 petsc_uses = {KSP} 3830} 3831 3832@InProceedings{ pr1, 3833 author = {Prasada Rao}, 3834 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 3835 Hydrodynamic Flows}, 3836 year = {2003}, 3837 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 3838 Conference}, 3839 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 3840 petsc_uses = {KSP} 3841} 3842 3843@InProceedings{ lichtner2004, 3844 author = {Peter C. Lichtner and Andrew Wolfsberg}, 3845 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 3846 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 3847 Challenge Supercomputing Problem}, 3848 year = {2004}, 3849 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 3850 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 3851 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 3852 lab = {LANL}, 3853 petsc_uses = {KSP} 3854} 3855 3856% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 3857@Article{ aba01:petsc-app, 3858 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 3859 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 3860 journal = {Int. J. High Performance Computing Applications}, 3861 year = {2001}, 3862 volume = {15}, 3863 number = {1}, 3864 pages = {13--21}, 3865 petsc_uses = {KSP} 3866} 3867 3868@PhDThesis{ tjb200, 3869 author = {Thomas James Byer}, 3870 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 3871 Facilities}, 3872 school = {Stanford}, 3873 year = {2000}, 3874 petsc_uses = {KSP} 3875} 3876 3877@InProceedings{ puchyr2006, 3878 author = {Peter J. Puchyr}, 3879 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 3880 Win32 Cluster}, 3881 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 3882 note = {Paper number CIPC2006-207}, 3883 year = {2006}, 3884 petsc_uses = {KSP} 3885} 3886 3887@InProceedings{ texas98, 3888 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 3889 and G. A. Pope}, 3890 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 3891 Simulation}, 3892 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 3893 Symposium}, 3894 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 3895 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 3896 year = {1998}, 3897 petsc_uses = {KSP} 3898} 3899 3900% LiteralHTML: 3901% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 3902% LiteralHTML: 3903@Article{ farrellmitchellscottwechsung2021, 3904 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 3905 stationary incompressible {Navier-Stokes} equations}, 3906 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 3907 Wechsung}, 3908 journal = {The SMAI journal of computational mathematics}, 3909 volume = {7}, 3910 pages = {75--96}, 3911 year = {2021}, 3912 petsc_uses = {KSP} 3913} 3914 3915@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 3916 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 3917 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 3918 P MacLachlan and Ray S Tuminaro}, 3919 journal = {SIAM Journal on Scientific Computing}, 3920 number = {0}, 3921 pages = {S70--S91}, 3922 year = {2021}, 3923 petsc_uses = {KSP} 3924} 3925 3926@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 3927 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 3928 hyperelasticity}, 3929 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 3930 Oyar\'ua and Ricardo Ruiz-Baier}, 3931 journal = {Computer Methods in Applied Mechanics and Engineering}, 3932 volume = {374}, 3933 pages = {113562}, 3934 issn = {0045-7825}, 3935 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 3936 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 3937 year = {2021}, 3938 petsc_uses = {KSP} 3939} 3940 3941@Article{ farrellmitchellwechsung2018, 3942 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 3943 {Navier-Stokes} equations at high {Reynolds} number}, 3944 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 3945 journal = {SIAM Journal on Scientific Computing}, 3946 volume = {41}, 3947 number = {5}, 3948 eprint = {1810.03315}, 3949 pages = {A3073-A3096}, 3950 year = {2019}, 3951 petsc_uses = {KSP} 3952} 3953 3954@Article{ hevuikklaij2017, 3955 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 3956 discretized by a finite volume method}, 3957 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 3958 journal = {Journal of Numerical Mathematics}, 3959 volume = {25}, 3960 number = {2}, 3961 pages = {89--105}, 3962 year = {2017}, 3963 petsc_uses = {KSP} 3964} 3965 3966@InProceedings{ zou2015newton, 3967 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 3968 appearance/disappearance}, 3969 author = {Zou, L and Zhao, H and Zhang, H}, 3970 booktitle = {ANS 2015 Annual Meeting, June}, 3971 volume = {7}, 3972 number = {11}, 3973 year = {2015}, 3974 petsc_uses = {KSP} 3975} 3976 3977@Article{ guermond2009nonlinear, 3978 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 3979 Fourier/finite element technique and an interior penalty method}, 3980 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 3981 journal = {Journal of computational physics}, 3982 volume = {228}, 3983 number = {8}, 3984 pages = {2739--2757}, 3985 year = {2009}, 3986 publisher = {Elsevier}, 3987 petsc_uses = {KSP} 3988} 3989 3990@Article{ erzincanlisahin2015, 3991 title = {The numerical simulation of the wing kinematics effects on near wake topology and 3992 aerodynamic performance in hovering Drosophila flight}, 3993 author = {Belkis Erzincanli and Mehmet Sahin}, 3994 journal = {Computers \& Fluids}, 3995 volume = {122}, 3996 pages = {90--110}, 3997 year = {2015}, 3998 publisher = {Elsevier}, 3999 petsc_uses = {KSP} 4000} 4001 4002@Article{ ekensahin2015, 4003 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 4004 structure interaction problems}, 4005 author = {Ali Eken and Mehmet Sahin}, 4006 journal = {International Journal for Numerical Methods in Fluids}, 4007 year = {2015}, 4008 publisher = {Wiley Online Library}, 4009 petsc_uses = {KSP} 4010} 4011 4012@Article{ hwangsucai2015, 4013 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 4014 for transonic full potential equation}, 4015 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 4016 journal = {Computers \& Fluids}, 4017 volume = {110}, 4018 number = {30}, 4019 pages = {96--107}, 4020 year = {2015}, 4021 doi = {10.1016/j.compfluid.2014.04.005}, 4022 petsc_uses = {KSP} 4023} 4024 4025@Article{ yanghwangcai2016, 4026 title = {Nonlinear Preconditioning Techniques for Full-Space Lagrange--Newton Solution of 4027 PDE-Constrained Optimization Problems}, 4028 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 4029 journal = {SIAM Journal on Scientific Computing}, 4030 volume = {38}, 4031 number = {5}, 4032 pages = {A2756--A2778}, 4033 year = {2016}, 4034 petsc_uses = {KSP} 4035} 4036 4037@Article{ khanaidun2011, 4038 author = {Irfan Khan and Cyrus K. Aidun}, 4039 title = {Direct numerical simulation of saturated deformable porous media using parallel 4040 hybrid Lattice-Boltzmann and finite element method}, 4041 journal = {Int. J. Numer. Meth. Eng.}, 4042 volume = {86}, 4043 pages = {1379--1395}, 4044 year = {2011}, 4045 petsc_uses = {KSP} 4046} 4047 4048@Article{ khanaidun2014, 4049 author = {Irfan Khan and Cyrus K. Aidun}, 4050 title = {Modeling the deformation of saturate porous media using direct numerical 4051 simulation}, 4052 journal = {Int. J. Multiphase Flow}, 4053 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 4054 year = {2014}, 4055 petsc_uses = {KSP} 4056} 4057 4058@Article{ mofidi2014simulations, 4059 author = {A. Mofidi and P. M. Carrica}, 4060 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 4061 and Propeller}, 4062 journal = {Computers and Fluids}, 4063 pages = {191--203}, 4064 year = {2014}, 4065 petsc_uses = {KSP} 4066} 4067 4068@Article{ paik2014fluidstructure, 4069 author = {K. Paik and P. M. Carrica}, 4070 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 4071 Surface in a Rolling Tank}, 4072 journal = {Ocean Engineering}, 4073 pages = {201--212}, 4074 year = {2014}, 4075 petsc_uses = {KSP} 4076} 4077 4078@Article{ castro2013bubble, 4079 author = {A. M. Castro and P. M. Carrica}, 4080 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 4081 evaluation and numerical issues}, 4082 journal = {International Journal of Multiphase Flow 57}, 4083 pages = {131--150}, 4084 year = {2013}, 4085 petsc_uses = {KSP} 4086} 4087 4088@Article{ carrica2013turn, 4089 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 4090 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 4091 Dynamic Overset Grids}, 4092 journal = {Journal of Marine Science and Technology}, 4093 pages = {166--181}, 4094 year = {2013}, 4095 petsc_uses = {KSP} 4096} 4097 4098@Article{ castro2013eulerian, 4099 author = {A. M. Castro and P. M. Carrica}, 4100 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 4101 {Athena} {R}/V,}, 4102 journal = {International Shipbuilding Progress}, 4103 pages = {403--433}, 4104 year = {2013}, 4105 petsc_uses = {KSP} 4106} 4107 4108@Article{ chase2013overset, 4109 author = {N. Chase and T. Michael and P. M. Carrica}, 4110 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 4111 {Maneuvering} {Conditions}}, 4112 journal = {International Shipbuilding Progress}, 4113 pages = {171--205}, 4114 year = {2013}, 4115 petsc_uses = {KSP} 4116} 4117 4118@Article{ sadathosseini2013wu, 4119 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 4120 Stern}, 4121 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 4122 Free Surge Conditions in Short and Long Head Waves}, 4123 journal = {Ocean Engineering}, 4124 volume = {59}, 4125 pages = {240--273}, 4126 year = {2013}, 4127 petsc_uses = {KSP} 4128} 4129 4130@Article{ chase2013cfd, 4131 author = {N. Chase and P. M. Carrica}, 4132 title = {CFD Simulations of a Submarine Propeller and Application to Self-Propulsion of a 4133 Submarine}, 4134 journal = {Ocean Engineering}, 4135 pages = {68--80}, 4136 year = {2013}, 4137 petsc_uses = {KSP} 4138} 4139 4140@Article{ carrica2012cfd, 4141 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 4142 title = {CFD Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 4143 of Moving Rudders and Rotating Propellers}, 4144 journal = {Computers and Fluids 53}, 4145 pages = {117--132}, 4146 year = {2012}, 4147 petsc_uses = {KSP} 4148} 4149 4150@Article{ sakamoto2012urans, 4151 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 4152 title = {URANS Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 4153 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 4154 publisher = {Journal of Marine Science and Technology}, 4155 pages = {422--445}, 4156 year = {2012}, 4157 petsc_uses = {KSP} 4158} 4159 4160@Article{ sakamoto2012uransb, 4161 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 4162 title = {URANS Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 4163 Analysis and Validation of Local Flow Characteristics}, 4164 journal = {Journal of Marine Science and Technology}, 4165 pages = {446--468}, 4166 year = {2012}, 4167 petsc_uses = {KSP} 4168} 4169 4170@Article{ li2012dynamic, 4171 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 4172 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 4173 journal = {Renewable Energy}, 4174 pages = {285--298}, 4175 year = {2012}, 4176 petsc_uses = {KSP} 4177} 4178 4179@Article{ huang2012a, 4180 author = {J. Huang and P. M. Carrica and F. Stern}, 4181 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 4182 journal = {International Journal for Numerical Methods in Fluids}, 4183 pages = {160--180}, 4184 year = {2012}, 4185 petsc_uses = {KSP} 4186} 4187 4188@Article{ huang2012b, 4189 author = {J. Huang and P. M. Carrica and F. Stern}, 4190 title = {A geometry-based level set method for curvilinear overset grids with application 4191 to ship hydrodynamics}, 4192 journal = {International Journal for Numerical Methods in Fluids}, 4193 pages = {494--521}, 4194 year = {2012}, 4195 petsc_uses = {KSP} 4196} 4197 4198@Article{ carrica2011computations, 4199 author = {P. M. Carrica and H. Fu and F. Stern}, 4200 title = {Computations of self-propulsion free to sink and trim and of motions in head 4201 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 4202 journal = {Applied Ocean Research}, 4203 pages = {309--320}, 4204 year = {2011}, 4205 petsc_uses = {KSP} 4206} 4207 4208@Article{ bhushan2011scalability, 4209 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 4210 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 4211 Using {CFDShip}-Iowa}, 4212 journal = {International Journal of High Performance Computing Applications}, 4213 pages = {466--487}, 4214 year = {2011}, 4215 petsc_uses = {KSP} 4216} 4217 4218@Article{ castro2011full, 4219 author = {A. M. Castro and P. M. Carrica and F. Stern}, 4220 title = {Full scale self-propulsion computations using discretized propeller for the 4221 {KRISO} container ship {KCS}}, 4222 journal = {Computers and Fluids}, 4223 pages = {35--47}, 4224 year = {2011}, 4225 petsc_uses = {KSP} 4226} 4227 4228@Article{ kandasamy2011multifidelity, 4229 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 4230 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 4231 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing Catamaran 4232 for Low Wake}, 4233 journal = {Journal of Marine Science and Technology}, 4234 pages = {143--156}, 4235 year = {2011}, 4236 petsc_uses = {KSP} 4237} 4238 4239@Article{ kandasamy2011cfd, 4240 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 4241 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 4242 title = {CFD Validation Studies for a High-speed Foil-assisted Semi-planing Catamaran}, 4243 journal = {Journal of Marine Science and Technology}, 4244 pages = {157--167}, 4245 year = {2011}, 4246 petsc_uses = {KSP} 4247} 4248 4249@Article{ sadathosseini2011cfd, 4250 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 4251 and S. Yamamura and A. Mastuda}, 4252 title = {CFD System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 4253 Periodic Motion and Broaching}, 4254 journal = {Ocean Engineering}, 4255 pages = {88--110}, 4256 year = {2011}, 4257 petsc_uses = {KSP} 4258} 4259 4260@Article{ mosaviraad2010development, 4261 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 4262 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 4263 with Comparison to Regular Wave and Transient Wave Group Procedures Using 4264 {URANS}}, 4265 journal = {Ocean Engineering}, 4266 pages = {653--666}, 4267 year = {2010}, 4268 petsc_uses = {KSP} 4269} 4270 4271@Article{ carrica2010largescale, 4272 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 4273 Stern}, 4274 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 4275 Heave Problems for a Surface Combatant}, 4276 journal = {Computers and Fluids}, 4277 pages = {1095--1111}, 4278 year = {2010}, 4279 petsc_uses = {KSP} 4280} 4281 4282@Article{ carrica2010selfpropulsion, 4283 author = {P. M. Carrica and A. M. Castro and F. Stern}, 4284 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 4285 with Dynamic Overset Grids}, 4286 journal = {Journal of Marine Science and Technology}, 4287 pages = {316--330}, 4288 year = {2010}, 4289 petsc_uses = {KSP} 4290} 4291 4292@Article{ ismail2010evaluation, 4293 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 4294 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 4295 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 4296 journal = {International Journal of Numerical Methods in Fluids}, 4297 pages = {850--886}, 4298 year = {2010}, 4299 petsc_uses = {KSP} 4300} 4301 4302@Article{ kandasamy2010integral, 4303 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 4304 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 4305 journal = {Journal of Fluids Engineering}, 4306 pages = {101103}, 4307 year = {2010}, 4308 petsc_uses = {KSP} 4309} 4310 4311@Article{ kirk:2014de, 4312 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 4313 title = {{Modeling hypersonic entry with the fully-implicit Navier--Stokes (FIN-S) 4314 stabilized finite element flow solver}}, 4315 journal = {Computers {\&} Fluids}, 4316 year = {2014}, 4317 volume = {92}, 4318 number = {0}, 4319 pages = {281--292}, 4320 month = mar, 4321 petsc_uses = {KSP} 4322} 4323 4324@Article{ carracciuolo20111382, 4325 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 4326 in high performance computing environment}, 4327 journal = {Journal of Non-Newtonian Fluid Mechanics }, 4328 volume = {166}, 4329 number = {23--24}, 4330 pages = {1382--1395}, 4331 year = {2011}, 4332 issn = {0377-0257}, 4333 doi = {10.1016/j.jnnfm.2011.08.014}, 4334 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 4335 Maffettone and A. Murli}, 4336 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 4337 method, High performance computing}, 4338 petsc_uses = {KSP} 4339} 4340 4341@Article{ bungartzgatzhammerliebmehlneckel11, 4342 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 4343 Miriam and Neckel, Tobias}, 4344 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 4345 journal = {Computational Mechanics}, 4346 volume = {48}, 4347 number = {3}, 4348 pages = {365-376}, 4349 year = {2011}, 4350 issn = {0178-7675}, 4351 doi = {10.1007/s00466-011-0626-1}, 4352 publisher = {Springer-Verlag}, 4353 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 4354 Thermohydraulics; Two-phase flow}, 4355 language = {English}, 4356 petsc_uses = {KSP} 4357} 4358 4359@Article{ bpr:cfl, 4360 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 4361 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 4362 Equations}}, 4363 journal = {International Journal for Numerical Methods in Fluids}, 4364 year = {2009}, 4365 volume = {59}, 4366 number = {1}, 4367 pages = {1--18}, 4368 doi = {10.1002/fld.1798}, 4369 petsc_uses = {KSP} 4370} 4371 4372@InBook{ bonfiglioli_campobasso_carpentieri_2010, 4373 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 4374 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 4375 preconditioned newton-krylov solver}, 4376 publisher = {Curran Associates}, 4377 year = {2010}, 4378 url = {http://www.proceedings.com/05932.html}, 4379 petsc_uses = {KSP} 4380} 4381 4382@Article{ bonfiglioli_rans_2005, 4383 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 4384 Bernardo}, 4385 title = {RANS simulations of a junction flow}, 4386 journal = {International Journal of Computational Fluid Dynamics}, 4387 volume = {19}, 4388 number = {2}, 4389 pages = {179-189}, 4390 year = {2005}, 4391 doi = {10.1080/10618560410001729126}, 4392 petsc_uses = {KSP} 4393} 4394 4395@InCollection{ bonfiglioli__carpentieri_rans_2008, 4396 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 4397 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 4398 Italy}, 4399 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 4400 Equations Using Fluctuation Splitting Schemes}, 4401 booktitle = {Numerical Mathematics and Advanced Applications}, 4402 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 4403 publisher = {Springer Berlin Heidelberg}, 4404 isbn = {978-3-540-69777-0}, 4405 pages = {151-158}, 4406 doi = {10.1007/978-3-540-69777-0_17}, 4407 year = {2008}, 4408 petsc_uses = {KSP} 4409} 4410 4411@InCollection{ bonfiglioli__carpentieri_ens_2007, 4412 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 4413 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 4414 Italy}, 4415 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 4416 Problems on Unstructured Grids}, 4417 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 4418 series = {Lecture Notes in Computer Science}, 4419 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 4420 publisher = {Springer Berlin / Heidelberg}, 4421 isbn = {978-3-540-75754-2}, 4422 pages = {676-685}, 4423 volume = {4699}, 4424 doi = {10.1007/978-3-540-75755-9_83}, 4425 year = {2007}, 4426 petsc_uses = {KSP} 4427} 4428 4429@Article{ terrelscottknepleykirby08, 4430 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 4431 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 4432 journal = {BIT}, 4433 volume = {48}, 4434 number = {2}, 4435 year = {2008}, 4436 petsc_uses = {KSP} 4437} 4438 4439@Article{ martamadermartinsweidealonso07, 4440 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 4441 J. Alonso}, 4442 title = {A methodology for the development of discrete adjoint solvers using automatic 4443 differentiation tools}, 4444 journal = {Computational Fluid Dyanmics}, 4445 volume = {21}, 4446 pages = {307--327}, 4447 year = {2007}, 4448 petsc_uses = {KSP} 4449} 4450 4451@TechReport{ avb2008, 4452 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 4453 title = {Variational Space-time (Dis)continuous Galerkin Method for Linear Free Surface 4454 Waves}, 4455 year = {2008}, 4456 institution = {University of Twente, the Netherlands}, 4457 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 4458 petsc_uses = {KSP} 4459} 4460 4461@InProceedings{ bdsm2005, 4462 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 4463 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 4464 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 4465 year = {2005}, 4466 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 4467 petsc_uses = {KSP} 4468} 4469 4470@InProceedings{ ms2006, 4471 author = {S. Muller and Y. Stiriba}, 4472 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 4473 STEADY COMPRESSIBLE FLOWS}, 4474 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 4475 year = {2006}, 4476 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 4477 petsc_uses = {KSP} 4478} 4479 4480@Article{ araujoteixeiracunhagroth08, 4481 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 4482 title = {Parallel three-dimensional simulation of the injection molding process}, 4483 journal = {International Journal for Numerical Methods in Fluids}, 4484 year = {2008}, 4485 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 4486 petsc_uses = {KSP} 4487} 4488 4489@PhDThesis{ a2008, 4490 author = {A. Cubero}, 4491 title = {a parallel coupled algorithm for collocated grids and its application to Large 4492 Eddy Simulation of a turbulent wake}, 4493 school = {University of Zaragoza (Spain)}, 4494 year = {2008}, 4495 petsc_uses = {KSP} 4496} 4497 4498@Article{ afa2007, 4499 author = {A. Cubero and N. Fueyo}, 4500 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 4501 journal = {Numerical Heat Transfer, part B-Fundamentals}, 4502 volume = {56}, 4503 number = {6}, 4504 pages = {507--529}, 4505 year = {2007}, 4506 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 4507 petsc_uses = {KSP} 4508} 4509 4510@TechReport{ af2007, 4511 title = {Preconditioning based on a partially implicit implementation of Momentum 4512 Interpolation for coupled solvers}, 4513 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 4514 year = {2007}, 4515 author = {A. Cubero and N. Fueyo}, 4516 petsc_uses = {KSP} 4517} 4518 4519@InCollection{ dwight2004, 4520 author = {Richard Dwight}, 4521 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 4522 booktitle = {Computational Fluid Dynamics 2006}, 4523 editor = {H. Deconinck and E. Dick}, 4524 publisher = {Springer}, 4525 year = {2006}, 4526 url = {http://www.maths.man.ac.uk/\~{ 4527 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 4528 petsc_uses = {KSP} 4529} 4530 4531@InProceedings{ dwight2006, 4532 author = {Richard Dwight and Joel Brezillon}, 4533 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 4534 Optimization}, 4535 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 4536 AIAA-2006-0690}, 4537 year = {2006}, 4538 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 4539 petsc_uses = {KSP} 4540} 4541 4542@PhDThesis{ dwight2006a, 4543 author = {Richard Dwight}, 4544 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 4545 and Adjoint Methods on Unstructured Grids}, 4546 school = {School of Mathematics, University of Manchester}, 4547 year = {2006}, 4548 url = {http://www.maths.man.ac.uk/\~{ 4549 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 4550 petsc_uses = {KSP} 4551} 4552 4553@InProceedings{ lhdfrh, 4554 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 4555 W. Hiller}, 4556 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 4557 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 4558 March, 10-14, 2003, Munich University of Technology, German}, 4559 year = {2003}, 4560 petsc_uses = {KSP} 4561} 4562 4563@InProceedings{ brios-ying-2002, 4564 author = {George Biros and Lexing Ying and Denis Zorin}, 4565 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 4566 {Navier-Stokes} equations}, 4567 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 4568 year = {2002}, 4569 petsc_uses = {KSP} 4570} 4571 4572@InProceedings{ mohsen-straatman-ins, 4573 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 4574 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 4575 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 4576 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 4577 Systems and Applications}, 4578 pages = {11--16}, 4579 year = {2005}, 4580 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 4581 petsc_uses = {KSP} 4582} 4583 4584@TechReport{ bonglioli-icnmfd98, 4585 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 4586 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 4587 institution = {Universita della Basilicata via della Tecnica 3}, 4588 year = {1996}, 4589 author = {A. Bonglioli}, 4590 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 4591 petsc_uses = {KSP} 4592} 4593 4594@Article{ deng-piquet-ctf, 4595 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 4596 title = {A new fully coupled method for computing turbulent flows}, 4597 journal = {Computers and Fluids}, 4598 volume = {30}, 4599 pages = {445--472}, 4600 year = {2001}, 4601 petsc_uses = {KSP} 4602} 4603 4604@InProceedings{ knepleysarinsameh99b, 4605 title = {Multilevel Preconditioning for Parallel {CFD}}, 4606 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 4607 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 4608 Problems In Industrial Applications}, 4609 address = {Minneapolis, MN}, 4610 year = {1999}, 4611 petsc_uses = {KSP} 4612} 4613 4614@InProceedings{ garbey1, 4615 author = {M. Garbey and B. Hadri and W. Shyy.}, 4616 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 4617 Problems on the Grid}, 4618 booktitle = {Aerospace Sciences Meeting and Exhibit}, 4619 note = {Paper No. 2005-1386}, 4620 year = {2005}, 4621 petsc_uses = {KSP} 4622} 4623 4624@Article{ carrica2007unsteady, 4625 title = {An unsteady single-phase level set method for viscous free surface flows}, 4626 author = {Carrica, PM and Wilson, RV and Stern, F.}, 4627 journal = {International Journal for Numerical Methods in Fluids}, 4628 volume = {53}, 4629 number = {2}, 4630 pages = {229--256}, 4631 year = {2007}, 4632 publisher = {Chichester; New York: Wiley, c1981-}, 4633 petsc_uses = {KSP} 4634} 4635 4636@Article{ pctw2004, 4637 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 4638 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 4639 Spillways}, 4640 journal = {Journal of Hydraulic Research}, 4641 note = {accepted for publication}, 4642 year = {2004}, 4643 petsc_uses = {KSP} 4644} 4645 4646@Article{ wcs2004, 4647 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 4648 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 4649 Combatant}, 4650 journal = {Computers and Fluids}, 4651 note = {in press}, 4652 year = {2004}, 4653 petsc_uses = {KSP} 4654} 4655 4656@Article{ cws2005, 4657 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 4658 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 4659 journal = {Computers and Fluids}, 4660 note = {accepted for publication}, 4661 year = {2005}, 4662 petsc_uses = {KSP} 4663} 4664 4665@Article{ chndss2010, 4666 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 4667 Stern}, 4668 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 4669 Heave Problems for a Surface Combatant}, 4670 journal = {Computers and Fluids}, 4671 year = {2010}, 4672 volume = {39}, 4673 number = {7}, 4674 pages = {1095--1111}, 4675 petsc_uses = {KSP} 4676} 4677 4678@InProceedings{ chnkss2008, 4679 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 4680 Stern}, 4681 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 4682 Grids}, 4683 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 4684 year = {2008}, 4685 petsc_uses = {KSP} 4686} 4687 4688@MastersThesis{ mtj, 4689 author = {M. T. Jozkowski}, 4690 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 4691 About Submerged Bodies}, 4692 school = {The Pennsylvania State University}, 4693 year = {2005}, 4694 petsc_uses = {KSP} 4695} 4696 4697@Article{ pp, 4698 author = {E. G. Paterson and L. J. Peltier}, 4699 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 4700 Wakes}, 4701 journal = {ASME Journal of Fluids Engineering}, 4702 note = {In press}, 4703 year = {2005}, 4704 petsc_uses = {KSP} 4705} 4706 4707@Article{ eps, 4708 author = {B. A. Edge and E. G. Paterson and G. Settles}, 4709 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 4710 journal = {ASME Journal of Fluids Engineering}, 4711 note = {In press}, 4712 year = {2005}, 4713 petsc_uses = {KSP} 4714} 4715 4716@InProceedings{ rp, 4717 author = {B. Racine and E. G. Paterson}, 4718 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 4719 Using Unsteady {RANS} {CFD}}, 4720 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 4721 year = {2005}, 4722 petsc_uses = {KSP} 4723} 4724 4725@InProceedings{ etpp, 4726 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 4727 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 4728 and DES}, 4729 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 4730 year = {2004}, 4731 petsc_uses = {KSP} 4732} 4733 4734@InProceedings{ pp8, 4735 author = {E. G. Paterson and L. J. Peltier}, 4736 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 4737 refinement grids and detached-eddy simulation}, 4738 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 4739 year = {2004}, 4740 petsc_uses = {KSP} 4741} 4742 4743@InProceedings{ mzwp, 4744 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 4745 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 4746 booktitle = {25th Symposium on Naval Hydrodynamics}, 4747 year = {2004}, 4748 petsc_uses = {KSP} 4749} 4750 4751@InProceedings{ ppph, 4752 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 4753 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 4754 booktitle = {25th Symposium on Naval Hydrodynamics}, 4755 year = {2004}, 4756 petsc_uses = {KSP} 4757} 4758 4759@InProceedings{ ppd, 4760 author = {E. G. Paterson and L. J. Peltier}, 4761 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 4762 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 4763 year = {2004}, 4764 petsc_uses = {KSP} 4765} 4766 4767@InProceedings{ bp, 4768 author = {W. J. Baker and E. G. and Paterson}, 4769 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 4770 Control Wing}, 4771 booktitle = {NASA/ONR Workshop on Circulation Control}, 4772 year = {2004}, 4773 petsc_uses = {KSP} 4774} 4775 4776@InProceedings{ pb, 4777 author = {E. G. Paterson and W. J. Baker}, 4778 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 4779 booktitle = {NASA/ONR Workshop on Circulation Control}, 4780 year = {2004}, 4781 petsc_uses = {KSP} 4782} 4783 4784@InProceedings{ pb3, 4785 author = {E. G. Paterson and W. J. Baker}, 4786 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 4787 Surfaces}, 4788 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 4789 year = {2004}, 4790 petsc_uses = {KSP} 4791} 4792 4793@InProceedings{ gid1, 4794 author = {G. Frank and J. D'Elia}, 4795 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 4796 year = {2004}, 4797 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 4798 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 4799 petsc_uses = {KSP} 4800} 4801 4802@InBook{ b1, 4803 author = {A.Bonfiglioli}, 4804 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 4805 year = {2001}, 4806 title = {Science and Supercomputing at CINECA}, 4807 pages = {397--400}, 4808 petsc_uses = {KSP} 4809} 4810 4811@InProceedings{ b2004, 4812 author = {L. A. Barba}, 4813 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 4814 fully meshless formulation}, 4815 year = {2004}, 4816 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 4817 note = {Submitted}, 4818 petsc_uses = {KSP} 4819} 4820 4821@InProceedings{ bl2004, 4822 author = {L. A. Barba and A. Leonard}, 4823 title = {Computation of Viscous Vortices with Fully Meshless Method}, 4824 year = {2004}, 4825 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 4826 note = {Submitted}, 4827 petsc_uses = {KSP} 4828} 4829 4830@Article{ vws1, 4831 author = {B. G. M. Van Wachem and J. C. Schouten}, 4832 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 4833 Velocity}, 4834 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 4835 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 4836 Netherlands}, 4837 journal = {AIChE}, 4838 volumne = {48}, 4839 number = {12}, 4840 month = dec, 4841 year = {2002}, 4842 petsc_uses = {KSP} 4843} 4844 4845@TechReport{ lbam1, 4846 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 4847 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 4848 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 4849 di Bari Italy}, 4850 year = {2002}, 4851 number = {25/02}, 4852 petsc_uses = {KSP} 4853} 4854 4855@Article{ kees_miller_02, 4856 author = {C. E. Kees and C. T. Miller}, 4857 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 4858 journal = {Advances in Water Resources}, 4859 year = {2002}, 4860 volume = {25}, 4861 number = {2}, 4862 pages = {159-177.}, 4863 petsc_uses = {KSP} 4864} 4865 4866@InProceedings{ lepotmeersessers2001, 4867 author = {I. Lepot and F. Meers and J.A. Essers}, 4868 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 4869 Unstructured Meshes}, 4870 year = {2001}, 4871 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 4872 url = {http://www.ulg.ac.be/aerodyn}, 4873 petsc_uses = {KSP} 4874} 4875 4876@InProceedings{ knepley98, 4877 author = {Matthew Knepley and Denis Vanderstraeten}, 4878 title = {Parallel Building Blocks for Finite Element Simulations: Application to 4879 Solid-Liquid Mixture Flows}, 4880 booktitle = {Proceedings of Parallel CFD'97}, 4881 publisher = {Elsevier}, 4882 pages = {281--287}, 4883 year = {1998}, 4884 petsc_uses = {KSP} 4885} 4886 4887@InProceedings{ pcfd97, 4888 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 4889 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 4890 publisher = {Elsevier}, 4891 year = {1998}, 4892 booktitle = {Proceedings of Parallel CFD'97}, 4893 pages = {333-344}, 4894 petsc_uses = {KSP} 4895} 4896 4897@InProceedings{ knepleysamehsari98, 4898 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 4899 title = {Parallel Simulation of Particulate Flows}, 4900 booktitle = {Solving Irregularly Structured Problems in Parallel}, 4901 editors = {A. Ferreira et al}, 4902 year = {1998}, 4903 series = {Lecture Notes in Computer Science}, 4904 volume = {1457}, 4905 pages = {226--237}, 4906 petsc_uses = {KSP} 4907} 4908 4909@Article{ gkmt98, 4910 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 4911 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 4912 Implicit {CFD}}, 4913 journal = {Int. J. High Performance Computing Applications}, 4914 year = {2000}, 4915 volume = {14}, 4916 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 4917 pages = {102-136}, 4918 petsc_uses = {KSP} 4919} 4920 4921@InProceedings{ agkks-sc99, 4922 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 4923 Smith}, 4924 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 4925 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 4926 editor = {}, 4927 publisher = {}, 4928 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 4929 year = {1999}, 4930 note = {Winner of Gordon Bell Special Prize at SC 99}, 4931 petsc_uses = {KSP} 4932} 4933 4934@Article{ gkks01, 4935 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 4936 title = {High Performance Parallel Implicit {CFD}}, 4937 journal = {Journal of Parallel Computing}, 4938 year = {2001}, 4939 volume = {27}, 4940 pages = {337-362}, 4941 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 4942 petsc_uses = {KSP} 4943} 4944 4945@Article{ cristea-sofonea-02, 4946 author = {Artur Cristea and Victor Sofonea}, 4947 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 4948 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 4949 Sciences, Information Sciences}, 4950 volume = {3}, 4951 number = {3}, 4952 year = {2002}, 4953 petsc_uses = {KSP} 4954} 4955 4956@Article{ cristea2, 4957 author = {Artur Cristea and Victor Sofonea}, 4958 title = {Two component lattice Boltzmann model with flux limiter techniques}, 4959 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 4960 Sciences, Information Sciences}, 4961 volume = {4}, 4962 number = {1}, 4963 year = {2003}, 4964 pages = {59--64}, 4965 petsc_uses = {KSP} 4966} 4967 4968@Article{ cristea1, 4969 author = {Artur Cristea and Victor Sofonea}, 4970 title = {Two component lattice Boltzmann model with flux limiters}, 4971 journal = {Central European Journal of Physics}, 4972 volume = {2}, 4973 number = {2}, 4974 year = {2004}, 4975 pages = {382--396}, 4976 petsc_uses = {KSP} 4977} 4978 4979@Article{ sofnea-lamura1, 4980 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 4981 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 4982 systems}, 4983 journal = {Physical Review E}, 4984 volume = {70}, 4985 number = {4}, 4986 year = {2004}, 4987 pages = {046702-1 / 046702-9}, 4988 petsc_uses = {KSP} 4989} 4990 4991@InProceedings{ gkks01b, 4992 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 4993 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 4994 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 4995 Mechanics}, 4996 editor = {}, 4997 location = {Cambridge, MA}, 4998 year = {2001}, 4999 month = jun, 5000 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 5001 petsc_uses = {KSP} 5002} 5003 5004@InProceedings{ gkks00, 5005 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5006 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 5007 Code}, 5008 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 5009 (HiPC '2000)}, 5010 editor = {}, 5011 location = {Bangalore, India}, 5012 year = {2000}, 5013 pages = {395--404}, 5014 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 5015 petsc_uses = {KSP} 5016} 5017 5018@InProceedings{ gkks-sc00, 5019 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5020 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 5021 booktitle = {Proceedings of SC2000}, 5022 editor = {}, 5023 publisher = {IEEE Computer Society}, 5024 year = {2000}, 5025 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 5026 petsc_uses = {KSP} 5027} 5028 5029@InProceedings{ knepleysamehsarin99, 5030 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 5031 title = {Design of Large Scale Parallel Simulations}, 5032 booktitle = {Proceedings of Parallel CFD'99}, 5033 editors = {A. {Ecer et al.}}, 5034 publisher = {Elsevier}, 5035 year = {1999}, 5036 petsc_uses = {KSP} 5037} 5038 5039@InProceedings{ gkks-pcfd99, 5040 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 5041 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 5042 booktitle = {Proceedings of Parallel CFD'99}, 5043 editors = {A. {Ecer et al.}}, 5044 publisher = {Elsevier}, 5045 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 5046 year = {1999}, 5047 petsc_uses = {KSP} 5048} 5049 5050@InProceedings{ kks97, 5051 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5052 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 5053 Parallelization of an Unstructured Grid Incompressible Flow Code}, 5054 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 5055 Methods}, 5056 editor = {J. Mandel et al.}, 5057 pages = {311--319}, 5058 publisher = {Wiley}, 5059 note = {}, 5060 year = {1997}, 5061 petsc_uses = {KSP} 5062} 5063 5064@InProceedings{ kks99, 5065 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5066 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 5067 Incompressible Flows on Unstructured Grids}, 5068 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 5069 Methods}, 5070 editors = {C.-H. {Lai et al.}}, 5071 publisher = {Domain Decomposition Press, Bergen}, 5072 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 5073 year = {1999}, 5074 petsc_uses = {KSP} 5075} 5076 5077@InCollection{ kks97_cfd, 5078 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 5079 title = {Perspectives for {CFD} on Petaflops Systems}, 5080 booktitle = {CFD Review 1998}, 5081 editor = {M. Hafez and K. Oshima}, 5082 publisher = {World Scientific, Singapore}, 5083 pages = {1079--1096}, 5084 note = {}, 5085 year = {1998}, 5086 petsc_uses = {KSP} 5087} 5088 5089@Article{ hm99, 5090 author = {P. D. Hovland and L. C. McInnes}, 5091 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 5092 {PETSc}}, 5093 year = {2000}, 5094 journal = {Parallel Computing}, 5095 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 5096 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 5097 petsc_uses = {KSP} 5098} 5099 5100@InProceedings{ cruzbarbaknepley08, 5101 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 5102 title = {Fast Multipole Method for particle interactions: an open source parallel library 5103 component}, 5104 booktitle = {Proceedings of ParCFD2008}, 5105 year = {2008}, 5106 editor = {Tromeur-Dervout et. al.}, 5107 publisher = {Elsevier}, 5108 petsc_uses = {KSP} 5109} 5110 5111@Article{ hwangcai05, 5112 author = {F.-N. Hwang and X.-C. Cai}, 5113 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 5114 for incompressible {Navier-Stokes} equations}, 5115 journal = {J. Comput. Phys.}, 5116 volume = {204}, 5117 year = {2005}, 5118 pages = {666--691}, 5119 petsc_uses = {KSP} 5120} 5121 5122@Article{ barbaleonard07, 5123 author = {Lorena A Barba and Anthony Leonard}, 5124 title = {Emergence and evolution of tripole vortices from net-circulation initial 5125 conditions}, 5126 journal = {Phys. Fluids}, 5127 volume = {19}, 5128 pages = {017101}, 5129 year = {2007}, 5130 doi = {10.1063/1.2409734}, 5131 petsc_uses = {KSP} 5132} 5133 5134@Article{ barba07, 5135 author = {Lorena A Barba}, 5136 title = {Non-shielded multipolar vortices at high Reynolds number}, 5137 journal = {Phys. Rev. E}, 5138 volume = {73}, 5139 pages = {065303}, 5140 year = {2006}, 5141 doi = {10.1103/PhysRevE.73.065303}, 5142 petsc_uses = {KSP} 5143} 5144 5145@Article{ schofield2010multi, 5146 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 5147 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 5148 Lowrie, R.B. and Swartz, B.K.}, 5149 journal = {International Journal for Numerical Methods in Fluids}, 5150 volume = {63}, 5151 number = {8}, 5152 pages = {931--952}, 5153 year = {2010}, 5154 publisher = {Wiley Online Library}, 5155 petsc_uses = {KSP} 5156} 5157 5158% LiteralHTML: 5159% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 5160% LiteralHTML: 5161% LiteralHTML: article{DeGersem99, 5162% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 5163% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 5164% LiteralHTML: } 5165@Article{ nagler2014, 5166 title = {Sound transmission through a poroelastic layered panel}, 5167 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 5168 journal = {Computational Mechanics}, 5169 volume = {53}, 5170 number = {4}, 5171 pages = {549--560}, 5172 issn = {1432-0924}, 5173 doi = {10.1007/s00466-013-0916-x}, 5174 year = {2014}, 5175 petsc_uses = {KSP} 5176} 5177 5178@Article{ sheikh2013, 5179 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 5180 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 5181 deflation}, 5182 journal = {Numerical Linear Algebra with Applications}, 5183 volume = {20}, 5184 number = {4}, 5185 issn = {1099-1506}, 5186 doi = {10.1002/nla.1882}, 5187 pages = {645--662}, 5188 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 5189 analysis}, 5190 year = {2013}, 5191 petsc_uses = {KSP} 5192} 5193 5194@InProceedings{ silence, 5195 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 5196 Fuenmayor}, 5197 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 5198 Application to the study of acoustic behaviour of silencers}, 5199 year = {2004}, 5200 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 5201 (ECCOMAS)}, 5202 petsc_uses = {KSP} 5203} 5204 5205@Article{ degersem99, 5206 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 5207 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 5208 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 5209 journal = {COMPEL}, 5210 year = {1999}, 5211 volume = {18}, 5212 number = {3}, 5213 pages = {298--310}, 5214 bibdate = {}, 5215 petsc_uses = {KSP} 5216} 5217 5218@InProceedings{ widlund-wave-98, 5219 author = {Olof B. Widlund}, 5220 title = {Schwarz Methods for {H}elmholtz's Equation}, 5221 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 5222 editor = {John A. DeSanto}, 5223 year = {1998}, 5224 publisher = {SIAM}, 5225 pages = {620--622}, 5226 address = {Philadelphia}, 5227 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 5228 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 5229 petsc_uses = {KSP} 5230} 5231 5232@InProceedings{ toselli-wave-98, 5233 author = {Andrea Toselli}, 5234 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 5235 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 5236 editor = {John A. DeSanto}, 5237 year = {1998}, 5238 publisher = {SIAM}, 5239 address = {Philadelphia}, 5240 pages = {540--542}, 5241 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 5242 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 5243 petsc_uses = {KSP} 5244} 5245 5246@InProceedings{ mcinnes-wave-98, 5247 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 5248 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 5249 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 5250 editor = {John A. DeSanto}, 5251 year = {1998}, 5252 publisher = {SIAM}, 5253 address = {Philadelphia}, 5254 pages = {623--625}, 5255 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 5256 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 5257 petsc_uses = {KSP} 5258} 5259 5260@InProceedings{ mska98, 5261 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 5262 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 5263 Parallel Computation of {H}elmholtz Problems}, 5264 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 5265 editor = {J. Mandel et al.}, 5266 publisher = {AMS}, 5267 pages = {349--357}, 5268 year = {1998}, 5269 petsc_uses = {KSP} 5270} 5271 5272@InProceedings{ ccew98, 5273 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 5274 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 5275 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 5276 editor = {J. Mandel et al.}, 5277 publisher = {AMS}, 5278 pages = {437-445}, 5279 year = {1998}, 5280 petsc_uses = {KSP} 5281} 5282 5283@InProceedings{ ra98a, 5284 author = {R. Susan-Resiga and H. M. Atassi}, 5285 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 5286 Problems}, 5287 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 5288 publisher = {AIAA}, 5289 pages = {86-96}, 5290 note = {AIAA paper 98-2218}, 5291 year = {1998}, 5292 petsc_uses = {KSP} 5293} 5294 5295@InProceedings{ ar98c, 5296 author = {H. M. Atassi and R. Susan-Resiga}, 5297 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 5298 General Formulation}, 5299 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 5300 publisher = {ASME}, 5301 note = {NCA-25}, 5302 pages = {375-379}, 5303 year = {1998}, 5304 petsc_uses = {KSP} 5305} 5306 5307@InProceedings{ ra98b, 5308 author = {R. Susan-Resiga and H. M. Atassi}, 5309 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 5310 Numerical Implementation and Applications}, 5311 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 5312 publisher = {ASME}, 5313 note = {NCA-25}, 5314 pages = {381 -388}, 5315 year = {1998}, 5316 petsc_uses = {KSP} 5317} 5318 5319@InProceedings{ cai-dd10-98, 5320 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 5321 Widlund}, 5322 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 5323 booktitle = {Domain Decomposition Methods 10}, 5324 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 5325 series = {Contemporary Mathematics}, 5326 volume = {218}, 5327 publisher = {American Mathematical Society}, 5328 address = {Providence, Rhode Island}, 5329 year = {1998}, 5330 pages = {437--445}, 5331 petsc_uses = {KSP} 5332} 5333 5334@InProceedings{ alghamdi2011petclaw, 5335 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 5336 booktitle = {Proceedings of SpringSim 2011}, 5337 publisher = {ACM}, 5338 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 5339 Kyle T. Mandli and Lisandro Dalcin}, 5340 year = {2011}, 5341 petsc_uses = {KSP} 5342} 5343 5344@Article{ pyclaw2012, 5345 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 5346 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 5347 Emmett}, 5348 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 5349 journal = {SIAM Journal on Scientific Computing}, 5350 volume = {34}, 5351 number = {4}, 5352 pages = {C210--C231}, 5353 note = {\url{http://arxiv.org/abs/1111.6583}}, 5354 year = {2012}, 5355 petsc_uses = {KSP} 5356} 5357 5358% LiteralHTML: 5359% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 5360% LiteralHTML: 5361@Article{ sojkahorakhaplacermak2018, 5362 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 5363 decomposition method}, 5364 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 5365 journal = {Applied Mathematics and Computation}, 5366 volume = {319}, 5367 pages = {586--597}, 5368 year = {2018}, 5369 petsc_uses = {KSP} 5370} 5371 5372@Article{ chencai2014, 5373 title = {A parallel two-level domain decomposition based one-shot method for shape 5374 optimization problems}, 5375 author = {Rongliang Chen and Xiao‐Chuan Cai}, 5376 journal = {International Journal for Numerical Methods in Engineering}, 5377 volume = {99}, 5378 number = {13}, 5379 year = {2014}, 5380 doi = {10.1002/nme.4711}, 5381 petsc_uses = {KSP} 5382} 5383 5384@PhDThesis{ prudencio2005, 5385 author = {Ernesto Prudencio}, 5386 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 5387 for Optimization Problems Constrained by Partial Differential Equations}, 5388 school = {University of Colorado, Boulder}, 5389 year = {2005}, 5390 petsc_uses = {KSP} 5391} 5392 5393@Article{ prudenciocai2007, 5394 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 5395 for {PDE}-constrained optimization}, 5396 author = {Ernesto Prudencio and X. C. Cai}, 5397 journal = {SIAM J. Sci. Comp.}, 5398 volume = {29}, 5399 number = {3}, 5400 pages = {964--985}, 5401 year = {2007}, 5402 petsc_uses = {KSP} 5403} 5404 5405@Article{ prudenciobyrdcai2006, 5406 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 5407 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 5408 {PDE}-constrained Optimization Problems}, 5409 journal = {SIAM J. Sci. Comp.}, 5410 volume = {27}, 5411 pages = {1305--1328}, 5412 year = {2006}, 5413 petsc_uses = {KSP} 5414} 5415 5416@InProceedings{ prudenciobyrdcai2004, 5417 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 5418 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 5419 booktitle = {VECPAR 2004}, 5420 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 5421 publisher = {Springer}, 5422 pages = {569--582}, 5423 year = {2004}, 5424 petsc_uses = {KSP} 5425} 5426 5427@Article{ belhamadia-fortin-pcp, 5428 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 5429 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 5430 journal = {Journal of Computational Physics}, 5431 volume = {201}, 5432 pages = {753-770}, 5433 year = {2004}, 5434 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 5435 petsc_uses = {KSP} 5436} 5437 5438@Article{ biros00, 5439 author = {George Biros and Omar Ghattas}, 5440 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 5441 journal = {SIAG-Opt Views and News}, 5442 volume = {11}, 5443 number = {2}, 5444 year = {2000}, 5445 month = aug, 5446 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 5447 petsc_uses = {KSP} 5448} 5449 5450@Article{ bmm01, 5451 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 5452 journal = {ACM Transactions on Mathematical Software}, 5453 title = {A case study in the performance and scalability of optimization algorithms}, 5454 year = {2001}, 5455 volume = {27}, 5456 number = {3}, 5457 pages = {361--376}, 5458 petsc_uses = {KSP} 5459} 5460 5461@InProceedings{ oghattas1999, 5462 author = {George Biros and Omar Ghattas}, 5463 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 5464 incompressible flows}, 5465 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 5466 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 5467 year = {1999}, 5468 petsc_uses = {KSP} 5469} 5470 5471@InProceedings{ hkms00, 5472 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 5473 PDE-constrained Optimization}, 5474 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 5475 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 5476 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 5477 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 5478 Hasco\"{e}t and Uwe Naumann}, 5479 publisher = {Springer}, 5480 year = {2002}, 5481 petsc_uses = {KSP} 5482} 5483 5484% old version: replace with biros2005pln1 5485@TechReport{ bg011, 5486 author = {George Biros and Omar Ghattas}, 5487 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 5488 Part I: The Krylov-Schur Solver}, 5489 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 5490 year = {2001}, 5491 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 5492 petsc_uses = {KSP} 5493} 5494 5495% old version: replace with biros2005pln2 5496@TechReport{ bg012, 5497 author = {George Biros and Omar Ghattas}, 5498 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 5499 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 5500 Optimal Control of Steady Viscous Flows}, 5501 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 5502 year = {2001}, 5503 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 5504 petsc_uses = {KSP} 5505} 5506 5507% LiteralHTML: 5508% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 5509% LiteralHTML: 5510@InProceedings{ ly2003, 5511 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 5512 title = {A New Parallel Kernel-independent Fast Multipole Method}, 5513 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 5514 year = {2003}, 5515 note = {Winner of the Best Student Paper at SC2003}, 5516 petsc_uses = {KSP} 5517} 5518 5519@Article{ yokotabarbaknepley10, 5520 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 5521 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 5522 journal = {Computer Methods in Applied Mechanics and Engineering}, 5523 volume = {199}, 5524 number = {25-28}, 5525 pages = {1793--1804}, 5526 url = {http://arxiv.org/abs/0909.5413v1}, 5527 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 5528 year = {2010}, 5529 petsc_uses = {KSP} 5530} 5531 5532@Article{ cruzknepleybarba10, 5533 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 5534 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 5535 journal = {International Journal of Numerical Methods in Engineering}, 5536 volume = {85}, 5537 number = {4}, 5538 pages = {403--428}, 5539 url = {http://arxiv.org/abs/0905.2637}, 5540 note = {\url{http://arxiv.org/abs/0905.2637}}, 5541 year = {2010}, 5542 petsc_uses = {KSP} 5543} 5544 5545% LiteralHTML: 5546% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 5547% LiteralHTML: 5548@Article{ buchanpainumplebysmedleystevenson2012, 5549 title = {A sub-grid scale finite element agglomeration multigrid method with application 5550 to the Boltzmann transport equation}, 5551 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 5552 journal = {International Journal for Numerical Methods in Engineering}, 5553 volume = {92}, 5554 number = {3}, 5555 pages = {318--342}, 5556 year = {2012}, 5557 publisher = {Wiley Online Library}, 5558 petsc_uses = {KSP} 5559} 5560 5561@Article{ magoulesahamedsuzuki2015, 5562 title = {Green computing on graphics processing units}, 5563 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 5564 journal = {Concurrency and Computation: Practice and Experience}, 5565 year = {2015}, 5566 publisher = {Wiley Online Library}, 5567 petsc_uses = {KSP} 5568} 5569 5570@InProceedings{ yanrhodes11, 5571 author = {Yan, Baoqiang and Rhodes, Philip J.}, 5572 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 5573 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 5574 series = {ICPP '11}, 5575 pages = {355--364}, 5576 year = {2011}, 5577 isbn = {978-0-7695-4510-3}, 5578 numpages = {10}, 5579 doi = {10.1109/ICPP.2011.70}, 5580 acmid = {2066965}, 5581 publisher = {IEEE Computer Society}, 5582 address = {Washington, DC, USA}, 5583 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 5584 petsc_uses = {KSP} 5585} 5586 5587@Article{ hakansson2013mdstochasticliouville, 5588 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 5589 Stulz, Eugen}, 5590 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 5591 equation study}, 5592 journal = {Phys. Chem. Chem. Phys.}, 5593 year = {2013}, 5594 volume = {15}, 5595 issue = {26}, 5596 pages = {10930-10941}, 5597 publisher = {The Royal Society of Chemistry}, 5598 doi = {10.1039/C3CP50788B}, 5599 petsc_uses = {KSP} 5600} 5601 5602@Article{ hakansson2011stochasticliouville, 5603 author = {Hakansson, Par and Nair, Prasanth B.}, 5604 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 5605 form}, 5606 journal = {Phys. Chem. Chem. Phys.}, 5607 year = {2011}, 5608 volume = {13}, 5609 issue = {20}, 5610 pages = {9578-9589}, 5611 publisher = {The Royal Society of Chemistry}, 5612 doi = {10.1039/C1CP20400A}, 5613 petsc_uses = {KSP} 5614} 5615 5616@InProceedings{ wang:lee:scidac2011, 5617 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 5618 McInnes and Todd Munson and Barry Smith}, 5619 title = {A Differential Variational Inequality Approach for the Simulation of 5620 Heterogeneous Materials}, 5621 booktitle = {Proceedings of SciDAC 2011 Conference}, 5622 year = {2011}, 5623 petsc_uses = {KSP} 5624} 5625 5626@Article{ bourdinlarsenrichardson2011, 5627 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 5628 title = {A time-discrete model for dynamic fracture based on crack regularization}, 5629 journal = {International Journal of Fracture}, 5630 volume = {168}, 5631 issue = {2}, 5632 pages = {133--143}, 5633 doi = {10.1007/s10704-010-9562-x}, 5634 year = {2011}, 5635 petsc_uses = {KSP} 5636} 5637 5638@Book{ bourdinfrancfortmarigo, 5639 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 5640 title = {The Variational Approach to Fracture}, 5641 publisher = {Springer}, 5642 year = {2008}, 5643 petsc_uses = {KSP} 5644} 5645 5646@Article{ bourdinfrancfortmarigo2008, 5647 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 5648 title = {The Variational Approach to Fracture}, 5649 journal = {J. Elasticity}, 5650 volume = {91}, 5651 issue = {1}, 5652 pages = {1--148}, 5653 doi = {10.1007/s10659-007-9107-3}, 5654 year = {2008}, 5655 petsc_uses = {KSP} 5656} 5657 5658@Article{ lahtinen2008spectrum, 5659 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 5660 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 5661 J.K.}, 5662 journal = {Annals of Physics}, 5663 volume = {323}, 5664 number = {9}, 5665 pages = {2286--2310}, 5666 year = {2008}, 5667 publisher = {Elsevier}, 5668 petsc_uses = {KSP} 5669} 5670 5671@InProceedings{ roark2004discriminative, 5672 title = {Discriminative language modeling with conditional random fields and the 5673 perceptron algorithm}, 5674 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 5675 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 5676 Linguistics}, 5677 pages = {47}, 5678 year = {2004}, 5679 organization = {Association for Computational Linguistics}, 5680 petsc_uses = {KSP} 5681} 5682 5683@Article{ roark2007discriminative, 5684 title = {Discriminative n-gram language modeling}, 5685 author = {Roark, B. and Saraclar, M. and Collins, M.}, 5686 journal = {Computer Speech \& Language}, 5687 volume = {21}, 5688 number = {2}, 5689 pages = {373--392}, 5690 year = {2007}, 5691 publisher = {Elsevier}, 5692 petsc_uses = {KSP} 5693} 5694 5695@Conference{ garcia2011parallel, 5696 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 5697 nanodevice simulators}}, 5698 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 5699 Aldegunde, M.}, 5700 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 5701 pages = {1--4}, 5702 organization = {IEEE}, 5703 petsc_uses = {KSP} 5704} 5705 5706@Conference{ wesley2006parallel, 5707 title = {{A parallel artificial neural network implementation}}, 5708 author = {Wesley-Smith, I.}, 5709 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 5710 year = {2006}, 5711 petsc_uses = {KSP} 5712} 5713 5714@Article{ hcsw1, 5715 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 5716 title = {Parallel Newton-Krylov-Schwarz algorithms for the three-dimensional 5717 Poisson-Boltzmann equation in numerical simulation of colloidal particle 5718 interactions}, 5719 journal = {Computer Physics Communications}, 5720 volumne = {181}, 5721 year = {2010}, 5722 pages = {1529--1537}, 5723 petsc_uses = {KSP} 5724} 5725 5726@Article{ hh1, 5727 author = {C.-Y. Huang and F.-N. Hwang}, 5728 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 5729 bifurcation analysis of incompressible sudden expansion flows}, 5730 journal = {Applied Numerical Mathematics}, 5731 volume = {60}, 5732 year = {2010}, 5733 pages = {738--751}, 5734 petsc_uses = {KSP} 5735} 5736 5737@Article{ hwhw1, 5738 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 5739 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 5740 polynomial eigenvalue problems in quantum dot simulation}, 5741 journal = {Journal of Computational Physics}, 5742 volume = {229}, 5743 year = {2010}, 5744 pages = {2932--2947}, 5745 petsc_uses = {KSP} 5746} 5747 5748@Article{ wei2011parallel, 5749 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 5750 Application in Quantum Dot Simulation}}, 5751 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 5752 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 5753 pages = {157--164}, 5754 year = {2011}, 5755 publisher = {Springer}, 5756 petsc_uses = {KSP} 5757} 5758 5759@Article{ flores2007sequential, 5760 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 5761 equation using second-degree iterative methods}}, 5762 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 5763 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 5764 pages = {426--438}, 5765 year = {2007}, 5766 publisher = {Springer}, 5767 petsc_uses = {KSP} 5768} 5769 5770@InProceedings{ gordonbell09, 5771 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 5772 Siegel and Won Sik Yang}, 5773 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 5774 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 5775 note = {{SC'09 Gordon Bell} Prize Finalist}, 5776 year = {2009}, 5777 petsc_uses = {KSP} 5778} 5779 5780@Article{ knepleykarpeevdavidovitseisenberggillespie10, 5781 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 5782 Eisenberg and Dirk Gillespie}, 5783 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 5784 Dimensions: Ionic Solutions}, 5785 journal = {Journal of Physical Chemistry}, 5786 volume = {132}, 5787 number = {12}, 5788 pages = {124101--124111}, 5789 url = {http://arxiv.org/abs/0910.1531}, 5790 year = {2010}, 5791 petsc_uses = {KSP} 5792} 5793 5794@Article{ knepleykarpeeveisenberggillespie09, 5795 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 5796 D.}, 5797 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 5798 Functional Theory Approach}}, 5799 journal = {Biophysical Journal}, 5800 month = feb, 5801 volume = {96}, 5802 pages = {661}, 5803 doi = {10.1016/j.bpj.2008.12.3494}, 5804 year = {2009}, 5805 petsc_uses = {KSP} 5806} 5807 5808@Article{ scx2008, 5809 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 5810 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 5811 CONCRETE}, 5812 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 5813 volume = {3}, 5814 number = {4}, 5815 year = {2006}, 5816 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 5817 petsc_uses = {KSP} 5818} 5819 5820@TechReport{ kdgs2008, 5821 year = {2008}, 5822 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 5823 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 5824 Chips}, 5825 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 5826 Stortia}, 5827 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 5828 petsc_uses = {KSP} 5829} 5830 5831@Article{ springerlink:10.1007/s10915-011-9551-x, 5832 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 5833 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 5834 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 5835 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 5836 Coupled FEM/SBFEM Approach}, 5837 journal = {Journal of Scientific Computing}, 5838 publisher = {Springer Netherlands}, 5839 issn = {0885-7474}, 5840 keyword = {Mathematics and Statistics}, 5841 pages = {1-22}, 5842 doi = {10.1007/s10915-011-9551-x}, 5843 petsc_uses = {KSP} 5844} 5845 5846@TechReport{ jj2007, 5847 author = {Boris Jeremic and Guanzhou Jie}, 5848 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 5849 Problems Report}, 5850 institution = {UCD CompGeoMech 02--2007}, 5851 year = {2007}, 5852 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 5853 petsc_uses = {KSP} 5854} 5855 5856@Unpublished{ kuiper08, 5857 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 5858 author = {Rolf Kuiper}, 5859 institution = {Max-Planck-Institute for Astronomy}, 5860 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 5861 year = {2008}, 5862 petsc_uses = {KSP} 5863} 5864 5865@Article{ williamson2012multidimensional, 5866 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 5867 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 5868 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 5869 journal = {Journal of Nuclear Materials}, 5870 volume = {423}, 5871 number = {1}, 5872 pages = {149--163}, 5873 year = {2012}, 5874 publisher = {Elsevier}, 5875 petsc_uses = {KSP} 5876} 5877 5878@InProceedings{ kucukboyaci2015cobra, 5879 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 5880 analysis}, 5881 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 5882 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 5883 Nuclear Applications and the Monte Carlo Method}, 5884 pages = {1--18}, 5885 year = {2015}, 5886 petsc_uses = {KSP} 5887} 5888 5889@Article{ hales2012solving, 5890 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 5891 {K}rylov Method}, 5892 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 5893 M.R.}, 5894 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 5895 volume = {84}, 5896 number = {2}, 5897 pages = {123--153}, 5898 year = {2012}, 5899 publisher = {Tech Science Press}, 5900 petsc_uses = {KSP} 5901} 5902 5903@InProceedings{ srksyp2008, 5904 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 5905 Palmiotti}, 5906 title = {Fast reactor core simulations using the {UNIC} code}, 5907 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 5908 Power: A Sustainable Resource}, 5909 year = {2008}, 5910 petsc_uses = {KSP} 5911} 5912 5913@InProceedings{ psrlkssl2007, 5914 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 5915 Siegel and B. Smith and E. E. Lewis}, 5916 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 5917 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 5918 Supercomputing in Nuclear Applications}, 5919 year = {2007}, 5920 petsc_uses = {KSP} 5921} 5922 5923@InProceedings{ sprkssl2007, 5924 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 5925 Smith and E. E. Lewis}, 5926 title = {{PNFE} Component of the {UNIC} Code}, 5927 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 5928 Supercomputing in Nuclear Applications}, 5929 year = {2007}, 5930 petsc_uses = {KSP} 5931} 5932 5933@InProceedings{ dc-oop-03, 5934 author = {H. Digonnet and T. Coupez}, 5935 title = {Object-oriented programming for fast-and-easy development of parallel 5936 applications in forming processes simulation}, 5937 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 5938 Mechanics}, 5939 year = {2003}, 5940 petsc_uses = {KSP} 5941} 5942 5943@InProceedings{ dc-cfm-03, 5944 author = {H. Digonnet and T. Coupez}, 5945 title = {Calcul parallele en mise en forme des materiaux}, 5946 booktitle = {XVIeme Congres Francais de Mecanique}, 5947 year = {2003}, 5948 petsc_uses = {KSP} 5949} 5950 5951@InProceedings{ dsc-pcsev-04, 5952 author = {H. Digonnet and L. Silva and T. Coupez}, 5953 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 5954 booktitle = {Proceedings of ECCOMAS 2004}, 5955 year = {2004}, 5956 petsc_uses = {KSP} 5957} 5958 5959@InProceedings{ dsc-pca3fs-04, 5960 author = {H. Digonnet and L. Silva and T. Coupez}, 5961 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 5962 booktitle = {Proceedings of WCCM VI}, 5963 year = {2004}, 5964 petsc_uses = {KSP} 5965} 5966 5967@InProceedings{ dbcs-cpaac-05, 5968 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 5969 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 5970 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 5971 year = {2005}, 5972 petsc_uses = {KSP} 5973} 5974 5975@Article{ sz2010, 5976 author = {B. Smith and H. Zhang}, 5977 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 5978 Performance}, 5979 journal = {International Journal of High Performance Computing Applications}, 5980 volume = {25}, 5981 number = {4}, 5982 pages = {386--391}, 5983 year = {2011}, 5984 petsc_uses = {KSP} 5985} 5986 5987@Article{ zssz2006, 5988 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 5989 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 5990 journal = {TOMS}, 5991 url = {http://math.nist.gov/toms/Current.html#v33n2}, 5992 volumne = {33}, 5993 number = {2}, 5994 year = {2007}, 5995 petsc_uses = {KSP} 5996} 5997 5998@Article{ gs2006, 5999 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 6000 title = {The detachment of a viscous drop in a viscous solution in the presence of a 6001 soluble surfactant}, 6002 journal = {Phys. Fluids}, 6003 volume = {18}, 6004 year = {2006}, 6005 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 6006 petsc_uses = {KSP} 6007} 6008 6009@Article{ jmemsci, 6010 author = {Bo Zhou and Adam Powell}, 6011 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 6012 of Polymeric Membranes in 2D and 3D}, 6013 journal = {J. Membrane Sci.}, 6014 volume = {268}, 6015 number = {2}, 6016 pages = {150--164}, 6017 year = {2006}, 6018 month = jan, 6019 day = {15}, 6020 doi = {10.1016/j.memsci.2005.05.030}, 6021 petsc_uses = {KSP} 6022} 6023 6024@InProceedings{ vbde2002, 6025 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 6026 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 6027 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 6028 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 6029 year = {2002}, 6030 petsc_uses = {KSP} 6031} 6032 6033@InProceedings{ wid2005, 6034 author = {Alexander I. Bobenko and Peter Schrader}, 6035 title = {Discrete Willmore Flow}, 6036 booktitle = {Eurographics Symposium on Geometry Processing}, 6037 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 6038 year = {2005}, 6039 editor = {M. Desbrun and H. Pottmann}, 6040 petsc_uses = {KSP} 6041} 6042 6043@Article{ stj2003, 6044 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 6045 journal = {International Journal for Numerical Methods in Fluids}, 6046 volume = {41}, 6047 issue = {4}, 6048 title = {A numerical method for inverse design based on the inverse Euler equations}, 6049 year = {2003}, 6050 pages = {339--355}, 6051 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 6052 petsc_uses = {KSP} 6053} 6054 6055@PhDThesis{ as2001, 6056 author = {ANDREA SCASCIGHINI}, 6057 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 6058 Inverse Euler Equations}, 6059 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 6060 year = {2001}, 6061 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 6062 petsc_uses = {KSP} 6063} 6064 6065@Article{ hb2005, 6066 author = {E. McKay Hyde and Oscar P. Bruno}, 6067 journal = {Journal of Computational Physics}, 6068 volume = {202}, 6069 title = {A fast, higher-order solver for scattering by penetrable bodies in three 6070 dimensions}, 6071 year = {2005}, 6072 pages = {236--261}, 6073 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 6074 petsc_uses = {KSP} 6075} 6076 6077@MastersThesis{ d2002, 6078 author = {Matthew F Dixon}, 6079 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 6080 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 6081 school = {READING UNIVERSITY}, 6082 year = {2002}, 6083 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 6084 petsc_uses = {KSP} 6085} 6086 6087@TechReport{ gzb, 6088 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 6089 title = {Fast Parallel PageRank: A Linear System Approach}, 6090 institution = {Stanford University}, 6091 year = {2004}, 6092 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 6093 petsc_uses = {KSP} 6094} 6095 6096@PhDThesis{ yergeau-99, 6097 author = {Daniel W. Yergeau}, 6098 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 6099 SEMICONDUCTORS}, 6100 school = {Stanford}, 6101 year = {1999}, 6102 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 6103 petsc_uses = {KSP} 6104} 6105 6106@InProceedings{ rathkopf-miller-00, 6107 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 6108 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 6109 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 6110 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 6111 year = {2000}, 6112 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 6113 Physics and Mathematics and Computation into the Next Millennium}, 6114 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 6115 lab = {LLNL}, 6116 petsc_uses = {KSP} 6117} 6118 6119@Article{ bonfi-palma-pas-05, 6120 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 6121 journal = {Journal of Turbomachinery}, 6122 volume = {127}, 6123 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 6124 year = {2005}, 6125 pages = {395-401}, 6126 petsc_uses = {KSP} 6127} 6128 6129@InProceedings{ fettig-sobh-05, 6130 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 6131 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 6132 year = {2005}, 6133 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 6134 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 6135 petsc_uses = {KSP} 6136} 6137 6138@TechReport{ melnikov-matagne-05, 6139 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 6140 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 6141 title = {Spin configurations in circular and rectangular vertical quantum dots in a 6142 magnetic field: Three-dimensional self-consistent simulation}, 6143 year = {2005}, 6144 number = {Arxiv preprint cond-mat/0506585}, 6145 url = {http://arxiv.org/pdf/cond-mat/0506585}, 6146 petsc_uses = {KSP} 6147} 6148 6149@InProceedings{ richard-smedley-03, 6150 author = {Richard P. Smedley-Stevenson}, 6151 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 6152 year = {2003}, 6153 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 6154 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 6155 petsc_uses = {KSP} 6156} 6157 6158@Article{ guan-godoy-ravaioli-03, 6159 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 6160 journal = {Journal of Computational Electronics}, 6161 volume = {2}, 6162 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 6163 for Transport in a Silicon Quantum Wire Structure}, 6164 year = {2003}, 6165 pages = {335--339}, 6166 petsc_uses = {KSP} 6167} 6168 6169@Article{ ovtchinnikovcai04, 6170 author = {S. Ovtchinnikov and X.-C. Cai}, 6171 journal = {Numer. Lin. Alg. Applics}, 6172 volume = {11}, 6173 title = {One-level Newton-Krylov-Schwarz algorithm for unsteady nonlinear radiation 6174 diffusion problem}, 6175 year = {2004}, 6176 pages = {867--881}, 6177 petsc_uses = {KSP} 6178} 6179 6180@Article{ mixedstress, 6181 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 6182 author = {Adam Powell and David Dussault}, 6183 journal = {Appl. Numer. Anal. Comp. Math.}, 6184 volume = {2}, 6185 number = {1}, 6186 year = {2005}, 6187 pages = {157--166}, 6188 petsc_uses = {KSP} 6189} 6190 6191@Article{ dhh2005, 6192 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 6193 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 6194 journal = {International Journal for Computation and Mathematics in Electrical and 6195 Electronic Engineering (COMPEL)}, 6196 year = {2005}, 6197 petsc_uses = {KSP} 6198} 6199 6200@Article{ dhh2004, 6201 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 6202 title = {Finite element modelling of ion convection by electrostatic forces}, 6203 journal = {IEE Proceedings Science, Measurement and Technology}, 6204 year = {2004}, 6205 volume = {151}, 6206 number = {6}, 6207 petsc_uses = {KSP} 6208} 6209 6210@Article{ adams-07b, 6211 author = {Adams M.F.}, 6212 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 6213 Frequency Response Analysis in Solid Mechanics}, 6214 journal = {Computional Mechanics}, 6215 year = {2007}, 6216 volume = {39}, 6217 number = {4}, 6218 pages = {497-507}, 6219 petsc_uses = {KSP} 6220} 6221 6222@InProceedings{ wc2004, 6223 author = {A. Wheelock and D. Cooke}, 6224 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 6225 Dimensions}, 6226 year = {2004}, 6227 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 6228 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 6229 petsc_uses = {KSP} 6230} 6231 6232@InProceedings{ allard-gouranton-ipts2002, 6233 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 6234 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 6235 year = {2002}, 6236 booktitle = {Immersive Projection Technology Symposium}, 6237 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 6238 petsc_uses = {KSP} 6239} 6240 6241@Article{ icc, 6242 author = {D Ioan and G Ciuprina and C Ciobotaru}, 6243 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 6244 journal = {IEEE Transactions on Magnetics}, 6245 year = {2000}, 6246 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 6247 petsc_uses = {KSP} 6248} 6249 6250@InProceedings{ hs1, 6251 author = {Brian J. Henz and Dale R. Shires}, 6252 title = {Development and Performance Analysis of a Parallel Finite Element Application 6253 Implemented in an Object-Oriented Programming Framework}, 6254 year = {2003}, 6255 booktitle = {PDPTA 2003}, 6256 pages = {1286-1292}, 6257 note = {Resin Transfer Modeling}, 6258 petsc_uses = {KSP} 6259} 6260 6261@TechReport{ b2000, 6262 author = {Rickard Bergstrom}, 6263 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 6264 year = {2000}, 6265 institution = {Chalmers}, 6266 number = {2000-05}, 6267 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 6268 petsc_uses = {KSP} 6269} 6270 6271@Article{ fs2004, 6272 author = {Petri Fast and Michael J. Shelley}, 6273 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 6274 Shaw Flow}, 6275 journal = {Journal of Computational Physics}, 6276 year = {2004}, 6277 volume = {195}, 6278 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 6279 pages = {117-142}, 6280 petsc_uses = {KSP} 6281} 6282 6283@MastersThesis{ wallach, 6284 author = {Hanna Wallach}, 6285 title = {Efficient Training of Conditional Random Fields}, 6286 school = {University of Edinburgh}, 6287 year = {2002}, 6288 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 6289 }osborne/msc-projects/wallach.ps.gz}, 6290 petsc_uses = {KSP} 6291} 6292 6293@Article{ something, 6294 author = {T Rylander and A Bondeson}, 6295 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 6296 equations}, 6297 journal = {Journal of Computational Physics}, 6298 year = {2002}, 6299 volume = {179}, 6300 pages = {426-438}, 6301 petsc_uses = {KSP} 6302} 6303 6304@TechReport{ uf1, 6305 author = {Uwe Fabricius}, 6306 title = {Comparison of two implementations of AMG-preconditioned CG considering an 6307 electrostatic problem}, 6308 year = {2004}, 6309 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 6310 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 6311 number = {04-1}, 6312 petsc_uses = {KSP} 6313} 6314 6315@InBook{ sg1, 6316 author = {Natalia Seoane and A.J.Garca-Loureiro}, 6317 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 6318 Equation}, 6319 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 6320 title = {Lecture Notes in Computer Science}, 6321 publisher = {Springer-Verlag}, 6322 volume = {3037}, 6323 year = {2004}, 6324 petsc_uses = {KSP} 6325} 6326 6327@Article{ nikyilmazgivisheikhipope10, 6328 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 6329 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 6330 journal = {AIAA Journal}, 6331 volume = {48}, 6332 number = {7}, 6333 pages = {1513--1522}, 6334 year = {2010}, 6335 petsc_uses = {KSP} 6336} 6337 6338@Article{ nikyilmazsheikhigivi10, 6339 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 6340 title = {Grid Resolution Effects on VSFMDF/LES}, 6341 journal = {Flow, Turbulence and Combustion}, 6342 doi = {10.1007/s10494-010-9272-5}, 6343 year = {2010}, 6344 petsc_uses = {KSP} 6345} 6346 6347@Article{ idema2013towards, 6348 title = {Towards faster solution of large power flow problems}, 6349 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 6350 and van der Sluis, Lou}, 6351 journal = {Power Systems, IEEE Transactions on}, 6352 volume = {28}, 6353 number = {4}, 6354 pages = {4918--4925}, 6355 year = {2013}, 6356 publisher = {IEEE}, 6357 petsc_uses = {KSP} 6358} 6359 6360@Article{ 6026245, 6361 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 6362 journal = {Power Systems, IEEE Transactions on}, 6363 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 6364 year = {2012}, 6365 month = feb, 6366 volume = {27}, 6367 number = {1}, 6368 pages = {390-396}, 6369 doi = {10.1109/TPWRS.2011.2165860}, 6370 issn = {0885-8950}, 6371 petsc_uses = {KSP} 6372} 6373 6374@Book{ idema2014computational, 6375 title = {Computational Methods in Power System Analysis}, 6376 author = {Idema, Reijer and Lahaye, Domenico JP}, 6377 year = {2014}, 6378 publisher = {Springer}, 6379 petsc_uses = {KSP} 6380} 6381 6382@PhDThesis{ abhyankar2011thesis, 6383 author = {Shrirang Abhyankar}, 6384 title = {Development of an implicitly coupled electromechanical and electromagnetic 6385 transients simulator for power systems}, 6386 school = {Illinois Institute of Technology}, 6387 year = {2011}, 6388 petsc_uses = {KSP} 6389} 6390 6391@InProceedings{ abhyankarhipcna11-1, 6392 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 6393 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 6394 year = {2011}, 6395 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 6396 Networking and Analytics for the Power Grid}, 6397 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 6398 publisher = {ACM}, 6399 petsc_uses = {KSP} 6400} 6401 6402@InProceedings{ abhyankarhipcna11-2, 6403 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 6404 title = {Development of a parallel three-phase transient stability simulator for power 6405 systems}, 6406 year = {2011}, 6407 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 6408 Networking and Analytics for the Power Grid}, 6409 publisher = {ACM}, 6410 petsc_uses = {KSP} 6411} 6412 6413@InProceedings{ abhyankarpesgeneral2012, 6414 author = {Shrirang Abhyankar and A. Flueck}, 6415 title = {An implicitly-coupled solution approach for combined electromechanical and 6416 electromagnetic transients simulation}, 6417 year = {2012}, 6418 booktitle = {Proceedings of the IEEE PES General Meeting}, 6419 publisher = {IEEE}, 6420 petsc_uses = {KSP} 6421} 6422 6423@Article{ idemalahayevuiksluis2012, 6424 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 6425 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 6426 journal = {IEEE Transactions on Power Systems}, 6427 year = {2012}, 6428 volume = {27}, 6429 pages = {390-396}, 6430 petsc_uses = {KSP} 6431} 6432 6433@Article{ korrestzavellasgalinas2013, 6434 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 6435 title = {A distributed implementation of multi-area power system state estimation on a 6436 cluster of computers }, 6437 journal = {Electric Power Systems Research }, 6438 volume = {102}, 6439 number = {0}, 6440 pages = {20 - 32}, 6441 year = {2013}, 6442 issn = {0378-7796}, 6443 doi = {10.1016/j.epsr.2013.04.002}, 6444 petsc_uses = {KSP} 6445} 6446 6447% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 6448% LiteralHTML:<font color="#FF0000"> 6449% LiteralHTML: Material failure, for example, cracking of steel beams resulting 6450% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 6451% LiteralHTML: are important for prediction and prevention. PETSc has been used 6452% LiteralHTML: in a variety of studies of material failure.</p> 6453% LiteralHTML:</font> 6454% LiteralHTML: 6455@InProceedings{ gray2, 6456 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 6457 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 6458 year = {2004}, 6459 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 6460 petsc_uses = {KSP} 6461} 6462 6463@InProceedings{ gray1, 6464 author = {J. Gray and and C. Homescu and L. Petzold and Richard Alkire}, 6465 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 6466 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 6467 year = {2003}, 6468 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 6469 petsc_uses = {KSP} 6470} 6471 6472@InProceedings{ crack2, 6473 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 6474 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 6475 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 6476 Conference}, 6477 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 6478 year = {2003}, 6479 petsc_uses = {KSP} 6480} 6481 6482@TechReport{ hdams1, 6483 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 6484 Lynd Stringer}, 6485 title = {Fracture Mechanics on the Intel Itanium Architecture}, 6486 year = {2001}, 6487 institution = {Intel Corporation}, 6488 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 6489 petsc_uses = {KSP} 6490} 6491 6492@InProceedings{ ihwi, 6493 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 6494 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 6495 booktitle = {International Conference ON Computational Engineering and Sciences}, 6496 year = {2002}, 6497 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 6498 petsc_uses = {KSP} 6499} 6500 6501@InProceedings{ crack, 6502 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 6503 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 6504 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 6505 and Paul A. Wawrzynek}, 6506 title = {Parallel FEM Simulation of Crack Propagation}, 6507 booktitle = {Proceedings of Irregular 2000}, 6508 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 6509 year = {2000}, 6510 petsc_uses = {KSP} 6511} 6512 6513@InProceedings{ beaudoin98, 6514 author = {A. J. Beaudoin}, 6515 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 6516 booktitle = {Simulation of materials processing: Theory, methods, and applications - 6517 Proceedings of the Sixth International Conference, NUMIFORM'98}, 6518 editor = {J. Hu\'etink and F. P. T. Baaijens}, 6519 optvolume = {}, 6520 optnumber = {}, 6521 optseries = {}, 6522 year = {1998}, 6523 optorganization={}, 6524 publisher = {A. A. Balkema Publishers}, 6525 address = {Rotterdam, Netherlands}, 6526 month = jun, 6527 optpages = {}, 6528 petsc_uses = {KSP} 6529} 6530 6531% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 6532@TechReport{ defordheld1, 6533 author = {JF DeFord and BL Held}, 6534 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 6535 year = {2002}, 6536 institution = {Simulation Technology and Applied Research}, 6537 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 6538 note = {Discusses their parallel commercial solver that uses PETSc}, 6539 petsc_uses = {KSP} 6540} 6541 6542@PhDThesis{ sande2003, 6543 author = {Hans Vande Sande}, 6544 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 6545 Quasi-Static Electromagnetic Systems}, 6546 school = {Katholieke Universiteit Leuven, Belgium}, 6547 year = {2003}, 6548 petsc_uses = {KSP} 6549} 6550 6551@Article{ sdchh2004, 6552 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 6553 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 6554 Tolerance}, 6555 journal = {IEEE Transactions on Magnetics}, 6556 year = {2004}, 6557 volume = {40}, 6558 pages = {1306--1309}, 6559 petsc_uses = {KSP} 6560} 6561 6562@Article{ holst-lindblom-etal:2004, 6563 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 6564 Scheel and Lawrence E. Kidder}, 6565 title = {Optimal constraint projection for hyperbolic evolution systems, }, 6566 journal = {Phys. Rev. D}, 6567 year = {2004}, 6568 volume = {70}, 6569 pages = {084017}, 6570 petsc_uses = {KSP} 6571} 6572 6573@Article{ marm2005, 6574 author = {Matthew Anderson and Richard A. Matzner}, 6575 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 6576 journal = {Foundations of Physics}, 6577 volume = {35}, 6578 pages = {1572--9516}, 6579 year = {2005}, 6580 petsc_uses = {KSP} 6581} 6582 6583@Article{ cook-pfeiffer:2004, 6584 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 6585 title = {Excision boundary conditions for black hole initial data}, 6586 journal = {Phys. Rev. D}, 6587 volume = {70}, 6588 pages = {104016--24}, 6589 year = {2004}, 6590 petsc_uses = {KSP} 6591} 6592 6593@Article{ pfeiffer-kidder-etal:2005, 6594 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 6595 Shoemaker}, 6596 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 6597 journal = {Phys. Rev. D}, 6598 year = {2005}, 6599 volume = {71}, 6600 pages = {024020}, 6601 petsc_uses = {KSP} 6602} 6603 6604@Article{ pfeiffer-kidder-etal:2003, 6605 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 6606 Saul A.}, 6607 title = {A multidomain spectral method for solving elliptic equations}, 6608 journal = {CPC}, 6609 year = {2003}, 6610 volume = {152}, 6611 pages = {253--273}, 6612 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 6613 For a related online version, see arXiv:gr-qc/0202096}, 6614 petsc_uses = {KSP} 6615} 6616 6617@Article{ pfeiffer-cook-teukolsky:2002, 6618 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 6619 title = {Comparing initial-data sets for binary black hole}, 6620 journal = {PRD}, 6621 year = {2002}, 6622 volume = {66}, 6623 pages = {024047}, 6624 note = {for a related online version, seearXiv:gr-qc/0203085}, 6625 petsc_uses = {KSP} 6626} 6627 6628@PhDThesis{ pfeiffer:2003, 6629 author = {Pfeiffer, Harald P.}, 6630 title = {Initial Data for Black Hole Evolutions}, 6631 school = {Cornell University}, 6632 year = {2003}, 6633 petsc_uses = {KSP} 6634} 6635 6636@TechReport{ h1, 6637 author = {Erik Schnetter}, 6638 title = {A fast apparent horizon algorithm}, 6639 year = {2002}, 6640 number = {Arxiv preprint gr-qc/0206003}, 6641 url = {http://arxiv.org/pdf/gr-qc/0206003}, 6642 petsc_uses = {KSP} 6643} 6644 6645@Article{ h2, 6646 author = {Erik Schnetter}, 6647 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 6648 year = {2003}, 6649 journal = {Class. Quantum Grav.}, 6650 pages = {4719-4737}, 6651 volume = {20}, 6652 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 6653 petsc_uses = {KSP} 6654} 6655 6656@Article{ adams-03a, 6657 author = {Adams, M.~F.}, 6658 journal = {Numerical Linear Algebra with Applications}, 6659 number = {2-3}, 6660 pages = {141-153}, 6661 title = {Algebraic multigrid methods for constrained linear systems with applications to 6662 contact problems in solid mechanics}, 6663 volume = {11}, 6664 year = {2004}, 6665 petsc_uses = {KSP} 6666} 6667 6668@Article{ vandesande1, 6669 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 6670 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 6671 year = {2003}, 6672 volume = {39}, 6673 pages = {1709--1712}, 6674 title = {Solving Nonlinear Magnetic Problems Using Newton Trust Region Methods}, 6675 petsc_uses = {KSP} 6676} 6677 6678@InProceedings{ vbde1, 6679 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 6680 year = {2002}, 6681 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 6682 Uintah PSE}, 6683 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 6684 2002}, 6685 pages = {49-55}, 6686 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 6687 note = {Extended abstract}, 6688 petsc_uses = {KSP} 6689} 6690 6691@Unpublished{ ep1, 6692 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 6693 author = {Bradley R. Eccleston and Todd S. Palmer}, 6694 institution = {Department of Nuclear Engineering, Oregon State University}, 6695 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 6696 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 6697 Parallel Simulations}, 6698 year = {1999}, 6699 petsc_uses = {KSP} 6700} 6701 6702@InProceedings{ teo2007scalable, 6703 title = {A scalable modular convex solver for regularized risk minimization}, 6704 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 6705 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 6706 discovery and data mining}, 6707 pages = {727--736}, 6708 year = {2007}, 6709 organization = {ACM}, 6710 petsc_uses = {KSP} 6711} 6712 6713@InProceedings{ rm02, 6714 author = {Robert Malouf}, 6715 year = {2002}, 6716 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 6717 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 6718 (CoNLL-2002)}, 6719 pages = {49-55}, 6720 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 6721 petsc_uses = {KSP} 6722} 6723 6724@Unpublished{ hrv02, 6725 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 6726 author = {V. Hernandex and J. E. Roman and V. Vidal}, 6727 note = {Submitted to CMMSE}, 6728 petsc_uses = {KSP} 6729} 6730 6731@Article{ tmh2001, 6732 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 6733 journal = {Journal of Economic Dynamics and Control}, 6734 year = {2002}, 6735 volume = {26}, 6736 pages = {1499-1515}, 6737 title = {Solving finite difference schemes arising in trivariate option pricing}, 6738 petsc_uses = {KSP} 6739} 6740 6741@InProceedings{ a2, 6742 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 6743 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 6744 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6745 Methods}, 6746 editor = {C.-H. Lai et al.}, 6747 publisher = {Domain Decomposition Press, Bergen}, 6748 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 6749 year = {1999}, 6750 petsc_uses = {KSP} 6751} 6752 6753@Unpublished{ mmmdcmaa-web-page, 6754 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 6755 {A}coustics {W}eb Page}, 6756 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 6757 author = {David E. Keyes}, 6758 institution = {Old Dominion University}, 6759 petsc_uses = {KSP} 6760} 6761 6762@Conference{ liu2010parallelization, 6763 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 6764 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 6765 booktitle = {International Symposium on Parallel and Distributed Processing with 6766 Applications}, 6767 pages = {528--535}, 6768 year = {2010}, 6769 organization = {IEEE}, 6770 petsc_uses = {KSP} 6771} 6772 6773@Unpublished{ oil-reservoir-sim-web-page, 6774 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 6775 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 6776 institution = {University of Texas at Austin and Argonne National Laboratory}, 6777 key = {University of Texas at Austin and Argonne National Laboratory}, 6778 petsc_uses = {KSP} 6779} 6780 6781@Article{ tmh2001b, 6782 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 6783 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 6784 year = {2001}, 6785 volume = {37}, 6786 pages = {143--146}, 6787 title = {Adapting EMAP3D to parallel processing}, 6788 petsc_uses = {KSP} 6789} 6790 6791@Article{ harbury98, 6792 author = {HK Harbury and W Porod}, 6793 journal = {VLSI Design}, 6794 year = {1998}, 6795 volume = {6}, 6796 pages = {47--51}, 6797 title = {Parallel computation for electronic waves in quantum corrals}, 6798 petsc_uses = {KSP} 6799} 6800 6801@Article{ bludszuwei98, 6802 author = {Mark Bludszuweit}, 6803 journal = {Journal of Lightwave Technology}, 6804 year = {1998}, 6805 volume = {16}, 6806 number = {7}, 6807 pages = {1336--42}, 6808 title = {Mixed Finite Element Beam Propagation Method}, 6809 petsc_uses = {KSP} 6810} 6811 6812@Article{ s1, 6813 author = {J. L. Friedman and N. Stergioulas}, 6814 journal = {Astrophysics Journal}, 6815 year = {1998}, 6816 volume = {492}, 6817 number = {301}, 6818 pages = {}, 6819 title = {}, 6820 petsc_uses = {KSP} 6821} 6822 6823@Article{ s1a, 6824 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 6825 journal = {Astrophysics Journal}, 6826 year = {1999}, 6827 volume = {510}, 6828 number = {854}, 6829 pages = {}, 6830 title = {}, 6831 petsc_uses = {KSP} 6832} 6833 6834@PhDThesis{ s2, 6835 author = {N. Stergioulas}, 6836 title = {Ph. D. thesis}, 6837 year = {1996}, 6838 institution = {University of Wisconsin-Milwaukee}, 6839 petsc_uses = {KSP} 6840} 6841 6842@InProceedings{ coral1, 6843 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 6844 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 6845 Parallel Computing Environment}, 6846 booktitle = {Proceedings of the Miami TEAM Workshop}, 6847 location = {Florida International University, Department of Electrical Engineering and 6848 Computing Science}, 6849 month = nov, 6850 year = {1993}, 6851 petsc_uses = {KSP} 6852} 6853 6854@InProceedings{ coral2, 6855 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 6856 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 6857 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 6858 month = dec, 6859 year = {1994}, 6860 petsc_uses = {KSP} 6861} 6862 6863@InProceedings{ coral3, 6864 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 6865 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 6866 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 6867 location = {Florida International University, Department of Electrical Engineering and 6868 Computing Science}, 6869 year = {1995}, 6870 petsc_uses = {KSP} 6871} 6872 6873@InProceedings{ mijalkovic, 6874 author = {Slobodan Mijalkovi\'{c}}, 6875 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 6876 Process Simulation}, 6877 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 6878 Gent, Belgium, September 27--30, 1999.}, 6879 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 6880 optvolume = {14}, 6881 optseries = {Lecture Notes in Computational Science and Engineering}, 6882 year = {2000}, 6883 publisher = {Springer}, 6884 address = {Berlin}, 6885 optpages = {179--184}, 6886 petsc_uses = {KSP} 6887} 6888 6889@Article{ bludszuwei98a, 6890 author = {Mark Bludszuweit}, 6891 journal = {Journal of Lightwave Technology}, 6892 year = {1998}, 6893 volume = {16}, 6894 number = {7}, 6895 pages = {1336--42}, 6896 title = {Mixed Finite Element Beam Propagation Method}, 6897 petsc_uses = {KSP} 6898} 6899 6900@Article{ gilli-pauletto-1998, 6901 author = {Manfred Gilli and Giorgio Pauletto}, 6902 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 6903 journal = {Computational Economics}, 6904 year = {2000}, 6905 volume = {16}, 6906 pages = {173--186}, 6907 petsc_uses = {KSP} 6908} 6909 6910% LiteralHTML: 6911% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 6912% LiteralHTML: 6913@Article{ collierdalcincalo2013, 6914 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 6915 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 6916 journal = {arxiv}, 6917 year = {2013}, 6918 number = {1305.4452}, 6919 note = {\url{http://arxiv.org/abs/1305.4452}}, 6920 petsc_uses = {KSP} 6921} 6922 6923@Article{ collierdalcinvignalcortescalo2016, 6924 title = {PetIGA: A framework for high-performance isogeometric analysis}, 6925 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 6926 Victor M. Calo}, 6927 journal = {Computer Methods in Applied Mechanics and Engineering}, 6928 year = {2016}, 6929 petsc_uses = {KSP} 6930} 6931 6932@Misc{ petiga-web-page, 6933 author = {N. Collier and L. Dalcin and V.M. Calo}, 6934 title = {{PetIGA} {W}eb page}, 6935 url = {https://bitbucket.org/dalcinl/petiga/}, 6936 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 6937 year = {2014}, 6938 petsc_uses = {KSP} 6939} 6940 6941@Article{ logg07, 6942 author = {Logg, Anders}, 6943 title = {Automating the Finite Element Method}, 6944 journal = {Archives of Computational Methods in Engineering}, 6945 volume = {14}, 6946 number = {2}, 6947 pages = {93-138}, 6948 year = {2007}, 6949 doi = {10.1007/s11831-007-9003-9}, 6950 publisher = {Kluwer Academic Publishers}, 6951 issn = {1134-3060}, 6952 language = {English}, 6953 petsc_uses = {KSP} 6954} 6955 6956@Article{ jezequelcouturierdenis12, 6957 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 6958 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 6959 versus the PETSc library}, 6960 journal = {The Journal of Supercomputing}, 6961 volume = {59}, 6962 number = {3}, 6963 pages = {1517-1532}, 6964 year = {2012}, 6965 issn = {0920-8542}, 6966 doi = {10.1007/s11227-011-0563-y}, 6967 publisher = {Springer US}, 6968 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 6969 Sparse linear solver}, 6970 language = {English}, 6971 petsc_uses = {KSP} 6972} 6973 6974@Unpublished{ feap-web-page, 6975 title = {FEAP: A Finite Element Analysis Program}, 6976 url = {http://www.ce.berkeley.edu/projects/feap/}, 6977 author = {FEAP Team}, 6978 note = {Uses PETSc linear solvers - iterative and direct}, 6979 petsc_uses = {KSP} 6980} 6981 6982@Unpublished{ parpre-web-page, 6983 title = {{ParPre} {W}eb {P}age}, 6984 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 6985 institution = {University of Tennessee}, 6986 author = {Victor Eijkhout}, 6987 note = {This is no longer supported. A set of preconditioners built on PETSc}, 6988 petsc_uses = {KSP} 6989} 6990 6991@Unpublished{ pism, 6992 title = {{PISM}: a Parallel Ice Sheet Model}, 6993 author = {{PISM Team}}, 6994 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 6995 Sheet Model). The thickness, temperature, velocity and age of the ice are all 6996 simulated, as is the deformation of the earth underneath the ice. New techniques 6997 for fast ice dynamics, earth deformation, and verification have are included.}, 6998 note = {\url{http://www.pism-docs.org/}}, 6999 petsc_uses = {KSP} 7000} 7001 7002@Unpublished{ oofem, 7003 title = {OOFEM - an object oriented finite element package}, 7004 author = {Borek Patzak}, 7005 url = {http://www.oofem.org}, 7006 petsc_uses = {KSP} 7007} 7008 7009@Unpublished{ dks2openfvm, 7010 title = {OpenFVM - a finite volume based general purpose CFD solver}, 7011 author = {Open source development}, 7012 url = {http://openfvm.sourceforge.net/}, 7013 petsc_uses = {KSP} 7014} 7015 7016@Unpublished{ sundar-2008w, 7017 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 7018 octree meshes}, 7019 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 7020 institution = {University of Pennsylvania}, 7021 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 7022 petsc_uses = {KSP} 7023} 7024 7025@Unpublished{ khatiwala07-software, 7026 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 7027 author = {Khatiwala, S.}, 7028 institution = {Columbia University}, 7029 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 7030 petsc_uses = {KSP} 7031} 7032 7033@InBook{ jiaolima99, 7034 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 7035 chapter = {SIFFEA:Scalable Integrated Framework for Finite Element Analysis}, 7036 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 7037 title = {Lecture Notes in Computer Science}, 7038 publisher = {Springer-Verlag}, 7039 volume = {1732}, 7040 year = {1999}, 7041 petsc_uses = {KSP} 7042} 7043 7044@Article{ crow1, 7045 author = {C. S. Crow IV}, 7046 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 7047 journal = {Hopkins Undergraduate Research Journal}, 7048 year = {2003}, 7049 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 7050 petsc_uses = {KSP} 7051} 7052 7053@Unpublished{ petsc-python, 7054 title = {PETSc for Python}, 7055 author = {L. Dalcin}, 7056 url = {https://petsc.org/main/petsc4py}, 7057 note = {Provides Python bindings for PETSc}, 7058} 7059 7060@Unpublished{ cfdship, 7061 title = {{CFDShip-Iowa}}, 7062 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 7063 institution = {University of Iowa}, 7064 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 7065 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 7066 structured grids, designed for ship applications}, 7067 petsc_uses = {KSP} 7068} 7069 7070@Unpublished{ bvw, 7071 title = {Multiflow}, 7072 author = {Berend van Wachem}, 7073 institution = {Mechanical Engineering - Chalmers University of Technology}, 7074 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 7075 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 7076 flows.}, 7077 petsc_uses = {KSP} 7078} 7079 7080@Unpublished{ dks2, 7081 title = {FENA - A Finite Element Model for the North Atlantic}, 7082 author = {Jens Schroeter}, 7083 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 7084 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 7085 petsc_uses = {KSP} 7086} 7087 7088@TechReport{ piwonski2010idea, 7089 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 7090 and Simulation in {3-D}}, 7091 author = {Piwonski, J. and Slawig, T.}, 7092 year = {2010}, 7093 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 7094 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 7095 petsc_uses = {KSP} 7096} 7097 7098@Unpublished{ metos3d-web, 7099 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 7100 author = {Piwonski, J. and Slawig, T.}, 7101 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 7102 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 7103 petsc_uses = {KSP} 7104} 7105 7106@Unpublished{ magpar, 7107 author = {W. Scholz}, 7108 title = {Magpar: Parallel Micromagnetics Code}, 7109 institution = {Vienna University of Technology}, 7110 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 7111 petsc_uses = {KSP} 7112} 7113 7114@Misc{ libmesh:sourceforge, 7115 author = {}, 7116 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 7117 equations on serial and parallel platforms}, 7118 note = {[Online]}, 7119 url = {http://libmesh.github.io}, 7120 petsc_uses = {KSP} 7121} 7122 7123@Misc{ moose-web-page, 7124 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 7125 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 7126 Gaston and John Peterson and Jason Miller}, 7127 institution = {Idaho National Laboratory}, 7128 howpublished = {\url{http://mooseframework.org}}, 7129 petsc_uses = {KSP} 7130} 7131 7132@Article{ gaston2009moose, 7133 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 7134 equations}, 7135 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 7136 journal = {Nuclear Engineering and Design}, 7137 volume = {239}, 7138 number = {10}, 7139 pages = {1768--1778}, 7140 year = {2009}, 7141 publisher = {Elsevier}, 7142 petsc_uses = {KSP} 7143} 7144 7145@Article{ tonks2012object, 7146 title = {An object-oriented finite element framework for multiphysics phase field 7147 simulations}, 7148 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 7149 journal = {Computational Materials Science}, 7150 volume = {51}, 7151 number = {1}, 7152 pages = {20--29}, 7153 year = {2012}, 7154 publisher = {Elsevier}, 7155 petsc_uses = {KSP} 7156} 7157 7158@Misc{ pylithmanual, 7159 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 7160 Strand and Charles Williams}, 7161 title = {{PyLith} User Manual Version 2.0.0}, 7162 year = {2014}, 7163 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 7164 petsc_uses = {KSP} 7165} 7166 7167@Misc{ pylith-web-page, 7168 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 7169 title = {{PyLith}}, 7170 year = {2012}, 7171 url = {http://geodynamics.org/resources/pylith/}, 7172 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 7173 petsc_uses = {KSP} 7174} 7175 7176@Misc{ galemanual, 7177 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 7178 title = {Gale User Manual Version 2.0.0}, 7179 year = {2011}, 7180 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 7181 petsc_uses = {KSP} 7182} 7183 7184@Unpublished{ underworld, 7185 author = {Louis Moresi}, 7186 title = {{UnderWorld}: A Geodynamics Modelling Code}, 7187 institution = {Monash University}, 7188 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 7189 petsc_uses = {KSP} 7190} 7191 7192@Article{ moresi2007computational, 7193 title = {Computational approaches to studying non-linear dynamics of the crust and 7194 mantle}, 7195 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 7196 M{\"u}hlhaus, H.B.}, 7197 journal = {Physics of the Earth and Planetary Interiors}, 7198 volume = {163}, 7199 number = {1-4}, 7200 pages = {69--82}, 7201 year = {2007}, 7202 publisher = {Elsevier}, 7203 petsc_uses = {KSP} 7204} 7205 7206@Article{ pitt2009chaste, 7207 title = {Chaste: a test-driven approach to software development for biological modelling}, 7208 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 7209 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 7210 and Walter, A. and others}, 7211 journal = {Computer Physics Communications}, 7212 volume = {180}, 7213 number = {12}, 7214 pages = {2452--2471}, 7215 year = {2009}, 7216 publisher = {Elsevier}, 7217 petsc_uses = {KSP} 7218} 7219 7220@Misc{ fenicsproject, 7221 title = {{The FEniCS project}}, 7222 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 7223 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 7224 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 7225 url = {http://fenicsproject.org}, 7226 year = {2011}, 7227 petsc_uses = {KSP} 7228} 7229 7230@Unpublished{ snark, 7231 title = {Snark: A suite of software for geoscientific applications and a philosophy of 7232 scientific software development}, 7233 institution = {Victorian Partnership for Advanced Computing}, 7234 url = {http://vpac.org/Snark}, 7235 petsc_uses = {KSP} 7236} 7237 7238@Misc{ imoose:sourceforge, 7239 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 7240 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 7241 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 7242 note = {[Online]}, 7243 url = {http://imoose.sourceforge.net}, 7244 petsc_uses = {KSP} 7245} 7246 7247@Unpublished{ fossi, 7248 author = {Stephan Frickenhaus}, 7249 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 7250 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 7251 codes}, 7252 institution = {AWI-Bremerhaven, Germanny}, 7253 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 7254 petsc_uses = {KSP} 7255} 7256 7257@Unpublished{ fun3dweb, 7258 author = {Dinesh Kaushik}, 7259 title = {PETSC-FUN3D Benchmark Page}, 7260 institution = {ODU/ANL}, 7261 url = {http://www.mcs.anl.gov/petsc-fun3d}, 7262 note = {CFD Benchmark of some solvers in PETSc}, 7263 petsc_uses = {KSP} 7264} 7265 7266@Unpublished{ scirun, 7267 author = {SCIRun Development Team}, 7268 title = {SCIRun}, 7269 institution = {University of Utah}, 7270 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 7271 note = {SCIRun now uses PETSc linear solvers}, 7272 petsc_uses = {KSP} 7273} 7274 7275@Misc{ prometheus, 7276 author = {Mark F. Adams}, 7277 title = {Prometheus - A scalable unstructured finite element solver}, 7278 institution = {Berkeley}, 7279 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 7280 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 7281 petsc_uses = {KSP} 7282} 7283 7284@Unpublished{ illuminator, 7285 author = {Adam C. Powell, IV}, 7286 title = {Illuminator Distributed Visualization Library}, 7287 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 7288 petsc_uses = {KSP} 7289} 7290 7291@Unpublished{ rheoplast, 7292 title = {RheoPlast Phase Field Multi-Physics Code}, 7293 author = {Adam Powell and David Dussault and Bo Zhou}, 7294 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 7295 petsc_uses = {KSP} 7296} 7297 7298@Misc{ tao-web-page, 7299 title = {{Toolkit for Advanced Optimization (TAO)} {W}eb Page}, 7300 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 7301 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 7302 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 7303 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 7304 petsc_uses = {KSP} 7305} 7306 7307@TechReport{ tao-user-ref, 7308 title = {{Toolkit for Advanced Optimization (TAO) users manual}}, 7309 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 7310 and Steve Benson and Lois Curfman McInnes}, 7311 institution = {Argonne National Laboratory}, 7312 year = {2019}, 7313 number = {ANL/MCS-TM-322 - Rev 3.12}, 7314 petsc_uses = {KSP} 7315} 7316 7317% url = "http://www.mcs.anl.gov/tao", 7318@Unpublished{ mefpp-web-page, 7319 title = {{MEF++} {W}eb {P}age}, 7320 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 7321 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 7322 author = {Eric Chamberland}, 7323 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 7324 multiphysics}, 7325 petsc_uses = {KSP} 7326} 7327 7328@Unpublished{ tipetsc-titanium, 7329 title = {Ti-PETSc - an interface to PETSc from Titanium}, 7330 institution = {Berkeley}, 7331 author = {He, Yun and Liblit, Bun and Lin, Chang}, 7332 url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, 7333 year = {1999}, 7334 petsc_uses = {KSP}, 7335} 7336 7337@Unpublished{ ptatin-web-page, 7338 title = {ptatin3d}, 7339 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 7340 url = {https://bitbucket.org/jedbrown/ptatin3d}, 7341 year = {2018}, 7342 petsc_uses = {KSP} 7343} 7344 7345@Misc{ multiphase-web-page, 7346 author = {Q. Zou}, 7347 title = {Multiphase flow with {PETSc}}, 7348 institution = {LANL}, 7349 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 7350 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 7351 lab = {LANL}, 7352 petsc_uses = {KSP} 7353} 7354 7355@Misc{ electromag-web-page, 7356 title = {{EMSolve Web} page}, 7357 institution = {LLNL}, 7358 howpublished = {http://www.llnl.gov/casc/emsolve}, 7359 url = {http://www.Llnl.gov/casc/emsolve}, 7360 author = {Daniel {White et al.}}, 7361 lab = {LLNL}, 7362 petsc_uses = {KSP} 7363} 7364 7365@Unpublished{ fe-software-web-page, 7366 institution = {Kuleuven}, 7367 title = {Finite element software}, 7368 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 7369 petsc_uses = {KSP} 7370} 7371 7372@Misc{ petsc-web-page, 7373 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 7374 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 7375 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 7376 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 7377 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 7378 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 7379 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 7380 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 7381 Zhang}, 7382 title = {{PETS}c {W}eb page}, 7383 url = {https://petsc.org/}, 7384 howpublished = {\url{https://petsc.org/}}, 7385 year = {2023} 7386} 7387 7388@Unpublished{ petsc-debian-package, 7389 author = {Adam C. Powell, IV}, 7390 title = {Debian package for PETSc}, 7391 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 7392 petsc_uses = {KSP} 7393} 7394 7395@Unpublished{ cactus, 7396 title = {Cactus Website}, 7397 url = {http://www.cactuscode.org/}, 7398 note = {Provides two interface to the PETSc solvers}, 7399 petsc_uses = {KSP} 7400} 7401 7402@Unpublished{ petsc-fem, 7403 author = {Mario Storti and Norberto Nigro}, 7404 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 7405 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 7406 url = {http://www.cimec.org.ar/petscfem}, 7407 petsc_uses = {KSP} 7408} 7409 7410@Misc{ fidap, 7411 title = {FIDAP 8.5}, 7412 howpublished = {\url{http://www.fluent.com}}, 7413 url = {http://www.fluent.com}, 7414 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 7415 solves.}, 7416 key = {FIDAP 8.5}, 7417 petsc_uses = {KSP} 7418} 7419 7420@Unpublished{ slepc, 7421 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 7422 Vicente Hern\'andez and Vicent Vidal}, 7423 title = {{SLEPc} Website}, 7424 url = {http://slepc.upv.es/}, 7425 note = {Scalable Library for Eigenvalue Problem Computations}, 7426 petsc_uses = {KSP} 7427} 7428 7429@TechReport{ slepc-users-manual, 7430 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 7431 Vicente Hern\'andez and Vicent Vidal}, 7432 title = {{SLEPc} Users Manual}, 7433 number = {DISC-II/24/02}, 7434 url = {http://slepc.upv.es/}, 7435 note = {Scalable Library for Eigenvalue Problem Computations}, 7436 petsc_uses = {KSP} 7437} 7438 7439@Misc{ deal.ii, 7440 title = {deal.II}, 7441 howpublished = {\url{http://www.dealii.org}}, 7442 url = {http://www.dealii.org}, 7443 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 7444 It allows PETSc linear algebra and solvers to be used underneath.}, 7445 key = {deal.II 5.0}, 7446 petsc_uses = {KSP} 7447} 7448 7449@Article{ bangerth2007deal, 7450 title = {{deal.II---A general-purpose object-oriented finite element library}}, 7451 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 7452 journal = {ACM Transactions on Mathematical Software (TOMS)}, 7453 volume = {33}, 7454 number = {4}, 7455 pages = {24--es}, 7456 issn = {0098-3500}, 7457 year = {2007}, 7458 publisher = {ACM}, 7459 petsc_uses = {KSP} 7460} 7461 7462@Misc{ globalarrays, 7463 author = {Jarek {Nieplocha et al.}}, 7464 title = {Global Arrays}, 7465 institution = {Pacific Northwest National Laboratories}, 7466 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 7467 url = {http://www.emsl.pnl.gov/docs/global}, 7468 note = {Global arrays can use PETSc linear solvers}, 7469 lab = {PNNL}, 7470 petsc_uses = {KSP} 7471} 7472 7473% LiteralHTML: 7474% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 7475% LiteralHTML: 7476@Article{ petsccommunity2022, 7477 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 7478 Community}, 7479 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 7480 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 7481 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 7482 and Hong Zhang and Junchao Zhang}, 7483 journal = {Computing in Science and Engineering}, 7484 volume = {24}, 7485 number = {03}, 7486 pages = {6--15}, 7487 issn = {1558-366X}, 7488 doi = {10.1109/MCSE.2022.3169974}, 7489 publisher = {IEEE Computer Society}, 7490 address = {Los Alamitos, CA, USA}, 7491 month = may, 7492 year = {2022}, 7493 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 7494 petsc_uses = {KSP} 7495} 7496 7497@Article{ brownknepleysmith14, 7498 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 7499 title = {Run-time extensibility and librarization of simulation software}, 7500 journal = {IEEE Computing in Science and Engineering}, 7501 month = jan, 7502 volume = {17}, 7503 number = {1}, 7504 pages = {38--45}, 7505 doi = {10.1109/MCSE.2014.95}, 7506 year = {2015}, 7507 petsc_uses = {KSP} 7508} 7509 7510@TechReport{ ass2012, 7511 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 7512 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 7513 institution = {Argonne National Laboratory}, 7514 type = {Preprint}, 7515 year = {2012}, 7516 number = {ANL/MCS-P2011-0112}, 7517 petsc_uses = {KSP} 7518} 7519 7520@TechReport{ clearyknepley99, 7521 author = {Andrew Cleary and Matthew G. Knepley}, 7522 title = {Solvers as Operators}, 7523 institution = {Lawrence Livermore National Laboratory}, 7524 type = {Technical Report}, 7525 number = {UCRL-ID-135342}, 7526 year = {1999}, 7527 petsc_uses = {KSP} 7528} 7529 7530@TechReport{ smcabbkz2012, 7531 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 7532 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 7533 title = {{PETSc's} software strategy for the design space of composable extreme-scale 7534 solvers}, 7535 institution = {Argonne National Laboratory}, 7536 type = {Preprint}, 7537 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 7538 year = {2012}, 7539 number = {ANL/MCS-P2059-0312}, 7540 petsc_uses = {KSP} 7541} 7542 7543@InProceedings{ mhwpmhs2009, 7544 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 7545 and G. E. Hammond and B. Smith}, 7546 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 7547 Toolkit {MPI} at Scale}, 7548 booktitle = {Cray Users Group Conference}, 7549 year = {2009}, 7550 petsc_uses = {KSP} 7551} 7552 7553@InProceedings{ msmhls2010, 7554 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 7555 Lichtner and B. F. Smith}, 7556 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 7557 {BlueGene} Architectures}, 7558 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 7559 year = {2010}, 7560 petsc_uses = {KSP} 7561} 7562 7563@InCollection{ msk2013, 7564 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 7565 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 7566 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7567 series = {Lecture Notes in Earth System Sciences}, 7568 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7569 Yaolin Shi}, 7570 doi = {10.1007/978-3-642-16405-7_7}, 7571 publisher = {Springer Berlin Heidelberg}, 7572 pages = {131--140}, 7573 year = {2013}, 7574 isbn = {978-3-642-16404-0}, 7575 petsc_uses = {KSP} 7576} 7577 7578@InCollection{ knepleyyuen13, 7579 author = {Matthew G. Knepley and David A. Yuen}, 7580 title = {Why Scientists and Engineers need {GPU}s today}, 7581 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7582 series = {Lecture Notes in Earth System Sciences}, 7583 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7584 Yaolin Shi}, 7585 doi = {10.1007/978-3-642-16405-7_1}, 7586 publisher = {Springer Berlin Heidelberg}, 7587 pages = {131--140}, 7588 year = {2013}, 7589 isbn = {978-3-642-16404-0}, 7590 petsc_uses = {KSP} 7591} 7592 7593@InCollection{ karpeevknepleybrune13, 7594 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 7595 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 7596 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7597 series = {Lecture Notes in Earth System Sciences}, 7598 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7599 Yaolin Shi}, 7600 doi = {10.1007/978-3-642-16405-7_30}, 7601 publisher = {Springer Berlin Heidelberg}, 7602 pages = {487--501}, 7603 year = {2013}, 7604 isbn = {978-3-642-16404-0}, 7605 petsc_uses = {KSP} 7606} 7607 7608@InCollection{ zhengetal13, 7609 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 7610 Variable Viscosity}, 7611 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 7612 Zhang and Yaolin Shi}, 7613 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 7614 series = {Lecture Notes in Earth System Sciences}, 7615 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 7616 Yaolin Shi}, 7617 doi = {10.1007/978-3-642-16405-7_21}, 7618 publisher = {Springer Berlin Heidelberg}, 7619 pages = {321--333}, 7620 year = {2013}, 7621 isbn = {978-3-642-16404-0}, 7622 petsc_uses = {KSP} 7623} 7624 7625@Article{ zhengetal13b, 7626 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 7627 strongly variable viscosity based on {M}atlab and {CUDA}}, 7628 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 7629 Zhang and Yaolin Shi}, 7630 journal = {IJHPCA}, 7631 volume = {28}, 7632 number = {1}, 7633 pages = {50--60}, 7634 doi = {10.1177/1094342013478640}, 7635 year = {2013}, 7636 petsc_uses = {KSP} 7637} 7638 7639@InBook{ s2011, 7640 author = {B. Smith}, 7641 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 7642 title = {Encyclopedia of Parallel Computing}, 7643 bookeditor = {D. Padua}, 7644 publisher = {Springer}, 7645 year = {2011}, 7646 petsc_uses = {KSP} 7647} 7648 7649@Article{ acostamejia06, 7650 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 7651 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 7652 journal = {Lecturas Matem\'aticas}, 7653 volume = {27}, 7654 year = {2006}, 7655 pages = {213--224}, 7656 petsc_uses = {KSP} 7657} 7658 7659@InProceedings{ quenettemoresisunterappelbe07, 7660 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 7661 title = {Explaining StGermain: An aspect oriented environment for building extensible 7662 computational mechanics modeling software}, 7663 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 7664 publisher = {IEEE}, 7665 pages = {1--8}, 7666 yerar = {2007}, 7667 petsc_uses = {KSP} 7668} 7669 7670@Article{ dfm1, 7671 title = {Vectorized sparse matrix multiply for compressed row storage format}, 7672 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 7673 journal = {Lecture Notes in Computer Science}, 7674 year = {2005}, 7675 pages = {99--106}, 7676 volume = {3514}, 7677 lab = {ORNL}, 7678 petsc_uses = {KSP} 7679} 7680 7681@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 7682 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 7683 Vandewalle and Stefaan Poedts}, 7684 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 7685 Scientific Computing Software}, 7686 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 7687 year = {2005}, 7688 note = {Lecture Notes in Computer Science}, 7689 volume = {3514}, 7690 publisher = {Springer-Verlag GmbH}, 7691 petsc_uses = {KSP} 7692} 7693 7694@InProceedings{ dalcin-paz-storti, 7695 author = {L. Dalcin and R. Paz and M. Storti}, 7696 title = {Desarrollo de Aplicaciones Paralelas en Python}, 7697 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 7698 Bariloche, Argentina}, 7699 year = {2004}, 7700 petsc_uses = {KSP} 7701} 7702 7703@Article{ mpi-python, 7704 author = {L. Dalcin and R. Paz and M. Storti}, 7705 title = {MPI for Python}, 7706 journal = {Journal of Parallel and Distributed Computing}, 7707 year = {2005}, 7708 petsc_uses = {KSP} 7709} 7710 7711@Unpublished{ hrv02a, 7712 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 7713 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7714 note = {Submited to VecPar 2002}, 7715 year = {2002}, 7716 petsc_uses = {KSP} 7717} 7718 7719@Article{ knyazev2007block, 7720 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 7721 {PETSc}}, 7722 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 7723 journal = {SIAM Journal on Scientific Computing}, 7724 volume = {29}, 7725 pages = {2224-2239}, 7726 doi = {10.1137/060661624}, 7727 year = {2007}, 7728 petsc_uses = {KSP} 7729} 7730 7731@MastersThesis{ aarrestad-master, 7732 author = {Asbjorn Hoiland Aarrestad}, 7733 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 7734 school = {University of Bergen}, 7735 month = aug, 7736 year = {2003}, 7737 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 7738 note = {Implemented Runge-Kutta methods using PETSc}, 7739 petsc_uses = {KSP} 7740} 7741 7742@PhDThesis{ kaushik-phd, 7743 author = {D. K. Kaushik}, 7744 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 7745 Differential Equations on Unstructured Grids}, 7746 school = {Old Dominion University}, 7747 month = dec, 7748 year = {2002}, 7749 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 7750 petsc_uses = {KSP} 7751} 7752 7753@TechReport{ rb1, 7754 author = {Rickard Bergstrom}, 7755 title = {Object Oriented Implementation of a General Finite Element Code}, 7756 number = {2002-13}, 7757 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 7758 year = {2002}, 7759 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 7760 note = {Discribes a finite element software package that uses PETSc for its solvers}, 7761 petsc_uses = {KSP} 7762} 7763 7764@InProceedings{ dbl1, 7765 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 7766 title = {A Parallel General Purpose Finite Element System}, 7767 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 7768 publisher = {SIAM}, 7769 year = {1999}, 7770 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 7771 note = {Describes software that uses PETSc for its parallel linear solves}, 7772 petsc_uses = {KSP} 7773} 7774 7775@Article{ p1, 7776 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 7777 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 7778 and B. Smith}, 7779 journal = {Parallel Computing}, 7780 year = {2002}, 7781 pages = {1811--1831}, 7782 volume = {28 (12)}, 7783 petsc_uses = {KSP} 7784} 7785 7786@Article{ automatic-ad, 7787 author = {Paul Hovland and Boyana Norris and Barry Smith}, 7788 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 7789 year = {2005}, 7790 journal = {Future Generation Computer Systems}, 7791 volume = {21}, 7792 number = {8}, 7793 pages = {1426--1438}, 7794 petsc_uses = {KSP} 7795} 7796 7797@TechReport{ remote-math, 7798 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 7799 Smith}, 7800 title = {Remote Access to Mathematical Software}, 7801 number = {ANL/MCS-P889-0601}, 7802 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 7803 month = jun, 7804 year = {2001}, 7805 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 7806 petsc_uses = {KSP} 7807} 7808 7809@InProceedings{ gropp98, 7810 author = {William D. Gropp}, 7811 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 7812 publisher = {SIAM}, 7813 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7814 Scientific and Engineering Computing}, 7815 year = {1999}, 7816 pages = {21-29}, 7817 petsc_uses = {KSP} 7818} 7819 7820@InProceedings{ knepleysarin99, 7821 author = {Matthew Knepley and Vivek Sarin}, 7822 title = {Algorithm Development for Large Scale Computing}, 7823 publisher = {SIAM}, 7824 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7825 Scientific and Engineering Computing}, 7826 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 7827 year = {1999}, 7828 petsc_uses = {KSP} 7829} 7830 7831@InBook{ bgms00, 7832 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 7833 chapter = {Software for the Scalable Solution of {PDEs}}, 7834 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 7835 title = {CRPC Handbook of Parallel Computing}, 7836 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 7837 and A. White}, 7838 publisher = {Morgan Kaufmann Publishers}, 7839 year = {2002}, 7840 petsc_uses = {KSP} 7841} 7842 7843@InProceedings{ hovland_norris_smith98, 7844 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 7845 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 7846 Computations}, 7847 publisher = {SIAM}, 7848 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7849 Scientific and Engineering Computing}, 7850 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 7851 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 7852 year = {1999}, 7853 pages = {129-137}, 7854 petsc_uses = {KSP} 7855} 7856 7857@InProceedings{ efficient, 7858 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 7859 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 7860 Libraries}, 7861 booktitle = {Modern Software Tools in Scientific Computing}, 7862 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 7863 publisher = {Birkhauser Press}, 7864 pages = {163--202}, 7865 year = {1997}, 7866 petsc_uses = {KSP} 7867} 7868 7869% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 7870@TechReport{ petsc-user-ref, 7871 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 7872 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 7873 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 7874 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 7875 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 7876 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 7877 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 7878 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 7879 Zhang}, 7880 title = {{PETSc/TAO} Users Manual}, 7881 institution = {Argonne National Laboratory}, 7882 number = {ANL-21/39 - Revision 3.20}, 7883 doi = {10.2172/1968587}, 7884 year = {2023} 7885} 7886 7887% url = {https://petsc.org/release} 7888@TechReport{ petsc-developers, 7889 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 7890 title = {{PETS}c Developers Guide}, 7891 institution = {Argonne National Laboratory}, 7892 number = {ANL-18/18}, 7893 year = {2018}, 7894 url = {https://petsc.org/release/developers}, 7895 petsc_uses = {KSP} 7896} 7897 7898@Unpublished{ alice-memory-snooper, 7899 author = {Ibrahima Ba and Barry~F. Smith}, 7900 title = {The {ALICE} Memory Snooper}, 7901 year = {1999}, 7902 petsc_uses = {KSP} 7903} 7904 7905@TechReport{ petsc-user-ref-polish, 7906 author = {Marcin Bojko and Piotr Krzyzanowski}, 7907 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 7908 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 7909 year = {1998}, 7910 note = {An introduction to PETSc in Polish}, 7911 petsc_uses = {KSP} 7912} 7913 7914@InProceedings{ abghmn00, 7915 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 7916 High-Performance Scientific Computing}, 7917 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 7918 Norris}, 7919 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 7920 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 7921 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 7922 Hasco\"{e}t and Uwe Naumann}, 7923 publisher = {Springer}, 7924 year = {2002}, 7925 petsc_uses = {KSP} 7926} 7927 7928@Unpublished{ petsc-mpi-paper, 7929 author = {Lois Curfman McInnes and Barry F. Smith}, 7930 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 7931 Libraries}, 7932 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 7933 month = jun, 7934 year = {1995}, 7935 petsc_uses = {KSP} 7936} 7937 7938@InProceedings{ miss-paper, 7939 author = {William D. Gropp and Barry F. Smith}, 7940 title = {Scalable, Extensible, and Portable Numerical Libraries}, 7941 publisher = {IEEE}, 7942 year = {1994}, 7943 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 7944 address = {Mississippi State University}, 7945 pages = {87--93}, 7946 keyword = {numerical libraries, scientific computing, parallel computing}, 7947 petsc_uses = {KSP} 7948} 7949 7950@InProceedings{ snes-paper, 7951 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 7952 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 7953 Minimization Problems}, 7954 publisher = {IEEE}, 7955 year = {1995}, 7956 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 7957 address = {Mississippi State University}, 7958 pages = {60-67}, 7959 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 7960 petsc_uses = {KSP} 7961} 7962 7963@Article{ dsneutral, 7964 author = {Barry F. Smith and William D. Gropp}, 7965 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 7966 Sparse Linear Systems}, 7967 journal = {Scientific Programming}, 7968 volume = {5}, 7969 pages = {329--336}, 7970 key = {GroppSmith96 ! KSP design}, 7971 year = {1996}, 7972 petsc_uses = {KSP} 7973} 7974 7975@InProceedings{ bgms98, 7976 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 7977 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 7978 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 7979 Scientific and Engineering Computing}, 7980 publisher = {SIAM}, 7981 pages = {58-67}, 7982 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 7983 year = {1998}, 7984 petsc_uses = {KSP} 7985} 7986 7987@Article{ hkm98, 7988 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 7989 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 7990 {PDE} Computation}, 7991 journal = {Advances in Engineering Software}, 7992 volume = {29}, 7993 pages = {415-424}, 7994 year = {1998}, 7995 petsc_uses = {KSP} 7996} 7997 7998@TechReport{ pdpta99, 7999 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 8000 Smith}, 8001 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 8002 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 8003 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 8004 Vegas, Nevada}, 8005 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8006 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 8007 number = {ANL/MCS-P751-0599}, 8008 year = {1999}, 8009 petsc_uses = {KSP} 8010} 8011 8012@InProceedings{ bbh:com, 8013 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 8014 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 8015 Computing}}, 8016 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 8017 Euro-Par Conference, Munich, Germany, August/September 2000}, 8018 year = {2000}, 8019 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 8020 volume = {1900}, 8021 series = {Lecture Notes in Computer Science}, 8022 pages = {86--94}, 8023 address = {Berlin}, 8024 publisher = {Springer}, 8025 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 8026 petsc_uses = {KSP} 8027} 8028 8029@InProceedings{ overture00, 8030 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8031 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 8032 Components}, 8033 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 8034 booktitle = {Proceedings of the International Federation for Information Processing Working 8035 Conference on Software Architectures for Scientific Computing, Kluwer}, 8036 year = {2000}, 8037 pages = {57--68}, 8038 petsc_uses = {KSP} 8039} 8040 8041@TechReport{ smith97, 8042 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 8043 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 8044 number = {ANL/MCS-P701}, 8045 author = {Barry F. Smith}, 8046 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8047 petsc_uses = {KSP} 8048} 8049 8050@Article{ smith98, 8051 author = {Barry Smith}, 8052 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 8053 journal = {SIGNUM Newsletter}, 8054 year = {1998}, 8055 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 8056 petsc_uses = {KSP} 8057} 8058 8059@TechReport{ ad-petsc-tm, 8060 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 8061 {PETSc}}, 8062 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 8063 year = {1997}, 8064 type = {Technical Memorandum}, 8065 institution = {ANL}, 8066 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 8067 number = {ANL/MCS-TM-233}, 8068 petsc_uses = {KSP} 8069} 8070 8071% LiteralHTML: 8072% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 8073% LiteralHTML: 8074@PhDThesis{ klotzthesis2019, 8075 author = {Thomas S. Klotz}, 8076 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 8077 Biology}, 8078 school = {Rice University}, 8079 year = {2019}, 8080 petsc_uses = {KSP} 8081} 8082 8083@Article{ klotzbardhanknepley2018, 8084 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 8085 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 8086 journal = {Communications in Applied Mathematics and Computational Science}, 8087 note = {In review}, 8088 url = {https://arxiv.org/abs/1708.06028}, 8089 year = {2018}, 8090 petsc_uses = {KSP} 8091} 8092 8093@Misc{ brown2016, 8094 title = {Threading Tradeoffs in Domain Decomposition}, 8095 author = {Jed Brown}, 8096 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 8097 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 8098 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 8099 year = {2016}, 8100 petsc_uses = {KSP} 8101} 8102 8103@Article{ changnakshatralaknepleyjohnsson2017, 8104 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 8105 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 8106 Johnsson}, 8107 journal = {Concurency: Practice and Experience}, 8108 volume = {30}, 8109 number = {11}, 8110 eprint = {1705.03625}, 8111 doi = {10.1002/cpe.4401}, 8112 year = {2017}, 8113 petsc_uses = {KSP} 8114} 8115 8116@Article{ changfabienknepleymills2018, 8117 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 8118 spectrum analysis}, 8119 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 8120 journal = {SIAM Journal on Scientific Computing}, 8121 volume = {40}, 8122 number = {6}, 8123 pages = {C779--C802}, 8124 eprint = {1802.07832}, 8125 doi = {10.1137/18M1172260}, 8126 year = {2018}, 8127 petsc_uses = {KSP} 8128} 8129 8130@Article{ joshaghanichangnakshatralaknepley2019, 8131 title = {Composable solvers for the four-field double porosity/permeability model}, 8132 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 8133 Knepley}, 8134 journal = {Journal of Computational Physics}, 8135 volume = {386}, 8136 pages = {428--466}, 8137 doi = {10.1016/j.jcp.2019.02.020}, 8138 year = {2019}, 8139 petsc_uses = {KSP} 8140} 8141 8142@InProceedings{ barralknepleylangepiggottgorman2016, 8143 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 8144 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 8145 and Gerard J. Gorman}, 8146 booktitle = {25th International Meshing Roundtable}, 8147 editor = {Steve Owen and Hang Si}, 8148 month = sep, 8149 address = {Washington, DC}, 8150 pages = {1--5}, 8151 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 8152 year = {2016}, 8153 petsc_uses = {KSP} 8154} 8155 8156@Article{ adamsbrownknepleysamtaney2016, 8157 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 8158 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 8159 journal = {SIAM Journal on Scientific Computing}, 8160 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 8161 epub = {http://arxiv.org/abs/1406.7808}, 8162 volume = {8}, 8163 number = {4}, 8164 pages = {C426--C440}, 8165 doi = {10.1137/140975127}, 8166 year = {2016}, 8167 petsc_uses = {KSP} 8168} 8169 8170@InProceedings{ maysananruppknepleysmith2016, 8171 title = {Extreme-Scale Multigrid Components within {PETSc}}, 8172 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 8173 Smith}, 8174 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 8175 series = {PASC '16}, 8176 isbn = {978-1-4503-4126-4}, 8177 location = {Lausanne, Switzerland}, 8178 pages = {5:1--5:12}, 8179 articleno = {5}, 8180 numpages = {12}, 8181 doi = {10.1145/2929908.2929913}, 8182 acmid = {2929913}, 8183 publisher = {ACM}, 8184 address = {New York, NY, USA}, 8185 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 8186 preconditioning}, 8187 year = {2016}, 8188 petsc_uses = {KSP} 8189} 8190 8191@Article{ liu2015field, 8192 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 8193 author = {Lulu Liu and David E Keyes}, 8194 journal = {SIAM Journal on Scientific Computing}, 8195 volume = {37}, 8196 number = {3}, 8197 pages = {A1388--A1409}, 8198 year = {2015}, 8199 publisher = {SIAM}, 8200 petsc_uses = {KSP} 8201} 8202 8203@Article{ lujiaomissirlis2014, 8204 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 8205 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 8206 journal = {Numerical Linear Algebra with Applications}, 8207 volume = {21}, 8208 number = {2}, 8209 pages = {221--238}, 8210 year = {2014}, 8211 publisher = {Wiley Online Library}, 8212 petsc_uses = {KSP} 8213} 8214 8215@Article{ badiamartinprincipe2013, 8216 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 8217 solid mechanics}, 8218 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 8219 journal = {International Journal for Numerical Methods in Engineering}, 8220 volume = {96}, 8221 number = {4}, 8222 pages = {203--230}, 8223 year = {2013}, 8224 petsc_uses = {KSP} 8225} 8226 8227@Article{ morganknepleysananscott2016, 8228 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 8229 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 8230 journal = {Concurrency and Computation: Practice and Experience}, 8231 volume = {28}, 8232 pages = {4532--4542}, 8233 year = {2016}, 8234 url = {http://arxiv.org/abs/1602.04873}, 8235 doi = {10.1002/cpe.3820}, 8236 petsc_uses = {KSP} 8237} 8238 8239@Article{ morgansananknepleymills2020, 8240 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 8241 solvers}, 8242 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 8243 journal = {The International Journal of High Performance Computing Applications}, 8244 volume = {35}, 8245 issue = {1}, 8246 doi = {10.1177/1094342020966835}, 8247 url = {https://doi.org/10.1177/1094342020966835}, 8248 eprint = {https://doi.org/10.1177/1094342020966835}, 8249 year = {2020}, 8250 petsc_uses = {KSP} 8251} 8252 8253@Article{ msz2013, 8254 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 8255 author = {M. McCourt and B. F. Smith and H. Zhang}, 8256 journal = {SIAM Journal on Matrix Analysis and Applications}, 8257 year = {2015}, 8258 note = {To appear}, 8259 petsc_uses = {KSP} 8260} 8261 8262@Article{ bassi2014agglomeration, 8263 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 8264 free}, 8265 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 8266 journal = {Mathematical Models and Methods in Applied Sciences}, 8267 volume = {24}, 8268 number = {08}, 8269 pages = {1495--1539}, 8270 year = {2014}, 8271 publisher = {World Scientific}, 8272 petsc_uses = {KSP} 8273} 8274 8275@Article{ jhuranidemkowicz12, 8276 author = {{Jhurani}, C. and {Demkowicz}, L.}, 8277 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 8278 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 8279 journal = {Computer Methods in Applied Mechanics and Engineering}, 8280 volume = {213}, 8281 pages = {418-426}, 8282 year = {2012}, 8283 month = mar, 8284 doi = {10.1016/j.cma.2011.06.003}, 8285 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 8286 petsc_uses = {KSP} 8287} 8288 8289@Article{ yangcai11, 8290 author = {Yang, Haijian and Cai, Xiao-Chuan}, 8291 title = {Parallel Two-Grid Semismooth Newton-Krylov-Schwarz Method for Nonlinear 8292 Complementarity Problems}, 8293 journal = {J. Sci. Comput.}, 8294 issue_date = {May 2011}, 8295 volume = {47}, 8296 number = {2}, 8297 month = may, 8298 pages = {258--280}, 8299 year = {2011}, 8300 issn = {0885-7474}, 8301 numpages = {23}, 8302 doi = {10.1007/s10915-010-9436-4}, 8303 acmid = {1971246}, 8304 publisher = {Plenum Press}, 8305 address = {New York, NY, USA}, 8306 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 8307 preconditioners, Semismooth Newton, Two-level methods}, 8308 petsc_uses = {KSP} 8309} 8310 8311@Article{ rheinbach09, 8312 author = {Rheinbach, Oliver}, 8313 title = {Parallel Iterative Substructuring in Structural Mechanics}, 8314 journal = {Archives of Computational Methods in Engineering}, 8315 volume = {16}, 8316 number = {4}, 8317 pages = {425-463}, 8318 year = {2009}, 8319 issn = {1134-3060}, 8320 doi = {10.1007/s11831-009-9035-4}, 8321 publisher = {Springer Netherlands}, 8322 language = {English}, 8323 petsc_uses = {KSP} 8324} 8325 8326@Article{ knepleyterrel2013, 8327 author = {Matthew G. Knepley and Andy R. Terrel}, 8328 title = {Finite Element Integration on {GPUs}}, 8329 journal = {{ACM} Transactions on Mathematical Software}, 8330 volume = {39}, 8331 number = {2}, 8332 accepted = {17 April 2012}, 8333 year = {2013}, 8334 abstract = {We present a novel finite element integration method for low order elements on 8335 GPUs. We achieve more than 100GF for element integration on first order 8336 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 8337 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 8338 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 8339 url = {http://arxiv.org/abs/1103.0066}, 8340 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 8341 petsc_uses = {KSP} 8342} 8343 8344@Article{ knepleyruppterrel2016, 8345 title = {Finite Element Integration with Quadrature on the GPU}, 8346 journal = {ArXiv e-prints}, 8347 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 8348 version = {1}, 8349 date = {2016-07-14}, 8350 eprinttype = {arxiv}, 8351 eprintclass = {cs.MS}, 8352 eprint = {1607.04245v1}, 8353 petsc_uses = {KSP} 8354} 8355 8356@Article{ klawonnlanserrheinbach2014, 8357 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 8358 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 8359 journal = {SIAM Journal on Scientific Computing}, 8360 volume = {36}, 8361 number = {2}, 8362 pages = {A737--A765}, 8363 year = {2014}, 8364 petsc_uses = {KSP} 8365} 8366 8367@TechReport{ pbmkbsxt2012, 8368 title = {Composing Scalable Nonlinear Algebraic Solvers}, 8369 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 8370 year = {2013}, 8371 type = {Preprint}, 8372 number = {ANL/MCS-P2010-0112}, 8373 institution = {Argonne National Laboratory}, 8374 petsc_uses = {KSP} 8375} 8376 8377@Article{ bruneknepleysmithtu15, 8378 title = {Composing Scalable Nonlinear Algebraic Solvers}, 8379 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 8380 journal = {SIAM Review}, 8381 volume = {57}, 8382 number = {4}, 8383 pages = {535--565}, 8384 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 8385 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 8386 doi = {10.1137/130936725}, 8387 year = {2015}, 8388 petsc_uses = {KSP} 8389} 8390 8391@Article{ mszm2014, 8392 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 8393 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 8394 volume = {40}, 8395 pages = {17--31}, 8396 year = {2014}, 8397 journal = {Parallel Computing}, 8398 doi = {10.1016/j.parco.2013.10.001}, 8399 petsc_uses = {KSP} 8400} 8401 8402@TechReport{ mszm2012, 8403 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 8404 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 8405 year = {2012}, 8406 number = {ANL/MCS-P2097-0512}, 8407 institution = {Argonne National Laboratory}, 8408 petsc_uses = {KSP} 8409} 8410 8411@InProceedings{ bkmms2012, 8412 author = {Jed Brown and Matthew G. Knepley and David A. May and Lois C. McInnes and Barry 8413 F. Smith}, 8414 title = {Composable linear solvers for multiphysics}, 8415 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 8416 Computing} ({ISPDC} 2012)}, 8417 year = {2012}, 8418 doi = {10.1109/ISPDC.2012.16}, 8419 publisher = {IEEE Computer Society}, 8420 pages = {55--62}, 8421 petsc_uses = {KSP} 8422} 8423 8424@Article{ bourdinbucuroudet2009, 8425 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 8426 title = {Optimal Partitions for Eigenvalues}, 8427 journal = {SIAM J. Sci. Comput.}, 8428 volume = {31}, 8429 number = {6}, 8430 pages = {4100--4114}, 8431 year = {2009}, 8432 petsc_uses = {KSP} 8433} 8434 8435@InBook{ kimnbourdin2007, 8436 author = {J.-H. Kimn and Blaise Bourdin}, 8437 title = {Numerical implementation of overlapping balancing domain decomposition methods on 8438 unstructured meshes}, 8439 editor = {O. B. Widlund and D. E. Keyes}, 8440 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 8441 series = {Lecture Notes in Computational Science and Engineering}, 8442 number = {55}, 8443 publisher = {Springer-Verlag}, 8444 pages = {309--315}, 8445 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 8446 year = {2007}, 8447 petsc_uses = {KSP} 8448} 8449 8450@Article{ bjm2005, 8451 author = {AH Baker and ER Jessup and T Manteuffel}, 8452 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 8453 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 8454 year = {2005}, 8455 petsc_uses = {KSP} 8456} 8457 8458@Unpublished{ sundar-2008a, 8459 author = {R.S. Sampath and G. Biros}, 8460 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 8461 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 8462 petsc_uses = {KSP} 8463} 8464 8465@Article{ sundar-2008, 8466 author = {H. Sundar and R.S. Sampath and G. Biros}, 8467 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 8468 journal = {SIAM Journal on Scientific Computing}, 8469 year = {2008}, 8470 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 8471 petsc_uses = {KSP} 8472} 8473 8474@InProceedings{ sundar-2007, 8475 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 8476 title = {Low-constant parallel algorithms for finite element simulations using linear 8477 octrees}, 8478 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 8479 year = {2007}, 8480 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 8481 petsc_uses = {KSP} 8482} 8483 8484@InProceedings{ adams-98a, 8485 author = {Adams, Mark ~F.}, 8486 title = {A Parallel Maximal Independent Set Algorithm}, 8487 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 8488 year = {1998}, 8489 petsc_uses = {KSP} 8490} 8491 8492@Article{ akcelik2005ddd, 8493 title = {{Dynamic data-driven inversion for terascale simulations: real-time 8494 identification of airborne contaminants}}, 8495 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 8496 van Bloemen Waanders, B.}, 8497 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 8498 year = {2005}, 8499 publisher = {IEEE Computer Society Washington, DC, USA}, 8500 petsc_uses = {KSP} 8501} 8502 8503@InBook{ akcelik-2006, 8504 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 8505 Bloemen Waanders}, 8506 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 8507 title = {Frontiers of Parallel Computing}, 8508 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 8509 publisher = {SIAM}, 8510 year = {2006}, 8511 petsc_uses = {KSP} 8512} 8513 8514@Article{ dt, 8515 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 8516 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 8517 Convection Diffusion Equations}, 8518 journal = {The Journal of Supercomputing}, 8519 year = {2004}, 8520 pages = {235--253}, 8521 volume = {28}, 8522 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 8523 petsc_uses = {KSP} 8524} 8525 8526@PhDThesis{ hwang2004, 8527 author = {Feng-Nan Hwang}, 8528 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 8529 Computational Fluid Dynamics}, 8530 school = {University of Colorado at Boulder}, 8531 year = {2004}, 8532 petsc_uses = {KSP} 8533} 8534 8535@PhDThesis{ baker, 8536 author = {{A. H.} Baker}, 8537 title = {On improving the performance of the linear solver restarted {GMRES}}, 8538 school = {University of Colorado at Boulder}, 8539 year = {2003}, 8540 petsc_uses = {KSP} 8541} 8542 8543@TechReport{ klawonnrheinbach601, 8544 author = {Axel Klawonn and Oliver Rheinbach}, 8545 title = {A Parallel Implementation of Dual-Primal FETI-DP Methods for Three Dimensional 8546 Linear Elasticity Using a Transformation of Basis}, 8547 institution = {Universit\"at Duisburg-Essen}, 8548 year = {2005}, 8549 type = {Technical Report}, 8550 number = {SM-E-601}, 8551 petsc_uses = {KSP} 8552} 8553 8554@TechReport{ klawonnrheinbach609, 8555 author = {Axel Klawonn and Oliver Rheinbach}, 8556 title = {Inexact FETI-DP Methods}, 8557 institution = {Universit\"at Duisburg-Essen}, 8558 year = {2005}, 8559 type = {Technical Report}, 8560 number = {SM-E-609}, 8561 petsc_uses = {KSP} 8562} 8563 8564@TechReport{ klawonnrheinbach607, 8565 author = {Axel Klawonn and Oliver Rheinbach}, 8566 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 8567 institution = {Universit\"at Duisburg-Essen}, 8568 year = {2005}, 8569 type = {Technical Report}, 8570 number = {SM-E-607}, 8571 petsc_uses = {KSP} 8572} 8573 8574@Article{ kul-natraj-pbp, 8575 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 8576 title = {Performance of a parallel mixed finite element implementation for fourth order 8577 clamped anisotropic plate bending problems in distributed memory environments}, 8578 journal = {Applied Mathematics and Computation}, 8579 volume = {155}, 8580 year = {2004}, 8581 number = {3}, 8582 pages = {753--777}, 8583 petsc_uses = {KSP} 8584} 8585 8586@Article{ bramkamp2006uej, 8587 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 8588 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 8589 journal = {Computers \& Fluids}, 8590 volume = {35}, 8591 number = {10}, 8592 pages = {1063--1073}, 8593 doi = {10.1016/j.compfluid.2005.10.003}, 8594 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 8595 derivation of the analytic flux Jacobian can become quite complicated depending on 8596 the complexity of the numerical flux calculation. Practically, the derivation of 8597 the exact Jacobian by hand is an unrealistic option because of the enormous 8598 man-hour investment needed. In this work, automatic differentiation is used to 8599 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 8600 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 8601 approximated by first-order forward differences. For a two-dimensional airfoil 8602 under three different flight conditions (quasi-incompressible flow, compressible 8603 subsonic flow, and transonic flow), we show that the robustness and performance of 8604 the present finite volume scheme is significantly improved by using exact 8605 Jacobians.}, 8606 year = {2006}, 8607 petsc_uses = {KSP} 8608} 8609 8610@Article{ shahbazi1, 8611 author = {Khosro Shahbazi}, 8612 title = {An explicit expression for the penalty parameter of the interior penalty method}, 8613 journal = {Journal of Computational Physics}, 8614 volume = {205}, 8615 year = {2005}, 8616 pages = {401--407}, 8617 petsc_uses = {KSP} 8618} 8619 8620@TechReport{ kk, 8621 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 8622 author = {Hans-Peter Kersken and Uwe Kuster}, 8623 year = {1999}, 8624 institution = {University of Stuttgart}, 8625 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 8626 number = {310}, 8627 petsc_uses = {KSP} 8628} 8629 8630@Article{ miha-mija, 8631 author = {M. D. Mihajlovi and S. Mijalkovi}, 8632 title = {A component decomposition preconditioning for 3D stress analysis problems}, 8633 journal = {Numerical Linear Algebra with Applications}, 8634 volume = {9}, 8635 year = {2002}, 8636 pages = {567--583}, 8637 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 8638 petsc_uses = {KSP} 8639} 8640 8641@Article{ bjm, 8642 author = {M Benzi and W Joubert and G Mateescu}, 8643 journal = {Electronic Transactions on Numerical Analysis}, 8644 year = {1999}, 8645 volume = {8}, 8646 pages = {88--114}, 8647 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 8648 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 8649 petsc_uses = {KSP} 8650} 8651 8652@PhDThesis{ hyde, 8653 author = {EMK Hyde}, 8654 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 8655 school = {Caltech}, 8656 year = {2003}, 8657 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 8658 petsc_uses = {KSP} 8659} 8660 8661@Article{ km2003, 8662 author = {A. Keese and H. G. Matthies}, 8663 journal = {Proceedings in Applied Mathematics and Mechanics}, 8664 year = {2003}, 8665 volume = {2}, 8666 pages = {485--486}, 8667 title = {Parallel Solution of Stochastic PDEs}, 8668 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 8669 petsc_uses = {KSP} 8670} 8671 8672@Article{ whszss, 8673 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 8674 and Otmar Scherzer and H. Siegfried Stiehl}, 8675 journal = {Real Time Imaging}, 8676 year = {2001}, 8677 volume = {7}, 8678 pages = {31--45}, 8679 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 8680 approaches}, 8681 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 8682 petsc_uses = {KSP} 8683} 8684 8685@TechReport{ baker1, 8686 title = {An Efficient Block Variant of GMRES}, 8687 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 8688 year = {2003}, 8689 type = {Technical Report}, 8690 institution = {University of Colorado, Boulder}, 8691 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 8692 number = {CU-CS-957-03}, 8693 petsc_uses = {KSP} 8694} 8695 8696@InProceedings{ mc2003, 8697 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 8698 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 8699 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8700 Methods}, 8701 pages = {639--646}, 8702 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8703 note = {}, 8704 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8705 year = {2003}, 8706 petsc_uses = {KSP} 8707} 8708 8709@InProceedings{ kt2003, 8710 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 8711 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 8712 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8713 Methods}, 8714 pages = {615--622}, 8715 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8716 note = {}, 8717 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8718 year = {2003}, 8719 petsc_uses = {KSP} 8720} 8721 8722@InProceedings{ krw2003, 8723 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 8724 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 8725 3D}, 8726 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8727 Methods}, 8728 pages = {361--368}, 8729 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8730 note = {}, 8731 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8732 year = {2003}, 8733 petsc_uses = {KSP} 8734} 8735 8736@InProceedings{ hc2003, 8737 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 8738 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 8739 Nonlinear Preconditioning}, 8740 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 8741 Methods}, 8742 pages = {201--208}, 8743 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 8744 note = {}, 8745 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 8746 year = {2003}, 8747 petsc_uses = {KSP} 8748} 8749 8750@InProceedings{ g2003, 8751 author = {P. Goldfeld}, 8752 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 8753 (Generalized) {Stokes} and Parallel Implementation}, 8754 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 8755 Methods}, 8756 pages = {209--216}, 8757 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 8758 publisher = {National Autonomous University of Mexico (UNAM)}, 8759 note = {}, 8760 url = {http://www.ddm.org/DD14}, 8761 year = {2003}, 8762 petsc_uses = {KSP} 8763} 8764 8765@InProceedings{ dhv2003, 8766 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 8767 title = {Toward scalable FETI algorithm for variational inequalities with applications to 8768 composites}, 8769 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 8770 Methods}, 8771 pages = {395--401}, 8772 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 8773 publisher = {National Autonomous University of Mexico (UNAM)}, 8774 note = {}, 8775 url = {http://www.ddm.org/DD14}, 8776 year = {2003}, 8777 petsc_uses = {KSP} 8778} 8779 8780@InProceedings{ dhsv2002, 8781 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 8782 title = {Scalabilities of FETI for variational inequalities and contact shape 8783 optimization}, 8784 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 8785 Methods}, 8786 pages = {359--367}, 8787 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 8788 publisher = {CIMNE, Barcelona, Spain}, 8789 note = {}, 8790 url = {http://www.ddm.org/DD13}, 8791 year = {2002}, 8792 petsc_uses = {KSP} 8793} 8794 8795@InProceedings{ cky2002, 8796 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 8797 title = {A Nonlinear Additive Schwarz Preconditioned Inexact Newton Method for Shocked 8798 Duct Flows}, 8799 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 8800 Methods}, 8801 pages = {343--350}, 8802 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 8803 publisher = {CIMNE, Barcelona, Spain}, 8804 note = {}, 8805 url = {http://www.ddm.org/DD13}, 8806 year = {2002}, 8807 petsc_uses = {KSP} 8808} 8809 8810@Conference{ li-etal:03, 8811 author = {Li, Z. and Lanteri S. and Saad, Y.}, 8812 title = {Multiplicative-additive preconditioning combination for general sparse linear 8813 systems}, 8814 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 8815 Matrix Problems in Scientific and Industrial Applications}, 8816 address = {Napa, California, USA}, 8817 date = {october 27-29}, 8818 year = {2003}, 8819 petsc_uses = {KSP} 8820} 8821 8822@Article{ bashir2008hessian, 8823 title = {Hessian-based model reduction for large-scale systems with initial-condition 8824 inputs}, 8825 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 8826 J.}, 8827 journal = {International journal for numerical methods in engineering}, 8828 volume = {73}, 8829 number = {6}, 8830 pages = {844--868}, 8831 year = {2008}, 8832 publisher = {Wiley Online Library}, 8833 petsc_uses = {KSP} 8834} 8835 8836@Article{ bashir2007hessian, 8837 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 8838 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 8839 K.}, 8840 journal = {Computational Science--ICCS 2007}, 8841 pages = {1010--1017}, 8842 year = {2007}, 8843 publisher = {Springer}, 8844 petsc_uses = {KSP} 8845} 8846 8847@Article{ akcelik2011fast, 8848 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 8849 inverse problems based on low-rank partial {H}essian approximations}, 8850 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 8851 Waanders, B. and Wilcox, L.}, 8852 journal = {SIAM Journal on Scientific Computing}, 8853 volume = {33}, 8854 number = {1}, 8855 year = {2011}, 8856 petsc_uses = {KSP} 8857} 8858 8859@InProceedings{ ff2003, 8860 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 8861 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 8862 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 8863 year = {2003}, 8864 petsc_uses = {KSP} 8865} 8866 8867@InProceedings{ d2b2004, 8868 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 8869 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 8870 Ordering Strategies}, 8871 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 8872 year = {2004}, 8873 petsc_uses = {KSP} 8874} 8875 8876@InProceedings{ d2v2005, 8877 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 8878 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 8879 Flow Equations}, 8880 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 8881 year = {2005}, 8882 petsc_uses = {KSP} 8883} 8884 8885@InProceedings{ dvs2006, 8886 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 8887 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 8888 Mixed Convection Equations}, 8889 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 8890 year = {2006}, 8891 petsc_uses = {KSP} 8892} 8893 8894@Article{ dsv2006, 8895 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 8896 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 8897 Flow Equations}, 8898 journal = {Computational Fluid Dynamics}, 8899 year = {2006}, 8900 volume = {15}, 8901 number = {1}, 8902 petsc_uses = {KSP} 8903} 8904 8905@Article{ lahaye03, 8906 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 8907 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 8908 journal = {J. Comput. Appl. Math.}, 8909 year = {2004}, 8910 pages = {267--275}, 8911 volume = {168}, 8912 petsc_uses = {KSP} 8913} 8914 8915@TechReport{ brmn, 8916 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 8917 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 8918 year = {2002}, 8919 type = {Technical Report}, 8920 institution = {ANL}, 8921 number = {ANL/MCS-P993-0902}, 8922 note = {To appear in Future Generation Computer Systems}, 8923 petsc_uses = {KSP} 8924} 8925 8926@InProceedings{ mnbr, 8927 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 8928 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 8929 Algorithms}, 8930 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 8931 Mechanics}, 8932 year = {2003}, 8933 petsc_uses = {KSP} 8934} 8935 8936@InProceedings{ bmnr, 8937 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 8938 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 8939 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 8940 Applications, Lecture notes in Computer Science 2677}, 8941 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 8942 pages = {828--839}, 8943 year = {2003}, 8944 petsc_uses = {KSP} 8945} 8946 8947@Article{ ph03, 8948 author = {M. Pernice and R. D. Hornung}, 8949 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 8950 journal = {Computing and Visualization in Science}, 8951 year = {2003}, 8952 lab = {LANL}, 8953 petsc_uses = {KSP} 8954} 8955 8956@Article{ adams-02, 8957 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 8958 journal = {J. Comp. Phys.}, 8959 number = {2}, 8960 pages = {593-610}, 8961 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 8962 volume = {188}, 8963 year = {2003}, 8964 petsc_uses = {KSP} 8965} 8966 8967@InProceedings{ adams2001distributed, 8968 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 8969 smoothers}, 8970 author = {Adams, M.F.}, 8971 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 8972 pages = {14--14}, 8973 year = {2001}, 8974 organization = {IEEE}, 8975 petsc_uses = {KSP} 8976} 8977 8978@PhDThesis{ els01, 8979 author = {Ulrich Elsner}, 8980 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 8981 algorithms}, 8982 school = {Technical University Chemnitz}, 8983 year = {2002}, 8984 publisher = {Logos Verlag, Berlin}, 8985 isbn = {3-89722-923-4}, 8986 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 8987 different graph partitioning algorithms}, 8988 petsc_uses = {KSP} 8989} 8990 8991@TechReport{ ckk02, 8992 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 8993 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 8994 year = {2002}, 8995 type = {Technical Report}, 8996 institution = {ODU}, 8997 url = {http://www.math.odu.edu/\~{ }keyes}, 8998 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 8999 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 9000 Methods}, 9001 petsc_uses = {KSP} 9002} 9003 9004@Article{ gpw2002, 9005 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 9006 Heterogeneous Problems in Linear Elasticity}, 9007 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 9008 year = {2003}, 9009 pages = {283--324}, 9010 volume = {95}, 9011 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 9012 journal = {Numerische Mathematik}, 9013 petsc_uses = {KSP} 9014} 9015 9016@Article{ dh1, 9017 title = {Scalability and FETI based algorithm for large discretized variational 9018 inequalities}, 9019 author = {Z Dostal and D Horak}, 9020 year = {2003}, 9021 pages = {347--357}, 9022 volume = {61}, 9023 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 9024 journal = {Mathematics and Computers in Simulation}, 9025 petsc_uses = {KSP} 9026} 9027 9028@InProceedings{ dhsv1, 9029 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9030 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 9031 title = {36 Scalabilities of FETI for Variational Inequalities and Contact Shape 9032 Optimization}, 9033 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9034 Methods}, 9035 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 9036 Kuznetsov}, 9037 petsc_uses = {KSP} 9038} 9039 9040@Article{ lahaye02, 9041 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 9042 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 9043 journal = {IEEEMAGN}, 9044 year = {2002}, 9045 volume = {38}, 9046 number = {2}, 9047 pages = {413-416}, 9048 petsc_uses = {KSP} 9049} 9050 9051@Article{ ckm01, 9052 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 9053 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 9054 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 9055 fluid dynamics}, 9056 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 9057 year = {2002}, 9058 volume = {40}, 9059 pages = {1463--1470}, 9060 petsc_uses = {KSP} 9061} 9062 9063@InProceedings{ cky01, 9064 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 9065 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 9066 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 9067 duct flow}, 9068 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9069 Methods}, 9070 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 9071 Kuznetsov}, 9072 year = {2002}, 9073 petsc_uses = {KSP} 9074} 9075 9076@Article{ ck02, 9077 author = {X.-C. Cai and D. E. Keyes}, 9078 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 9079 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 9080 journal = {SIAM J. Sci. Comput.}, 9081 year = {2002}, 9082 pages = {183--200}, 9083 volume = {24}, 9084 petsc_uses = {KSP} 9085} 9086 9087@Article{ c04, 9088 author = {Feng-Nan Hwang and X.-C. Cai}, 9089 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 9090 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 9091 for incompressible {Navier-Stokes} equations}, 9092 journal = {Journal of Computational Physics}, 9093 year = {2005}, 9094 volume = {204}, 9095 pages = {666--691}, 9096 petsc_uses = {KSP} 9097} 9098 9099@Article{ hc06, 9100 author = {Feng-Nan Hwang and X.-C. Cai}, 9101 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 9102 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 9103 Algorithms}, 9104 journal = {Computer Methods in Applied Mechanics and Engineering}, 9105 year = {2006}, 9106 volume = {196}, 9107 pages = {1603--1611}, 9108 petsc_uses = {KSP} 9109} 9110 9111@InProceedings{ adams-01, 9112 author = {Mark F. Adams}, 9113 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 9114 Smoothers}, 9115 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 9116 address = {Denver, Colorado}, 9117 month = nov, 9118 year = {2001}, 9119 petsc_uses = {KSP} 9120} 9121 9122@Book{ 1dl, 9123 author = {Domenico Lahaye}, 9124 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 9125 Computations}, 9126 year = {2001}, 9127 publisher = {Katholieke Universiteit Leuven}, 9128 notes = {Thesis}, 9129 petsc_uses = {KSP} 9130} 9131 9132@Article{ adams-00, 9133 author = {Adams, M.~F.}, 9134 journal = {International Journal for Numerical Methods in Engineering}, 9135 number = {8}, 9136 pages = {1241-1262}, 9137 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 9138 Deformation Elasticity and Plasticity}, 9139 volume = {48}, 9140 year = {2000}, 9141 petsc_uses = {KSP} 9142} 9143 9144@Article{ adams2002evaluation, 9145 author = {Adams, M.~F.}, 9146 journal = {International Journal for Numerical Methods in Engineering}, 9147 number = {1}, 9148 pages = {519-534}, 9149 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 9150 Problems in Solid Mechanics}, 9151 volume = {55}, 9152 year = {2002}, 9153 petsc_uses = {KSP} 9154} 9155 9156@Article{ lahaye00, 9157 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 9158 title = {Algebraic Multigrid for Complex Symmetric Systems}, 9159 journal = {IEEEMAGN}, 9160 year = {2000}, 9161 volume = {36}, 9162 number = {4}, 9163 pages = {1535--1538}, 9164 petsc_uses = {KSP} 9165} 9166 9167@InProceedings{ adams-99c, 9168 author = {Mark F. Adams and J. Demmel}, 9169 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 9170 Finite Element Problems}, 9171 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 9172 address = {Portland, Oregon}, 9173 month = nov, 9174 year = {1999}, 9175 petsc_uses = {KSP} 9176} 9177 9178@Article{ chan95, 9179 author = {T. Chan and B. Smith and J. Zou}, 9180 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 9181 Grids}, 9182 journal = {Numer. Math.}, 9183 year = {1995}, 9184 volume = {73}, 9185 pages = {149--167}, 9186 petsc_uses = {KSP} 9187} 9188 9189@TechReport{ adams-csd-98-993, 9190 pages = {11}, 9191 year = {1998}, 9192 type = {Technical Report}, 9193 number = {CSD-98-993}, 9194 institution = {University of California, Berkeley}, 9195 title = {A Parallel Maximal Independent Set Algorithm}, 9196 bibdate = {March 11, 1998}, 9197 author = {Mark F. Adams and James Demmel}, 9198 abstract = {The parallel construction of maximal independent sets is a useful building block 9199 for many algorithms in the computational sciences, including graph coloring and 9200 multigrid coarse grid creation on unstructured meshes. We present an efficient 9201 asynchronous maximal independent set algorithm for use on parallel computers, for 9202 ``well partitioned'' graphs, that arise from finite element (FE) models. For 9203 appropriately partitioned bounded degree graphs, it is shown that the running time 9204 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 9205 improvement over the previous best P-RAM complexity for this class of graphs. We 9206 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 9207 model is indicative of the performance one can expect with practical partitions on 9208 graphs from FE problems.}, 9209 month = mar, 9210 petsc_uses = {KSP} 9211} 9212 9213@TechReport{ k676, 9214 year = {1994}, 9215 type = {Technical Report}, 9216 number = {TR1994-676}, 9217 institution = {New York University}, 9218 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 9219 Term}, 9220 author = {Axel Klawonn}, 9221 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 9222 petsc_uses = {KSP} 9223} 9224 9225@Book{ ak1, 9226 author = {Axel Klawonn}, 9227 title = {Preconditioners for Indefinite Problems}, 9228 year = {1995}, 9229 publisher = {Westfalishen Wilhelms-Universitat Munster}, 9230 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 9231 notes = {Thesis}, 9232 petsc_uses = {KSP} 9233} 9234 9235@TechReport{ knepleykarpeev05, 9236 pages = {41}, 9237 year = {2005}, 9238 type = {Technical Report}, 9239 number = {ANL/MCS-P1295-1005}, 9240 institution = {Argonne National Laboratory}, 9241 title = {Flexible Representation of Computational Meshes}, 9242 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 9243 abstract = {}, 9244 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 9245 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 9246 month = oct, 9247 petsc_uses = {DMPlex} 9248} 9249 9250@TechReport{ knepleykarpeev07a, 9251 pages = {14}, 9252 year = {2007}, 9253 type = {Technical Report}, 9254 number = {ANL/MCS-P1455-0907}, 9255 institution = {Argonne National Laboratory}, 9256 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 9257 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 9258 abstract = {}, 9259 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 9260 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 9261 month = feb, 9262 petsc_uses = {DMPlex} 9263} 9264 9265@Article{ knepleykarpeev09, 9266 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 9267 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 9268 journal = {Scientific Programming}, 9269 volume = {17}, 9270 number = {3}, 9271 pages = {215--230}, 9272 year = {2009}, 9273 doi = {10.3233/SPR-2009-0249}, 9274 url = {http://arxiv.org/abs/0908.4427}, 9275 note = {\url{http://arxiv.org/abs/0908.4427}}, 9276 petsc_uses = {DMPlex} 9277} 9278 9279@Article{ biezuner2012computing, 9280 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 9281 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 9282 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 9283 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 9284 Sublinear Supersolutions}, 9285 journal = {Journal of Scientific Computing}, 9286 publisher = {Springer Netherlands}, 9287 issn = {0885-7474}, 9288 keyword = {Mathematics and Statistics}, 9289 pages = {180--201}, 9290 volume = {52}, 9291 issue = {1}, 9292 year = {2012}, 9293 doi = {10.1007/s10915-011-9540-0}, 9294 petsc_uses = {KSP} 9295} 9296 9297% LiteralHTML: 9298% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 9299% LiteralHTML: 9300@Book{ knepley2017, 9301 title = {Computational Science I}, 9302 author = {Matthew G. Knepley}, 9303 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 9304 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 9305 publisher = {PETSc}, 9306 year = {2017}, 9307 petsc_uses = {KSP} 9308} 9309 9310@Article{ verleyeuser, 9311 title = {{User friendly permeability predicting software for technical textiles}}, 9312 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 9313 Roose, D.}, 9314 journal = {status: published}, 9315 issn = {1560-6074}, 9316 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 9317 petsc_uses = {KSP} 9318} 9319 9320@Book{ pacheco, 9321 author = {Peter Pacheco}, 9322 title = {Parallel Programming with MPI}, 9323 year = {1997}, 9324 publisher = {Morgan-Kaufmann}, 9325 note = {Devotes a couple of sections to PETSc}, 9326 petsc_uses = {KSP} 9327} 9328 9329@Book{ 1sbg, 9330 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 9331 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 9332 Differential Equations}, 9333 year = {1996}, 9334 publisher = {Cambridge University Press}, 9335 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 9336 petsc_uses = {KSP} 9337} 9338 9339@Misc{ petsc-fem:homepage, 9340 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 9341 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 9342 G. Rodriguez and G. Filippini}, 9343 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 9344 petsc_uses = {KSP} 9345} 9346 9347@Misc{ petsc4py-web-page, 9348 author = {Lisandro Dalcin}, 9349 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 9350 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 9351 note = {http://code.google.com/p/petsc4py/}, 9352 petsc_uses = {KSP} 9353} 9354 9355@Article{ libmeshpaper06, 9356 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 9357 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 9358 Simulations}}, 9359 journal = {Engineering with Computers}, 9360 volume = {22}, 9361 number = {3--4}, 9362 pages = {237--254}, 9363 year = {2006}, 9364 doi = {10.1007/s00366-006-0049-3}, 9365 petsc_uses = {KSP} 9366} 9367 9368@Misc{ sisiphus:homepage, 9369 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 9370 High-Resolution, Unstructured Simulations}, 9371 author = {T. {Tautges et al.}}, 9372 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 9373 petsc_uses = {KSP} 9374} 9375 9376@Misc{ pflotran:homepage, 9377 title = {{PFLOTRAN} project}, 9378 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 9379 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 9380 howpublished = {\url{http://pflotran.org/}}, 9381 petsc_uses = {KSP} 9382} 9383 9384@Misc{ pism:homepage, 9385 title = {{PISM}: A Parallel Ice Sheet Model}, 9386 author = {E. {Bueler et al.}}, 9387 howpublished = {\url{http://pism-docs.org}}, 9388 petsc_uses = {KSP} 9389} 9390 9391@Misc{ dohp:homepage, 9392 title = {Dohp: Dual order $hp$-finite elements}, 9393 author = {J. Brown}, 9394 howpublished = {\url{http://dohp.org}}, 9395 petsc_uses = {KSP} 9396} 9397 9398@Article{ mccourtrognlienetal12, 9399 title = {Improving parallel scalability for edge plasma transport simulations with neutral 9400 gas species}, 9401 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 9402 journal = {Computational Science and Discovery}, 9403 year = {2012}, 9404 volume = {5}, 9405 number = {014012}, 9406 doi = {10.1088/1749-4699/5/1/014012}, 9407 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 9408 2011)}, 9409 petsc_uses = {KSP} 9410} 9411 9412@Misc{ petclaw-github, 9413 title = {Pet{C}law Software}, 9414 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 9415 year = {2011}, 9416 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 9417 petsc_uses = {KSP} 9418} 9419 9420@Misc{ pyclaw-web-page, 9421 author = {Kyle T. Mandli and David I. Ketcheson and others}, 9422 title = {{PyClaw} software}, 9423 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 9424 url = {http://clawpack.github.io/doc/pyclaw/}, 9425 year = {2012}, 9426 petsc_uses = {KSP} 9427} 9428 9429@Article{ ketcheson2011highorder, 9430 title = {High-order wave propagation algorithms for general hyperbolic systems}, 9431 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 9432 year = {2011}, 9433 note = {submitted}, 9434 petsc_uses = {KSP} 9435} 9436 9437@Article{ biros2005pln1, 9438 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 9439 optimization. Part I: The {Krylov-Schur} solver}}, 9440 author = {Biros, G. and Ghattas, O.}, 9441 journal = {SIAM Journal on Scientific Computing}, 9442 volume = {27}, 9443 number = {2}, 9444 pages = {687--713}, 9445 year = {2005}, 9446 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 9447 petsc_uses = {KSP} 9448} 9449 9450@Article{ biros2005pln2, 9451 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 9452 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 9453 optimal control of steady viscous flows}, 9454 author = {Biros, G. and Ghattas, O.}, 9455 journal = {SIAM Journal on Scientific Computing}, 9456 volume = {27}, 9457 number = {2}, 9458 pages = {714--739}, 9459 year = {2005}, 9460 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 9461 petsc_uses = {KSP} 9462} 9463 9464@Misc{ issm:homepage, 9465 title = {{I}ce {S}heet {S}ystem {M}odel}, 9466 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 9467 year = {2010}, 9468 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 9469 petsc_uses = {KSP} 9470} 9471 9472@Article{ morlighem2010spatial, 9473 title = {Spatial patterns of basal drag inferred using control methods from a 9474 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 9475 {A}ntarctica}, 9476 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 9477 Aubry, D.}, 9478 journal = {Geophysical Research Letters}, 9479 volume = {37}, 9480 number = {14}, 9481 pages = {L14502}, 9482 year = {2010}, 9483 publisher = {American Geophysical Union}, 9484 petsc_uses = {KSP} 9485} 9486 9487@Article{ jardin2012plasmas, 9488 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 9489 of tokamak plasmas}, 9490 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 9491 journal = {Computational Science \& Discovery}, 9492 volume = {5}, 9493 number = {1}, 9494 url = {http://stacks.iop.org/1749-4699/5/014002}, 9495 year = {2012}, 9496 petsc_uses = {KSP} 9497} 9498 9499@Article{ cmz2016, 9500 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 9501 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 9502 journal = {Journal of Scientific Computing}, 9503 publisher = {Springer}, 9504 pages = {803--825}, 9505 volume = {68}, 9506 issue = {2}, 9507 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 9508 doi = {10.1007/s10915-015-0159-4}, 9509 year = {2016}, 9510 note = {Also preprint ANL/MCS-P3039-0912}, 9511 petsc_uses = {KSP} 9512} 9513 9514@Article{ knepleybrownruppsmith13, 9515 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 9516 title = {Achieving High Performance with Unified Residual Evaluation}, 9517 journal = {ArXiv e-prints}, 9518 eprint = {1309.1204}, 9519 archiveprefix = {arXiv}, 9520 primaryclass = {cs.MS}, 9521 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 9522 Engineering, Finance, and Science}, 9523 year = {2013}, 9524 month = sep, 9525 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 9526 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 9527 petsc_uses = {KSP} 9528} 9529 9530@Book{ fenicsbook, 9531 title = {Automated Solution of Differential Equations by the Finite Element Method: The 9532 FEniCS Book}, 9533 series = {Lecture Notes in Computational Science and Engineering}, 9534 volume = {84}, 9535 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 9536 publisher = {Springer}, 9537 isbn = {978-3-642-23098-1}, 9538 year = {2012}, 9539 petsc_uses = {KSP} 9540} 9541 9542@Article{ demidovahnertruppgottschling12, 9543 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 9544 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 9545 journal = {ArXiv e-prints}, 9546 archiveprefix = {arXiv}, 9547 eprint = {1212.6326}, 9548 primaryclass = {cs.MS}, 9549 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 9550 Parallel, and Cluster Computing, Physics - Computational Physics}, 9551 year = {2012}, 9552 month = dec, 9553 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 9554 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 9555 petsc_uses = {KSP} 9556} 9557 9558@InProceedings{ viennacl, 9559 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 9560 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 9561 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 9562 year = {2010}, 9563 pages = {51-56}, 9564 petsc_uses = {KSP} 9565} 9566 9567@Article{ knepleybrownmcinnessmithruppadams2015, 9568 title = {Exascale Computing without Threads}, 9569 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 9570 Karl Rupp and Mark Adams}, 9571 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 9572 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 9573 Scientific Software Architecture for Portability and Performance}, 9574 doi = {10.6084/m9.figshare.5824950.v1}, 9575 year = {2015}, 9576 petsc_uses = {KSP} 9577} 9578 9579@Article{ knepleybrownmcinnessmithruppadams2015b, 9580 title = {Overview of the {PETSc} Library}, 9581 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 9582 Karl Rupp and Mark Adams}, 9583 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 9584 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 9585 Scientific Software Architecture for Portability and Performance}, 9586 year = {2015}, 9587 petsc_uses = {KSP} 9588} 9589 9590@InBook{ balaybrownknepleymcinnessmith2015, 9591 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 9592 Smith}, 9593 bookeditor = {J. Carver}, 9594 title = {Software Engineering for Science}, 9595 chapter = {Providing Mixed Language and Legacy Support within a Library}, 9596 publisher = {Taylor \& Francis}, 9597 year = {2015}, 9598 petsc_uses = {KSP} 9599} 9600 9601@Article{ ruppbalaybrownknepleymcinnessmith2015, 9602 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 9603 Software}, 9604 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 9605 McInnes and Barry F. Smith}, 9606 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 9607 Productivity Challenges}, 9608 journal = {ArXiv e-prints}, 9609 archiveprefix = {arXiv}, 9610 eprint = {1510.01122}, 9611 year = {2015}, 9612 petsc_uses = {KSP} 9613} 9614 9615@InProceedings{ knepley2013accurately, 9616 title = {Accurately Citing Software and Algorithms Used in Publications}, 9617 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 9618 F.}, 9619 year = {2013}, 9620 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 9621 (WSSSPE), held at SC13}, 9622 doi = {10.6084/m9.figshare.785731}, 9623 petsc_uses = {KSP} 9624} 9625 9626@InProceedings{ milleretal2013, 9627 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 9628 Strategies Developed for {FASTMath}}, 9629 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 9630 Barry Smith}, 9631 year = {2013}, 9632 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 9633 (WSSSPE), held at SC13}, 9634 doi = {10.6084/m9.figshare.789055}, 9635 petsc_uses = {KSP} 9636} 9637 9638@TechReport{ dudsonetal2012, 9639 title = {Improved Nonlinear Solvers in {BOUT++}}, 9640 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 9641 institution = {Argonne National Laboratory}, 9642 number = {ANL/MCS-P3025-0812}, 9643 year = {2012}, 9644 petsc_uses = {KSP} 9645} 9646 9647@Misc{ brown13, 9648 author = {J. Brown}, 9649 title = {Scalable Repository Workflows}, 9650 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 9651 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 9652 year = {2013}, 9653 petsc_uses = {KSP} 9654} 9655 9656@Misc{ starforest11, 9657 title = {Star forests as a parallel communication model}, 9658 author = {Jed Brown}, 9659 url = {https://jedbrown.org/files/StarForest.pdf}, 9660 year = {2011}, 9661 petsc_uses = {KSP} 9662} 9663 9664@Misc{ brownknepleysmith13, 9665 author = {J. Brown and M. Knepley and B. Smith}, 9666 title = {Run-time Extensibility: Anything Less is Unsustainable}, 9667 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 9668 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 9669 year = {2013}, 9670 petsc_uses = {KSP} 9671} 9672 9673@Article{ jzhaoyliwkliu15, 9674 author = {J. Zhao and Y. Li and W.K. Liu}, 9675 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 9676 via {XFEM}}, 9677 journal = {Computational Mechanics}, 9678 year = {2015}, 9679 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 9680 petsc_uses = {KSP} 9681} 9682 9683@Article{ alisic14, 9684 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 9685 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 9686 journal = {J. Geophys. Res.}, 9687 year = {2014}, 9688 volume = {119}, 9689 number = {7}, 9690 pages = {5903-5920}, 9691 doi = {10.1002/2013JB010906}, 9692 petsc_uses = {KSP} 9693} 9694 9695@Article{ rhebergen14, 9696 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 9697 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 9698 journal = {SIAM J. Sci. Comp.}, 9699 year = {2014}, 9700 volume = {36}, 9701 number = {4}, 9702 pages = {1960-1977}, 9703 doi = {10.1137/130946678}, 9704 petsc_uses = {KSP} 9705} 9706 9707@Article{ allwright14, 9708 author = {J. Allwright and R.F. Katz}, 9709 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 9710 journal = {Geophys. J. Int.}, 9711 year = {2014}, 9712 volume = {199}, 9713 number = {3}, 9714 pages = {1608--1624}, 9715 doi = {10.1093/gji/ggu345}, 9716 petsc_uses = {KSP} 9717} 9718 9719@Misc{ gropp10, 9720 author = {William D. Gropp}, 9721 title = {Update on libraries for {B}lue {W}aters}, 9722 address = {Bordeaux, France}, 9723 year = {2010}, 9724 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 9725 petsc_uses = {KSP} 9726} 9727 9728@Article{ ssm2016, 9729 author = {P. Sanan and S.M. Schnepp and D.A. May}, 9730 title = {Pipelined, Flexible {Krylov} Subspace Methods}, 9731 journal = {SIAM Journal on Scientific Computing}, 9732 volume = {38}, 9733 number = {5}, 9734 pages = {C441-C470}, 9735 year = {2016}, 9736 doi = {10.1137/15M1049130}, 9737 petsc_uses = {KSP} 9738} 9739 9740@InProceedings{ mayknepley2017, 9741 title = {{DMSwarm}: Particles in {PETSc}}, 9742 author = {Dave A May and Matthew G Knepley}, 9743 booktitle = {EGU General Assembly Conference Abstracts}, 9744 volume = {19}, 9745 pages = {10133}, 9746 year = {2017}, 9747 petsc_uses = {KSP} 9748} 9749 9750@InProceedings{ adamsbrownknepley2013, 9751 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 9752 title = {Low-communication techniques for extreme-scale multilevel solvers}, 9753 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 9754 organization = {DOE Office of Advanced Scientific Computing Research}, 9755 year = {2013}, 9756 petsc_uses = {KSP} 9757} 9758 9759@Article{ bhallagriffithknepleyadamsguy2017, 9760 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 9761 boundary equations}, 9762 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 9763 Adams and Robert D. Guy}, 9764 journal = {Advances in Computational Mathematics}, 9765 eprint = {1612.02208}, 9766 note = {In review}, 9767 year = {2017}, 9768 petsc_uses = {KSP} 9769} 9770 9771@Article{ zampini2016pcbddc, 9772 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 9773 author = {Zampini, Stefano}, 9774 journal = {SIAM Journal on Scientific Computing}, 9775 volume = {38}, 9776 number = {5}, 9777 pages = {S282--S306}, 9778 year = {2016}, 9779 publisher = {SIAM}, 9780 petsc_uses = {KSP} 9781} 9782 9783@Article{ jolivetromanzampini2020, 9784 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 9785 robust multilevel overlapping {Schwarz} preconditioners}, 9786 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 9787 journal = {Computers and Mathematics with Applications}, 9788 volume = {84}, 9789 pages = {277--295}, 9790 year = {2020} 9791} 9792 9793@Article{ zampinitu2017, 9794 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 9795 porous media}, 9796 author = {Stefano Zampini and Xuemin Tu}, 9797 journal = {SIAM Journal of Scientific Computing}, 9798 volume = {39}, 9799 number = {4}, 9800 pages = {A1389--A1415}, 9801 year = {2017} 9802} 9803 9804@Article{ ohwidlundzampinidohrmann2017, 9805 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 9806 constraints for {Raviart-Thomas} vector fields}, 9807 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 9808 journal = {Mathematics of Computation}, 9809 volume = {87}, 9810 number = {310}, 9811 pages = {659--692}, 9812 year = {2017} 9813} 9814 9815@Article{ veigapavarinoscacchiwidlundzampini2016, 9816 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 9817 preconditioners}, 9818 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 9819 Stefano Zampini}, 9820 journal = {SIAM Journal of Scientific Computing}, 9821 volume = {39}, 9822 number = {1}, 9823 pages = {A281--A302}, 9824 year = {2016} 9825} 9826 9827@Article{ pavarinoscacchiwidlundzampini2018, 9828 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 9829 analysis}, 9830 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 9831 journal = {Mathematical Models and Methods in Applied Sciences}, 9832 volume = {28}, 9833 number = {7}, 9834 pages = {1337--1370}, 9835 year = {2018} 9836} 9837 9838@Article{ bergervergiatwaisman2017, 9839 title = {An overlapping Domain Decomposition preconditioning method for monolithic 9840 solution of shear bands}, 9841 author = {Luc Berger-Vergiat and Haim Waisman}, 9842 journal = {Computer Methods in Applied Mechanics and Engineering}, 9843 volume = {318}, 9844 pages = {33--60}, 9845 year = {2017}, 9846 petsc_uses = {KSP} 9847} 9848 9849@Article{ abhyankarmaldonadosmithzhang2020, 9850 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 9851 Simulations}, 9852 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 9853 H. Zhang}, 9854 journal = {ACM Transactions on Mathematical Software}, 9855 volume = {46}, 9856 number = {1}, 9857 year = {2020}, 9858 doi = {10.1145/3344587}, 9859 petsc_uses = {KSP} 9860} 9861 9862@InProceedings{ zhangellpack2018, 9863 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 9864 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 9865 {AVX-512}}, 9866 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 9867 year = {2018}, 9868 petsc_uses = {KSP} 9869} 9870 9871@Misc{ petsc-user-meetings:website, 9872 title = {{PETSc User Meetings}}, 9873 key = {PETSc User Meetings}, 9874 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 9875 petsc_uses = {KSP} 9876} 9877 9878@Article{ flexible-bicgstab-chen16, 9879 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 9880 author = {J. Chen and L.C. McInnes and H. Zhang}, 9881 journal = {Journal of Scientific Computing}, 9882 volume = {68}, 9883 number = {2}, 9884 month = jul, 9885 year = {2016}, 9886 pages = {803--825}, 9887 doi = {10.1007/s10915-015-0159-4}, 9888 petsc_uses = {KSP} 9889} 9890 9891@Misc{ petsc-extensibility2016, 9892 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 9893 title = {{Extensibility in PETSc}}, 9894 note = {SIAM News, available via 9895 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 9896 year = {2016}, 9897 petsc_uses = {KSP} 9898} 9899 9900@Misc{ error-estimation-whitepaper2017, 9901 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 9902 title = {End-to-end error estimation and control}, 9903 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 9904 doi = {10.6084/m9.figshare.5339866}, 9905 year = {2017}, 9906 petsc_uses = {KSP} 9907} 9908 9909@Misc{ petsc-user-support15, 9910 title = {On the Evolution of User Support Topics in Computational Science and Engineering 9911 Software}, 9912 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 9913 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 9914 15-16, 2015}, 9915 year = {2015}, 9916 petsc_uses = {KSP} 9917} 9918 9919@InBook{ petsc-mixed-language-support2016, 9920 title = {Numerical Library Support for High-Performance Mixed Language Applications and 9921 Legacy Code}, 9922 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 9923 booktitle = {Software Engineering for Science}, 9924 editors = {J. Carver et al.}, 9925 publisher = {CRC Press}, 9926 pages = {201--214}, 9927 year = {2016}, 9928 petsc_uses = {KSP} 9929} 9930 9931@InProceedings{ konolige2018parallel, 9932 title = {A Parallel Solver for Graph {L}aplacians}, 9933 author = {Tristan Konolige and Jed Brown}, 9934 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 9935 doi = {10.1145/3218176.3218227}, 9936 note = {Best Paper Award}, 9937 archiveprefix = {arXiv}, 9938 eprint = {1705.06266}, 9939 year = {2018}, 9940 petsc_uses = {KSP} 9941} 9942 9943@InProceedings{ werner-kimn2019, 9944 title = {Parallel implementation of AC optimal power flow and time-constrained optimal 9945 power flow using high-performance computing}, 9946 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 9947 Jung-Han Kimn}, 9948 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 9949 note = {Best Paper in Track}, 9950 year = {2019}, 9951 petsc_uses = {KSP} 9952} 9953 9954@MastersThesis{ rinaldo-ceresoli18, 9955 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 9956 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 9957 Applications}, 9958 school = {Politecnico di Milano}, 9959 year = {2018}, 9960 month = apr, 9961 petsc_uses = {KSP} 9962} 9963 9964@Article{ sananschneppmay2016, 9965 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 9966 author = {P. Sanan and S. M. Schnepp and D. A. May}, 9967 journal = {SIAM Journal on Scientific Computing}, 9968 volume = {38}, 9969 number = {5}, 9970 pages = {C441-C470}, 9971 year = {2016}, 9972 doi = {10.1137/15M1049130}, 9973 petsc_uses = {KSP} 9974} 9975 9976@Article{ petscsf2022, 9977 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 9978 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 9979 Smith, Barry F. and Zampini, Stefano}, 9980 journal = {IEEE Transactions on Parallel and Distributed Systems}, 9981 title = {The {PetscSF} Scalable Communication Layer}, 9982 year = {2022}, 9983 volume = {33}, 9984 number = {4}, 9985 pages = {842-853}, 9986 doi = {10.1109/TPDS.2021.3084070} 9987} 9988 9989@Article{ brandt2000, 9990 title = {General highly accurate algebraic coarsening}, 9991 author = {Achi Brandt}, 9992 journal = {Electronic Transactions on Numerical Analysis}, 9993 volume = {10}, 9994 number = {9680}, 9995 pages = {1--20}, 9996 issn = {10689613}, 9997 year = {2000} 9998} 9999 10000@Article{ dalcinpazklercosimo2011, 10001 title = {Parallel distributed computing using Python}, 10002 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 10003 journal = {Advances in Water Resources}, 10004 volume = {34}, 10005 number = {9}, 10006 pages = {1124 - 1139}, 10007 note = {New Computational Methods and Software Tools}, 10008 issn = {0309-1708}, 10009 doi = {10.1016/j.advwatres.2011.04.013}, 10010 year = {2011} 10011} 10012 10013@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 10014 title = {Cython: The Best of Both Worlds}, 10015 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 10016 Seljebotn,Dag Sverre and Smith,Kurt }, 10017 journal = {Computing in Science \& Engineering}, 10018 volume = {13}, 10019 number = {2}, 10020 pages = {31-39}, 10021 doi = {10.1109/MCSE.2010.118}, 10022 year = {2011} 10023} 10024 10025@Article{ dalcinpazstorti2005, 10026 title = {MPI for Python}, 10027 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 10028 journal = {Journal of Parallel and Distributed Computing}, 10029 volume = {65}, 10030 number = {9}, 10031 pages = {1108 - 1115}, 10032 issn = {0743-7315}, 10033 doi = {10.1016/j.jpdc.2005.03.010}, 10034 year = {2005} 10035} 10036 10037@Article{ dalcincolliervignalcortescalo2016, 10038 title = {PetIGA: A framework for high-performance isogeometric analysis}, 10039 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 10040 Calo}, 10041 journal = {Computer Methods in Applied Mechanics and Engineering}, 10042 volume = {308}, 10043 pages = {151 - 181}, 10044 issn = {0045-7825}, 10045 doi = {10.1016/j.cma.2016.05.011}, 10046 year = {2016} 10047} 10048 10049@Article{ collierpardodalcinpaszynskicalo2012, 10050 title = {The cost of continuity: A study of the performance of isogeometric finite 10051 elements using direct solvers}, 10052 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 10053 Calo}, 10054 journal = {Computer Methods in Applied Mechanics and Engineering}, 10055 volume = {213-216}, 10056 pages = {353 - 361}, 10057 issn = {0045-7825}, 10058 doi = {10.1016/j.cma.2011.11.002}, 10059 year = {2012} 10060} 10061 10062@Article{ collierdalcinpardocalo2013, 10063 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 10064 Elements}, 10065 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 10066 journal = {SIAM Journal on Scientific Computing}, 10067 volume = {35}, 10068 number = {2}, 10069 pages = {A767-A784}, 10070 doi = {10.1137/120881038}, 10071 year = {2013} 10072} 10073 10074@Article{ dunning2017jump, 10075 title = {{JuMP}: a modeling language for mathematical optimization}, 10076 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 10077 journal = {SIAM Review}, 10078 volume = {59}, 10079 number = {2}, 10080 pages = {295--320}, 10081 year = {2017}, 10082 publisher = {SIAM} 10083} 10084 10085@InProceedings{ prudencioschulz2011, 10086 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 10087 Estimation, Simulation and Optimization}, 10088 author = {Ernesto E Prudencio and Karl W Schulz}, 10089 booktitle = {European Conference on Parallel Processing}, 10090 pages = {398--407}, 10091 year = {2011} 10092} 10093 10094@Misc{ rol-website, 10095 key = {ROL}, 10096 title = {{Rapid Optimization Library} Website}, 10097 howpublished = {\url{https://trilinos.org/packages/rol}}, 10098 year = {2018} 10099} 10100 10101@Article{ more1994line, 10102 title = {Line search algorithms with guaranteed sufficient decrease}, 10103 author = {Mor{\'e}, Jorge J and Thuente, David J}, 10104 journal = {ACM Transactions on Mathematical Software}, 10105 volume = {20}, 10106 number = {3}, 10107 pages = {286--307}, 10108 year = {1994}, 10109 publisher = {ACM} 10110} 10111 10112@Article{ griewank2000algorithm, 10113 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 10114 adjoint mode of computational differentiation}, 10115 author = {Griewank, Andreas and Walther, Andrea}, 10116 journal = {ACM Transactions on Mathematical Software}, 10117 volume = {26}, 10118 number = {1}, 10119 pages = {19--45}, 10120 year = {2000}, 10121 publisher = {ACM} 10122} 10123 10124@Article{ metcalf2011seven, 10125 title = {The seven ages of fortran}, 10126 author = {Metcalf, Michael}, 10127 journal = {Journal of Computer Science \& Technology}, 10128 volume = {11}, 10129 year = {2011} 10130} 10131 10132@Article{ giraldo_2013, 10133 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 10134 model of the atmosphere {(NUMA)}}, 10135 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 10136 journal = {SIAM Journal on Scientific Computing}, 10137 year = {2013}, 10138 number = {5}, 10139 pages = {B1162-B1194}, 10140 volume = {35}, 10141 doi = {10.1137/120876034} 10142} 10143 10144@Article{ constantinescu_tr2016b, 10145 author = {Constantinescu, E.M.}, 10146 title = {Estimating Global Errors in Time Stepping}, 10147 journal = {ArXiv e-prints}, 10148 archiveprefix = {arXiv}, 10149 eprint = {1503.05166}, 10150 primaryclass = {math.NA}, 10151 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 10152 year = {2016}, 10153 month = mar, 10154 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 10155 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 10156} 10157 10158@Article{ pareschi_2005, 10159 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 10160 with Relaxation}, 10161 author = {L. Pareschi and G. Russo}, 10162 journal = {Journal of Scientific Computing}, 10163 year = {2005}, 10164 number = {1}, 10165 pages = {129--155}, 10166 volume = {25} 10167} 10168 10169@Article{ kennedy_2003, 10170 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 10171 author = {C.A. Kennedy and M.H. Carpenter}, 10172 journal = {Appl. Numer. Math.}, 10173 year = {2003}, 10174 number = {1-2}, 10175 pages = {139--181}, 10176 volume = {44}, 10177 doi = {10.1016/S0168-9274(02)00138-1}, 10178 publisher = {Elsevier Science Publishers B. V.} 10179} 10180 10181@Unpublished{ boscarino_tr2011, 10182 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 10183 equations in the diffusion limit}, 10184 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 10185 note = {Arxiv preprint arXiv:1110.4375}, 10186 year = {2011} 10187} 10188 10189@Article{ ascher_1997, 10190 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 10191 equations}, 10192 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 10193 journal = {Applied Numerical Mathematics}, 10194 year = {1997}, 10195 pages = {151--167}, 10196 volume = {25} 10197} 10198 10199@Book{ ascherpetzold1998, 10200 title = {Computer methods for ordinary differential equations and differential-algebraic 10201 equations}, 10202 author = {Uri M Ascher and Linda R Petzold}, 10203 volume = {61}, 10204 publisher = {SIAM}, 10205 year = {1998} 10206} 10207 10208@Article{ colomesbadia2016, 10209 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 10210 equations}, 10211 author = {Oriol Colom{\'e}s and Santiago Badia}, 10212 journal = {International Journal for Numerical Methods in Engineering}, 10213 volume = {105}, 10214 number = {5}, 10215 pages = {372--400}, 10216 year = {2016} 10217} 10218 10219@Article{ sandu_1997, 10220 title = {Benchmarking stiff ode solvers for atmospheric chemistry problems {II}: 10221 {R}osenbrock solvers}, 10222 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 10223 Potra}, 10224 journal = {Atmospheric Environment}, 10225 year = {1997}, 10226 number = {20}, 10227 pages = {3459--3472}, 10228 volume = {31}, 10229 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 10230 task is the integration of the stiff systems of ordinary differential equations 10231 describing the chemical transformations. It is therefore of interest to 10232 systematically search for stiff solvers which can be identified as close to 10233 optimal for atmospheric applications. In this paper we continue our investigation 10234 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 10235 and compare eight solvers on a set of seven box-models used in present day models. 10236 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 10237 application when they are provided with highly efficient sparse matrix techniques 10238 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 10239 the literature, viz. and 4, and two are new and specially developed for air 10240 quality applications, viz. 3 and 3. } 10241} 10242 10243@Article{ rang_2005, 10244 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 10245 equations of index 1}, 10246 author = {Rang, J. and Angermann, L.}, 10247 journal = {BIT Numerical Mathematics}, 10248 year = {2005}, 10249 number = {4}, 10250 pages = {761--787}, 10251 volume = {45}, 10252 publisher = {Springer} 10253} 10254 10255@Article{ gottliebketchesonshu2009, 10256 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 10257 title = {{High order strong stability preserving time discretizations}}, 10258 journal = {Journal of Scientific Computing}, 10259 volume = {38}, 10260 number = {3}, 10261 pages = {251--289}, 10262 doi = {10.1007/s10915-008-9239-z}, 10263 year = {2009} 10264} 10265 10266@Article{ ketcheson_2008, 10267 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 10268 Low-Storage Implementations}, 10269 author = {D.I. Ketcheson}, 10270 journal = {SIAM Journal on Scientific Computing}, 10271 year = {2008}, 10272 number = {4}, 10273 pages = {2113--2136}, 10274 volume = {30}, 10275 doi = {10.1137/07070485X}, 10276 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 10277 RungeKutta methods}, 10278 publisher = {SIAM} 10279} 10280 10281@Article{ jansen_2000, 10282 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 10283 equations with a stabilized finite element method}, 10284 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 10285 journal = {Computer Methods in Applied Mechanics and Engineering}, 10286 year = {2000}, 10287 number = {3}, 10288 pages = {305--319}, 10289 volume = {190}, 10290 publisher = {Elsevier} 10291} 10292 10293@Article{ butcher_2007, 10294 title = {Error propagation of general linear methods for ordinary differential equations}, 10295 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 10296 journal = {Journal of Complexity}, 10297 year = {2007}, 10298 number = {4-6}, 10299 pages = {560--580}, 10300 volume = {23}, 10301 abstract = {We discuss error propagation for general linear methods for ordinary differential 10302 equations up to terms of order p+2, where p is the order of the method. These 10303 results are then applied to the estimation of local discretization errors for 10304 methods of order p and for the adjacent order p+1. The results of numerical 10305 experiments confirm the reliability of these estimates. This research has 10306 applications in the design of robust stepsize and order changing strategies for 10307 algorithms based on general linear methods.}, 10308 doi = {10.1016/j.jco.2007.01.009}, 10309 issn = {0885-064X} 10310} 10311 10312@Article{ constantinescu_a2010a, 10313 title = {Extrapolated implicit-explicit time stepping}, 10314 author = {E.M. Constantinescu and A. Sandu}, 10315 journal = {SIAM Journal on Scientific Computing}, 10316 year = {2010}, 10317 number = {6}, 10318 pages = {4452-4477}, 10319 volume = {31}, 10320 comment = {Preprint \# ANL/MCS-P1612-0409}, 10321 doi = {10.1137/080732833} 10322} 10323 10324@InProceedings{ devito2011liszt, 10325 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 10326 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 10327 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 10328 Aiken, Alex and Duraisamy, Karthik and others}, 10329 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 10330 Networking, Storage and Analysis}, 10331 pages = {9}, 10332 year = {2011}, 10333 organization = {ACM} 10334} 10335 10336@Article{ devito2011designing, 10337 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 10338 author = {DeVito, Zachary and Hanrahan, Pat}, 10339 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 10340 year = {2011} 10341} 10342 10343@Misc{ pgasintro, 10344 author = {Tim Stitt}, 10345 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 10346 Model}, 10347 note = {\url{http://cnx.org/content/m20649/latest/}} 10348} 10349 10350@InProceedings{ el2006upc, 10351 title = {UPC: unified parallel C}, 10352 author = {El-Ghazawi, Tarek and Smith, Lauren}, 10353 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 10354 pages = {27}, 10355 year = {2006}, 10356 organization = {ACM} 10357} 10358 10359@InProceedings{ numrich1998co, 10360 title = {Co-Array Fortran for parallel programming}, 10361 author = {Numrich, Robert W and Reid, John}, 10362 booktitle = {ACM Sigplan Fortran Forum}, 10363 volume = {17}, 10364 number = {2}, 10365 pages = {1--31}, 10366 year = {1998}, 10367 organization = {ACM} 10368} 10369 10370@Article{ aiken1997titanium, 10371 title = {Titanium: A high-performance Java dialect}, 10372 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 10373 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 10374 Geoff and Semenzato, Luigi and others}, 10375 year = {1997} 10376} 10377 10378@Article{ charles2005x10, 10379 title = {X10: an object-oriented approach to non-uniform cluster computing}, 10380 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 10381 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 10382 Sarkar, Vivek}, 10383 journal = {Acm Sigplan Notices}, 10384 volume = {40}, 10385 number = {10}, 10386 pages = {519--538}, 10387 year = {2005}, 10388 publisher = {ACM} 10389} 10390 10391@Article{ chamberlain2007parallel, 10392 title = {Parallel programmability and the chapel language}, 10393 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 10394 journal = {International Journal of High Performance Computing Applications}, 10395 volume = {21}, 10396 number = {3}, 10397 pages = {291--312}, 10398 year = {2007}, 10399 publisher = {SAGE Publications} 10400} 10401 10402@InProceedings{ charmppoopsla93, 10403 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 10404 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 10405 editor = {Paepcke, A.}, 10406 fulleditor = {Paepcke, Andreas}, 10407 pages = {91--108}, 10408 month = sep, 10409 year = {1993}, 10410 booktitle = {{Proceedings of OOPSLA'93}}, 10411 publisher = {{ACM Press}} 10412} 10413 10414@InProceedings{ hewitt1973universal, 10415 title = {A universal modular actor formalism for artificial intelligence}, 10416 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 10417 booktitle = {Proceedings of the 3rd international joint conference on Artificial 10418 intelligence}, 10419 pages = {235--245}, 10420 year = {1973}, 10421 organization = {Morgan Kaufmann Publishers Inc.} 10422} 10423 10424@Book{ yonezawa1990abcl, 10425 title = {ABCL: an object-oriented concurrent system}, 10426 author = {Yonezawa, Akinori}, 10427 year = {1990}, 10428 publisher = {MIT press} 10429} 10430 10431@InProceedings{ dally1988object, 10432 title = {Object-oriented concurrent programming in CST}, 10433 author = {Dally, William J and Chien, Andrew A}, 10434 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 10435 applications: Architecture, software, computer systems, and general issues-Volume 10436 1}, 10437 pages = {434--439}, 10438 year = {1988}, 10439 organization = {ACM} 10440} 10441 10442@Article{ grimshaw1993easy, 10443 title = {Easy-to-use object-oriented parallel processing with Mentat}, 10444 author = {Grimshaw, Andrew S.}, 10445 journal = {Computer}, 10446 volume = {26}, 10447 number = {5}, 10448 pages = {39--51}, 10449 year = {1993}, 10450 publisher = {IEEE} 10451} 10452 10453@InProceedings{ gannon1991object, 10454 title = {Object oriented parallelism: pC++ ideas and experiments}, 10455 author = {Gannon, Dennis and Lee, JK}, 10456 booktitle = {Proceedings of}, 10457 pages = {13--23}, 10458 year = {1991} 10459} 10460 10461@InProceedings{ lau1992object, 10462 title = {An object-oriented class library for scalable parallel heuristic search}, 10463 author = {Lau, Wing-cheong and Singh, Vineet}, 10464 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 10465 pages = {252--267}, 10466 year = {1992}, 10467 organization = {Springer} 10468} 10469 10470@Book{ chase1989amber, 10471 title = {The Amber system: Parallel programming on a network of multiprocessors}, 10472 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 10473 Littlefield, Richard}, 10474 volume = {23}, 10475 number = {5}, 10476 year = {1989}, 10477 publisher = {ACM} 10478} 10479 10480@InProceedings{ kaiser2009parallex, 10481 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 10482 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 10483 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 10484 pages = {394--401}, 10485 year = {2009}, 10486 organization = {IEEE} 10487} 10488 10489@TechReport{ ipm, 10490 author = {Barry F. Smith}, 10491 title = {A New Parallel Programming Model for Computer Simulation}, 10492 institution = {Argonne National Laboratory}, 10493 year = {2014}, 10494 number = {ANL/MCS-P5135-0414} 10495} 10496 10497@Article{ groppsnir, 10498 author = {William Gropp and Marc Snir}, 10499 title = {Programming for Exascale Computers}, 10500 journal = {Computing in Science and Engineering}, 10501 volume = {15}, 10502 number = {6}, 10503 issn = {1521-9615}, 10504 year = {2013}, 10505 pages = {27-35}, 10506 doi = {10.1109/MCSE.2013.96}, 10507 publisher = {IEEE Computer Society}, 10508 address = {Los Alamitos, CA} 10509} 10510 10511@Book{ mpi3, 10512 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 10513 author = {Message Passing Interface Forum}, 10514 year = {2012}, 10515 publisher = {High Performance Computing Center Stuttgart (HLRS)} 10516} 10517 10518@Book{ openmp4, 10519 title = {OpenMP Application Program Interface, Version 4.0}, 10520 year = {2013}, 10521 publisher = {OpenMP Architecture Review Board} 10522} 10523 10524@InProceedings{ hartono2009annotation, 10525 title = {Annotation-based empirical performance tuning using {Orio}}, 10526 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 10527 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 10528 Symposium on}, 10529 pages = {1--11}, 10530 year = {2009}, 10531 organization = {IEEE} 10532} 10533 10534@Book{ toselli2005domain, 10535 title = {Domain Decomposition Methods: Algorithms and Theory}, 10536 author = {Toselli, Andrea and Widlund, Olof B}, 10537 volume = {34}, 10538 year = {2005}, 10539 publisher = {Springer} 10540} 10541 10542@InBook{ st2016, 10543 author = {Barry F. Smith and Xumin Tu}, 10544 chapter = {Domain Decomposition}, 10545 title = {Encyclopedia of Applied and Computational Mathematics}, 10546 bookeditor = {B. Engquist}, 10547 publisher = {Springer}, 10548 pages = {375--381}, 10549 year = {2016} 10550} 10551 10552@TechReport{ saws, 10553 author = {Matt Otten and Jed Brown and Barry F. Smith}, 10554 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 10555 institution = {Argonne National Laboratory}, 10556 year = {2013} 10557} 10558 10559@Article{ smith1997domain, 10560 title = {Domain Decomposition Methods for Partial Differential Equations}, 10561 author = {Smith, B.F.}, 10562 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 10563 volume = {4}, 10564 pages = {225--244}, 10565 year = {1997}, 10566 publisher = {Citeseer} 10567} 10568 10569@Article{ spillane2011abstract, 10570 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 10571 in the overlaps}, 10572 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 10573 Scheichl, R}, 10574 journal = {NuMa-Report}, 10575 volume = {7}, 10576 pages = {2007}, 10577 year = {2011} 10578} 10579 10580@InProceedings{ jolivet2013scalabledd, 10581 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 10582 problems}, 10583 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 10584 Prud'homme, Christophe}, 10585 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 10586 Networking, Storage and Analysis}, 10587 pages = {80}, 10588 year = {2013}, 10589 organization = {ACM} 10590} 10591 10592@Book{ ks2000, 10593 author = {D. Kinderlehrer and G. Stampacchia}, 10594 publisher = {Society for Industrial Mathematics}, 10595 title = {An Introduction to Variational Inequalities and Their Applications}, 10596 year = {2000} 10597} 10598 10599@Article{ wan2000energy, 10600 title = {An energy-minimizing interpolation for robust multigrid methods}, 10601 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 10602 journal = {SIAM Journal on Scientific Computing}, 10603 volume = {21}, 10604 number = {4}, 10605 pages = {1632--1649}, 10606 year = {2000}, 10607 publisher = {Philadelphia, PA: SIAM, c1993-} 10608} 10609 10610@Article{ chansmith1994, 10611 title = {Domain decomposition and multigrid algorithms for elliptic problems on 10612 unstructured meshes}, 10613 author = {Chan, T.F. and Smith, B.F.}, 10614 journal = {Electronic Transactions on Numerical Analysis}, 10615 volume = {2}, 10616 pages = {171--182}, 10617 year = {1994} 10618} 10619 10620@TechReport{ proto-fsp, 10621 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 10622 and Michael Zarnstorff and Michael Zika}, 10623 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 10624 institution = {Princeton Plasma Physics Laboratory}, 10625 year = {2010}, 10626 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 10627} 10628 10629@Article{ hirvijoki2021, 10630 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 10631 particle-in-cell codes}, 10632 journal = {Plasma Phys. Control. Fusion}, 10633 author = {Eero Hirvijoki}, 10634 note = {in press}, 10635 doi = {10.1088/1361-6587/abe884}, 10636 year = {2021} 10637} 10638 10639@Article{ ipsen2001, 10640 author = {Ilse C. F. Ipsen}, 10641 journal = {SIAM J. Sci. Comput.}, 10642 pages = {1050--1051}, 10643 volume = {23}, 10644 publisher = {SIAM}, 10645 title = {A Note on Preconditioning Nonsymmetric Matrices}, 10646 year = {2001} 10647} 10648 10649% Random papers on solvers for GPUs 10650@InProceedings{ gpus-suck, 10651 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 10652 title = { On the Limits of {GPU} Acceleration}, 10653 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 10654 year = {2010}, 10655 publisher = {USENIX} 10656} 10657 10658@InProceedings{ 882364, 10659 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 10660 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 10661 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 10662 year = {2003}, 10663 isbn = {1-58113-709-5}, 10664 pages = {917--924}, 10665 location = {San Diego, California}, 10666 doi = {10.1145/1201775.882364}, 10667 publisher = {ACM}, 10668 address = {New York, NY} 10669} 10670 10671@Conference{ feng2008multigrid, 10672 author = {Feng, Z. and Li, P.}, 10673 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 10674 date-added = {2010-08-19 15:57:06 -0500}, 10675 date-modified = {2010-08-19 15:57:06 -0500}, 10676 pages = {647--654}, 10677 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 10678 year = {2008} 10679} 10680 10681@Conference{ goodnight2003multigrid, 10682 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 10683 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 10684 date-added = {2010-08-19 15:45:20 -0500}, 10685 date-modified = {2010-08-19 15:45:20 -0500}, 10686 organization = {Eurographics Association}, 10687 pages = {102--111}, 10688 title = {A multigrid solver for boundary value problems using programmable graphics 10689 hardware}, 10690 year = {2003} 10691} 10692 10693@Article{ buatois2007concurrent, 10694 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 10695 date-added = {2010-08-19 15:45:02 -0500}, 10696 date-modified = {2010-08-19 15:45:02 -0500}, 10697 journal = {High Performance Computing and Communications}, 10698 pages = {358--371}, 10699 publisher = {Citeseer}, 10700 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 10701 year = {2007} 10702} 10703 10704@Article{ joldes2010real, 10705 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 10706 date-added = {2010-08-19 15:44:41 -0500}, 10707 date-modified = {2010-08-19 15:44:41 -0500}, 10708 journal = {Computer Methods in Applied Mechanics and Engineering}, 10709 publisher = {Elsevier}, 10710 title = {Real-time nonlinear finite element computations on {GPU}-application to 10711 neurosurgical simulation}, 10712 year = {2010} 10713} 10714 10715@Misc{ aharon2005gpu, 10716 author = {Aharon, S.}, 10717 date-added = {2010-08-19 15:44:32 -0500}, 10718 date-modified = {2010-08-19 15:44:32 -0500}, 10719 month = apr, 10720 note = {US Patent App. 11/115,642}, 10721 publisher = {Google Patents}, 10722 title = {{GPU}-based Finite Element}, 10723 year = {2005} 10724} 10725 10726@Article{ cevahir2009fast, 10727 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 10728 date-added = {2010-08-19 15:44:01 -0500}, 10729 date-modified = {2010-08-19 15:44:01 -0500}, 10730 journal = {Computational Science--ICCS 2009}, 10731 pages = {893--903}, 10732 publisher = {Springer}, 10733 title = {Fast conjugate gradients with multiple {GPU}s}, 10734 year = {2009} 10735} 10736 10737@Article{ maier1995symmetric, 10738 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 10739 date-added = {2010-08-19 15:43:57 -0500}, 10740 date-modified = {2010-08-19 15:43:57 -0500}, 10741 journal = {Computational Mechanics}, 10742 number = {1}, 10743 pages = {115--129}, 10744 publisher = {Springer}, 10745 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 10746 plasticity}, 10747 volume = {17}, 10748 year = {1995} 10749} 10750 10751@Article{ corrigan-running, 10752 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 10753 date-added = {2010-08-19 15:43:47 -0500}, 10754 date-modified = {2010-08-19 15:43:47 -0500}, 10755 journal = {International Journal for Numerical Methods in Fluids}, 10756 publisher = {John Wiley \& Sons}, 10757 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 10758} 10759 10760@InProceedings{ volkov08, 10761 author = {Vasily Volkov and James W. Demmel}, 10762 title = {Benchmarking GPUs to tune dense linear algebra}, 10763 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 10764 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 10765 year = {2008} 10766} 10767 10768@TechReport{ cray-mvmult, 10769 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 10770 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 10771 institution = {School of Computer Science, Carnegie Mellon University}, 10772 number = {CMU-CS-93-173}, 10773 month = aug, 10774 year = {1993} 10775} 10776 10777@Conference{ bell2009implementing, 10778 author = {Bell, N. and Garland, M.}, 10779 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 10780 and Analysis}, 10781 date-added = {2010-08-19 15:43:42 -0500}, 10782 date-modified = {2010-08-19 15:43:42 -0500}, 10783 organization = {ACM}, 10784 pages = {1--11}, 10785 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 10786 processors}, 10787 year = {2009} 10788} 10789 10790@Article{ bell2008efficient, 10791 author = {Bell, N. and Garland, M.}, 10792 date-added = {2010-08-19 15:43:36 -0500}, 10793 date-modified = {2010-08-19 15:43:36 -0500}, 10794 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 10795 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 10796 year = {2008} 10797} 10798 10799@Article{ cohen-fast, 10800 author = {Cohen, J. and Molemaker, M.J.}, 10801 date-added = {2010-08-19 15:43:34 -0500}, 10802 date-modified = {2010-08-19 15:43:34 -0500}, 10803 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 10804 pages = {414}, 10805 publisher = {DEStech Publications}, 10806 title = {A fast double precision CFD code using CUDA} 10807} 10808 10809@Article{ kazhdan2008streaming, 10810 author = {Kazhdan, M. and Hoppe, H.}, 10811 date-added = {2010-08-19 15:43:32 -0500}, 10812 date-modified = {2010-08-19 15:43:32 -0500}, 10813 journal = {ACM Transactions on Graphics (TOG)}, 10814 number = {3}, 10815 pages = {21}, 10816 publisher = {ACM}, 10817 title = {Streaming multigrid for gradient-domain operations on large images}, 10818 volume = {27}, 10819 year = {2008} 10820} 10821 10822@Article{ bonnet1998symmetric, 10823 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 10824 date-added = {2010-08-19 15:43:18 -0500}, 10825 date-modified = {2010-08-19 15:43:18 -0500}, 10826 journal = {Appl. Mech. Rev}, 10827 pages = {669--704}, 10828 title = {Symmetric {G}alerkin boundary element method.}, 10829 volume = {51}, 10830 year = {1998} 10831} 10832 10833@Conference{ zamith2007gpu, 10834 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 10835 Valente, L.}, 10836 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 10837 Entertainment}, 10838 date-added = {2010-08-19 15:43:14 -0500}, 10839 date-modified = {2010-08-19 15:43:14 -0500}, 10840 pages = {37--43}, 10841 title = {The {GPU} used as a math co-processor in real time applications}, 10842 year = {2007} 10843} 10844 10845@Article{ baskaran2009optimizing, 10846 author = {Baskaran, M.M. and Bordawekar, R.}, 10847 date-added = {2010-08-19 15:42:56 -0500}, 10848 date-modified = {2010-08-19 15:42:56 -0500}, 10849 journal = {IBM Research Report RC24704, IBM}, 10850 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 10851 year = {2009} 10852} 10853 10854@Misc{ szeliski2006locally, 10855 author = {Szeliski, R.}, 10856 date-added = {2010-08-19 15:42:45 -0500}, 10857 date-modified = {2010-08-19 15:42:45 -0500}, 10858 month = jul, 10859 note = {US Patent App. 11/459,724}, 10860 publisher = {Google Patents}, 10861 title = {Locally adapted hierarchical basis preconditioning}, 10862 year = {2006} 10863} 10864 10865@Article{ jung2006cholesky, 10866 author = {Jung, J.H. and O'Leary, D.P.}, 10867 date-added = {2010-08-19 15:42:34 -0500}, 10868 date-modified = {2010-08-19 15:42:34 -0500}, 10869 journal = {Scholarly Paper, University of Maryland}, 10870 publisher = {Citeseer}, 10871 title = {Cholesky decomposition and linear programming on a {GPU}}, 10872 year = {2006} 10873} 10874 10875@Conference{ filipovic2009gpu, 10876 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 10877 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 10878 date-added = {2010-08-19 15:42:33 -0500}, 10879 date-modified = {2010-08-19 15:42:33 -0500}, 10880 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 10881 Results}, 10882 year = {2009} 10883} 10884 10885@Article{ taylor2009modelling, 10886 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 10887 Atkinson, D. and Ourselin, S.}, 10888 date-added = {2010-08-19 15:42:23 -0500}, 10889 date-modified = {2010-08-19 15:42:23 -0500}, 10890 journal = {Medical Image Analysis}, 10891 number = {2}, 10892 pages = {234--244}, 10893 publisher = {Elsevier}, 10894 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 10895 solution and {GPU} execution}, 10896 volume = {13}, 10897 year = {2009} 10898} 10899 10900@Conference{ owens2007survey, 10901 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 10902 and Lefohn, A.E. and Purcell, T.J.}, 10903 booktitle = {Computer Graphics Forum}, 10904 date-added = {2010-08-19 15:42:21 -0500}, 10905 date-modified = {2010-08-19 15:42:21 -0500}, 10906 number = {1}, 10907 organization = {John Wiley \& Sons}, 10908 pages = {80--113}, 10909 title = {A survey of general-purpose computation on graphics hardware}, 10910 volume = {26}, 10911 year = {2007} 10912} 10913 10914@Article{ strzodka2005scientific, 10915 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 10916 date-added = {2010-08-19 15:42:18 -0500}, 10917 date-modified = {2010-08-19 15:42:18 -0500}, 10918 journal = {Simulation Modelling Practice and Theory}, 10919 number = {8}, 10920 pages = {667--680}, 10921 publisher = {Elsevier}, 10922 title = {Scientific computation for simulations on programmable graphics hardware}, 10923 volume = {13}, 10924 year = {2005} 10925} 10926 10927@Conference{ rumpf2001using, 10928 author = {Rumpf, M. and Strzodka, R.}, 10929 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 10930 (VIIP-01)}, 10931 date-added = {2010-08-19 15:42:15 -0500}, 10932 date-modified = {2010-08-19 15:42:15 -0500}, 10933 organization = {Citeseer}, 10934 pages = {193--202}, 10935 title = {Using graphics cards for quantized FEM computations}, 10936 year = {2001} 10937} 10938 10939@Article{ sirtori1992galerkin, 10940 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 10941 date-added = {2010-08-19 15:42:14 -0500}, 10942 date-modified = {2010-08-19 15:42:14 -0500}, 10943 journal = {International Journal for Numerical Methods in Engineering}, 10944 number = {2}, 10945 pages = {255--282}, 10946 publisher = {John Wiley \& Sons}, 10947 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 10948 implementation}, 10949 volume = {35}, 10950 year = {1992} 10951} 10952 10953@Article{ tejada2005large, 10954 author = {Tejada, E. and Ertl, T.}, 10955 date-added = {2010-08-19 15:42:09 -0500}, 10956 date-modified = {2010-08-19 15:42:09 -0500}, 10957 journal = {Simulation Modelling Practice and Theory}, 10958 number = {8}, 10959 pages = {703--715}, 10960 publisher = {Elsevier}, 10961 title = {Large steps in {GPU}-based deformable bodies simulation}, 10962 volume = {13}, 10963 year = {2005} 10964} 10965 10966@Article{ goddeke2008using, 10967 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 10968 and Becker, C. and Turek, S.}, 10969 date-added = {2010-08-19 15:42:06 -0500}, 10970 date-modified = {2010-08-19 15:42:06 -0500}, 10971 journal = {International Journal of Computational Science and Engineering}, 10972 number = {1}, 10973 pages = {36--55}, 10974 publisher = {Inderscience}, 10975 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 10976 volume = {4}, 10977 year = {2008} 10978} 10979 10980@Article{ garland2008parallel, 10981 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 10982 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 10983 date-added = {2010-08-19 15:41:51 -0500}, 10984 date-modified = {2010-08-19 15:41:51 -0500}, 10985 journal = {IEEE Micro}, 10986 number = {4}, 10987 pages = {13--27}, 10988 title = {Parallel computing experiences with CUDA}, 10989 volume = {28}, 10990 year = {2008} 10991} 10992 10993@Article{ wong1985method, 10994 author = {Wong, SH and Ciric, IR}, 10995 date-added = {2010-08-19 15:41:48 -0500}, 10996 date-modified = {2010-08-19 15:41:48 -0500}, 10997 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 10998 and Electronic Engineering}, 10999 publisher = {MCB UP Ltd}, 11000 title = {Method of conformal transformation for the finite-element solution of 11001 axisymmetric exterior-field problems}, 11002 volume = {4}, 11003 year = {1985} 11004} 11005 11006@Article{ turek-feast, 11007 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 11008 H.}, 11009 date-added = {2010-08-19 15:41:47 -0500}, 11010 date-modified = {2010-08-19 15:41:47 -0500}, 11011 journal = {Concurrency and Computation: Practice and Experience}, 11012 publisher = {John Wiley \& Sons}, 11013 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 11014 elements} 11015} 11016 11017@Article{ abedi2006space, 11018 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 11019 date-added = {2010-08-19 15:41:46 -0500}, 11020 date-modified = {2010-08-19 15:41:46 -0500}, 11021 journal = {Computer Methods in Applied Mechanics and Engineering}, 11022 number = {25-28}, 11023 pages = {3247--3273}, 11024 publisher = {Elsevier}, 11025 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 11026 element-wise momentum balance}, 11027 volume = {195}, 11028 year = {2006} 11029} 11030 11031@Conference{ georgii2005interactiveb, 11032 author = {Georgii, J. and Westermann, R.}, 11033 booktitle = {Proceedings of VMV}, 11034 date-added = {2010-08-19 15:41:36 -0500}, 11035 date-modified = {2010-08-19 15:41:36 -0500}, 11036 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 11037 year = {2005} 11038} 11039 11040@Article{ mosegaard2005gpu, 11041 author = {Mosegaard, J. and others}, 11042 date-added = {2010-08-19 15:41:35 -0500}, 11043 date-modified = {2010-08-19 15:41:35 -0500}, 11044 publisher = {IEEE Computer Society}, 11045 title = {{GPU} accelerated surgical simulators for complex morphology}, 11046 year = {2005} 11047} 11048 11049@Article{ meyer2007particle, 11050 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 11051 date-added = {2010-08-19 15:41:33 -0500}, 11052 date-modified = {2010-08-19 15:41:33 -0500}, 11053 journal = {IEEE Transactions on Visualization and Computer Graphics}, 11054 pages = {1015--1026}, 11055 publisher = {Published by the IEEE Computer Society}, 11056 title = {Particle systems for efficient and accurate high-order finite element 11057 visualization}, 11058 year = {2007} 11059} 11060 11061@Conference{ rumpf2001nonlinear, 11062 author = {Rumpf, M. and Strzodka, R.}, 11063 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 11064 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 11065 date-added = {2010-08-19 15:41:29 -0500}, 11066 date-modified = {2010-08-19 15:41:29 -0500}, 11067 organization = {Springer Verlag Wien}, 11068 pages = {75}, 11069 title = {Nonlinear diffusion in graphics hardware}, 11070 year = {2001} 11071} 11072 11073@Article{ georgii2005interactive, 11074 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 11075 date-added = {2010-08-19 15:41:28 -0500}, 11076 date-modified = {2010-08-19 15:41:28 -0500}, 11077 journal = {Simulation and Visualisation}, 11078 pages = {247--258}, 11079 publisher = {Citeseer}, 11080 title = {Interactive simulation of deformable bodies on {GPU}s}, 11081 volume = {2005}, 11082 year = {2005} 11083} 11084 11085@Article{ harish2007accelerating, 11086 author = {Harish, P. and Narayanan, P.}, 11087 date-added = {2010-08-19 15:41:27 -0500}, 11088 date-modified = {2010-08-19 15:41:27 -0500}, 11089 journal = {High Performance Computing--HiPC 2007}, 11090 pages = {197--208}, 11091 publisher = {Springer}, 11092 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 11093 year = {2007} 11094} 11095 11096@Article{ keunings1995parallel, 11097 author = {Keunings, R.}, 11098 date-added = {2010-08-19 15:41:19 -0500}, 11099 date-modified = {2010-08-19 15:41:19 -0500}, 11100 journal = {Computers and Chemical Engineering}, 11101 number = {6}, 11102 pages = {647--670}, 11103 publisher = {Oxford; New York: Pergamon Press, 1977-}, 11104 title = {Parallel finite element algorithms applied to computational rheology}, 11105 volume = {19}, 11106 year = {1995} 11107} 11108 11109@Conference{ taylor2007real, 11110 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 11111 booktitle = {Proceedings of the 10th international conference on Medical image computing and 11112 computer-assisted intervention-Volume Part I}, 11113 date-added = {2010-08-19 15:41:17 -0500}, 11114 date-modified = {2010-08-19 15:41:17 -0500}, 11115 organization = {Springer-Verlag}, 11116 pages = {701--708}, 11117 title = {Real-time nonlinear finite element analysis for surgical simulation using 11118 graphics processing units}, 11119 year = {2007} 11120} 11121 11122@Article{ liu2000finite, 11123 author = {Liu, R. and Li, DY}, 11124 date-added = {2010-08-19 15:41:16 -0500}, 11125 date-modified = {2010-08-19 15:41:16 -0500}, 11126 journal = {Materials Science and Engineering A}, 11127 number = {1-2}, 11128 pages = {169--175}, 11129 publisher = {Elsevier}, 11130 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 11131 volume = {277}, 11132 year = {2000} 11133} 11134 11135@Conference{ kakadiaris1994active, 11136 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 11137 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 11138 date-added = {2010-08-19 15:41:15 -0500}, 11139 date-modified = {2010-08-19 15:41:15 -0500}, 11140 organization = {Citeseer}, 11141 pages = {980--980}, 11142 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 11143 physics-based approach}, 11144 year = {1994} 11145} 11146 11147@Conference{ de2004gpu, 11148 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 11149 booktitle = {Proceedings of Eurohaptics}, 11150 date-added = {2010-08-19 15:41:14 -0500}, 11151 date-modified = {2010-08-19 15:41:14 -0500}, 11152 organization = {Citeseer}, 11153 pages = {44--51}, 11154 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 11155 volume = {2004}, 11156 year = {2004} 11157} 11158 11159@Book{ taflove1995computational, 11160 author = {Taflove, A. and Hagness, S.C.}, 11161 date-added = {2010-08-19 15:41:14 -0500}, 11162 date-modified = {2010-08-19 15:41:14 -0500}, 11163 publisher = {Artech House Norwood, MA}, 11164 title = {Computational electrodynamics}, 11165 year = {1995} 11166} 11167 11168@Conference{ galoppo2005lu, 11169 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 11170 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 11171 date-added = {2010-08-19 15:41:13 -0500}, 11172 date-modified = {2010-08-19 15:41:13 -0500}, 11173 organization = {IEEE Computer Society}, 11174 pages = {3}, 11175 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 11176 hardware}, 11177 year = {2005} 11178} 11179 11180@Conference{ ryoo2008optimization, 11181 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 11182 and Hwu, W.W.}, 11183 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 11184 parallel programming}, 11185 date-added = {2010-08-19 15:41:12 -0500}, 11186 date-modified = {2010-08-19 15:41:12 -0500}, 11187 organization = {ACM}, 11188 pages = {73--82}, 11189 title = {Optimization principles and application performance evaluation of a multithreaded 11190 {GPU} using CUDA}, 11191 year = {2008} 11192} 11193 11194@Conference{ micikevicius20093d, 11195 author = {Micikevicius, P.}, 11196 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 11197 Units}, 11198 date-added = {2010-08-19 15:41:11 -0500}, 11199 date-modified = {2010-08-19 15:41:11 -0500}, 11200 organization = {ACM}, 11201 pages = {79--84}, 11202 title = {3D finite difference computation on {GPU}s using {CUDA}}, 11203 year = {2009} 11204} 11205 11206@Conference{ zhou2004pixel, 11207 author = {Zhou, Y. and Garland, M. and Haber, R.}, 11208 booktitle = {IEEE Visualization, 2004}, 11209 date-added = {2010-08-19 15:41:03 -0500}, 11210 date-modified = {2010-08-19 15:41:03 -0500}, 11211 pages = {425--432}, 11212 title = {Pixel-exact rendering of spacetime finite element solutions}, 11213 year = {2004} 11214} 11215 11216@Article{ komatitsch2009porting, 11217 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 11218 date-added = {2010-08-19 15:41:01 -0500}, 11219 date-modified = {2010-08-19 15:41:01 -0500}, 11220 journal = {Journal of Parallel and Distributed Computing}, 11221 number = {5}, 11222 pages = {451--460}, 11223 publisher = {Elsevier}, 11224 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 11225 graphics cards using CUDA}, 11226 volume = {69}, 11227 year = {2009} 11228} 11229 11230@Article{ komatitsch1998spectral, 11231 author = {Komatitsch, D. and Vilotte, J.P.}, 11232 date-added = {2010-08-19 15:40:59 -0500}, 11233 date-modified = {2010-08-19 15:40:59 -0500}, 11234 journal = {Bulletin of the Seismological Society of America}, 11235 number = {2}, 11236 pages = {368--392}, 11237 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 11238 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 11239 of 2D and 3D geological structures}, 11240 volume = {88}, 11241 year = {1998} 11242} 11243 11244@Article{ wu2005improved, 11245 author = {Wu, W. and Heng, P.A.}, 11246 date-added = {2010-08-19 15:40:59 -0500}, 11247 date-modified = {2010-08-19 15:40:59 -0500}, 11248 journal = {The Visual Computer}, 11249 number = {8}, 11250 pages = {707--716}, 11251 publisher = {Springer}, 11252 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 11253 cutting and deformation}, 11254 volume = {21}, 11255 year = {2005} 11256} 11257 11258@Article{ taylor2008high, 11259 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 11260 date-added = {2010-08-19 15:40:57 -0500}, 11261 date-modified = {2010-08-19 15:40:57 -0500}, 11262 journal = {IEEE transactions on medical imaging}, 11263 number = {5}, 11264 pages = {650}, 11265 title = {High-speed nonlinear finite element analysis for surgical simulation using 11266 graphics processing units.}, 11267 volume = {27}, 11268 year = {2008} 11269} 11270 11271@Conference{ bolz2003sparse, 11272 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 11273 booktitle = {ACM SIGGRAPH 2003 Papers}, 11274 date-added = {2010-08-19 15:40:55 -0500}, 11275 date-modified = {2010-08-19 15:40:55 -0500}, 11276 organization = {ACM}, 11277 pages = {924}, 11278 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11279 year = {2003} 11280} 11281 11282@Article{ wu2004hybrid, 11283 author = {Wu, W. and Heng, P.A.}, 11284 date-added = {2010-08-19 15:40:54 -0500}, 11285 date-modified = {2010-08-19 15:40:54 -0500}, 11286 journal = {Computer Animation and Virtual Worlds}, 11287 number = {3-4}, 11288 pages = {219--227}, 11289 publisher = {John Wiley \& Sons}, 11290 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 11291 3D soft tissue cutting}, 11292 volume = {15}, 11293 year = {2004} 11294} 11295 11296% ---------------------------------------------------------------------------------------------------------------- 11297@TechReport{ davis97, 11298 author = {T. Davis}, 11299 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 11300 institution = {University of Florida}, 11301 year = {1997} 11302} 11303 11304@Article{ davis2011, 11305 author = {Davis, T. A. and Hu, Y.}, 11306 title = {The {U}niversity of {F}lorida sparse matrix collection}, 11307 journal = {ACM Transactions on Mathematical Software}, 11308 volume = {38}, 11309 issue = {1}, 11310 year = {2011}, 11311 pages = {1--25} 11312} 11313 11314@Article{ davis2004algorithm, 11315 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 11316 author = {Davis, Timothy A}, 11317 journal = {ACM Transactions on Mathematical Software}, 11318 volume = {30}, 11319 number = {2}, 11320 pages = {196--199}, 11321 year = {2004}, 11322 publisher = {ACM} 11323} 11324 11325@TechReport{ streams, 11326 author = {J. D. McCalpin}, 11327 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 11328 institution = {University of Virginia}, 11329 url = {http://www.cs.virginia.edu/stream}, 11330 year = {1995} 11331} 11332 11333@Article{ areusken_1988b, 11334 author = {A. Reusken}, 11335 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 11336 mildly nonlinear boundary value problems}, 11337 journal = {Numer. Math.}, 11338 volume = {52}, 11339 year = {1988}, 11340 pages = {251--277} 11341} 11342 11343@Article{ areusken_1988c, 11344 author = {A. Reusken}, 11345 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 11346 journal = {Numer. Math.}, 11347 volume = {53}, 11348 year = {1988}, 11349 pages = {663--686} 11350} 11351 11352@Unpublished{ mgnet, 11353 title = {Multigrid Net; http://www.mgnet.org/}, 11354 author = {Craig Douglas}, 11355 note = {Contains enormous bibliography on multigrid publications}, 11356 year = {2009} 11357} 11358 11359@Unpublished{ copper, 11360 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 11361 author = {}, 11362 note = {Held bi-annually}, 11363 year = {2009} 11364} 11365 11366@Book{ wessling1992, 11367 author = {Pieter Wesseling}, 11368 title = {An Introduction to Multigrid Methods}, 11369 year = {2004}, 11370 publisher = {R. T. Edwards} 11371} 11372 11373@Book{ bhm2000, 11374 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 11375 title = {A Multigrid Tutorial}, 11376 year = {2000}, 11377 publisher = {SIAM} 11378} 11379 11380@Book{ trottenberg2001multigrid, 11381 title = {{Multigrid}}, 11382 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 11383 isbn = {012701070X}, 11384 year = {2001}, 11385 publisher = {Academic Press} 11386} 11387 11388@TechReport{ brandt1984, 11389 author = {Achi Brandt}, 11390 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 11391 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 11392 number = {GMD-Studien Nr. 85}, 11393 year = {1984} 11394} 11395 11396@Article{ yavneh1998coarse, 11397 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 11398 author = {Yavneh, I.}, 11399 journal = {SIAM Journal on Scientific Computing}, 11400 volume = {19}, 11401 number = {5}, 11402 pages = {1682--1699}, 11403 year = {1998}, 11404 publisher = {Society for Industrial and Applied Mathematics} 11405} 11406 11407@Article{ wan2003phase, 11408 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 11409 author = {Wan, WL and Chan, T.F.}, 11410 journal = {SIAM Journal on Scientific Computing}, 11411 volume = {25}, 11412 pages = {857}, 11413 year = {2003} 11414} 11415 11416@Article{ imex, 11417 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 11418 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 11419 journal = {SIAM Journel on Numerical Analysis}, 11420 volume = {32}, 11421 number = {3}, 11422 pages = {797--823}, 11423 year = {1995} 11424} 11425 11426@Article{ ow1, 11427 author = {T. Washio and C. W. Oosterlee}, 11428 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 11429 Recirculating Flow}, 11430 journal = {SIAM Journal on Scientific Computing}, 11431 volume = {21}, 11432 number = {5}, 11433 pages = {1670--1690}, 11434 year = {2000} 11435} 11436 11437@Article{ vm1, 11438 author = {V. A. Mousseau}, 11439 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 11440 Heat Conduction}, 11441 journal = {Journal Of Computational Physics}, 11442 volume = {200}, 11443 pages = {104--132}, 11444 year = {2004} 11445} 11446 11447@Article{ vm2, 11448 author = {V. A. Mousseau}, 11449 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 11450 journal = {Journal Of Heat Transfer}, 11451 volume = {127}, 11452 pages = {531--539}, 11453 year = {2005} 11454} 11455 11456@Misc{ salome1, 11457 author = {Laurent Dada and Daniel Caruge}, 11458 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 11459 Simulation}, 11460 year = {2005}, 11461 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 11462 note = {Presentation at an ESA/ESTEC conference} 11463} 11464 11465@InProceedings{ downar1, 11466 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 11467 A. Mousseau and D. E. Ebert}, 11468 title = {Application of a generalized interface module to the coupling of {PARCS} with 11469 both {RELAP5} and {TRAC-M}}, 11470 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 11471 year = {1999} 11472} 11473 11474@Article{ lopez1, 11475 author = {A. P. Lopez and J. B. Sandova}, 11476 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 11477 thermal-hydraulics}, 11478 journal = {Annals of Nuclear Energy}, 11479 volume = {32(6)}, 11480 pages = {621--634}, 11481 year = {2005} 11482} 11483 11484@InProceedings{ og-1996, 11485 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 11486 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 11487 Transport Code}, 11488 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 11489 Transport Codes}, 11490 editor = {}, 11491 publisher = {}, 11492 pages = {}, 11493 note = {Paris, France}, 11494 month = dec, 11495 year = {1996} 11496} 11497 11498@Article{ wo-2000, 11499 author = {P. Warner and C. R. E. de Oliveira}, 11500 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 11501 {EVENT} for Shielding Applications}, 11502 journal = {J. Nucl. Sci. and Tech.}, 11503 volume = {Supplement 1}, 11504 pages = {466--470}, 11505 year = {2000} 11506} 11507 11508@Unpublished{ gnep-web, 11509 author = {{U.S. Department of Energy}}, 11510 title = {Global Nuclear Energy Partnership ({GNEP})}, 11511 note = {\url{ http://www.gnep.energy.gov}}, 11512 year = {2007} 11513} 11514 11515@Book{ lewis-miller-1984, 11516 author = {E. E. Lewis and W. F. Miller, Jr.}, 11517 title = {Computational Methods of Neutron Transport}, 11518 address = {}, 11519 publisher = {Wiley}, 11520 year = {1984} 11521} 11522 11523@Article{ couple1, 11524 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 11525 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 11526 THE {IBM-704}}, 11527 journal = {Nuclear Sci. and Eng.}, 11528 year = {1959}, 11529 pages = {113--115}, 11530 volume = {2(1)} 11531} 11532 11533@InProceedings{ weber1, 11534 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 11535 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 11536 and component design}, 11537 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 11538 year = {2000} 11539} 11540 11541@Misc{ gnep:report, 11542 author = {Phillip Finck and David Keyes and Rick Stevens}, 11543 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 11544 Nuclear Energy Systems}}, 11545 year = {2006} 11546} 11547 11548@Misc{ subsurface-workshop-ref, 11549 author = {D. {Zachman (Chair)}}, 11550 title = {{Computational Subsurface Sciences Workshop}}, 11551 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 11552} 11553 11554@Misc{ fusion:report, 11555 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 11556 Panel}}, 11557 author = {{Fusion Energy Sciences Advisory Committee}}, 11558 year = {2002}, 11559 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 11560} 11561 11562@Misc{ hecrtf:report, 11563 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 11564 key = {HECRTF}, 11565 year = {2004}, 11566 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 11567} 11568 11569@Misc{ doesc20years, 11570 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 11571 key = {Office of Science, U.S. Department of Energy}, 11572 year = {2003}, 11573 howpublished = {Office of Science, U.S. Department of Energy, see 11574 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 11575} 11576 11577@PhDThesis{ karpeev-thesis, 11578 author = {D. A. Karpeyev}, 11579 title = {Geometric Integrators for Hamiltonian PDEs}, 11580 school = {Old Dominion University}, 11581 year = {2002} 11582} 11583 11584@InCollection{ fjp:ima, 11585 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 11586 title = {The Scalability of Mesh Improvement Algorithms}, 11587 booktitle = {Algorithms for Parallel Processing}, 11588 publisher = {Springer-Verlag}, 11589 volume = {105}, 11590 series = {The IMA Volumes in Mathematics and Its Applications}, 11591 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 11592 year = {1998}, 11593 pages = {185--212} 11594} 11595 11596@InProceedings{ poet, 11597 author = {Rob Armstrong and Alex Cheung}, 11598 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 11599 for Scientific Distributed Computing}, 11600 booktitle = {Proceedings of {HICSS97}}, 11601 year = {1997} 11602} 11603 11604@Misc{ pseware-web-page, 11605 author = {}, 11606 title = {{PSEware} {Web} page}, 11607 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 11608 key = {{PSEware} {Web} page} 11609} 11610 11611@Article{ epperly2011high, 11612 title = {High-performance language interoperability for scientific computing through 11613 {B}abel}, 11614 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 11615 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 11616 journal = {International Journal of High Performance Computing Applications}, 11617 pages = {1094342011414036}, 11618 year = {2011}, 11619 publisher = {SAGE Publications} 11620} 11621 11622@Misc{ babel-web-page, 11623 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 11624 title = {{Babel} {Web} page}, 11625 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 11626} 11627 11628@Misc{ infospheres-web-page, 11629 author = {K.~M. {Chandy et al.}}, 11630 title = {{Infospheres} {W}eb page}, 11631 note = {\url{http://www.infospheres.caltech.edu}}, 11632 key = {{Infospheres} {Web} page} 11633} 11634 11635@Misc{ hammond, 11636 author = {Glenn Hammond}, 11637 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 11638 communication} 11639} 11640 11641@Misc{ ornl, 11642 author = {Oak Ridge National Laboratory}, 11643 title = {Private communication via petsc-maint email support} 11644} 11645 11646@Unpublished{ cumulvs-web-page, 11647 author = {}, 11648 title = {{Cumulvs} {W}eb page}, 11649 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 11650 key = {{Cumulvs} {W}eb page} 11651} 11652 11653@Article{ nonlineargmres, 11654 author = {T. Washio and C. W. Oosterlee}, 11655 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 11656 journal = {ETNA}, 11657 year = {1997}, 11658 pages = {271--290}, 11659 volume = {6} 11660} 11661 11662@Article{ pcice, 11663 author = {Richard C. Martineau and Ray A. Berry}, 11664 title = {The pressure-corrected ICE finite element method for compressible flows on 11665 unstructured meshes}, 11666 journal = {Journal of Computational Physics}, 11667 year = {2004}, 11668 pages = {659--685}, 11669 volume = {198(2)} 11670} 11671 11672@Article{ cumulvs97, 11673 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 11674 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 11675 Applications}, 11676 journal = {International Journal of Supercomputing Applications}, 11677 year = {1997} 11678} 11679 11680@TechReport{ daly2012interagency, 11681 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 11682 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 11683 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 11684 Paul Woodward}, 11685 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 11686 year = {2012}, 11687 publisher = {US Department of Defense} 11688} 11689 11690@Article{ karpeev1, 11691 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 11692 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 11693 journal = {J. Comp. Phys.}, 11694 year = {2001}, 11695 pages = {116--148}, 11696 volume = {173} 11697} 11698 11699@InProceedings{ scirun97, 11700 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 11701 title = {The {SCIRun} Computational Steering System}, 11702 booktitle = {Modern Software Tools in Scientific Computing}, 11703 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 11704 publisher = {Birkhauser Press}, 11705 year = {1997} 11706} 11707 11708@TechReport{ szyld, 11709 author = {Valeria Simoncini and Daniel B. Szyld}, 11710 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 11711 Computing}, 11712 year = {2002}, 11713 institution = {Department of Mathematics, Temple University}, 11714 number = {02-4-12} 11715} 11716 11717@TechReport{ pdelab, 11718 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 11719 and C. C. Chui and S. Markus}, 11720 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 11721 for {PDE} Based Applications}, 11722 year = {1994}, 11723 institution = {Department of Computer Sciences, Purdue University}, 11724 number = {CSD-TR-94-021} 11725} 11726 11727@Unpublished{ ilu-web-page, 11728 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 11729 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 11730 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 11731} 11732 11733@Unpublished{ doe2k-web-page, 11734 title = {{DOE2000 Initiative} {W}eb page}, 11735 note = {http://www.mcs.anl.gov/DOE2000}, 11736 key = {DOE2000 Initiative} 11737} 11738 11739@Misc{ pvode-web-page, 11740 title = {{PVODE} {W}eb Page}, 11741 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 11742 author = {A. {Hindmarsh et al.}} 11743} 11744 11745@Book{ szyperski97, 11746 author = {Clemens Szyperski}, 11747 title = {Component Software: Beyond Object-Oriented Programming}, 11748 publisher = {ACM Press}, 11749 address = {New York}, 11750 year = {1997} 11751} 11752 11753@Unpublished{ petsc:coloringuse, 11754 title = {Code for computing sparse {J}acobians}, 11755 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 11756 institution = {Argonne National Laboratory} 11757} 11758 11759@Unpublished{ petsc:external, 11760 author = {B. F. {Smith et al.}}, 11761 title = {{External Software Used by PETSc}}, 11762 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 11763 institution = {Argonne National Laboratory} 11764} 11765 11766@Unpublished{ petsc:use-by-external-packages, 11767 author = {B. F. {Smith et al.}}, 11768 title = {{Software Packages that Use or Interface to PETSc}}, 11769 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 11770 institution = {Argonne National Laboratory} 11771} 11772 11773@Unpublished{ petsc:prizes, 11774 author = {B. F. {Smith et al.}}, 11775 title = {{Prizes Won Using PETSc}}, 11776 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 11777 institution = {Argonne National Laboratory} 11778} 11779 11780@Unpublished{ petsc:csgf, 11781 author = {B. F. {Smith et al.}}, 11782 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 11783 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 11784 institution = {Argonne National Laboratory} 11785} 11786 11787@Unpublished{ flash-web-page, 11788 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 11789 {W}eb Page}, 11790 note = {http://www.asci.uchicago.edu}, 11791 author = {R. {Rosner et al.}}, 11792 institution = {University of Chicago} 11793} 11794 11795@Unpublished{ esi-web-page, 11796 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 11797 note = {http://z.ca.sandia.gov/esi}, 11798 author = {R. {Clay et al.}} 11799} 11800 11801@Unpublished{ infobus-web-page, 11802 title = {{I}nfo{B}us {W}eb Page}, 11803 note = {http://www.java.sun.com/beans/infobus}, 11804 key = {infobus} 11805} 11806 11807@Unpublished{ xray-web-page, 11808 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 11809 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 11810 note = {http://www.mcs.anl.gov/xray/}, 11811 institution = {Argonne National Laboratory} 11812} 11813 11814@InProceedings{ kohn98, 11815 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 11816 title = {Language Interoperability Mechanisms for High-Performance Scientific 11817 Applications}, 11818 publisher = {SIAM}, 11819 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 11820 Scientific and Engineering Computing}, 11821 year = {1999}, 11822 pages = {30-39} 11823} 11824 11825@InProceedings{ kohn01, 11826 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 11827 title = {Divorcing Language Dependencies from a Scientific Software Library}, 11828 publisher = {SIAM}, 11829 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 11830 year = {2001} 11831} 11832 11833@InProceedings{ freitag_jones_plassmann98, 11834 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 11835 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 11836 publisher = {SIAM}, 11837 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 11838 Scientific and Engineering Computing}, 11839 year = {1999}, 11840 pages = {215-224} 11841} 11842 11843@Book{ templates, 11844 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 11845 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 11846 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 11847 Methods}, 11848 publisher = {SIAM}, 11849 year = {1994}, 11850 address = {Philadelphia, PA} 11851} 11852 11853@InProceedings{ parasha2, 11854 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 11855 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 11856 {PDE} Solutions}, 11857 booktitle = {SC97 Proceedings}, 11858 publisher = {IEEE Computer Society Press}, 11859 year = {1997} 11860} 11861 11862@TechReport{ parasha, 11863 author = {M. Parashar and J. C. Browne}, 11864 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 11865 Techniques}, 11866 institution = {Department of Computer Science, University of Texas at Austin}, 11867 year = {1995} 11868} 11869 11870@Article{ parti, 11871 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 11872 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 11873 Memory Architectures}, 11874 journal = {Journal of Parallel and Distributed Computing}, 11875 year = {1994}, 11876 volume = {22}, 11877 pages = {462--478} 11878} 11879 11880@Article{ mparti, 11881 author = {G. Agrawal and A. Sussman and J. Saltz}, 11882 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 11883 Block Structured Applications}, 11884 journal = {IEEE Trans. on Parallel and Distributed Systems}, 11885 volume = {6}, 11886 number = {7}, 11887 year = {1995} 11888} 11889 11890@Article{ gropp-lusk-doss-skjellum, 11891 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 11892 title = {A high-performance, portable implementation of the {MPI} Message Passing 11893 Interface standard}, 11894 journal = {Parallel Computing}, 11895 year = {1996}, 11896 volume = {22}, 11897 pages = {789--828} 11898} 11899 11900@InProceedings{ lam, 11901 author = {Greg Burns and Raja Daoud and James Vaigl}, 11902 title = {{LAM}: An Open Cluster Environment for {MPI}}, 11903 booktitle = {Proceedings of Supercomputing Symposium '94}, 11904 editor = {John W. Ross}, 11905 publisher = {University of Toronto}, 11906 pages = {379--386}, 11907 year = {1994} 11908} 11909 11910@Article{ cs99, 11911 author = {X.-C. Cai and M. Sarkis}, 11912 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 11913 systems}, 11914 journal = {SIAM J. Scientific Computing}, 11915 year = {1999}, 11916 volume = {21}, 11917 pages = {792-797} 11918} 11919 11920@TechReport{ cs97a, 11921 author = {X.-C. Cai and M. Sarkis}, 11922 title = {A restricted additive {S}chwarz preconditioner for general sparse linear systems 11923 }, 11924 year = {1997}, 11925 institution = {Computer Science Department, University of Colorado-Boulder}, 11926 number = {CU-CS 843-97}, 11927 note = {(accepted by SIAM J. of Scientific Computing)} 11928} 11929 11930@Article{ cai2003restricted, 11931 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 11932 positive definite linear systems}, 11933 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 11934 journal = {SIAM Journal on Numerical Analysis}, 11935 volume = {41}, 11936 issue = {1}, 11937 pages = {1209--1231}, 11938 year = {2003}, 11939 doi = {10.1137/S0036142901389621} 11940} 11941 11942@TechReport{ caisaad, 11943 author = {Xiao-Chuan Cai and Youcef Saad}, 11944 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 11945 institution = {Army High Performance Computing Research Center, University of Minnesota }, 11946 year = {1993}, 11947 number = {Preprint 93-027 }, 11948 note = {SIAM J. Sci. Comp. (submitted)} 11949} 11950 11951@Book{ ruminations, 11952 author = {Andrew Koenig and Barbara Moo}, 11953 title = {Ruminations on C++}, 11954 year = {1996}, 11955 publisher = {Addison-Wesley} 11956} 11957 11958@Book{ mpi-complete, 11959 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 11960 Dongarra}, 11961 title = {{MPI}: The Complete Reference}, 11962 year = {1995}, 11963 publisher = {MIT Press} 11964} 11965 11966@Unpublished{ tcl-tk-web-page, 11967 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 11968 note = {http://www.sunlabs.com/research/tcl/}, 11969 year = {1996}, 11970 month = aug 11971} 11972 11973@Misc{ mpich-web-page, 11974 author = {William Gropp and {et. al.}}, 11975 title = {{MPICH} {W}eb page}, 11976 key = {MPICH}, 11977 url = {http://www.mpich.org}, 11978 howpublished = {\url{http://www.mpich.org}} 11979} 11980 11981@Article{ mpi-final, 11982 author = {MPI Forum}, 11983 title = {{MPI}: A Message-Passing Interface Standard}, 11984 journal = {International J. Supercomputing Applications}, 11985 volume = {8}, 11986 number = {3/4}, 11987 year = {1994}, 11988 key = {MPI Standard - final} 11989} 11990 11991@Unpublished{ npb-web-page, 11992 key = {NAS Parallel Benchmarks}, 11993 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 11994 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 11995 year = {1996}, 11996 month = dec 11997} 11998 11999@Book{ george81, 12000 title = {Computer Solution of Large Sparse Positive Definite Systems}, 12001 author = {Alan George and Joseph W. Liu}, 12002 publisher = {Prentice-Hall}, 12003 year = {1981}, 12004 key = {SparseDirect} 12005} 12006 12007@Book{ p4-book, 12008 title = {Portable Programs for Parallel Processors}, 12009 publisher = {Holt, Rinehart, {and} Winston}, 12010 year = {1987}, 12011 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 12012 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 12013 key = {P4Book} 12014} 12015 12016@Article{ stones, 12017 author = {H. L. Stone}, 12018 title = {Iterative solution of implicit approximations of multidimensional partial 12019 differential equations}, 12020 journal = {SIAM J. Numerical Analysis}, 12021 pages = {87--113}, 12022 volumne = {5}, 12023 year = {1968} 12024} 12025 12026@Article{ parallelstones, 12027 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 12028 title = {Parallel versions of {S}tones strongly implicit algorithm}, 12029 journal = {Concurrency and Computation: Practice and Experience}, 12030 pages = {1049--1062}, 12031 volumne = {13}, 12032 year = {2001} 12033} 12034 12035@Article{ p4-paper, 12036 author = {Ralph Butler and Ewing Lusk}, 12037 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 12038 journal = {Journal of Parallel Computing}, 12039 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 12040 Division preprint P362-0493)}, 12041 year = {1993} 12042} 12043 12044@TechReport{ picl, 12045 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 12046 title = {{PICL}: A portable instrumented communications library}, 12047 institution = {Oak Ridge National Laboratory}, 12048 number = {TM-11130}, 12049 year = {1990}, 12050 key = {PICL} 12051} 12052 12053@TechReport{ upshot, 12054 author = {Virginia Herrarte and Ewing Lusk}, 12055 title = {Studying Parallel Program Behavior with {U}pshot}, 12056 institution = {Argonne National Laboratory}, 12057 number = {ANL-91/15}, 12058 month = aug, 12059 year = {1991}, 12060 key = {Upshot} 12061} 12062 12063@TechReport{ p4-manual, 12064 author = {Ralph Butler and Ewing Lusk}, 12065 title = {User's Guide to the p4 Parallel Programming System}, 12066 institution = {Argonne National Laboratory}, 12067 number = {ANL-92/17}, 12068 month = oct, 12069 year = {1992}, 12070 key = {p4-Manual} 12071} 12072 12073@InProceedings{ oldparti, 12074 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 12075 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 12076 booktitle = {Proceedings of Supercomputing '93}, 12077 pages = {578--587}, 12078 year = {1993} 12079} 12080 12081@Article{ parti2, 12082 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 12083 and J. Saltz}, 12084 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 12085 journal = {ACM SIGPLAN Notices}, 12086 year = {1995}, 12087 pages = {68-79}, 12088 volume = {30}, 12089 number = {8} 12090} 12091 12092@Article{ parti3, 12093 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 12094 title = {Run-Time Parallelization and Scheduling of Loops}, 12095 journal = {IEEE Trans. Computers}, 12096 year = {1991}, 12097 pages = {604-612}, 12098 volume = {40}, 12099 number = {5} 12100} 12101 12102@InProceedings{ disz-lusk:wamtrace, 12103 author = {Terrence Disz and Ewing Lusk}, 12104 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 12105 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 12106 year = {1987}, 12107 pages = {46--53} 12108} 12109 12110@InProceedings{ gorlick-kesselman:gauge, 12111 author = {Michael Gorlick and Carl Kesselman}, 12112 title = {Timing {Prolog} programs without Clocks}, 12113 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 12114 year = {1996}, 12115 publisher = {Birkhauser} 12116} 12117 12118@TechReport{ aztec, 12119 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 12120 title = {Aztec User's Guide Version 1.1}, 12121 institution = {Sandia National Laboratories}, 12122 month = oct, 12123 year = {1995}, 12124 number = {SAND95/1559} 12125} 12126 12127@TechReport{ aztec2, 12128 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 12129 title = {Official {Aztec} User's Guide Version 2.1}, 12130 institution = {Sandia National Laboratories}, 12131 year = {1999} 12132} 12133 12134@Book{ taylor-chandy:pcn, 12135 author = {Chandy, M. and Taylor, S.}, 12136 title = {An Introduction to Parallel Programming}, 12137 year = {1991}, 12138 publisher = {Jones and Bartlett} 12139} 12140 12141@Book{ foster-taylor:strand, 12142 title = {Strand: New Concepts in Parallel Programming}, 12143 author = {Ian Foster and Stephen Taylor}, 12144 publisher = {Prentice-Hall}, 12145 adress = { Englewood Cliffs, New Jersey}, 12146 year = {1990} 12147} 12148 12149@Article{ aurora, 12150 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 12151 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 12152 Carlsson and A. Ciepielewski and B. Hausman}, 12153 title = {The Aurora OR-Parallel Prolog System}, 12154 journal = {New Generation Computing}, 12155 volume = {7}, 12156 number = {3}, 12157 year = {1990}, 12158 pages = {243--271} 12159} 12160 12161@TechReport{ roo, 12162 author = {E. Lusk and W. McCune and J. Slaney}, 12163 title = {Roo---a Parallel Theorem Prover}, 12164 institution = {Argonne National Laboratory}, 12165 number = {MCS--TM--149}, 12166 year = {1991} 12167} 12168 12169@TechReport{ heath-etheridge:vppp, 12170 author = {M. T. Heath and J. A. Etheridge}, 12171 title = {Visualizing the Performance of Parallel Programs}, 12172 institution = {Oak Ridge National Laboratory}, 12173 number = {ORNL TM-11813}, 12174 year = {1991} 12175} 12176 12177@TechReport{ chem:vis, 12178 author = {Ewing L. Lusk}, 12179 title = {Performance Visualization for Parallel Programs}, 12180 institution = {Argonne National Laboratory}, 12181 number = {ANL/MCS--P287--0192}, 12182 year = {1991}, 12183 note = {(to appear in {\em Theoretica Chimica Acta})} 12184} 12185 12186@TechReport{ picltrace, 12187 author = {P.~H.~Worley}, 12188 title = {A new {PICL} trace file format}, 12189 institution = {Oak Ridge National Laboratory}, 12190 number = {ORNL TM-12125}, 12191 month = jun, 12192 year = {1992} 12193} 12194 12195@InProceedings{ hideo, 12196 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 12197 title = {Inference of Phylogenetic trees using maximum likelihood}, 12198 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 12199 year = {1992}, 12200 pages = {247--262} 12201} 12202 12203@InProceedings{ dw90, 12204 author = {M. Dryja and O. Widlund}, 12205 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 12206 Problems}, 12207 booktitle = {Third International Symposium on Domain Decomposition Methods}, 12208 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 12209 year = {1990}, 12210 pages = {3-21}, 12211 publisher = {SIAM}, 12212 address = {Philadelphia}, 12213 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 12214 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 12215 references, good introduction to the theory. No computations}, 12216 key = {DryjaWidlund90 !AS} 12217} 12218 12219@Unpublished{ rosing, 12220 author = {Matt Rosing and Joel Saltz}, 12221 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 12222 key = {LowLatency}, 12223 note = {manuscript, 1992} 12224} 12225 12226@TechReport{ jp:incomplete, 12227 author = {Mark T. Jones and Paul E. Plassmann}, 12228 title = {An Improved Incomplete {C}holesky Factorization}, 12229 institution = {Argonne National Laboratory}, 12230 address = {Argonne, IL}, 12231 type = {Preprint}, 12232 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 12233 number = {MCS-P206-0191}, 12234 year = {1991}, 12235 key = {jones} 12236} 12237 12238@InCollection{ jp:ima, 12239 author = {Mark Jones and Paul Plassmann}, 12240 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 12241 booktitle = {Graph Theory and Sparse Matrix Computation}, 12242 publisher = {Springer-Verlag}, 12243 series = {The IMA Volumes in Mathematics and Its Applications}, 12244 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 12245 volume = {56}, 12246 year = {1993}, 12247 pages = {229--245} 12248} 12249 12250@Article{ pw98, 12251 author = {M. Pernice and H. F. Walker}, 12252 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 12253 journal = {SIAM J. Sci. Stat. Comput.}, 12254 year = {1998}, 12255 volume = {19}, 12256 pages = {302--318} 12257} 12258 12259@TechReport{ ysmp83, 12260 key = {Eisenstat}, 12261 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 12262 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 12263 institution = {Department of Computer Science, Yale University}, 12264 number = {YALE/DCS/RR-265}, 12265 month = apr, 12266 year = {1983} 12267} 12268 12269@InBook{ ysmp84, 12270 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 12271 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 12272 title = {Elliptic Problem Solvers II}, 12273 publisher = {Academic Press}, 12274 pages = {45--52}, 12275 editors = {G. Birkhoff and A. Schoenstadt}, 12276 year = {1984} 12277} 12278 12279@TechReport{ sparsekit, 12280 key = {Saad}, 12281 author = {Youcef Saad}, 12282 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 12283 institution = {Center for Supercomputing Research and Development, University of Illinois at 12284 Urbana-Champaign}, 12285 number = {1029}, 12286 year = {1990} 12287} 12288 12289@TechReport{ pde-user-ref, 12290 author = {Barry F. Smith}, 12291 title = {Extensible {PDE} Solvers Package Users Manual}, 12292 institution = {Argonne National Laboratory}, 12293 month = sep, 12294 year = {1994}, 12295 number = {ANL-93/40}, 12296 key = {Smith94 ! PDE} 12297} 12298 12299@TechReport{ bs-user-ref, 12300 author = {Mark T. Jones and Paul E. Plassmann}, 12301 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 12302 of Sparse Linear Systems}, 12303 institution = {Argonne National Laboratory}, 12304 month = dec, 12305 year = {1995}, 12306 number = {ANL-95/48} 12307} 12308 12309@TechReport{ snes-user-ref, 12310 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 12311 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 12312 institution = {Argonne National Laboratory}, 12313 month = feb, 12314 year = {1995}, 12315 number = {ANL/MCS-TM-193}, 12316 key = {GroppMcInnesSmith95 ! SNES} 12317} 12318 12319@TechReport{ sles-user-ref, 12320 author = {William D. Gropp and Barry F. Smith}, 12321 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 12322 institution = {Argonne National Laboratory}, 12323 month = mar, 12324 year = {1993}, 12325 number = {ANL-93/8}, 12326 key = {GroppSmith93 ! SLES} 12327} 12328 12329@TechReport{ chameleon-user-ref, 12330 author = {William D. Gropp and Barry F. Smith}, 12331 title = {Chameleon Parallel programming tools Users Manual}, 12332 institution = {Argonne National Laboratory}, 12333 month = mar, 12334 year = {1993}, 12335 number = {ANL-93/23}, 12336 key = {GroppSmith93 ! Chameleon} 12337} 12338 12339@Article{ euclid2, 12340 author = {D. Hysom and A. Pothen}, 12341 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 12342 journal = {SIAM J. Sci. Comput.}, 12343 volume = {22}, 12344 number = {6}, 12345 pages = {2194--2215} 12346} 12347 12348@TechReport{ euclid1, 12349 author = {D. Hysom and A. Pothen}, 12350 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 12351 Solution of Sparse Linear Systems)}, 12352 institution = {Old Dominion University}, 12353 year = {2001} 12354} 12355 12356@TechReport{ ksp-user-ref, 12357 author = {William D. Gropp and Barry F. Smith}, 12358 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 12359 Methods}, 12360 institution = {Argonne National Laboratory}, 12361 month = aug, 12362 year = {1993}, 12363 number = {ANL-93/30}, 12364 key = {GroppSmith93 ! KSP} 12365} 12366 12367@TechReport{ mpi-chameleon, 12368 author = {William D. Gropp and Ewing Lusk}, 12369 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 12370 institution = {Argonne National Laboratory}, 12371 month = dec, 12372 year = {1992}, 12373 number = {ANL-92/47}, 12374 key = {GroppLusk92 ! MPI} 12375} 12376 12377@TechReport{ blockcomm-fortran, 12378 author = {William D. Gropp}, 12379 title = {Block{C}omm for {F}ortran}, 12380 institution = {Argonne National Laboratory}, 12381 month = may, 12382 year = {1993}, 12383 number = {ANL-93/00 (to appear)}, 12384 key = {Gropp93 ! BlockComm} 12385} 12386 12387@TechReport{ autodocument, 12388 author = {William D. Gropp}, 12389 title = {Automatic documentation of {C} programs}, 12390 institution = {Argonne National Laboratory}, 12391 month = may, 12392 year = {1993}, 12393 number = {ANL-93/00}, 12394 key = {Gropp93 ! Autodoc} 12395} 12396 12397@TechReport{ zipcode, 12398 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 12399 Manfred Morari}, 12400 title = {The {Z}ipcode message-passing system}, 12401 institution = {Lawrence Livermore National Laboratory}, 12402 month = sep, 12403 year = {1992}, 12404 number = {Unpublished}, 12405 key = {Skjellum92 ! Zipcode} 12406} 12407 12408@Article{ paragraph, 12409 author = {Michael T. Heath and Jennifer Etheridge Finger}, 12410 title = {Visualizing performance of parallel programs}, 12411 journal = {IEEE Software}, 12412 volume = {8}, 12413 number = {5}, 12414 month = sep, 12415 year = {1991}, 12416 pages = {29--39}, 12417 key = {Heath91 ! Paragraph} 12418} 12419 12420@Article{ gropp90, 12421 author = {William Gropp and Edward Smith}, 12422 title = {Computational Fluid Dynamics on Parallel Processors}, 12423 journal = {Computers and Fluids}, 12424 volume = {18}, 12425 year = {1990}, 12426 pages = {289--304}, 12427 key = {Gropp90 ! performance} 12428} 12429 12430@Article{ foster92, 12431 author = {Ian Foster and William Gropp and Rick Stevens}, 12432 title = {The parallel scalability of the spectral transform method}, 12433 journal = {Monthly Weather Review}, 12434 volume = {120}, 12435 year = {1992}, 12436 pages = {835--850}, 12437 key = {Foster92 ! performance} 12438} 12439 12440@InBook{ fgn, 12441 author = {R. Freund and G. H. Golub and N. Nachtigal}, 12442 title = {Iterative Solution of Linear Systems}, 12443 series = {Acta Numerica}, 12444 year = {1992}, 12445 publisher = {Cambridge University Press}, 12446 pages = {57--100} 12447} 12448 12449@TechReport{ nachtigal90, 12450 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 12451 title = {How Fast are Nonsymmetric Matrix Iterations?}, 12452 institution = {Massachusetts Institute of Technology}, 12453 month = mar, 12454 year = {1990}, 12455 number = {90-2}, 12456 key = {Nachtigal | Krylov} 12457} 12458 12459@Article{ nachtigal1992fnm, 12460 title = {How Fast are Nonsymmetric Matrix Iterations?}, 12461 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 12462 journal = {SIAM Journal on Matrix Analysis and Applications}, 12463 volume = {13}, 12464 pages = {778}, 12465 year = {1992}, 12466 publisher = {SIAM} 12467} 12468 12469@TechReport{ embree1999descriptive, 12470 title = {How descriptive are {GMRES} convergence bounds}, 12471 author = {Embree, M.}, 12472 year = {1999}, 12473 number = {08}, 12474 institution = {Oxford University Computing Laboratory} 12475} 12476 12477@Article{ vorst92, 12478 author = {H. van der Vorst}, 12479 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 12480 of nonsymmetric linear systems}, 12481 journal = {SIAM J. Sci. Stat. Comput.}, 12482 year = {1992}, 12483 volume = {13}, 12484 pages = {631--644} 12485} 12486 12487@Article{ eisenstat81, 12488 author = {S. Eisenstat}, 12489 title = {Efficient Implementation of a Class of {CG} Methods}, 12490 journal = {SIAM J. Sci. Stat. Comput.}, 12491 year = {1981}, 12492 volume = {2}, 12493 pages = {1--4} 12494} 12495 12496@Manual{ ibm-essl, 12497 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 12498 Reference}, 12499 organization = {IBM}, 12500 year = {1992}, 12501 key = {IBM-ESSL} 12502} 12503 12504@Manual{ ibm-eui, 12505 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 12506 Release 2.0}, 12507 organization = {IBM}, 12508 month = jun, 12509 year = {1994}, 12510 key = {IBM-EUI} 12511} 12512 12513@Manual{ ibm-euih, 12514 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 12515 organization = {IBM}, 12516 author = {Peter Hochschild}, 12517 year = {1993}, 12518 key = {IBM-EUIH} 12519} 12520 12521@TechReport{ mpi, 12522 title = {Document for a Standard Message-Passing Interface}, 12523 author = {Message Passing Interface Forum}, 12524 institution = {University of Tennessee}, 12525 number = {CS-93-214}, 12526 month = nov, 12527 year = {1993}, 12528 key = {MPI Standard} 12529} 12530 12531@Unpublished{ mpi-final-web, 12532 author = {Message Passing Interface Forum}, 12533 title = {{MPI}: A Message-Passing Interface Standard}, 12534 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 12535 year = {1994}, 12536 month = may 12537} 12538 12539@Book{ hockney-jesshope, 12540 author = {R. W. Hockney and C. R. Jesshope}, 12541 title = {Parallel Computers 2}, 12542 publisher = {Adam Hilger}, 12543 year = {1988} 12544} 12545 12546@Book{ cm-fortran, 12547 author = {{Thinking Machines Corporation}}, 12548 title = {Users Manual for CM-Fortran}, 12549 publisher = {Thinking Machines Corporation}, 12550 year = {1993} 12551} 12552 12553@TechReport{ chang93, 12554 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 12555 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 12556 institution = {Yale Department of Computer Science}, 12557 number = {YALEU/DCS/RR-994}, 12558 month = nov, 12559 year = {1993}, 12560 key = {BDD|diag} 12561} 12562 12563@InProceedings{ gropplevine93, 12564 author = {N. Galbreath and W. Gropp and D. Levine}, 12565 title = {Applications-Driven Parallel {I/O}}, 12566 booktitle = {Proceedings of Supercomputing '93}, 12567 year = {1993}, 12568 pages = {462--471} 12569} 12570 12571@Book{ siegle85, 12572 author = {H. J. Siegel}, 12573 title = {Interconnection Networks for Large Scale Parallel Processing}, 12574 publisher = {Lexington Books}, 12575 year = {1985}, 12576 key = {Network Comparison} 12577} 12578 12579@Article{ lawrie75, 12580 author = {D. H. Lawrie}, 12581 title = {Access and alignment of data in an array processor}, 12582 journal = {IEEE Transactions on Computers}, 12583 volume = {C-24}, 12584 number = {12}, 12585 month = dec, 12586 year = {1975}, 12587 pages = {1145--1155}, 12588 key = {Omega Network} 12589} 12590 12591@Book{ knuth1986, 12592 title = {The {\TeX}{Book}}, 12593 author = {Donald Ervin Knuth and Duane Bibby}, 12594 volume = {1993}, 12595 year = {1986}, 12596 publisher = {Addison-Wesley Reading, Massachusetts} 12597} 12598 12599@Book{ lamport86, 12600 author = {Leslie Lamport}, 12601 title = {{LaTeX}: A document preparation system}, 12602 publisher = {Addison-Wesley}, 12603 year = {1986}, 12604 key = {Latex Manual} 12605} 12606 12607@InProceedings{ gropp-lusk:unix-tools, 12608 author = {William Gropp and Ewing Lusk}, 12609 title = {Scalable {U}nix Tools on Parallel Processors}, 12610 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 12611 publisher = {IEEE}, 12612 pages = {56--62} 12613} 12614 12615@InProceedings{ jp:bell_prize, 12616 author = {Mark Jones and Paul Plassmann}, 12617 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 12618 Applications}, 12619 booktitle = {Proceedings of Supercomputing '92}, 12620 publisher = {IEEE Computer Society Press}, 12621 year = {1992}, 12622 pages = {551--560} 12623} 12624 12625@COMMENT{WEB, CWEB references (for doctext)} 12626@TechReport{ web, 12627 author = {Donald E. Knuth}, 12628 title = {The {\tt WEB} system of structured documentation}, 12629 institution = {Computer Science Department, Stanford University}, 12630 year = {1983}, 12631 number = {980}, 12632 month = sep 12633} 12634 12635@Article{ literatepgm, 12636 author = {Donald E. Knuth}, 12637 title = {Literate Programming}, 12638 journal = {Computer Journal}, 12639 year = {1984}, 12640 volume = {27}, 12641 number = {2}, 12642 pages = {91--111} 12643} 12644 12645@Unpublished{ cweb-code, 12646 author = {Silvio Levy and Donald E. Knuth}, 12647 title = {CWEB}, 12648 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 12649} 12650 12651@Article{ jp:scalable, 12652 author = {Mark Jones and Paul Plassmann}, 12653 title = {Scalable Iterative Solution of Sparse Linear Systems}, 12654 journal = {Parallel Computing}, 12655 volume = {20}, 12656 number = {5}, 12657 month = may, 12658 year = {1994}, 12659 pages = {753--773} 12660} 12661 12662@Article{ jp:pcolor, 12663 author = {Mark T. Jones and Paul E. Plassmann}, 12664 title = {A Parallel Graph Coloring Heuristic}, 12665 journal = {SIAM J. Sci. Comput.}, 12666 volume = {14}, 12667 number = {3}, 12668 pages = {654-669}, 12669 year = {1993} 12670} 12671 12672@TechReport{ block_solve, 12673 author = {Mark T. Jones and Paul E. Plassmann}, 12674 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 12675 Sparse Linear Systems}, 12676 institution = {Argonne National Laboratory}, 12677 year = {1992}, 12678 number = {ANL-92/46}, 12679 key = {JonesPlassmann92 ! block_solve} 12680} 12681 12682@InProceedings{ supercond, 12683 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 12684 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 12685 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 12686 Conference}, 12687 month = feb, 12688 year = {1994}, 12689 key = {McInnesPalumbo94 ! superconductivity } 12690} 12691 12692@Unpublished{ preosti:93, 12693 author = {Gianfranco Preosti}, 12694 title = { }, 12695 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 12696 year = {1993}, 12697 key = {preosti93 ! GL-tilt3d} 12698} 12699 12700@Unpublished{ more:93, 12701 author = {Jorge J. Mor\'{e}}, 12702 title = { }, 12703 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 12704 {A}rgonne {N}ational {L}aboratory}, 12705 year = {1993}, 12706 key = {more93 ! MINPACK-2} 12707} 12708 12709@Article{ brownsaad:90, 12710 author = {Peter N. Brown and Youcef Saad}, 12711 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 12712 journal = {SIAM J. Sci. Stat. Comput.}, 12713 year = {1990}, 12714 volume = {11}, 12715 pages = {450-481} 12716} 12717 12718@Book{ using-mpi, 12719 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 12720 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 12721 publisher = {MIT Press}, 12722 year = {1994} 12723} 12724 12725@Book{ using-mpi2, 12726 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 12727 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 12728 publisher = {MIT Press}, 12729 year = {1999} 12730} 12731 12732@Article{ hs:52, 12733 author = {Magnus R. Hestenes and Eduard Steifel}, 12734 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 12735 journal = {J. Research of the National Bureau of Standards}, 12736 year = {1952}, 12737 volume = {49}, 12738 pages = {409-436} 12739} 12740 12741@Article{ ss:86, 12742 author = {Youcef Saad and Martin H. Schultz}, 12743 title = {{GMRES}: A Generalized Minimal Residual Algorithm for Solving Nonsymmetric Linear 12744 Systems}, 12745 journal = {SIAM J. Sci. Stat. Comput.}, 12746 year = {1986}, 12747 volume = {7}, 12748 pages = {856-869} 12749} 12750 12751@Article{ so:89, 12752 author = {Peter Sonneveld}, 12753 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 12754 journal = {SIAM J. Sci. Stat. Comput.}, 12755 year = {1989}, 12756 volume = {10}, 12757 pages = {36-52} 12758} 12759 12760@Article{ v:92, 12761 author = {{H. A.} {van der Vorst}}, 12762 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 12763 of nonsymmetric linear systems}, 12764 journal = {SIAM J. Sci. Stat. Comput.}, 12765 volume = {13}, 12766 year = {1992}, 12767 pages = {631-644} 12768} 12769 12770@Article{ f:93, 12771 author = {Roland W. Freund}, 12772 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 12773 Systems}, 12774 journal = {SIAM J. Sci. Stat. Comput.}, 12775 volume = {14}, 12776 year = {1993}, 12777 pages = {470-482} 12778} 12779 12780@Article{ ish:89, 12781 author = {S. Ishizuka}, 12782 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 12783 journal = {Combustion and Flame}, 12784 volume = {75}, 12785 year = {1989}, 12786 pages = {367-379} 12787} 12788 12789@Book{ williams89, 12790 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 12791 author = {F.A. Williams}, 12792 publisher = {Addison-Wesley}, 12793 year = {1989}, 12794 pages = {367-379} 12795} 12796 12797@Book{ ra75, 12798 author = {R. Aris}, 12799 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 12800 publisher = {Oxford}, 12801 year = {1975} 12802} 12803 12804@Book{ bebernes89, 12805 author = {J. Bebernes and D. Eberly}, 12806 title = {Mathematical Problems from Combustion Theory}, 12807 publisher = {Springer-Verlag}, 12808 series = {Applied Mathematical Sciences 83}, 12809 year = {1989} 12810} 12811 12812@InProceedings{ kikuchi89, 12813 author = {F. Kikuchi}, 12814 booktitle = { Computing Methods in Applied Sciences and Engineering}, 12815 editor = {R. Glowinski and J. L. Lions}, 12816 publisher = {Springer-Verlag}, 12817 series = {Lecture Notes in Mathematics}, 12818 title = {Finite element approximations to bifurcation problems of turning point type}, 12819 year = {1977} 12820} 12821 12822@Article{ rg85, 12823 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 12824 title = {Continuation-conjugate Gradient Methods fo the Least Squares Solution of 12825 Nonlinear Boundary Problems}, 12826 journal = {SIAM J. Sci. Stat. Comput.}, 12827 volume = {6}, 12828 year = {1985}, 12829 pages = {793-832} 12830} 12831 12832@InProceedings{ whitfield91, 12833 author = {D. Whitfield and L. Taylor}, 12834 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 12835 Schemes}, 12836 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 12837 misc = {AIAA-91-1539}, 12838 pages = {134-145}, 12839 year = {1991} 12840} 12841 12842@InProceedings{ quinlan1, 12843 author = {M. Lemke and D. Quinlan}, 12844 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 12845 Architecture-Independent Development of Structured Grid Applications}, 12846 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 12847 publisher = {Springer Verlag}, 12848 year = {1992} 12849} 12850 12851@InProceedings{ quinlan2, 12852 author = {R. Parsons and D. Quinlan}, 12853 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 12854 Computations}, 12855 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 12856 year = {1994} 12857} 12858 12859% ***** Overview of functionality in Diffpack 12860@InBook{ dpoverview, 12861 author = {Bruaset, A. M. and Langtangen, H. P.}, 12862 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 12863 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 12864 {Diffpack}}, 12865 publisher = {Birkh{\"{a}}user}, 12866 pages = {61--90}, 12867 year = {1997} 12868} 12869 12870% ***** Short overview of Diffpack 12871@InCollection{ dpoverview2, 12872 author = {Bruaset, A. M. and Langtangen, H. P.}, 12873 editor = {A. Sydow}, 12874 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 12875 and Applied Mathematics}, 12876 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 12877 pages = {553--558}, 12878 volume = {4}, 12879 year = {1997} 12880} 12881 12882% ***** Comprehensive documentation of Diffpack and 12883% associated numerical methods: 12884@Book{ dpbook, 12885 author = {H. P. Langtangen}, 12886 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 12887 Software. Part I}, 12888 series = {Lecture Notes in Computational Science and Engineering}, 12889 publisher = {Springer-Verlag}, 12890 year = {1998} 12891} 12892 12893% ***** Design issues of the linear solvers in Diffpack, serves also as a 12894% collection of examples on O-O in numerical computing 12895@Article{ ambhpl97a, 12896 author = {A. M. Bruaset and H. P. Langtangen }, 12897 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 12898 journal = {Transactions on Mathematical Software}, 12899 volume = {23 }, 12900 pages = {50--80}, 12901 year = {1997} 12902} 12903 12904@Misc{ dpurl, 12905 author = {{Diffpack Web page}}, 12906 howpublished = {\url{http://www.diffpack.com}} 12907} 12908 12909% ***** General intro to object-oriented numerics for "FORTRAN programmers" 12910@InCollection{ oonintro, 12911 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 12912 editor = {D{\ae}hlen, M. and Tveito, A.}, 12913 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 12914 title = {Object-Oriented Numerics}, 12915 publisher = {Birkh{\"{a}}user}, 12916 year = {1997} 12917} 12918 12919% ***** Efficiency comparison: BLAS 1, Diffpack, C, 12920% and finite element applications (F77 vs Diffpack) 12921@InCollection{ dpefficiency, 12922 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 12923 H. P. and Miller, C. T.}, 12924 editor = {D{\ae}hlen, M. and Tveito, A.}, 12925 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 12926 title = {On the Efficiency of {C++} in Scientific Computing}, 12927 publisher = {Birkh{\"{a}}user}, 12928 pages = {91--118}, 12929 year = {1997} 12930} 12931 12932% ***** Parallel concept in Diffpack: 12933@InCollection{ dpparallel, 12934 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 12935 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 12936 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 12937 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 12938 Simulators}, 12939 publisher = {Springer--Verlag}, 12940 series = {Lecture Notes in Computer Science}, 12941 pages = {161--168}, 12942 year = {1997} 12943} 12944 12945% ***** DD and ML methods in Diffpack: 12946@InCollection{ dpddml, 12947 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 12948 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 12949 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 12950 title = {Domain decomposition and multilevel methods in Diffpack}, 12951 year = {1997} 12952} 12953 12954@InProceedings{ bsca98, 12955 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 12956 Alexander}, 12957 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 12958 Optimization}, 12959 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12960 Scientific and Engineering Computing}, 12961 editor = {Mike Henderson et al.}, 12962 pages = {165-173}, 12963 year = {1998} 12964} 12965 12966@Book{ scalapack-user-guide, 12967 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 12968 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 12969 Stanley and D. Walker and R. C. Whaley}, 12970 title = {Sca{LAPACK} Users' Guide}, 12971 publisher = {SIAM}, 12972 address = {Philadelphia, PA}, 12973 year = {1997} 12974} 12975 12976@InProceedings{ keyes99, 12977 author = {D. E. Keyes}, 12978 title = {How Scalable is Domain Decomposition in Practice?}, 12979 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 12980 Methods}, 12981 editor = {C.-H. Lai et al.}, 12982 publisher = {Domain Decomposition Press, Bergen}, 12983 note = {To appear}, 12984 year = {1999} 12985} 12986 12987@Article{ fun3d, 12988 author = {W. K. Anderson and D. L. Bonhaus}, 12989 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 12990 grids}, 12991 journal = {Computers and Fluids}, 12992 year = {1994}, 12993 volume = {23}, 12994 pages = {1--21} 12995} 12996 12997% ------------------------------------------------------------------------- 12998% ------------------------------------------------------------------------- 12999@Article{ torczon, 13000 author = {Dennis, Jr., J. E. and V.~Torczon}, 13001 title = {Direct Search Methods on Parallel Machines}, 13002 journal = {SIAM J. Optimization}, 13003 volume = {1}, 13004 pages = {448--474}, 13005 year = {1991}, 13006 key = {Torczon !PDS} 13007} 13008 13009@InProceedings{ wt91, 13010 author = {D. L. Whitfield and L. K. Taylor}, 13011 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13012 Schemes}, 13013 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 13014 misc = {AIAA-91-1539}, 13015 pages = {134-145}, 13016 year = {1991} 13017} 13018 13019@Article{ ew96, 13020 author = {S. C. Eisenstat and H. F. Walker}, 13021 title = {Choosing the forcing terms in an inexact {N}ewton method}, 13022 journal = {SIAM J. Scientific Computing}, 13023 volume = {17}, 13024 year = {1996}, 13025 pages = {16--32} 13026} 13027 13028@Book{ thi93, 13029 author = {{Thinking Machines Corporation}}, 13030 title = {Users Manual for CM-Fortran}, 13031 publisher = {Thinking Machines Corporation}, 13032 year = {1993} 13033} 13034 13035@Book{ mortonmayers94, 13036 author = {K. W. Morton and D. F. Mayers}, 13037 title = {Numerical Solution of Partial Differential Equations}, 13038 publisher = {Press Syndicate of the University of Cambridge}, 13039 year = {1994} 13040} 13041 13042@Book{ heath97, 13043 author = {Michael T. Heath}, 13044 title = {Scientific Computing: An Introductory Survey}, 13045 publisher = {McGraw Hill}, 13046 year = {1997} 13047} 13048 13049@Article{ captools96, 13050 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 13051 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 13052 Performance on the Parallelization of Structured Mesh Codes}, 13053 journal = {Parallel Computing}, 13054 volume = {22}, 13055 pages = {197-226}, 13056 year = {1996} 13057} 13058 13059@Unpublished{ nastran-web-page, 13060 author = {{MSC Software Corporation}}, 13061 title = {{NASTRAN} {W}eb page}, 13062 note = {See {\tt http://www.mechsolutions.com\-/products\-/nastran/}} 13063} 13064 13065@Book{ hpf, 13066 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 13067 Zosel}, 13068 title = {The High Performance Fotran Handbook}, 13069 publisher = {MIT Press}, 13070 year = {1994} 13071} 13072 13073@InProceedings{ keyes98, 13074 author = {D. E. Keyes}, 13075 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 13076 Architectures}, 13077 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 13078 editors = {M. D. Salas and W. K. Anderson}, 13079 ppublisher = {Elsevier}, 13080 year = {1998} 13081} 13082 13083@InProceedings{ pooma-atlas, 13084 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 13085 J. V. W. Reynders and M. Tholburn}, 13086 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 13087 Applications}, 13088 year = {1995}, 13089 month = dec, 13090 booktitle = {Supercomputing '95 Proceedings} 13091} 13092 13093% --------------------------------------------------------------------------------- 13094% New bib entries for CRPC paper 13095@Misc{ mgnet-web-page, 13096 author = {Craig C. Douglas}, 13097 title = {{MGNet Web page}}, 13098 note = {See {\tt http://\-www.mgnet.org}} 13099} 13100 13101@Misc{ dagh-web-page, 13102 author = {M. Parashar and J. C. Browne}, 13103 title = {{DAGH Web page}}, 13104 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 13105} 13106 13107@Misc{ parasol-web-page, 13108 key = {PARASOL}, 13109 title = {{PARASOL Web page}}, 13110 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 13111} 13112 13113@Misc{ pooma-web-page, 13114 author = {{POOMA Web page}}, 13115 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 13116} 13117 13118@Misc{ mudpack-web-page, 13119 author = {John C. Adams}, 13120 title = {{MUDPACK Web page}}, 13121 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 13122} 13123 13124@Misc{ pellpack-web-page, 13125 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 13126 title = {{Parallel ELLPACK Web page}}, 13127 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 13128} 13129 13130@InProceedings{ pellpack95, 13131 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 13132 Catlin and S. Weerawarana and T.S. Papatheodorou}, 13133 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 13134 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 13135 address = {Albuquerque, NM}, 13136 year = {1995} 13137} 13138 13139@Misc{ nhse-web-page, 13140 author = {{National High-Performance Software Exchange Web page}}, 13141 note = {See {\tt http://\-www.nhse.org}} 13142} 13143 13144@Misc{ doug-web-page, 13145 author = {Mark J. Hagger and Linda Stals}, 13146 title = {{DOUG Web Page}}, 13147 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 13148} 13149 13150@TechReport{ doug97, 13151 author = {Mark J. Hagger}, 13152 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 13153 institution = {Mathematical Sciences, University of Bath}, 13154 year = {1997}, 13155 number = {9706}, 13156 note = {Advances in Computational Mathematics (to appear)} 13157} 13158 13159@Misc{ ug-web-page, 13160 author = {{UG Web Page}}, 13161 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 13162} 13163 13164@Article{ ug97, 13165 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 13166 Rentz-Reichert and C. Wieners}, 13167 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 13168 journal = {Computing and Visualization in Science}, 13169 year = {1997}, 13170 volume = {}, 13171 pages = {} 13172} 13173 13174@Misc{ vecfem-web-page, 13175 author = {Lutz Grosz}, 13176 title = {{VECFEM Web Page}}, 13177 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 13178} 13179 13180@Misc{ atlas-web-page, 13181 author = {R. Clint {Whaley et al.}}, 13182 title = {{ATLAS Web Page}}, 13183 howpublished = {\url{http://math-atlas.sourceforge.net}} 13184} 13185 13186@Misc{ fenics-web-page, 13187 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 13188 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 13189 title = {{FEniCS Web Page}}, 13190 note = {\url{http://www.fenicsproject.org}}, 13191 year = {2005} 13192} 13193 13194@Misc{ matlab-web-page, 13195 author = {{The} {MathWorks}}, 13196 title = {{Matlab} {Web} page}, 13197 url = {http://www.mathworks.com} 13198} 13199 13200@Misc{ phipac-web-page, 13201 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 13202 and D. Lam}, 13203 title = {{PHiPAC Web Page}}, 13204 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 13205} 13206 13207@InProceedings{ kelp, 13208 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 13209 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 13210 booktitle = {Irregular '96}, 13211 year = {1996} 13212} 13213 13214@Unpublished{ kelp-web-page, 13215 author = {Scott Baden}, 13216 title = {{KeLP} {W}eb page}, 13217 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 13218} 13219 13220@InProceedings{ hk99, 13221 author = {R. Hornung and S. Kohn}, 13222 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 13223 Framework}, 13224 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 13225 Scientific and Engineering Computing}, 13226 pages = {235-244}, 13227 year = {1999}, 13228 note = {See \url{http://www.llnl.gov/CASC/samrai}} 13229} 13230 13231@Unpublished{ samrai-web-page, 13232 title = {{SAMRAI} {W}eb Page}, 13233 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 13234 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 13235} 13236 13237@Misc{ overture-web-page, 13238 author = {William Henshaw and Kyle Chand}, 13239 title = {{Overture} {W}eb page}, 13240 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 13241} 13242 13243@InProceedings{ overture99, 13244 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 13245 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 13246 on Overlapping Grids}, 13247 publisher = {SIAM}, 13248 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 13249 Scientific and Engineering Computing}, 13250 year = {1999}, 13251 pages = {215-224}, 13252 note = {See \url{http://www.llnl.gov/CASC/Overture}} 13253} 13254 13255@InProceedings{ diffpack, 13256 author = {A.M. Bruaset and H.P. Langtangen}, 13257 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 13258 {D}iffpack}, 13259 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 13260 year = {1997}, 13261 pages = {61--90}, 13262 publisher = {Birkhauser Press} 13263} 13264 13265@Article{ dongarra:1984:ila, 13266 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 13267 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 13268 Machine}, 13269 journal = {SIAM Review}, 13270 volume = {26}, 13271 number = {1}, 13272 pages = {91--112}, 13273 month = jan, 13274 year = {1984}, 13275 coden = {SIREAD}, 13276 issn = {0036-1445 (print), 1095-7200 (electronic)}, 13277 mrclass = {65F10 (65F30)}, 13278 mrnumber = {85c:65032}, 13279 bibdate = {Mon Jan 20 1997}, 13280 abstract = {The authors examine common implementations of linear algebra algorithms, such as 13281 matrix-vector multiplication, matrix-matrix multiplication and the solution of 13282 linear equations. The different versions are examined for efficiency on a computer 13283 architecture which uses vector processing and has pipelined instruction execution. 13284 By using the advanced architectural features of such machines, one can usually 13285 achieve maximum performance, and tremendous improvements in terms of execution 13286 speed can be seen over conventional computers.}, 13287 classification= {723; 921}, 13288 journalabr = {SIAM Rev}, 13289 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 13290 mathematical programming; vector pipeline machine} 13291} 13292 13293@Book{ qv99, 13294 author = {Alfio Quarteroni and Alberto Valli}, 13295 title = {Domain Decomposition Methods for Partial Differential Equations}, 13296 publisher = {Oxford Science Publications}, 13297 address = {Oxford}, 13298 year = {1999} 13299} 13300 13301@Book{ ksv97, 13302 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 13303 title = {Parallel Numerical Algorithms}, 13304 publisher = {Kluwer Academic Publishers}, 13305 address = {the Netherlands}, 13306 year = {1997} 13307} 13308 13309@Book{ hackbusch94, 13310 author = {Wolfgang Hackbusch}, 13311 title = {Iterative Solution of Large Sparse Systems of Equations}, 13312 publisher = {Springer-Verlag}, 13313 address = {New York}, 13314 year = {1994} 13315} 13316 13317@Article{ hackbusch1980fast, 13318 title = {Fast solution of elliptic control problems}, 13319 author = {Hackbusch, W.}, 13320 journal = {Journal of Optimization Theory and Applications}, 13321 volume = {31}, 13322 number = {4}, 13323 pages = {565--581}, 13324 year = {1980}, 13325 publisher = {Springer} 13326} 13327 13328@Book{ hackbusch1985multi, 13329 title = {{Multi-grid methods and applications}}, 13330 author = {Hackbusch, W.}, 13331 isbn = {3540127615}, 13332 issn = {0179-3632}, 13333 year = {1985}, 13334 publisher = {Springer Verlag} 13335} 13336 13337@Book{ axelsson94, 13338 author = {Owe Axelsson}, 13339 title = {Iterative Solution Methods}, 13340 publisher = {Cambridge University Press}, 13341 address = {Cambridge}, 13342 year = {1994} 13343} 13344 13345@Book{ saad96, 13346 author = {Yousef Saad}, 13347 title = {Iterative Methods for Sparse Linear Systems}, 13348 publisher = {PWS Publishing Company}, 13349 address = {Boston}, 13350 year = {1996} 13351} 13352 13353@Book{ saad2003, 13354 title = {Iterative Methods for Sparse Linear Systems}, 13355 author = {Saad, Yousef}, 13356 doi = {10.1016/S1570-579X(01)80025-2}, 13357 edition = {2nd}, 13358 publisher = {SIAM}, 13359 year = {2003} 13360} 13361 13362@Book{ vandervorst03, 13363 author = {Henk A. {van der Vorst}}, 13364 title = {Iterative Krylov Methods for Large Linear Systems}, 13365 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 13366 year = {2003} 13367} 13368 13369@Book{ koniges00, 13370 editor = {Alice E. Koniges}, 13371 title = {Industrial Strength Parallel Computing}, 13372 publisher = {Morgan Kaufmann Publishers}, 13373 address = {San Francisco}, 13374 year = {2000} 13375} 13376 13377@Misc{ fftw-web-page, 13378 key = {Fftw}, 13379 title = {{FFTW} {Web} page}, 13380 note = {\texttt{http://www.fftw.org/}}, 13381 annote = {fast FFT. Parallel versions with MPI and Cilk} 13382} 13383 13384@InProceedings{ frigojohnson93, 13385 author = {Matteo Frigo and Steven G. Johnson}, 13386 title = {The Design and Implementation of {FFTW3}}, 13387 booktitle = {Proceedings of the IEEE}, 13388 volume = {93}, 13389 number = {2}, 13390 pages = {216--231}, 13391 year = {2005} 13392} 13393 13394@Book{ kelley95, 13395 author = {C. T. Kelley}, 13396 title = {Iterative Methods for Linear and Nonlinear Equations}, 13397 year = {1995}, 13398 publisher = {SIAM}, 13399 address = {Philadelphia} 13400} 13401 13402@Unpublished{ spai-web-page, 13403 title = {{SPAI} {W}eb {P}age}, 13404 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 13405 author = {Steven Bernard and Marcus Grote}, 13406 institution = {NASA Ames Research Center and ETH Zurich} 13407} 13408 13409@Article{ gh97, 13410 author = {M. J. Grote and T. Huckle}, 13411 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 13412 year = {1997}, 13413 journal = {SIAM J. of Scient. Comput.}, 13414 volume = {18}, 13415 pages = {838-853} 13416} 13417 13418@Article{ zhang96, 13419 author = {Wen Zhang}, 13420 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 13421 simulation of a sintering process}, 13422 year = {1996}, 13423 journal = {Appl. Numer. Math.}, 13424 volume = {20}, 13425 pages = {235-244} 13426} 13427 13428@Article{ zhang98, 13429 author = {Wen Zhang and Ian Gladwell}, 13430 title = {The sintering of two particles by surface and grain boundary diffusion - a 13431 three-dimensional numerical study}, 13432 journal = {Comp. Mater. Sci.}, 13433 year = {1998}, 13434 volume = {12} 13435} 13436 13437@InProceedings{ mollerschwartzbach01, 13438 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 13439 title = {The Pointer Assertion Logic Engine}, 13440 booktitle = {ACM Proceedings of PLDI'01}, 13441 year = {2001} 13442} 13443 13444@InProceedings{ klarlandschwartzbach97, 13445 author = {Nils Klarland and Michael I. Schwartzbach}, 13446 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 13447 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 13448 publisher = {USENIX}, 13449 month = oct, 13450 year = {1997}, 13451 address = {Santa Barbara, CA} 13452} 13453 13454@InProceedings{ conselmarlet98, 13455 author = {C. Consel and R. Marlet}, 13456 title = {Architecturing software using a methodology for language development}, 13457 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 13458 Implementations, Logics and Programs}, 13459 year = {1998}, 13460 pages = {170-174}, 13461 month = sep, 13462 address = {Pisa, Italy} 13463} 13464 13465@Misc{ sundials:homepage, 13466 author = {C. {Woodward et al.}}, 13467 title = {{SUNDIALS {W}eb page}}, 13468 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 13469} 13470 13471@article{gardner2022sundials, 13472 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 13473 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 13474 journal = {ACM Transactions on Mathematical Software (TOMS)}, 13475 publisher = {ACM}, 13476 year = {2022}, 13477 doi = {10.1145/3539801} 13478} 13479 13480@Misc{ sundials-user-ref, 13481 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 13482 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 13483 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 13484 and Dan Shumaker and Carol Woodward}, 13485 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 13486 number = {UCRL-JP-200037}, 13487 year = {2003} 13488} 13489 13490@Article{ sundials05, 13491 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 13492 and C. Woodward}, 13493 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 13494 journal = {ACM Transactions on Mathematical Software}, 13495 volume = {31}, 13496 number = {3}, 13497 pages = {363--396}, 13498 year = {2005} 13499} 13500 13501@InProceedings{ serban2005cvodes, 13502 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 13503 author = {Serban, Radu and Hindmarsh, Alan C}, 13504 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 13505 Dynamics and Control, Long Beach, CA}, 13506 year = {2005} 13507} 13508 13509@Article{ pvode99, 13510 author = {G. Byrne and A. Hindmarsh}, 13511 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 13512 journal = {Int. J. High Perf. Comput. Apps.}, 13513 volume = {13}, 13514 number = {4}, 13515 year = {1999}, 13516 pages = {354 -- 365} 13517} 13518 13519@Article{ cvode95, 13520 author = {S. Cohen and A. Hindmarsh}, 13521 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 13522 journal = {Computers in Physics}, 13523 volume = {10}, 13524 number = {2}, 13525 year = {1996}, 13526 pages = {138 -- 143} 13527} 13528 13529@TechReport{ ifpack, 13530 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 13531 author = {Marzio Sala and Michael Heroux}, 13532 institution = {Sandia National Laboratories}, 13533 number = {SAND2005-0662}, 13534 year = {2005} 13535} 13536 13537@TechReport{ kinsol-user-ref, 13538 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 13539 Computers}, 13540 author = {Allan Taylor and Alan Hindmarsh}, 13541 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 13542 number = {UCRL-ID-131185}, 13543 year = {1998} 13544} 13545 13546@Article{ fiardmanteuffelmccormick98, 13547 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 13548 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 13549 numerical results}, 13550 journal = {SIAM J. Sci. Comp.}, 13551 year = {1998}, 13552 volume = {19}, 13553 pages = {1958--1979} 13554} 13555 13556@InProceedings{ vuduc02, 13557 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 13558 Rajesh Nishtala and Benjamin Lee}, 13559 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 13560 booktitle = {Proceedings of Supercomputing}, 13561 year = {2002}, 13562 month = nov, 13563 address = {Baltimore} 13564} 13565 13566@Article{ beckerbraackrannacher1999, 13567 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 13568 elements}, 13569 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 13570 journal = {Combustion Theory and Modelling}, 13571 volume = {3}, 13572 pages = {503--534}, 13573 year = {1999} 13574} 13575 13576@Article{ beckerrannacher01, 13577 author = {R. Becker and R. Rannacher}, 13578 title = {An optimal control approach to a posteriori error estimation in finite element 13579 methods}, 13580 journal = {Acta Numerica}, 13581 year = {2001}, 13582 volume = {10}, 13583 pages = {1--102} 13584} 13585 13586@Article{ babuskamiller84a, 13587 author = {I. Babu$\check{s}$ka and A.D. Miller}, 13588 title = {The post-processing approach in the finite element method, {I}: Calculations of 13589 displacements, stresses, and other higher derivatives of the displacements}, 13590 journal = {Int. J. Numer. Meth. Eng.}, 13591 year = {1984}, 13592 volume = {20}, 13593 pages = {1085--1109} 13594} 13595 13596@Article{ babuskamiller84b, 13597 author = {I. Babu$\check{s}$ka and A.D. Miller}, 13598 title = {The post-processing approach in the finite element method, {II}: The calculation 13599 of stress intensity factors}, 13600 journal = {Int. J. Numer. Meth. Eng.}, 13601 year = {1984}, 13602 volume = {20}, 13603 pages = {1111--1129} 13604} 13605 13606@Article{ babuskamiller84c, 13607 author = {I. Babu$\check{s}$ka and A.D. Miller}, 13608 title = {The post-processing approach in the finite element method, {III}: A posteriori 13609 error estimation and adaptive mesh refinement}, 13610 journal = {Int. J. Numer. Meth. Eng.}, 13611 year = {1984}, 13612 volume = {20}, 13613 pages = {2311--2324} 13614} 13615 13616@Unpublished{ jtb-web-page, 13617 title = {{The Java Tree Builder}}, 13618 note = {See \url{http://www.cs.purdue.edu/jtb}}, 13619 author = {Jens Palsberg}, 13620 institution = {Purdue University} 13621} 13622 13623@Unpublished{ palsberg98, 13624 title = {Why Visitors?}, 13625 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 13626 author = {Jens Palsberg}, 13627 institution = {Purdue University}, 13628 year = {1998} 13629} 13630 13631@Unpublished{ ply-web-page, 13632 title = {{PLY (Python Lex-Yacc)}}, 13633 note = {\url{http://systems.cs.chicago.edu/ply}}, 13634 author = {David Beazley}, 13635 institution = {University of Chicago} 13636} 13637 13638@Misc{ adic-web-page, 13639 title = {{ADIC Web page}}, 13640 note = {\url{http://www.mcs.anl.gov/autodiff}}, 13641 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 13642 institution = {Argonne National Laboratory} 13643} 13644 13645@Article{ naumann02, 13646 author = {Uwe Naumann}, 13647 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 13648 computational graph}, 13649 journal = {Mathematical Programming (to appear)}, 13650 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 13651 year = {2003} 13652} 13653 13654@Article{ kaper1, 13655 author = {H. G. Kaper and T. J. Kaper}, 13656 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 13657 journal = {Physica D}, 13658 year = {2002}, 13659 pages = {66--93}, 13660 volume = {165} 13661} 13662 13663@Misc{ veltisto-web-page, 13664 author = {George Biros}, 13665 title = {{Veltisto Web page}}, 13666 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 13667} 13668 13669@Article{ karypiskumar98, 13670 author = {George Karypis and Vipin Kumar}, 13671 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 13672 Ordering}, 13673 journal = {Journal of Parallel and Distributed Computing}, 13674 volume = {48}, 13675 pages = {71--85}, 13676 year = {1998} 13677} 13678 13679@TechReport{ karypiskumar97, 13680 author = {Karypis, George and Kumar, V.}, 13681 institution = {Department of Computer Science, University of Minnesota}, 13682 keywords = {graph partitioning; ParMetis}, 13683 note = {http://www.cs.umn.edu/~metis}, 13684 number = {97-060}, 13685 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 13686 year = {1997} 13687} 13688 13689@Misc{ parmetis-web-page, 13690 author = {George {Karypis et al.}}, 13691 title = {{ParMETIS Web page}}, 13692 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 13693 year = {2005} 13694} 13695 13696@Misc{ sparskit-web-page, 13697 author = {Yousef {Saad et al.}}, 13698 title = {{SPARSKIT Web page}}, 13699 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 13700} 13701 13702@Misc{ dscpack-web-page, 13703 author = {Padma Raghavan}, 13704 title = {{DSCPACK Web page}}, 13705 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 13706} 13707 13708@Misc{ gaussian-web-page, 13709 author = {}, 13710 title = {{Gaussian Web page}}, 13711 note = {\url{http://gaussian.com}}, 13712 key = {{Gaussian} {Web} page} 13713} 13714 13715@Book{ lapack-user-guide, 13716 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 13717 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 13718 Sorensen}, 13719 title = {LAPACK Users' Guide, Third Edition}, 13720 publisher = {SIAM}, 13721 year = {1999} 13722} 13723 13724@Manual{ nwchem4.1, 13725 author = {High Performance Computational Chemistry Group}, 13726 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 13727 year = {2002}, 13728 organization = {Pacific Northwest National Laboratory}, 13729 address = {Richland, Washington 99325-0999 USA}, 13730 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 13731} 13732 13733@TechReport{ tchem, 13734 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 13735 author = {Cosmin Safta and Habib Najm and Omar Knio}, 13736 institution = {Sandia National Laboratories}, 13737 number = {SAND2011-3282}, 13738 year = {2011} 13739} 13740 13741@Misc{ scidac-web-page, 13742 author = {}, 13743 title = {{{SciDAC Initiative Web page}}}, 13744 note = {\url{http://www.osti.gov/scidac}}, 13745 key = {{SciDAC Initiative Web page}} 13746} 13747 13748@Misc{ cmrs:homepage, 13749 author = {Amitava {Bhattacharjee (PI)}}, 13750 title = {{Center for Magnetic Reconnection Studies}}, 13751 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 13752} 13753 13754@Misc{ tops:homepage, 13755 author = {David {Keyes (PI)}}, 13756 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 13757 howpublished = {\url{http://scalablesolvers.org}} 13758} 13759 13760@Misc{ tstt:homepage, 13761 author = {David Brown and Jim Glimm and Lori Freitag}, 13762 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 13763 howpublished = {\url{http://www.tstt-scidac.org}}, 13764 year = {2005} 13765} 13766 13767@Misc{ petsc:applications, 13768 author = {B. F. {Smith et al.}}, 13769 title = {{Scientific Applications Using {PETSc}}}, 13770 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 13771} 13772 13773@Misc{ petsc:users, 13774 author = {B. F. {Smith et al.}}, 13775 title = {{PETSc User Statistics}}, 13776 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 13777} 13778 13779@Misc{ cemm:homepage, 13780 author = {Steve {Jardin (PI)}}, 13781 title = {{Center for Extended MHD Modeling}}, 13782 howpublished = {\url{http://w3.pppl.gov/CEMM}} 13783} 13784 13785@Misc{ m3d:homepage, 13786 author = {Steve {Jardin et al.}}, 13787 title = {{M3D Web page}}, 13788 howpublished = {\url{http://w3.pppl.gov/m3d}} 13789} 13790 13791@Misc{ nimrod:homepage, 13792 author = {Carl R. {Sovinec et al.}}, 13793 title = {{NIMROD Web page}}, 13794 howpublished = {http://nimrodteam.org} 13795} 13796 13797@Misc{ grace-web-page, 13798 author = {Manish {Parashar et al.}}, 13799 title = {{GrACE Web Page}}, 13800 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 13801} 13802 13803@Misc{ accel1, 13804 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 13805 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 13806 author = {K. Ko and R. Ryne (PIs)} 13807} 13808 13809@Unpublished{ katzspiegelman03, 13810 author = {Richard F. Katz and Marc Spiegelman}, 13811 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 13812 advection-diffusion problems}, 13813 note = {Columbia University, in preparation} 13814} 13815 13816@Misc{ acts:homepage, 13817 author = {}, 13818 title = {{Advanced CompuTational Software (ACTS) Web page}}, 13819 howpublished = {\url{http://acts.nersc.gov}}, 13820 key = {{Advanced CompuTational Software (ACTS) Web page}} 13821} 13822 13823@Article{ superlu99, 13824 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 13825 Joseph W. H. Liu}, 13826 title = {A supernodal approach to sparse partial pivoting}, 13827 journal = {SIAM J. Matrix Analysis and Applications}, 13828 year = {1999}, 13829 volume = {20}, 13830 number = {3}, 13831 pages = {720-755} 13832} 13833 13834@Misc{ superlu:homepage, 13835 author = {J. Demmel and J. Gilbert and X. Li}, 13836 title = {{SuperLU Web page}}, 13837 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 13838} 13839 13840@InProceedings{ ccf98, 13841 author = {E. Chow and A. Cleary and R. Falgout}, 13842 title = {Design of the hypre Preconditioner Library}, 13843 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 13844 Scientific and Engineering Computing}, 13845 publisher = {SIAM}, 13846 year = {1999} 13847} 13848 13849@TechReport{ hypre-users-manual, 13850 author = {R. Falgout}, 13851 title = {{hypre} Users Manual}, 13852 number = {Revision 2.28}, 13853 institution = {Lawrence Livermore National Laboratory}, 13854 year = {2023}, 13855 url = {https://hypre.readthedocs.io/} 13856} 13857 13858@Misc{ hypre:homepage, 13859 author = {R. Falgout}, 13860 title = {{hypre Web page}}, 13861 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 13862} 13863 13864@InProceedings{ trilinos:gpu, 13865 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 13866 title = {A Light-weight API for Portable Multicore Programming}, 13867 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 13868 Network-Based Processing (PDP)}, 13869 pages = {601--606}, 13870 publisher = {IEEE}, 13871 year = {2010} 13872} 13873 13874@InProceedings{ heroux2004design, 13875 title = {The design of {T}rilinos}, 13876 author = {Heroux, Michael A and Sala, Marzio}, 13877 booktitle = {International Workshop on Applied Parallel Computing}, 13878 pages = {620--628}, 13879 year = {2004}, 13880 organization = {Springer} 13881} 13882 13883@Misc{ trilinos:homepage, 13884 author = {M. {Heroux et al.}}, 13885 title = {{Trilinos Web page}}, 13886 howpublished = {{\tt http://trilinos.sandia.gov/}} 13887} 13888 13889@Article{ trilinos:overview, 13890 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 13891 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 13892 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 13893 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 13894 Kendall S. Stanley}, 13895 title = {An overview of the {T}rilinos project}, 13896 journal = {ACM Transactions on Mathematical Software}, 13897 volume = {31}, 13898 number = {3}, 13899 year = {2005}, 13900 issn = {0098-3500}, 13901 pages = {397--423}, 13902 publisher = {ACM Press}, 13903 doi = {10.1145/1089014.1089021} 13904} 13905 13906@Misc{ rythmos:homepage, 13907 author = {T. Coffey and R. Bartlett}, 13908 title = {Rythmos: Transient Integration of Differential Equations}, 13909 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 13910} 13911 13912@Misc{ triangle:homepage, 13913 author = {J. {Shewchuk}}, 13914 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 13915 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 13916 year = {2005} 13917} 13918 13919@Misc{ tetgen:homepage, 13920 author = {Hang {Si}}, 13921 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 13922 Triangulator}}, 13923 howpublished = {\url{http://tetgen.berlios.de}}, 13924 year = {2005} 13925} 13926 13927@Misc{ eigen:homepage, 13928 author = {Benoit Jacob and Ga\"el Guennebaud}, 13929 title = {{Eigen} {W}eb page}, 13930 key = {Jacob}, 13931 url = {http://eigen.tuxfamily.org/}, 13932 howpublished = {\url{http://eigen.tuxfamily.org/}}, 13933 year = {2015} 13934} 13935 13936@Misc{ dune:homepage, 13937 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 13938 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 13939 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 13940 Oliver Sander}, 13941 title = {{DUNE} {W}eb page}, 13942 key = {Bastian}, 13943 url = {http://www.dune-project.org/}, 13944 howpublished = {\url{http://www.dune-project.org/}}, 13945 year = {2015} 13946} 13947 13948@Misc{ thrust, 13949 author = {N. Bell and J. Hoberock}, 13950 title = {The {T}hrust Library}, 13951 howpublished = {{\tt http://code.google.com/p/thrust/}}, 13952 year = {2010} 13953} 13954 13955@Misc{ cusp, 13956 author = {N. Bell and M. Garland}, 13957 title = {The {C}usp Library}, 13958 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 13959 year = {2010} 13960} 13961 13962@Misc{ cig:homepage, 13963 author = {M. {Gurnis et al.}}, 13964 title = {{Computational Infrastructure for Geodynamics}}, 13965 howpublished = {\url{http://www.geodynamics.org}} 13966} 13967 13968@Article{ maltsevselkov00, 13969 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 13970 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 13971 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 13972 metabolic reconstruction}, 13973 journal = {Nucleic Acids Res.}, 13974 year = {2000}, 13975 month = jan, 13976 pages = {123-125}, 13977 volume = {28}, 13978 number = {1} 13979} 13980 13981@Article{ more:coloring, 13982 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 13983 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 13984 journal = {SIAM Journal on Numerical Analysis}, 13985 year = {1983}, 13986 month = feb, 13987 pages = {187--209}, 13988 volume = {20}, 13989 number = {1} 13990} 13991 13992@Article{ selkovmaltsev97, 13993 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 13994 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 13995 data}, 13996 journal = {Gene}, 13997 year = {1997}, 13998 pages = {GC11-GC26}, 13999 volume = {197}, 14000 number = {1-2} 14001} 14002 14003@Unpublished{ rocketcenter, 14004 title = {Center for Simulation of Advanced Rockets}, 14005 note = {http://www.csar.uiuc.edu}, 14006 institution = {University of Illinois at Urbana-Champaign} 14007} 14008 14009@Article{ kirby03, 14010 title = {A posteriori error estimates for the mixed hybrid finite element method}, 14011 author = {Robert C Kirby}, 14012 journal = {Computational Geosciences}, 14013 volume = {7}, 14014 pages = {197--214}, 14015 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 14016 year = {2003} 14017} 14018 14019@Article{ kirby2003b, 14020 title = {On the convergence of high resolution methods with multiple time scales for 14021 hyperbolic conservation laws}, 14022 author = {Robert C Kirby}, 14023 journal = {Mathematics of computation}, 14024 volume = {72}, 14025 number = {243}, 14026 pages = {1239--1250}, 14027 year = {2003} 14028} 14029 14030@Article{ dawsonkirby2001, 14031 title = {High resolution schemes for conservation laws with locally varying time steps}, 14032 author = {Clint Dawson and Robert C Kirby}, 14033 journal = {SIAM Journal on Scientific Computing}, 14034 volume = {22}, 14035 number = {6}, 14036 pages = {2256--2281}, 14037 year = {2001}, 14038 publisher = {SIAM} 14039} 14040 14041@Article{ dawsonkirby1999, 14042 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 14043 a dynamically changing mesh}, 14044 author = {Clint Dawson and Robert C Kirby}, 14045 journal = {SIAM Journal on Numerical Analysis}, 14046 volume = {37}, 14047 number = {2}, 14048 pages = {423--442}, 14049 year = {1999}, 14050 publisher = {SIAM} 14051} 14052 14053@Article{ barthlarson00, 14054 author = {T. J. Barth and M. G. Larson}, 14055 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 14056 Hyperbolic Systems}, 14057 journal = {LNCS}, 14058 year = {2000}, 14059 volume = {11}, 14060 publisher = {Spinger-Verlag} 14061} 14062 14063@Article{ xu1, 14064 author = {J. Xu}, 14065 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 14066 journal = {SIAM Review}, 14067 volume = {34}, 14068 pages = {581--613}, 14069 year = {1992} 14070} 14071 14072@Article{ brandt77, 14073 author = {Achi Brandt}, 14074 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 14075 journal = {Mathematics of Computation}, 14076 month = apr, 14077 year = {1977}, 14078 pages = {333--390}, 14079 volume = {31}, 14080 number = {138}, 14081 doi = {10.2307/2006422} 14082} 14083 14084@Article{ brandt1979multigrid, 14085 title = {{Multigrid solutions to elliptic flow problems}}, 14086 author = {Brandt, A. and Dinar, N.}, 14087 journal = {Numerical Methods for Partial Differential Equations}, 14088 pages = {53--147}, 14089 year = {1979} 14090} 14091 14092@InCollection{ brandt1979singular, 14093 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 14094 author = {Achi Brandt}, 14095 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 14096 editor = {Hemker, Pieter W. and Miller, John J.H.}, 14097 pages = {53--142}, 14098 year = {1979}, 14099 publisher = {Academic Press} 14100} 14101 14102@Article{ amge1, 14103 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 14104 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 14105 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 14106 journal = {SIAM J. Scientific Computing}, 14107 volume = {22}, 14108 pages = {1570--1592}, 14109 year = {2000} 14110} 14111 14112@Book{ bramble1, 14113 author = {J. H. Bramble}, 14114 title = {Multigrid Methods}, 14115 publisher = {Longman Scientific and Technical}, 14116 address = {Essex, England}, 14117 year = {1993} 14118} 14119 14120@Book{ arpack98, 14121 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 14122 title = {ARPACK, Users' Guide}, 14123 publisher = {SIAM}, 14124 year = {1998} 14125} 14126 14127@Article{ bbder96, 14128 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 14129 title = {Algorithmic bombardment for the iterative solution of linear systems: A 14130 polyIterative approach}, 14131 journal = {J. of Computational and Applied Mathematics}, 14132 year = {1996}, 14133 volume = {74}, 14134 pages = {91--110} 14135} 14136 14137@Article{ egks94, 14138 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 14139 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 14140 journal = {SIAM J. Scientific Computing}, 14141 year = {1994}, 14142 volume = {15}, 14143 number = {3}, 14144 pages = {681--703} 14145} 14146 14147@Article{ dftb02, 14148 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 14149 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 14150 diamond grain boundaries,}, 14151 journal = {Phys. Rev}, 14152 year = {2002}, 14153 volume = {B65}, 14154 pages = {045403} 14155} 14156 14157@InBook{ lsa, 14158 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 14159 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 14160 title = {The linear system analyzer}, 14161 series = {enabling technologies for computational science}, 14162 year = {2002}, 14163 publisher = {Kluwer}, 14164 location = {Dordrecht} 14165} 14166 14167@Article{ kk97, 14168 author = {Carl T. Kelley and David E. Keyes}, 14169 title = {Convergence analysis of pseudo-transient continuation}, 14170 journal = {SIAM J. Numerical Analysis}, 14171 year = {1998}, 14172 volume = {35}, 14173 pages = {508--523} 14174} 14175 14176@Article{ swtm01, 14177 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 14178 journal = {Journal of Computational Physics}, 14179 year = {2001}, 14180 volume = {172}, 14181 number = {2}, 14182 pages = {472--514}, 14183 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 14184 Method} 14185} 14186 14187@TechReport{ zhou03, 14188 author = {Y. Zhou}, 14189 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 14190 IIGD, RQI and Newton} Updates}, 14191 institution = {Argonne National Laboratory}, 14192 number = {ANL/MCS-P1074-0803}, 14193 note = {Submitted to Numerical Linear Algebra with Applications}, 14194 year = {2003} 14195} 14196 14197@Unpublished{ mtwm03, 14198 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 14199 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 14200 Detailed analysis of one-dimensional applications}, 14201 note = {to appear in the Journal of Chemical Physics}, 14202 year = {2003} 14203} 14204 14205@Article{ singhjosephheslaglowinskipan00, 14206 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 14207 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 14208 particulate flows}, 14209 journal = {J. Non-Newtonian Fluid Mech.}, 14210 volume = {91}, 14211 pages = {165--188}, 14212 year = {2000} 14213} 14214 14215@Book{ joseph02, 14216 author = {Daniel D. Joseph}, 14217 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 14218 publisher = {Springer-Verlag}, 14219 month = mar, 14220 year = {2002}, 14221 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 14222} 14223 14224@Misc{ triangle-web-page, 14225 author = {Jonathan R. Shewchuk}, 14226 title = {{Triangle Web} page}, 14227 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 14228} 14229 14230@InCollection{ shewchuk96, 14231 author = {Jonathan R. Shewchuk}, 14232 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 14233 Triangulator}, 14234 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 14235 editor = {Ming C. Lin and Dinesh Manocha}, 14236 series = {Lecture Notes in Computer Science}, 14237 volume = {1148}, 14238 publisher = {Springer-Verlag}, 14239 pages = {203--222}, 14240 month = may, 14241 year = {1996}, 14242 note = {From the First ACM Workshop on Applied Computational Geometry} 14243} 14244 14245@Article{ leaf1, 14246 author = {Transient Dynamics of Pinning of Domain Walls}, 14247 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 14248 journal = {J. Magnetism and Magnetic Materials}, 14249 volume = {241}, 14250 pages = {118--123}, 14251 year = {2002} 14252} 14253 14254@Article{ leaf2, 14255 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 14256 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 14257 Superconductivity}, 14258 journal = {SIAM J. Sci. Comp.}, 14259 volume = {23}, 14260 pages = {1944--1959}, 14261 year = {2002} 14262} 14263 14264@Article{ leaf3, 14265 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 14266 title = {Hysteresis in Layered Spring Magnets}, 14267 journal = { Discreet and Continuous Dynamical Systems, Series B}, 14268 volume = {1}, 14269 pages = {219--232}, 14270 year = {2001} 14271} 14272 14273@Article{ leaf4, 14274 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 14275 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 14276 journal = {J. Phys. D Appl. Phys.}, 14277 volume = {35}, 14278 pages = {2339--2343}, 14279 year = {2002} 14280} 14281 14282@Article{ leaf5, 14283 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 14284 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 14285 journal = {Submitted to Phys. Rev. B.}, 14286 note = {Submitted}, 14287 year = {2003} 14288} 14289 14290@Article{ graysumpternoidbarnes01, 14291 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 14292 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 14293 Nanospheres}, 14294 journal = {Chem. Phys. Lett.}, 14295 volume = {333}, 14296 pages = {308--313}, 14297 year = {2001} 14298} 14299 14300@InProceedings{ petsc-efficient, 14301 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 14302 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 14303 Libraries}, 14304 booktitle = {Modern Software Tools in Scientific Computing}, 14305 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 14306 publisher = {Birkh{\"{a}}user Press}, 14307 pages = {163--202}, 14308 year = {1997} 14309} 14310 14311@Article{ mumps01, 14312 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 14313 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 14314 journal = {SIAM Journal on Matrix Analysis and Applications}, 14315 volume = {23}, 14316 number = {1}, 14317 pages = {15--41}, 14318 year = {2001} 14319} 14320 14321@Article{ mumps19, 14322 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 14323 Multicore Architectures}}, 14324 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 14325 journal = {ACM Transactions on Mathematical Software}, 14326 volume = {45}, 14327 issue = {1}, 14328 pages = {2:1--2:26}, 14329 year = {2019} 14330} 14331 14332@Article{ zoltan06, 14333 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 14334 \c{C}ataly\"urek and Robert H. Bisseling}, 14335 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 14336 journal = {SIAM Parallel Processing for Scientific Computing}, 14337 month = feb, 14338 year = {2006} 14339} 14340 14341@Article{ lidemmel03, 14342 author = {Xiaoye S. Li and James W. Demmel}, 14343 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 14344 unsymmetric linear systems}, 14345 journal = {ACM Transactions on Mathematical Software}, 14346 year = {2003}, 14347 month = jun, 14348 volume = {29}, 14349 number = {2}, 14350 pages = {110--140} 14351} 14352 14353@TechReport{ superlu, 14354 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 14355 title = {{SuperLU} Users' Guide}, 14356 number = {LBNL-44289}, 14357 institution = {Lawrence Berkeley National Laboratory}, 14358 year = {2003}, 14359 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 14360} 14361 14362@TechReport{ trilinos-overview03, 14363 title = {{An Overview of {T}rilinos}}, 14364 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 14365 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 14366 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 14367 Willenbring and Alan Williams}, 14368 institution = {Sandia National Laboratories}, 14369 number = {SAND2003-2927}, 14370 year = {2003} 14371} 14372 14373@TechReport{ trilinos-users-guide, 14374 title = {{Trilinos} Users Guide}, 14375 author = {Michael A. Heroux and James M. Willenbring}, 14376 institution = {Sandia National Laboratories}, 14377 number = {SAND2003-2952}, 14378 url = {http://trilinos.sandia.gov/}, 14379 year = {2003} 14380} 14381 14382@Article{ pilut01, 14383 author = {David Hysom and Alex Pothen}, 14384 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 14385 journal = {SIAM Journal on Scientific Computing}, 14386 volume = {22}, 14387 pages = {2194--2215}, 14388 year = {2001} 14389} 14390 14391@TechReport{ boomeramg00, 14392 author = {V.~E. Henson and U.~M. Yang}, 14393 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 14394 institution = {Lawrence Livermore National Laboratory}, 14395 number = {UCRL-JC-133948}, 14396 year = {2000} 14397} 14398 14399@InCollection{ baker2012scaling, 14400 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 14401 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 14402 and Schulz, Martin and Yang, Ulrike Meier}, 14403 booktitle = {Competence in High Performance Computing 2010}, 14404 pages = {215--226}, 14405 year = {2012}, 14406 publisher = {Springer} 14407} 14408 14409@Article{ knollkeyes:04, 14410 author = {D. A. Knoll and D. E. Keyes}, 14411 year = {2004}, 14412 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 14413 journal = {J. Comp. Phys.}, 14414 volume = {193}, 14415 pages = {357-397} 14416} 14417 14418@Article{ chacon02, 14419 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 14420 title = {An implicit nonlinear reduced resistive {MHD} solver}, 14421 journal = {J. Comput. Phys}, 14422 volume = {188}, 14423 year = {2002}, 14424 pages = {15--36} 14425} 14426 14427@Article{ mousseau03, 14428 author = {V. A. Mousseau and D. A. Knoll}, 14429 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 14430 Radiation Diffusion}, 14431 journal = {J. Comput. Physics}, 14432 year = {2003} 14433} 14434 14435@Article{ mousseau00, 14436 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 14437 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 14438 Radiation Diffusion}, 14439 journal = {J. Comput. Physics}, 14440 year = {2000}, 14441 pages = {743--765}, 14442 volume = {160} 14443} 14444 14445@Unpublished{ facets:homepage, 14446 author = {John {Cary (PI)}}, 14447 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 14448 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 14449} 14450 14451@Unpublished{ cpes:homepage, 14452 author = {{C.S.} {Chang (PI)}}, 14453 title = {{Center for Plasma Edge Simulation (CPES)}}, 14454 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 14455} 14456 14457@Misc{ epsi:homepage, 14458 author = {{C.S.} {Chang (PI)}}, 14459 title = {{Center for Edge Physics Simulation (EPSI)}}, 14460 note = {\url{http://epsi.pppl.gov}} 14461} 14462 14463@Unpublished{ groundwater-scidac2:web, 14464 author = {Peter {Lichtner (PI)}}, 14465 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 14466 Advanced Computing}, 14467 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 14468} 14469 14470@Misc{ pflotran:web, 14471 author = {Peter {Lichtner (PI)}}, 14472 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 14473 Advanced Computing}}, 14474 note = {\url{http://ees.lanl.gov/pflotran/}} 14475} 14476 14477@Misc{ accel-scidac2-solicitation, 14478 author = {{DOE Office of Science}}, 14479 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 14480 year = {2006}, 14481 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 14482} 14483 14484@Article{ nieter04, 14485 author = {C. Nieter and J. R. Cary}, 14486 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 14487 journal = {J. Comp. Phys.}, 14488 year = {2004}, 14489 volume = {196}, 14490 pages = {448} 14491} 14492 14493@Article{ synergia06, 14494 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 14495 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 14496 journal = {J. Comp. Phys.}, 14497 year = {2006}, 14498 volume = {211}, 14499 pages = {229-248} 14500} 14501 14502@Unpublished{ stoltz07, 14503 author = {P. H. Stoltz}, 14504 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 14505 year = {2007}, 14506 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 14507 Albuquerque, NM, 2007} 14508} 14509 14510@Misc{ iter:homepage, 14511 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 14512 year = {2007}, 14513 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 14514 howpublished = {\url{http://www.iter.org}} 14515} 14516 14517@Misc{ epp2010, 14518 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 14519 Council}}, 14520 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 14521 Particle Physics}, 14522 year = {2006}, 14523 howpublished = {The National Academies Press, ISBN: 0309101948} 14524} 14525 14526@Misc{ post-fsp-report, 14527 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 14528 and P.~Colella and S.~C.~Jardin}, 14529 title = {{Report of Fusion Simulation Project Steering Committee}}, 14530 month = aug, 14531 year = {2004}, 14532 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 14533} 14534 14535@Misc{ fsp:workshop2011, 14536 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 14537 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 14538 month = feb, 14539 year = {2011}, 14540 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 14541} 14542 14543@Book{ hazeltine-meiss-book, 14544 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 14545 title = {Plasma Confinement}, 14546 year = {1991}, 14547 publisher = {Addison-Wesley, Redwood City, CA} 14548} 14549 14550@Article{ falgout05a, 14551 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 14552 title = {Conceptual Interfaces in hypre}, 14553 journal = {Future Generation Computer Systems}, 14554 note = {Special issue on PDE software}, 14555 volume = {22}, 14556 year = {2005}, 14557 pages = {239--251} 14558} 14559 14560@Article{ falgout05b, 14561 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 14562 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 14563 journal = {ACM Trans. Math. Softw.}, 14564 volume = {31}, 14565 year = {2005}, 14566 pages = {326--350} 14567} 14568 14569@Unpublished{ compass:homepage, 14570 author = {Panagiotis {Spentzouris (PI)}}, 14571 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 14572 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 14573} 14574 14575@Unpublished{ cmsnf:homepage, 14576 author = {{Todd Allen, Director}}, 14577 title = {{Center for Materials Science of Nuclear Fuel}}, 14578 note = {Energy Frontier Research Center, see 14579 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 14580} 14581 14582@Unpublished{ dvi-materials:project, 14583 author = {{L.~C.} {McInnes (PI)}}, 14584 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 14585 note = {{SciDAC}-e project}, 14586 year = {2011} 14587} 14588 14589@Misc{ scidac:homepage, 14590 author = {{DOE Office of Science}}, 14591 title = {{Scientific Discovery through Advanced Computing}}, 14592 year = {2007}, 14593 howpublished = {\url{http://www.scidac.gov}} 14594} 14595 14596@Misc{ corba, 14597 author = {{Object Management Group}}, 14598 year = {2007}, 14599 title = {{Common Object Request Broker Architecture (CORBA)}}, 14600 howpublished = {\url{http://www.corba.org}} 14601} 14602 14603@Article{ uedge, 14604 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 14605 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 14606 Divertor Tokamak}, 14607 journal = {J. Plasma Physics}, 14608 year = {1999}, 14609 volume = {6}, 14610 pages = {1851}, 14611 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 14612} 14613 14614@Article{ bout, 14615 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 14616 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 14617 journal = {J. Plasma Physics}, 14618 year = {2000}, 14619 volume = {7}, 14620 pages = {1951}, 14621 note = {} 14622} 14623 14624@Article{ bout++, 14625 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 14626 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 14627 journal = {Computer Physics Communications}, 14628 year = {2009}, 14629 volume = {180}, 14630 issue = {9}, 14631 pages = {1467 -- 1480}, 14632 note = {} 14633} 14634 14635@Article{ tempest, 14636 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 14637 and G. Kerbel and W.M. Nevins and T. Rognlien}, 14638 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 14639 journal = {Bull. Am. Phys. Soc. }, 14640 year = {2005}, 14641 volume = {50}, 14642 number = {86}, 14643 pages = {CP1}, 14644 note = {} 14645} 14646 14647@Article{ ccahpc, 14648 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 14649 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 14650 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 14651 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 14652 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 14653 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 14654 and Theresa L. Windus and Shujia Zhou}, 14655 title = {A Component Architecture for High-Performance Scientific Computing}, 14656 journal = {Intl. J. High-Perf. Computing Appl.}, 14657 volume = {20}, 14658 pages = {163--202}, 14659 year = {2006}, 14660 note = {ACTS Collection special issue} 14661} 14662 14663@Misc{ cca-forum:homepage, 14664 author = {{Common Component Architecture Forum}}, 14665 note = {\url{http://www.cca-forum.org}}, 14666 year = {2010} 14667} 14668 14669@Misc{ petsc:driven-cavity-example, 14670 title = {{PETSc Driven Cavity Example Code}}, 14671 author = {B. F. {Smith et al.}}, 14672 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 14673} 14674 14675@Misc{ petsc-dm:webpage, 14676 author = {B. F. {Smith et al.}}, 14677 title = {{PETSc DM Webpage}}, 14678 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 14679 year = {2018} 14680} 14681 14682@Misc{ unic-ref, 14683 author = {Giuseppe Palmiotti}, 14684 title = {{UNIC} Neutronics Software}, 14685 note = {Nuclear Engineering Division, Argonne National Laboratory} 14686} 14687 14688% ----------------------------------------------------------------------- 14689% Model coupling refs 14690@Book{ greve-blatter, 14691 author = {Ralf Greve and Heinz Blatter}, 14692 title = {Dynamics of Ice Sheets and Glaciers}, 14693 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 14694 publisher = {Springer}, 14695 year = {2009} 14696} 14697 14698@Misc{ doe-isicles, 14699 key = {ISICLES}, 14700 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 14701 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 14702} 14703 14704@Article{ safta2011tchem, 14705 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 14706 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 14707 journal = {Sandia Report, SAND2011-3282}, 14708 year = {2011} 14709} 14710 14711@Misc{ chemkin-website, 14712 key = {chemkin}, 14713 title = {ANSYS Chemkin-Pro Website}, 14714 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 14715 year = {2017} 14716} 14717 14718@Misc{ mct-website, 14719 key = {MCT}, 14720 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 14721 howpublished = {\url{http://www.mcs.anl.gov/mct}} 14722} 14723 14724@Article{ larson:05, 14725 author = {Jay Larson and Robert Jacob and Everest Ong}, 14726 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 14727 Multi-Physics Parallel Coupled Models}, 14728 journal = {Int. J. High Perf. Comp. App.}, 14729 year = {2005}, 14730 pages = {277--292} 14731} 14732 14733@Article{ dennis2012computational, 14734 title = {Computational performance of ultra-high-resolution capability in the Community 14735 Earth System Model}, 14736 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 14737 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 14738 journal = {International Journal of High Performance Computing Applications}, 14739 volume = {26}, 14740 number = {1}, 14741 pages = {5--16}, 14742 year = {2012}, 14743 publisher = {SAGE Publications} 14744} 14745 14746@InProceedings{ bettge01, 14747 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 14748 year = {2001}, 14749 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 14750 Backroads}, 14751 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 14752 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 14753 pages = {148 -- 156}, 14754 series = {Lecture Notes in Computer Science}, 14755 volume = {2073}, 14756 publisher = {Springer-Verlag} 14757} 14758 14759@InProceedings{ jacob01, 14760 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 14761 year = {2001}, 14762 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 14763 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 14764 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 14765 series = {Lecture Notes in Computer Science}, 14766 volume = {2073}, 14767 publisher = {Springer-Verlag} 14768} 14769 14770@Article{ chen2008new, 14771 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 14772 design}, 14773 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 14774 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 14775 journal = {Chinese Science Bulletin}, 14776 volume = {53}, 14777 number = {22}, 14778 pages = {3433--3445}, 14779 year = {2008}, 14780 publisher = {Springer} 14781} 14782 14783@InProceedings{ baum01, 14784 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 14785 and C. Charman}, 14786 year = {2001}, 14787 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 14788 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 14789 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 14790 series = {Lecture Notes in Computer Science}, 14791 volume = {2073}, 14792 publisher = {Springer-Verlag} 14793} 14794 14795@InProceedings{ lefantzi03, 14796 author = {S. Lefantzi and J. Ray}, 14797 year = {2003}, 14798 title = {A Component-based Scientific Toolkit for Reacting Flows}, 14799 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 14800 volume = {2}, 14801 publisher = {Elsevier} 14802} 14803 14804@Article{ boville98, 14805 author = {B. A. Boville and P. R. Gent}, 14806 title = {The {NCAR} Climate System Model, Version One}, 14807 journal = {Journal of Climate}, 14808 volume = {11}, 14809 year = {1998}, 14810 pages = {1115--1130} 14811} 14812 14813@Misc{ paraschivoiu99, 14814 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 14815 title = {Multi-domain multi-model formulation for compressible flows: Conservative 14816 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 14817 note = {AIAA Paper 99-0784}, 14818 year = {1999} 14819} 14820 14821@Article{ peszynska, 14822 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 14823 title = {Mortar upscaling for multiphysics flow in porous media}, 14824 journal = {Computational Geosciences} 14825} 14826 14827@TechReport{ wheeler00, 14828 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 14829 title = {A distributed computing portal for coupling multi-physics and multiple domains in 14830 porous media}, 14831 institution = {University of Texas at Austin}, 14832 number = {TICAM 00-03}, 14833 year = {2000} 14834} 14835 14836@TechReport{ peszynska00, 14837 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 14838 title = {Multiphysics Coupling of Codes}, 14839 institution = {University of Texas at Austin}, 14840 number = {TICAM 00-02}, 14841 year = {2000} 14842} 14843 14844@Article{ joshaghanijoodatnakshatrala2019, 14845 title = {A stabilized mixed discontinuous Galerkin formulation for double 14846 porosity/permeability model}, 14847 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 14848 journal = {Computer Methods in Applied Mechanics and Engineering}, 14849 volume = {352}, 14850 pages = {508--560}, 14851 year = {2019} 14852} 14853 14854@InProceedings{ cai99, 14855 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 14856 title = {An explicit multi-model compressible flow formulation based on the full potential 14857 equation and the {Euler} equations on {3D} unstructured meshes}, 14858 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 14859 Methods}, 14860 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 14861 year = {1999} 14862} 14863 14864@Article{ he05, 14865 author = {Yun He and Chris H. Q. Ding}, 14866 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 14867 Architectures}, 14868 year = {2005}, 14869 volume = {19}, 14870 pages = {329--240}, 14871 number = {3}, 14872 journal = {Int. Journal of High Performance Computing Applications} 14873} 14874 14875@InProceedings{ uiuc-rocket-center02, 14876 author = {W. A. Dick and M. T. Heath}, 14877 title = {Whole System Simulation of Solid Propellant Rockets}, 14878 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 14879 month = jul, 14880 year = {2002} 14881} 14882 14883@InProceedings{ toth04, 14884 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 14885 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 14886 Oehmke}, 14887 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 14888 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 14889 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 14890 Sun-Earth Connection}, 14891 year = {2004}, 14892 publisher = {Elsevier}, 14893 pages = {383--397} 14894} 14895 14896@Misc{ csdrm:web, 14897 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 14898 Shepherd}, 14899 title = {{Center for Simulation of Dynamic Response of Materials}}, 14900 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 14901} 14902 14903@Misc{ csar:web, 14904 author = {M. {Heath (Director)}}, 14905 title = {{Center for Simulation of Advanced Rockets}}, 14906 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 14907} 14908 14909@Misc{ csafe:web, 14910 author = {D. {Pershing (Director)}}, 14911 title = {{Center for Simulation of Accidental Fires and Explosions}}, 14912 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 14913} 14914 14915@Misc{ cits:web, 14916 author = {P. {Moin (Director)}}, 14917 title = {{Center for Integrated Turbulence Simulations}}, 14918 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 14919} 14920 14921@Misc{ flash:web, 14922 author = {D. {Lamb (Director)}}, 14923 title = {{Center for Integrated Turbulence Simulations}}, 14924 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 14925} 14926 14927@TechReport{ utah-csafe03, 14928 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 14929 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 14930 Problems, Part 1: Algorithm Development}, 14931 institution = {University of Utah, Center for the Simulation of Accidental Fires and 14932 Explosions}, 14933 year = {2003} 14934} 14935 14936@InBook{ shepherd07, 14937 author = {M. Shepherd and E. Seol and B. FrantzDale}, 14938 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 14939 year = {2007}, 14940 booktitle = {CRC Handbook of Dynamic System Modeling}, 14941 publisher = {Wiley}, 14942 pages = {1--41}, 14943 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 14944} 14945 14946@InProceedings{ cactus02, 14947 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 14948 Radke and Edward Seidel and John Shalf}, 14949 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 14950 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 14951 year = {2002}, 14952 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 14953} 14954 14955@Misc{ cactus:homepage, 14956 author = {G. {Allen et al.}}, 14957 title = {{Cactus Web page}}, 14958 howpublished = {\url{http://cactuscode.org}} 14959} 14960 14961@Misc{ open-grid-forum:web, 14962 key = {{Open Grid Forum}}, 14963 title = {{Open Grid Forum}}, 14964 note = {See \url{http://www.ogf.org}} 14965} 14966 14967@Misc{ nox:web, 14968 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 14969 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 14970 note = {See \url{http://software.sandia.gov/nox}} 14971} 14972 14973@Misc{ chombo:web, 14974 author = {P. {Colella (PI)}}, 14975 title = {{Chombo}}, 14976 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 14977} 14978 14979@Article{ lanzkron96, 14980 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 14981 title = {An Analysis of Approximate Nonlinear Elimination}, 14982 journal = {SIAM J. Sci. Comput.}, 14983 volume = {17}, 14984 year = {1996}, 14985 pages = {538--559} 14986} 14987 14988@Article{ jiang95, 14989 author = {J. Jiang and P. Forsyth}, 14990 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 14991 Equations}, 14992 journal = {Computers and Fluids}, 14993 volume = {24}, 14994 pages = {753--770}, 14995 year = {1995} 14996} 14997 14998@Article{ young90, 14999 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 15000 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 15001 journal = {Int. J. Numer. Methods Fluids}, 15002 volume = {11}, 15003 pages = {1075--1095}, 15004 year = {1990} 15005} 15006 15007@Article{ fishwick04, 15008 author = {Paul A. Fishwick}, 15009 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 15010 to Interrelating Model Structures}, 15011 journal = {SCS Trans. on Simulation}, 15012 note = {Special Issue in Grand Challenges in Computer Simulation}, 15013 year = {2004} 15014} 15015 15016@Article{ fishwick03, 15017 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 15018 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 15019 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 15020 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 15021 year = {2003} 15022} 15023 15024@InProceedings{ kirner00, 15025 author = {T. G. Kirner and V. F. Martins}, 15026 title = {Development of an Information Visualization Tool Using Virtual Reality}, 15027 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 15028 year = {2000}, 15029 pages = {604--606} 15030} 15031 15032@InProceedings{ orso03, 15033 author = {A. Orso and J. Jones and M. J. Harrold}, 15034 title = {Visualization of Program-Execution Data for Deployed Software}, 15035 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 15036 year = {2003}, 15037 pages = {67--76} 15038} 15039 15040@Book{ tiller01, 15041 author = {M. Tiller}, 15042 title = {Introduction to Physical System Modeling with Modelica}, 15043 series = {Kluwer International Series inEngineering and Computer Science}, 15044 volume = {615}, 15045 publisher = {Kluwer}, 15046 year = {2001} 15047} 15048 15049@Article{ buck94, 15050 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 15051 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 15052 journal = {Int. Journal of Computer Simulation}, 15053 volume = {4}, 15054 pages = {155--182}, 15055 year = {1994} 15056} 15057 15058@Article{ mu95, 15059 author = {M. Mu and J.R. Rice}, 15060 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 15061 journal = {Comp. Syst. Engr.}, 15062 volume = {6}, 15063 year = {1995}, 15064 pages = {87--95} 15065} 15066 15067@TechReport{ drashansky96, 15068 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 15069 author = {R. Drashansky and A. Joshi and J. R. Rice}, 15070 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 15071 year = {1996} 15072} 15073 15074@Article{ michopoulos05, 15075 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 15076 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 15077 journal = {Journal of Computing and Information Science in Engineering}, 15078 volume = {5}, 15079 issue = {3}, 15080 pages = {198--213}, 15081 year = {2005} 15082} 15083 15084@Article{ dubey09, 15085 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 15086 Multiphysics Simulation Code}, 15087 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 15088 Siegel and K. Weide}, 15089 journal = {Parallel Computing}, 15090 volume = {35}, 15091 issue = {10 -- 11}, 15092 pages = {512 -- 522}, 15093 year = {2009} 15094} 15095 15096@Book{ bottloring95, 15097 author = {Raoul Bott and Loring W. Tu}, 15098 title = {Differential Forms in Algebraic Topology}, 15099 publisher = {Springer}, 15100 year = {1995} 15101} 15102 15103@Book{ kobayashinomizu96, 15104 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 15105 title = {Foundations of Differential Geometry}, 15106 publisher = {Wiley-Interscience}, 15107 year = {1996} 15108} 15109 15110@Article{ hornungkohn02, 15111 author = {Richard D. Hornung and Scott R. Kohn}, 15112 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 15113 journal = {Concurrency and Computation: Practice and Experience}, 15114 volume = {14}, 15115 pages = {347--368}, 15116 year = {2002} 15117} 15118 15119@InProceedings{ concepts06, 15120 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 15121 Gabriel Dos Reis and Andrew Lumsdaine}, 15122 title = {Concepts: Linguistic Support for Generic Programming in C++}, 15123 booktitle = {Proceedings of OOPSLA 2006}, 15124 year = {2006}, 15125 pages = {???--???} 15126} 15127 15128@Book{ hatcher02, 15129 author = {Hatcher, Allen}, 15130 title = {Algebraic Topology}, 15131 publisher = {Cambridge University Press}, 15132 year = {2002} 15133} 15134 15135@Book{ gammahelmjohnsonvlissides95, 15136 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 15137 development, offering timeless and elegant solutions to common problems in 15138 software design. It describes patterns for managing object creation, composing 15139 objects into larger structures, and coordinating control flow between objects. The 15140 book provides numerous examples where using composition rather than inheritance 15141 can improve the reusability and flexibility of code. Note, though, that it's not a 15142 tutorial but a catalog that you can use to find an object-oriented design pattern 15143 that's appropriate for the needs of your particular application--a selection for 15144 virtuoso programmers who appreciate (or require) consistent, well-engineered 15145 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 15146 more valuable than ever! 15147 15148 Use the contents of the CD to create your own design documents and reusable 15149 components. The CD contains: 23 patterns you can cut and paste into your own 15150 design documents; sample code demonstrating pattern implementation; complete 15151 Design Patterns content in standard HTML format, with numerous hyperlinked 15152 cross-references; accessed through a standard web browser; Java-based dynamic 15153 search mechanism, enhancing online seach capabilities; graphical user environment, 15154 allowing ease of navigation. 15155 15156 First published in 1995, this landmark work on object-oriented software design 15157 presents a catalog of simple and succinct solutions to common design problems. 15158 Created by four experienced designers, the 23 patterns contained herein have 15159 become an essential resource for anyone developing reusable object-oriented 15160 software. In response to reader demand, the complete text and pattern catalog are 15161 now available on CD-ROM. This electronic version of Design Patterns enables 15162 programmers to install the book directly onto a computer or network for use as an 15163 online reference for creating reusable object-oriented software. 15164 15165 The authors first describe what patterns are and how they can help you in the 15166 design process. They then systematically name, explain, evaluate, and catalog 15167 recurring designs in object-oriented systems. All patterns are compiled from 15168 real-world examples and include code that demonstrates how they may be implemented 15169 in object-oriented programming languages such as C++ and Smalltalk. Readers who 15170 already own the book will want the CD to take advantage of its dynamic search 15171 mechanism and ready-to-install patterns.}}, 15172 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 15173 citeulike-article-id={115158}, 15174 howpublished = {Hardcover}, 15175 isbn = {0201633612}, 15176 keywords = {1995 algorithms architecture book books computer computing design design-pattern 15177 design-patterns design_patterns designpatterns development diplom entwurfsmuster 15178 four gang gof java mathgamespatterns no-tag object object-orientation 15179 object-oriented of oo-patterns oop oriented pattern patterns programming se 15180 software software-development software-engineering software_design 15181 softwareengineering standard}, 15182 month = jan, 15183 publisher = {{Addison-Wesley Professional}}, 15184 title = {Design Patterns}, 15185 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 15186 year = {1995} 15187} 15188 15189@InProceedings{ chaco95, 15190 author = {Bruce Hendrickson and Robert Leland}, 15191 title = {A multilevel algorithm for partitioning graphs}, 15192 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 15193 (CDROM)}, 15194 year = {1995}, 15195 isbn = {0-89791-816-9}, 15196 pages = {28}, 15197 location = {San Diego, California, United States}, 15198 doi = {10.1145/224170.224228}, 15199 publisher = {ACM Press}, 15200 address = {New York} 15201} 15202 15203@Book{ aleksandrov98, 15204 author = {Aleksandrov, Pavel S.}, 15205 title = {Combinatorial Topology}, 15206 publisher = {Dover}, 15207 volume = {3}, 15208 year = {1998} 15209} 15210 15211@Book{ steenrod99, 15212 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 15213 importance in modern physics--such as in gauge theory. This book, a succinct 15214 introduction to the subject by renown mathematician Norman Steenrod, was the first 15215 to present the subject systematically. 15216 15217 It begins with a general introduction to bundles, including such topics as 15218 differentiable manifolds and covering spaces. The author then provides brief 15219 surveys of advanced topics, such as homotopy theory and cohomology theory, before 15220 using them to study further properties of fibre bundles. The result is a classic 15221 and timeless work of great utility that will appeal to serious mathematicians and 15222 theoretical physicists alike. }}, 15223 author = {Steenrod, Norman}, 15224 citeulike-article-id={712999}, 15225 howpublished = {Paperback}, 15226 isbn = {0691005486}, 15227 keywords = {fibre_bundles topology}, 15228 month = apr, 15229 publisher = {{Princeton University Press}}, 15230 title = {The Topology of Fibre Bundles. (PMS-14)}, 15231 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 15232 year = {1999} 15233} 15234 15235@Book{ bredon97, 15236 author = {Bredon, Glen E.}, 15237 title = {Sheaf Theory}, 15238 publisher = {Springer}, 15239 pages = {524}, 15240 series = {Graduate Texts in Mathematics}, 15241 year = {1997} 15242} 15243 15244@TechReport{ tautgesmeyers04, 15245 title = {{MOAB}: A Mesh-Oriented Database}, 15246 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 15247 Ernst}, 15248 institution = {Sandia National Laboratories}, 15249 number = {SAND2004-1592}, 15250 month = apr, 15251 year = {2004} 15252} 15253 15254@Article{ tautges04, 15255 author = {Timothy J. Tautges}, 15256 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 15257 journal = {Engineering With Computers}, 15258 volume = {20}, 15259 pages = {286--293}, 15260 year = {2004} 15261} 15262 15263@InProceedings{ meyers02, 15264 author = {Ray Meyers et. al}, 15265 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 15266 booktitle = {8th International conference on numerical grid generation in computational field 15267 simulations}, 15268 month = jun, 15269 year = {2002} 15270} 15271 15272@InProceedings{ seolshepard05, 15273 author = {E. S. Seol and Mark S. Shephard}, 15274 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 15275 Analysis}, 15276 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 15277 year = {2005} 15278} 15279 15280@Article{ beallwalshshephard04, 15281 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 15282 title = {A comparison of techniques for geometry access related to mesh generation}, 15283 journal = {Engineering With Computers}, 15284 volume = {20}, 15285 number = {3}, 15286 pages = {210--221}, 15287 year = {2004} 15288} 15289 15290@Article{ careyandersoncarneskirk04, 15291 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 15292 Kirk}, 15293 title = {Some aspects of adaptive grid technology related to boundary and interior 15294 layers}, 15295 journal = {Journal of Computational Applied Mathematics}, 15296 volume = {166}, 15297 number = {1}, 15298 pages = {55--86}, 15299 year = {2004} 15300} 15301 15302@PhDThesis{ gralthesis, 15303 author = {Guntram Berti}, 15304 title = {Generic Software Components for Scientific Computing}, 15305 school = {TU Cottbus}, 15306 year = {2000}, 15307 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 15308} 15309 15310@Article{ whitehead1949, 15311 title = {Combinatorial homotopy. I}, 15312 author = {John HC Whitehead}, 15313 journal = {Bulletin of the American Mathematical Society}, 15314 volume = {55}, 15315 number = {3. P1}, 15316 pages = {213--245}, 15317 year = {1949}, 15318 publisher = {American Mathematical Society} 15319} 15320 15321@Article{ beylkincoifmanrokhlin91, 15322 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 15323 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 15324 journal = {Communications on Pure and Applied Mathematics}, 15325 volume = {44}, 15326 pages = {141--183}, 15327 year = {1991} 15328} 15329 15330@Book{ wesseling92, 15331 author = {Pieter Wesseling}, 15332 title = {An Introduction to Multigrid Methods}, 15333 publisher = {John Wiley and Sons}, 15334 year = {1992} 15335} 15336 15337@Book{ grakakos04, 15338 author = {Loukas Grakakos}, 15339 title = {Classical and Modern Fourier Analysis}, 15340 publisher = {Pearson Education}, 15341 address = {New Jersey}, 15342 year = {2004} 15343} 15344 15345@Misc{ hlib-web-page, 15346 key = {HLib}, 15347 title = {{HLib} {Web} page}, 15348 note = {{\texttt{http://www.hlib.org/}}}, 15349 annote = {Hierarchical matrices for fast integral transform} 15350} 15351 15352@Article{ hackbusch99, 15353 author = {Wolfgang Hackbusch}, 15354 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 15355 Introduction to {$\mathcal H$}-matrices}, 15356 journal = {Computing}, 15357 volume = {62}, 15358 pages = {89--108}, 15359 year = {1999} 15360} 15361 15362@TechReport{ kay1999green, 15363 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 15364 equations}, 15365 author = {Kay, D. and Loghin, D.}, 15366 year = {1999}, 15367 institution = {Oxford University Computing Laboratory}, 15368 number = {99/06} 15369} 15370 15371@Article{ bebendorf2003existence, 15372 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 15373 elliptic operators with {$L^\infty$}-coefficients}, 15374 author = {Bebendorf, M. and Hackbusch, W.}, 15375 journal = {Numerische Mathematik}, 15376 volume = {95}, 15377 number = {1}, 15378 pages = {1--28}, 15379 year = {2003}, 15380 publisher = {Springer} 15381} 15382 15383@Article{ hackbusch2005direct, 15384 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 15385 H$}-matrix approximation}, 15386 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 15387 journal = {Computing and Visualization in Science}, 15388 volume = {8}, 15389 number = {3}, 15390 pages = {179--188}, 15391 year = {2005}, 15392 publisher = {Springer} 15393} 15394 15395@TechReport{ duphof2003, 15396 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 15397 Logg and L. R. Scott}, 15398 title = {The {FE}ni{CS} project}, 15399 institution = {Chalmers Finite Element Center Preprint Series}, 15400 number = {2003--21}, 15401 year = {2003} 15402} 15403 15404@Article{ flame01, 15405 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 15406 Geijn}, 15407 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 15408 journal = {Transactions on Mathematical Software}, 15409 volume = {27}, 15410 number = {4}, 15411 year = {2001}, 15412 pages = {422--455} 15413} 15414 15415@Article{ puschel05, 15416 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 15417 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 15418 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 15419 Nick Rizzolo}, 15420 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 15421 journal = {Proceedings of the IEEE}, 15422 volume = {93}, 15423 number = {2}, 15424 year = {2005}, 15425 note = {special issue on "Program Generation, Optimization, and Adaptation"} 15426} 15427 15428@Article{ kirbylogg06, 15429 author = {Robert C. Kirby and Anders Logg}, 15430 title = {A compiler for variational forms}, 15431 journal = {ACM Transactions on Mathematical Software}, 15432 volume = {32}, 15433 number = {3}, 15434 year = {2006}, 15435 issn = {0098-3500}, 15436 pages = {417--444}, 15437 doi = {10.1145/1163641.1163644}, 15438 publisher = {ACM Press}, 15439 address = {New York, NY} 15440} 15441 15442@Article{ kirbylogg07, 15443 author = {Robert C. Kirby and Anders Logg}, 15444 title = {Efficient compilation of a class of variational forms}, 15445 journal = {ACM Transactions on Mathematical Software}, 15446 volume = {33}, 15447 number = {3}, 15448 year = {2007}, 15449 issn = {0098-3500}, 15450 pages = {17}, 15451 doi = {10.1145/1268769.1268771}, 15452 publisher = {ACM Press}, 15453 address = {New York, NY} 15454} 15455 15456@Article{ bankdupont81, 15457 author = {Randolph Bank and Todd Dupont}, 15458 title = {An optimal order process for solving finite element equations}, 15459 journal = {Mathematics of Computation}, 15460 volume = {36}, 15461 pages = {35--51}, 15462 year = {1981} 15463} 15464 15465@TechReport{ adams00, 15466 author = {Mark F. Adams}, 15467 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 15468 in solid mechanics}, 15469 institution = {UC Berkeley}, 15470 number = {CSD-00-1103}, 15471 year = {2000}, 15472 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 15473} 15474 15475@Article{ bergengradlhuelsemannruede06, 15476 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 15477 title = {A Massively Parallel Multigrid Method for Finite Elements}, 15478 journal = {Computing in Science \& Engineering}, 15479 volume = {8}, 15480 number = {6}, 15481 pages = {56--62}, 15482 year = {2006} 15483} 15484 15485@MastersThesis{ brunethesis08, 15486 author = {Peter R. Brune}, 15487 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 15488 school = {University of Chicago}, 15489 address = {Chicago, IL}, 15490 year = {2008}, 15491 month = feb 15492} 15493 15494@Article{ arnoldwinther02, 15495 author = {Douglas N. Arnold and Ragnar Winther}, 15496 title = {Mixed finite elements for elasticity}, 15497 journal = {Numerische Mathematik}, 15498 volume = {92}, 15499 number = {3}, 15500 month = sep, 15501 year = {2002}, 15502 pages = {401--419}, 15503 doi = {10.1007/s002110100348} 15504} 15505 15506@Article{ arnoldfalkwinther06, 15507 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 15508 title = {Finite element exterior calculus, homological techniques, and applications}, 15509 journal = {Acta Numerica}, 15510 year = {2006}, 15511 volume = {15}, 15512 pages = {1--155}, 15513 publisher = {Cambridge University Press}, 15514 doi = {10.1017/S0962492906210018} 15515} 15516 15517@Article{ kirby04, 15518 author = {Robert C. Kirby}, 15519 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 15520 functions}, 15521 journal = {ACM Transactions on Mathematical Software}, 15522 volume = {30}, 15523 number = {4}, 15524 year = {2004}, 15525 issn = {0098-3500}, 15526 pages = {502--516}, 15527 doi = {10.1145/1039813.1039820}, 15528 publisher = {ACM Press}, 15529 address = {New York, NY} 15530} 15531 15532@Article{ kirby06, 15533 author = {Robert C. Kirby}, 15534 title = {Optimizing {FIAT} with level 3 {BLAS}}, 15535 journal = {ACM Transactions on Mathematical Software}, 15536 volume = {32}, 15537 number = {2}, 15538 year = {2006}, 15539 issn = {0098-3500}, 15540 pages = {223--235}, 15541 doi = {10.1145/1141885.1141889}, 15542 publisher = {ACM Press}, 15543 address = {New York, NY} 15544} 15545 15546@Misc{ bluecrystal08, 15547 author = {{B}lue {C}rystal Cluster}, 15548 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 15549 year = {2008}, 15550 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 15551} 15552 15553@Article{ beylkin95, 15554 author = {Gregory Beylkin}, 15555 title = {On the Fast Fourier Transform of Functions With Singularities}, 15556 journal = {Applied and Computational Harmonic Analysis}, 15557 volume = {2}, 15558 pages = {363--381}, 15559 year = {1995} 15560} 15561 15562@InProceedings{ riehl08, 15563 author = {Jonathan Riehl}, 15564 title = {Implementing the MyFEM Embedded Domain-specific Language}, 15565 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 15566 Development (DSPD'08)}, 15567 address = {Nashville, TN}, 15568 year = {2008} 15569} 15570 15571@Article{ appel85, 15572 author = {Andrew W. Appel}, 15573 date-added = {2008-02-27 12:23:39 +0000}, 15574 date-modified = {2008-02-27 12:24:02 +0000}, 15575 doi = {10.1137/0906008}, 15576 journal = {SIAM Journal on Scientific and Statistical Computing}, 15577 keywords = {treecodes}, 15578 number = {1}, 15579 pages = {85-103}, 15580 publisher = {SIAM}, 15581 title = {An Efficient Program for Many-Body Simulation}, 15582 volume = {6}, 15583 year = {1985} 15584} 15585 15586@Article{ ewald21, 15587 author = {{Ewald}, P.~P.}, 15588 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 15589 journal = {Annalen der Physik}, 15590 year = {1921}, 15591 volume = {369}, 15592 pages = {253-287}, 15593 doi = {10.1002/andp.19213690304}, 15594 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 15595 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 15596} 15597 15598@Article{ greengardrokhlin87, 15599 author = {L. Greengard and V. Rokhlin}, 15600 date-added = {2008-02-15 18:43:55 +0000}, 15601 date-modified = {2008-02-26 20:09:11 +0000}, 15602 doi = {10.1016/0021-9991(87)90140-9}, 15603 journal = {J. Comput.\ Phys.}, 15604 keywords = {FMM}, 15605 number = {2}, 15606 pages = {325--348}, 15607 title = {A Fast Algorithm for Particle Simulations}, 15608 url = {citeseer.ist.psu.edu/greengard87fast.html}, 15609 volume = {73}, 15610 year = {1987}, 15611 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 15612} 15613 15614@Article{ greengardrokhlin97, 15615 author = {L. Greengard and V. Rokhlin}, 15616 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 15617 Dimensions}, 15618 journal = {Acta Numerica}, 15619 volume = {6}, 15620 year = {1997}, 15621 pages = {229--269} 15622} 15623 15624@Article{ luchenghuangmccammon06, 15625 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 15626 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 15627 systems}, 15628 journal = {PNAS}, 15629 doi = {10.1073/pnas.0605166103}, 15630 volume = {102}, 15631 number = {51}, 15632 year = {2006}, 15633 pages = {19314--19319} 15634} 15635 15636@Article{ schussnadlereisenberg01, 15637 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 15638 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 15639 from a molecular model}, 15640 journal = {Physical Review E}, 15641 volume = {64}, 15642 number = {3}, 15643 year = {2001} 15644} 15645 15646@Book{ hairerlubichwanner02, 15647 author = {E. Hairer and Ch. Lubich and G. Wanner}, 15648 title = {Geometric Numerical Integration}, 15649 publisher = {Springer-Verlag}, 15650 address = {Berlin Heidelberg}, 15651 year = {2002} 15652} 15653 15654@Article{ holstbakerwang00, 15655 author = {M. Holst and N. Baker and F. Wang}, 15656 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 15657 equation on massively parallel computers}, 15658 journal = {Journal of Computational Chemistry}, 15659 volume = {21}, 15660 year = {2000} 15661} 15662 15663@Book{ hockneyeastwood81, 15664 author = {R. Hockney and J. Eastwood}, 15665 title = {Computer simulation using particles}, 15666 publisher = {McGraw-Hill}, 15667 address = {New York}, 15668 year = {1981} 15669} 15670 15671@Article{ lutydavistironigunsteren94, 15672 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 15673 Gunsteren}, 15674 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 15675 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 15676 journal = {Molecular Simulation}, 15677 volume = {14}, 15678 number = {1}, 15679 year = {1994}, 15680 pages = {11--20} 15681} 15682 15683@Book{ briggshensonmccormick00, 15684 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 15685 title = {A Multigrid Tutorial (2nd ed.)}, 15686 year = {2000}, 15687 isbn = {0-89871-462-1}, 15688 publisher = {Society for Industrial and Applied Mathematics}, 15689 address = {Philadelphia, PA} 15690} 15691 15692@Article{ chartier2003spectral, 15693 title = {Spectral AMGe ($\rho$ AMGe)}, 15694 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 15695 McCormick, S and Ruge, J and Vassilevski, PS}, 15696 journal = {SIAM Journal on Scientific Computing}, 15697 volume = {25}, 15698 number = {1}, 15699 pages = {1--26}, 15700 year = {2003}, 15701 publisher = {SIAM} 15702} 15703 15704@Article{ galvis2010domain, 15705 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 15706 media}, 15707 author = {Galvis, Juan and Efendiev, Yalchin}, 15708 journal = {Multiscale Modeling \& Simulation}, 15709 volume = {8}, 15710 number = {4}, 15711 pages = {1461--1483}, 15712 year = {2010}, 15713 publisher = {SIAM} 15714} 15715 15716@Book{ brennerscott02, 15717 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 15718 title = {The mathematical theory of finite element methods}, 15719 year = {2002}, 15720 isbn = {0-38795-451-1}, 15721 publisher = {Springer}, 15722 pages = {361} 15723} 15724 15725@Book{ trefethenbau97, 15726 author = {Lloyd N. Trefethen and David {Bau, III}}, 15727 title = {Numerical Linear Algebra}, 15728 publisher = {Society for Industrial and Applied Mathematics}, 15729 address = {Philadelphia, PA}, 15730 pages = {xii + 361}, 15731 year = {1997}, 15732 isbn = {0-89871-361-7}, 15733 isbn-13 = {978-0-89871-361-9}, 15734 lccn = {QA184 .T74 1997}, 15735 mrclass = {65-01 (65-02 65Fxx)}, 15736 mrnumber = {MR1444820 (98k:65002)}, 15737 mrreviewer = {Moody T. Chu}, 15738 bibdate = {Wed Jan 07 15:23:19 1998}, 15739 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 15740} 15741 15742@Article{ liptonreagan2014, 15743 title = {Quantum Algorithms via Linear Algebra: A Primer}, 15744 author = {Richard J Lipton and Kenneth W Regan}, 15745 pages = {206}, 15746 isbn = {978-0-26202-839-4}, 15747 year = {2014} 15748} 15749 15750@InProceedings{ rhea08, 15751 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 15752 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 15753 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 15754 booktitle = {Proceedings of IEEE/ACM SC '08}, 15755 year = {2008} 15756} 15757 15758@Misc{ bursteddewilcox09, 15759 author = {Carsten Burstedde and Lucas~C. Wilcox}, 15760 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 15761 note = {in preparation} 15762} 15763 15764@Article{ skeeltezcanhardy02, 15765 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 15766 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 15767 journal = {J. Comp. Chem.}, 15768 volume = {23}, 15769 pages = {673--684}, 15770 year = {2002} 15771} 15772 15773@Article{ verschelde99, 15774 author = {Jan Verschelde}, 15775 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 15776 homotopy continuation}, 15777 journal = {ACM Trans. Math. Softw.}, 15778 volume = {25}, 15779 number = {2}, 15780 issn = {0098-3500}, 15781 pages = {251--276}, 15782 doi = {10.1145/317275.317286}, 15783 publisher = {ACM}, 15784 address = {New York, NY}, 15785 year = {1999} 15786} 15787 15788@InProceedings{ sommeseverscheldewampler08, 15789 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 15790 title = {Solving Polynomial Systems Equation by Equation}, 15791 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 15792 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 15793 pages = {133--152}, 15794 publisher = {Springer-Verlag}, 15795 year = {2008} 15796} 15797 15798@Article{ phanthientanner77, 15799 author = {N. Phan-Thien and R.~I. Tanner}, 15800 title = {A new constitutive equation derived from network theory}, 15801 journal = {J. Non-Newt. Fluid Mech.}, 15802 volume = {2}, 15803 pages = {353}, 15804 year = {1977} 15805} 15806 15807@Manual{ sage, 15808 key = {SAGE}, 15809 author = {W.\thinspace{}A. Stein and others}, 15810 organization = {The Sage~Development Team}, 15811 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 15812 note = {{\tt http://www.sagemath.org}}, 15813 year = {2009} 15814} 15815 15816@Misc{ bateshauensteinsommesewampler06, 15817 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 15818 Wampler}, 15819 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 15820 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 15821} 15822 15823@Article{ archer09, 15824 author = {A. J. Archer}, 15825 collaboration = {}, 15826 title = {Dynamical density functional theory for molecular and colloidal fluids: A 15827 microscopic approach to fluid mechanics}, 15828 publisher = {AIP}, 15829 year = {2009}, 15830 journal = {The Journal of Chemical Physics}, 15831 volume = {130}, 15832 number = {1}, 15833 eid = {014509}, 15834 numpages = {8}, 15835 pages = {014509}, 15836 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 15837 transition; statistical distributions; stochastic processes}, 15838 doi = {10.1063/1.3054633} 15839} 15840 15841@Article{ giesekus1966, 15842 author = {Hanswalter Giesekus}, 15843 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 15844 journal = {Rheologica Acta}, 15845 publisher = {Springer Berlin / Heidelberg}, 15846 volume = {5}, 15847 number = {1}, 15848 month = mar, 15849 year = {1966}, 15850 doi = {10.1007/BF01973575}, 15851 pages = {29-35} 15852} 15853 15854@Article{ baaijens98, 15855 author = {F.P. Baaijens}, 15856 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 15857 journal = {Journal of Non-Newtonian Fluid Mechanics}, 15858 volume = {79}, 15859 year = {1998}, 15860 pages = {361--385} 15861} 15862 15863@Book{ joseph90, 15864 author = {D.~D. Joseph}, 15865 title = {Fluid Dynamics of Viscoelastic Liquids}, 15866 publisher = {Springer}, 15867 address = {New York, NY}, 15868 year = {1990} 15869} 15870 15871@Article{ oldroyd50, 15872 author = {J.~G. Oldroyd}, 15873 title = {On the Formulation of Rheological Equations of State}, 15874 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 15875 Sciences}, 15876 volume = {200}, 15877 year = {1950}, 15878 pages = {523--541} 15879} 15880 15881@InProceedings{ bynasungroppthakur04, 15882 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 15883 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 15884 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 15885 year = {2004} 15886} 15887 15888@Book{ pozrikidis07, 15889 author = {C. Pozrikidis}, 15890 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 15891 publisher = {Kluwer (Springer)}, 15892 pages = {675}, 15893 year = {2001}, 15894 isbn = {0792373510} 15895} 15896 15897@Misc{ kritzkeyesfsp07, 15898 author = {A. Kritz and D. Keyes}, 15899 title = {{Fusion Simulation Project Workshop Report}}, 15900 month = jul, 15901 year = {2007}, 15902 note = {Available via 15903 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 15904} 15905 15906@Misc{ dahlburg02, 15907 author = {J. {Dahlburg (Chair)}}, 15908 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 15909 year = {2002}, 15910 note = {Available via 15911 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 15912} 15913 15914@Misc{ brown08, 15915 author = {D. {Brown (Chair)}}, 15916 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 15917 to the Future}}, 15918 year = {2008}, 15919 howpublished = {Office of Science, U.S. Department of Energy}, 15920 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 15921} 15922 15923@Misc{ crosscutting10, 15924 author = {D. Brown and P. {Messina (Chairs)}}, 15925 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 15926 Exascale}}, 15927 year = {2010}, 15928 howpublished = {Office of Science, U.S. Department of Energy}, 15929 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 15930} 15931 15932@Misc{ extreme-scale-solvers-workshop12, 15933 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 15934 L.C. McInnes and E. Ng and S. Wild}, 15935 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 15936 Architectures}, 15937 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 15938 note = {{Washington, DC}, March 8-9, 2012}, 15939 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 15940 year = {2012} 15941} 15942 15943@Misc{ monizrosner09, 15944 author = {{E. Moniz and R. Rosner}}, 15945 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 15946 and Simulation at the Extreme Scale}}, 15947 month = may, 15948 year = {2009}, 15949 note = {See 15950 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 15951} 15952 15953@Misc{ blanford08, 15954 author = {{R. Blandord (Chair)}}, 15955 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 15956 Computing at the Extreme Scale}}, 15957 month = dec, 15958 year = {2008}, 15959 note = {See 15960 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 15961} 15962 15963@Misc{ exascale07, 15964 author = {H. Simon and T. Zacharia and R. Stevens}, 15965 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 15966 year = {2007}, 15967 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 15968} 15969 15970@Misc{ ascrbreakthroughs08, 15971 author = {{Panel on Recent Significant Advancements in Computational Science}}, 15972 title = {Breakthroughs}, 15973 year = {2008}, 15974 note = {See 15975 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 15976} 15977 15978@Misc{ petsc-rd100-2009, 15979 author = {{R\&D Magazine}}, 15980 title = {{PETSc} {R}\&{D} 100 Award}, 15981 year = {2009}, 15982 note = {See 15983 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 15984} 15985 15986@Article{ compass-scidac08, 15987 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 15988 R. Ryne}, 15989 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 15990 Computational Science for Future Accelerators and Accelerator Technologies}, 15991 journal = {J. Phys.: Conf. Ser.}, 15992 volume = {125}, 15993 year = {2008}, 15994 pages = {012001}, 15995 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 15996} 15997 15998@Article{ compass-amundson-scidac08, 15999 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 16000 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 16001 Stoltz}, 16002 journal = {J. Phys.: Conf. Ser.}, 16003 volume = {125}, 16004 year = {2008} 16005} 16006 16007@InProceedings{ muszala09, 16008 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 16009 Simulations}, 16010 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 16011 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 16012 {(CBHPC 2009)}}, 16013 year = {2009} 16014} 16015 16016@Article{ gaston09, 16017 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 16018 Equations}, 16019 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 16020 journal = {Nuclear Engineering and Design}, 16021 volume = {239}, 16022 number = {10}, 16023 year = {2009}, 16024 pages = {1768 -- 1778} 16025} 16026 16027@Article{ gaston09b, 16028 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 16029 Engineering}, 16030 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 16031 and C. Permann and W. Taitano}, 16032 journal = {J. Phys.: Conf. Ser.}, 16033 volume = {180}, 16034 year = {2009}, 16035 pages = {012012} 16036} 16037 16038@Article{ newman09, 16039 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 16040 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 16041 author = {Chris Newman and Glen Hansen and Derek Gaston}, 16042 journal = {Journal of Nuclear Materials}, 16043 volume = {392}, 16044 issue = {1}, 16045 year = {2009}, 16046 pages = {6 -- 15} 16047} 16048 16049@Misc{ www:fenics, 16050 author = {{FE}ni{CS}}, 16051 title = {{FE}ni{CS} Project}, 16052 howpublished = {\url{http://www.fenics.org/}}, 16053 year = {2018} 16054} 16055 16056@InProceedings{ zwart08, 16057 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 16058 Systems}, 16059 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 16060 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 16061 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 16062 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 16063 booktitle = {Proceedings of ICCS 2008}, 16064 year = {2008} 16065} 16066 16067@Article{ klocknerwarburtonbridgehesthaven09, 16068 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 16069 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 16070 journal = {J. Comput. Phys.}, 16071 volume = {228}, 16072 number = {21}, 16073 year = {2009}, 16074 issn = {0021-9991}, 16075 pages = {7863--7882}, 16076 doi = {10.1016/j.jcp.2009.06.041}, 16077 publisher = {Academic Press Professional}, 16078 address = {San Diego, CA} 16079} 16080 16081@PhDThesis{ rankin99, 16082 author = {Rankin, W. T.}, 16083 keywords = {FMM, parallel FMM}, 16084 school = {Department of Electrical and Computer Engineering, Duke University}, 16085 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 16086 year = {1999} 16087} 16088 16089@InProceedings{ warrensalmon93, 16090 abstract = {We report on an efficient adaptive N-body method which we have recently designed 16091 and implemented. The algorithm computes the forces on an arbitrary distribution of 16092 bodies in a time which scales as N log N with the particle number. The accuracy of 16093 the force calculations is analytically bounded, and can be adjusted via a user 16094 defined parameter between a few percent relative accuracy, down to machine 16095 arithmetic accuracy. Instead of using pointers to indicate the topology of the 16096 tree, we identify...}, 16097 address = {New York}, 16098 author = {Warren, Michael S. and Salmon, John K.}, 16099 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 16100 citeulike-article-id={580952}, 16101 keywords = {oct-tree}, 16102 pages = {12--21}, 16103 publisher = {ACM}, 16104 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 16105 year = {1993}, 16106 doi = {10.1145/169627.169640}, 16107 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 16108} 16109 16110@Unpublished{ cruzwccm10, 16111 author = {Felipe A. Cruz}, 16112 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 16113 note = {Presentation at WCCM 2010, Sydney Australia}, 16114 year = {2010} 16115} 16116 16117@Article{ mcguffee06, 16118 author = {S.~R. {McGuffee} and A.~H. Elcock}, 16119 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 16120 of salt, {pH}, point mutations, and protein concentration in simulations of 16121 1000-molecule systems}, 16122 journal = {Journal of the American Chemical Society}, 16123 volume = {128}, 16124 pages = {12098--12110}, 16125 year = {2006} 16126} 16127 16128@Article{ nilsencaihoylandlangtangen10, 16129 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 16130 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 16131 in Python}}, 16132 journal = {ArXiv e-prints}, 16133 archiveprefix = {arXiv}, 16134 eprint = {1002.0705}, 16135 primaryclass = {cs.DC}, 16136 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 16137 - Programming Languages}, 16138 year = {2010}, 16139 month = feb, 16140 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 16141 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16142} 16143 16144@Misc{ mcinnes:siam09:minisymposium, 16145 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 16146 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 16147 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 16148 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 16149 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 16150 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 16151 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 16152 Austin).} 16153} 16154 16155@Misc{ mcinnes:fsp-summary:feb2011, 16156 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 16157 title = {Solvers and Time Integration Breakout Summary}, 16158 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 16159 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 16160} 16161 16162@Misc{ dvi-materials:siamcse11, 16163 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 16164 Materials}, 16165 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 16166 Smith and L. Wang}, 16167 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 16168 and Engineering, March 3, 2011} 16169} 16170 16171@Misc{ jamroz:cemm10, 16172 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 16173 author = {B. Jamroz and S. Kruger and T. Austin}, 16174 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 16175} 16176 16177@Misc{ kruger:feb4-2011, 16178 title = {personal communication}, 16179 author = {S. Kruger}, 16180 note = {February, 2011} 16181} 16182 16183@Article{ elman1996, 16184 author = {H.C. Elman}, 16185 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 16186 viscosity}, 16187 journal = {SIAM J. Sci. Comput.}, 16188 volume = {20}, 16189 year = {1996}, 16190 pages = {1299--1316} 16191} 16192 16193@Article{ kayloghinwathen2002, 16194 author = {D. Kay and D. Loghin and A. Wathen}, 16195 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 16196 journal = {SIAM J. Sci. Comput.}, 16197 volume = {24}, 16198 year = {2002}, 16199 pages = {237--256} 16200} 16201 16202@Article{ elmanhowleshadidshuttleworthtuminaro2006, 16203 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 16204 title = {Block preconditioners based on approximate commutators}, 16205 journal = {SIAM J. Sci. Comput.}, 16206 volume = {27}, 16207 number = {5}, 16208 year = {2006}, 16209 pages = {1651--1668} 16210} 16211 16212@Article{ braesssarazin1997, 16213 author = {Dietrich Braess and Regina Sarazin}, 16214 title = {An efficient smoother for the {Stokes} problem}, 16215 journal = {Applied Numerical Mathematics}, 16216 volume = {23}, 16217 number = {1}, 16218 year = {1997}, 16219 pages = {3--19}, 16220 doi = {10.1016/S0168-9274(96)00059-1} 16221} 16222 16223@Article{ wright2001large, 16224 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 16225 author = {Wright, T.G. and Trefethen, L.N.}, 16226 journal = {SIAM Journal on Scientific Computing}, 16227 volume = {23}, 16228 pages = {591}, 16229 year = {2001} 16230} 16231 16232@Misc{ wright2002eigtool, 16233 title = {Eig{T}ool}, 16234 author = {Wright, T.G. and Trefethen, LN}, 16235 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 16236 year = {2002} 16237} 16238 16239@Misc{ visit-web-site, 16240 key = {{VisIt}}, 16241 title = {{VisIt web site}}, 16242 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 16243 url = {http://wci.llnl.gov/codes/visit/}, 16244 year = {2011} 16245} 16246 16247@Book{ trefethen1996, 16248 title = {Finite difference and spectral methods for ordinary and partial differential 16249 equations}, 16250 author = {Lloyd Nicholas Trefethen}, 16251 year = {1996}, 16252 publisher = {Cornell University-Department of Computer Science and Center for Applied 16253 Mathematics} 16254} 16255 16256@Book{ trefethen2005spectra, 16257 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 16258 author = {Trefethen, L.N. and Embree, M.}, 16259 year = {2005}, 16260 publisher = {Princeton University Press} 16261} 16262 16263@Article{ gomez2010isogeometric, 16264 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 16265 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 16266 journal = {Computer Methods in Applied Mechanics and Engineering}, 16267 volume = {199}, 16268 number = {25-28}, 16269 pages = {1828--1840}, 16270 issn = {0045-7825}, 16271 year = {2010}, 16272 publisher = {Elsevier} 16273} 16274 16275@Article{ gomez2008isogeometric, 16276 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 16277 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 16278 journal = {Computer Methods in Applied Mechanics and Engineering}, 16279 volume = {197}, 16280 number = {49-50}, 16281 pages = {4333--4352}, 16282 year = {2008}, 16283 publisher = {Elsevier} 16284} 16285 16286@Misc{ fastmath:project, 16287 author = {Lori {Diachin (PI)}}, 16288 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 16289 (FASTMath) Institute}}, 16290 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 16291} 16292 16293@Misc{ exascale-software:proposal, 16294 author = {Peter {Beckman (PI)}}, 16295 title = {{Exascale Software Center}}, 16296 note = {proposal to DOE} 16297} 16298 16299@Misc{ imex:project, 16300 author = {Barry {Smith (PI)}}, 16301 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 16302 Multimodel PDEs}}, 16303 note = {DOE ASCR applied math project} 16304} 16305 16306@Misc{ intel-mic:website, 16307 author = {Intel}, 16308 title = {{Many Integrated Core Architecture}}, 16309 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 16310} 16311 16312@Article{ dudson:2009, 16313 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 16314 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 16315 journal = {Computer Physics Communications}, 16316 volume = {180}, 16317 pages = {1467}, 16318 year = {2009} 16319} 16320 16321@Article{ umansky:2009, 16322 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 16323 title = {{Status and verification of edge plasma turbulence code BOUT}}, 16324 journal = {Computer Physics Communications}, 16325 year = {2009}, 16326 volume = {180}, 16327 pages = {887-903} 16328} 16329 16330@Article{ xu:1998, 16331 author = {X.Q. Xu and R.H. Cohen}, 16332 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 16333 journal = {Computer Physics Communications}, 16334 year = {1998}, 16335 volume = {36}, 16336 number = {1-2}, 16337 pages = {158} 16338} 16339 16340@Article{ tron:1999, 16341 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 16342 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 16343 journal = {SIAM Journal on Optimization}, 16344 volume = {9}, 16345 number = {4}, 16346 pages = {1100-1127}, 16347 year = {1999} 16348} 16349 16350@Article{ stubenamg, 16351 author = {K. St\"{u}ben}, 16352 title = {A review of algebraic multigrid}, 16353 journal = {J. Comput. Appl. Math.}, 16354 volume = {128}, 16355 number = {1-2}, 16356 year = {2001}, 16357 issn = {0377-0427}, 16358 pages = {281--309}, 16359 doi = {10.1016/S0377-0427(00)00516-1}, 16360 publisher = {Elsevier Science Publishers B. V.}, 16361 address = {Amsterdam, The Netherlands, The Netherlands} 16362} 16363 16364@Article{ feuchtermg, 16365 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 16366 title = {Bridging the gap between geometric and algebraic multigrid methods}, 16367 journal = {Computing and visualization in science}, 16368 publisher = {Springer}, 16369 volume = {6}, 16370 number = {1}, 16371 year = {2003}, 16372 pages = {1--13} 16373} 16374 16375@Article{ chowmgsmoothness, 16376 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 16377 only attempts to interpolate in the directions of geometrical smoothness. These 16378 directions are determined by analyzing samples of algebraically smooth error, e. 16379 Neighboring grid points i and j are called smoothly coupled if e i and e j are 16380 consistently nearby in value. In addition, these dierences may be used to dene 16381 interpolation weights. These new ideas may be incorporated into the algebraic 16382 multigrid method. Test results show that the new method can have much lower grid 16383 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 16384 author = {Chow, Edmond}, 16385 citeulike-article-id={7675372}, 16386 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 16387 journal = {American Journal of Mathematics}, 16388 keywords = {fem, multigrid}, 16389 pages = {197--215}, 16390 posted-at = {2010-08-17 23:29:51}, 16391 priority = {2}, 16392 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 16393 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 16394 volume = {65}, 16395 year = {2001} 16396} 16397 16398@Article{ jonesamge, 16399 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 16400 elements) method based on element agglomeration. In the method, coarse grid 16401 elements are formed by agglomerating fine grid elements. Compatible interpolation 16402 operators are constructed which yield coarse grid basis functions with a minimal 16403 energy property. Heuristics based on interpolation quality measures are used to 16404 guide the agglomeration procedure. The performance of the resulting method is 16405 demonstrated in two-level numerical experiments.}}, 16406 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 16407 citeulike-article-id={8598569}, 16408 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 16409 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 16410 journal = {SIAM Journal on Scientific Computing}, 16411 keywords = {amg, fem, multigrid}, 16412 number = {1}, 16413 pages = {109--133}, 16414 posted-at = {2011-01-13 18:05:55}, 16415 priority = {2}, 16416 publisher = {SIAM}, 16417 title = {{AMGE Based on Element Agglomeration}}, 16418 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 16419 volume = {23}, 16420 year = {2001} 16421} 16422 16423@Article{ saad1993, 16424 author = {Saad, Youcef}, 16425 doi = {10.1137/0914028}, 16426 issn = {10648275}, 16427 journal = {SIAM Journal on Scientific Computing}, 16428 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 16429 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 16430 precondition-,preconditioned conju-,subject classi cations,variable 16431 preconditioners}, 16432 number = {2}, 16433 pages = {461--469}, 16434 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 16435 volume = {14}, 16436 year = {1993} 16437} 16438 16439@Misc{ path:homepage, 16440 author = {S. Dirkse and M. Ferris and T. Munson}, 16441 title = {{{PATH} {W}eb page}}, 16442 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 16443} 16444 16445@Article{ ketcheson2008, 16446 author = {David I Ketcheson}, 16447 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 16448 Low-Storage Implementations}, 16449 volume = {30}, 16450 journal = {SIAM Journal on Scientific Computing}, 16451 year = {2008}, 16452 pages = {2113--2136} 16453} 16454 16455@Article{ elman2009boundary, 16456 title = {{Boundary conditions in approximate commutator preconditioners for the 16457 Navier-Stokes equations}}, 16458 author = {Elman, H.C. and Tuminaro, R.}, 16459 journal = {Electronic Transactions on Numerical Analysis}, 16460 volume = {35}, 16461 pages = {257--280}, 16462 year = {2009} 16463} 16464 16465@Article{ elman2008tcp, 16466 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 16467 incompressible Navier-Stokes equations}}, 16468 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 16469 R.}, 16470 journal = {Journal of Computational Physics}, 16471 volume = {227}, 16472 number = {1}, 16473 pages = {1790--1808}, 16474 year = {2008}, 16475 publisher = {Academic Press}, 16476 url = {http://chess.cs.umd.edu/~elman/papers/tax.pdf} 16477} 16478 16479@Article{ arioli2013, 16480 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 16481 author = {Arioli, Mario}, 16482 journal = {SIAM Journal on Matrix Analysis and Applications}, 16483 volume = {34}, 16484 number = {2}, 16485 pages = {571--592}, 16486 year = {2013}, 16487 publisher = {SIAM} 16488} 16489 16490@Book{ wesseling2009, 16491 title = {Principles of computational fluid dynamics}, 16492 author = {Wesseling, Pieter}, 16493 volume = {29}, 16494 year = {2009}, 16495 publisher = {Springer Science \& Business Media} 16496} 16497 16498@Article{ silvester2001efficient, 16499 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 16500 incompressible flow}}, 16501 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 16502 journal = {Journal of Computational and Applied Mathematics}, 16503 volume = {128}, 16504 number = {1-2}, 16505 pages = {261--279}, 16506 issn = {0377-0427}, 16507 year = {2001}, 16508 publisher = {Elsevier} 16509} 16510 16511@Article{ elman1999bfbt, 16512 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 16513 viscosity}}, 16514 author = {Elman, H.C.}, 16515 journal = {SIAM Journal on Scientific Computing}, 16516 volume = {20}, 16517 number = {4}, 16518 pages = {1299--1316}, 16519 issn = {1064-8275}, 16520 year = {1999}, 16521 publisher = {Citeseer} 16522} 16523 16524@Article{ elman2006bpb, 16525 title = {{Block preconditioners based on approximate commutators}}, 16526 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 16527 journal = {SIAM Journal on Scientific Computing}, 16528 volume = {27}, 16529 number = {5}, 16530 pages = {1651--1668}, 16531 year = {2006}, 16532 publisher = {Philadelphia, PA: SIAM, c1993-} 16533} 16534 16535@Article{ olshanskii2006analysis, 16536 title = {{Analysis of a Stokes interface problem}}, 16537 author = {Olshanskii, M.A. and Reusken, A.}, 16538 journal = {Numerische Mathematik}, 16539 volume = {103}, 16540 number = {1}, 16541 pages = {129--149}, 16542 issn = {0029-599X}, 16543 year = {2006}, 16544 publisher = {Springer} 16545} 16546 16547@Article{ patankar1972cph, 16548 title = {{A calculation procedure for heat, mass and momentum transfer in 16549 three-dimensional parabolic flows}}, 16550 author = {Patankar, S.V. and Spalding, D.B.}, 16551 journal = {Int. J. Heat Mass Transfer}, 16552 volume = {15}, 16553 pages = {1787--1806}, 16554 year = {1972} 16555} 16556 16557@Article{ rannacher1992simple, 16558 title = {{Simple nonconforming quadrilateral Stokes element}}, 16559 author = {Rannacher, R. and Turek, S.}, 16560 journal = {Numerical Methods for Partial Differential Equations}, 16561 volume = {8}, 16562 number = {2}, 16563 pages = {97--111}, 16564 issn = {1098-2426}, 16565 year = {1992}, 16566 publisher = {Wiley Online Library} 16567} 16568 16569@Article{ rannacher2000finite, 16570 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 16571 author = {Rannacher, R.}, 16572 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 16573 pages = {191}, 16574 isbn = {3764364149}, 16575 year = {2000}, 16576 publisher = {Birkhauser} 16577} 16578 16579@Article{ vanka1986block, 16580 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 16581 variables}}, 16582 author = {Vanka, S.P.}, 16583 journal = {Journal of Computational Physics}, 16584 volume = {65}, 16585 number = {1}, 16586 pages = {138--158}, 16587 issn = {0021-9991}, 16588 year = {1986}, 16589 publisher = {Elsevier} 16590} 16591 16592@Article{ eisenstat1983variational, 16593 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 16594 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 16595 journal = {SIAM Journal on Numerical Analysis}, 16596 volume = {20}, 16597 number = {2}, 16598 pages = {345--357}, 16599 year = {1983}, 16600 publisher = {JSTOR} 16601} 16602 16603@InProceedings{ burstedde2008scalable, 16604 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16605 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 16606 T. and Wilcox, L.C. and Zhong, S.}, 16607 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 16608 pages = {62}, 16609 year = {2008}, 16610 organization = {IEEE Press} 16611} 16612 16613@Article{ burstedde2009parallel, 16614 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 16615 flow problems}, 16616 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 16617 journal = {Computer Methods in Applied Mechanics and Engineering}, 16618 volume = {198}, 16619 number = {21-26}, 16620 pages = {1691--1700}, 16621 year = {2009}, 16622 publisher = {Elsevier} 16623} 16624 16625@Article{ stadler2010dynamics, 16626 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 16627 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 16628 Ghattas, O.}, 16629 journal = {Science}, 16630 volume = {329}, 16631 number = {5995}, 16632 pages = {1033}, 16633 year = {2010}, 16634 publisher = {American Association for the Advancement of Science} 16635} 16636 16637@Article{ tackley2008modelling, 16638 title = {Modelling compressible mantle convection with large viscosity contrasts in a 16639 three-dimensional spherical shell using the yin-yang grid}, 16640 author = {Tackley, P.J.}, 16641 journal = {Physics of the Earth and Planetary Interiors}, 16642 volume = {171}, 16643 number = {1-4}, 16644 pages = {7--18}, 16645 year = {2008}, 16646 publisher = {Elsevier} 16647} 16648 16649@Article{ moresizhonggurnis96, 16650 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 16651 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 16652 viscosity}, 16653 journal = {Physics of the Earth and Planetary Interiors}, 16654 volume = {97}, 16655 pages = {83-–94}, 16656 year = {1996} 16657} 16658 16659@Article{ moresisolomatov95, 16660 author = {Louis N. Moresi and V. S. Solomatov}, 16661 title = {Numerical investigation of {2D} convection with extremely large viscosity 16662 variations}, 16663 journal = {Physics of Fluids}, 16664 volume = {7}, 16665 number = {9}, 16666 pages = {2154-–2162}, 16667 year = {1995} 16668} 16669 16670@Article{ chenmolnar83, 16671 author = {W.-P. Chen and P. Molnar}, 16672 title = {Focal depths of intra-continental and intraplate earthquakes and their 16673 implications for the thermal and mechanical properties of the lithosphere}, 16674 journal = {Journal of Geophysical Research}, 16675 volume = {88}, 16676 pages = {4183–-4214}, 16677 year = {1983} 16678} 16679 16680@Article{ jackson02, 16681 author = {J. Jackson}, 16682 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 16683 journal = {GSA Today}, 16684 volume = {12}, 16685 pages = {4–-10}, 16686 year = {2002} 16687} 16688 16689@Article{ burovwatts06, 16690 author = {E.B. Burov and A.B. Watts}, 16691 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 16692 brulee?}, 16693 journal = {GSA Today}, 16694 volume = {16}, 16695 pages = {4–-10}, 16696 year = {2006} 16697} 16698 16699@InProceedings{ yang:brent:2002, 16700 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 16701 Parallel Distributed Memory Architectures}, 16702 author = {Laurence T. Yang and Richard Brent}, 16703 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 16704 for Parallel Processing}, 16705 year = {2002}, 16706 publisher = {IEEE} 16707} 16708 16709@Article{ demmel2008communication, 16710 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 16711 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 16712 journal = {Arxiv preprint arXiv:0808.2664}, 16713 year = {2008} 16714} 16715 16716@Article{ demmel09, 16717 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 16718 title = {Communication-optimal Iterative Methods}, 16719 journal = {Journal of Physics: Conf. Series}, 16720 volume = {180}, 16721 year = {2009} 16722} 16723 16724@TechReport{ parms04, 16725 author = {Yousef Saad and Masha Sosonkina}, 16726 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 16727 linear systems user's guide}, 16728 number = {UMSI2004-8}, 16729 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 16730 year = {2004} 16731} 16732 16733@Article{ picard1890, 16734 author = {Emile Picard}, 16735 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 16736 m\'ethode des approximations successives}, 16737 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 16738 volume = {4}, 16739 number = {6}, 16740 pages = {145--210}, 16741 year = {1890}, 16742 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 16743} 16744 16745@Book{ rall1969, 16746 author = {Louis B. Rall}, 16747 title = {Computational solution of nonlinear operator equations}, 16748 publisher = {Krieger Pub Co.}, 16749 pages = {225}, 16750 year = {1969} 16751} 16752 16753@Article{ fletcherreeves1964, 16754 author = {R. Fletcher and C. M. Reeves}, 16755 title = {Function Minimization by Conjugate Gradients}, 16756 journal = {Computer Journal}, 16757 volume = {7}, 16758 pages = {149–-154}, 16759 year = {1964} 16760} 16761 16762@InBook{ mcinnesallanetal06, 16763 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 16764 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 16765 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 16766 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 16767 editor = {A.~M.~Bruaset and A.~Tveito}, 16768 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 16769 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 16770 publisher = {Springer}, 16771 year = {2006}, 16772 number = {51}, 16773 series = {Lecture Notes in Computational Science and Engineering}, 16774 pages = {327--381}, 16775 doi = {10.1016/S0167-8191(02)00191-6} 16776} 16777 16778@Article{ cyrshadidtuminaro12, 16779 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 16780 equations}, 16781 journal = {Journal of Computational Physics}, 16782 volume = {231}, 16783 number = {2}, 16784 pages = {345 - 363}, 16785 year = {2012}, 16786 issn = {0021-9991}, 16787 doi = {10.1016/j.jcp.2011.09.001}, 16788 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 16789} 16790 16791@Article{ keyesmcinneswoodwardetal13, 16792 title = {Multiphysics Simulations: Challenges and Opportunities}, 16793 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 16794 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 16795 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 16796 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 16797 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 16798 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 16799 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 16800 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 16801 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 16802 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 16803 journal = {International Journal of High Performance Computing Applications}, 16804 month = feb, 16805 year = {2013}, 16806 volume = {27}, 16807 number = {1}, 16808 pages = {4--83}, 16809 doi = {10.1177/1094342012468181}, 16810 note = {Special issue}, 16811 abstract = {We consider multiphysics applications from algorithmic and architectural 16812 perspectives, where ``algorithmic'' includes both mathematical analysis and 16813 computational complexity and ``architectural'' includes both software and hardware 16814 environments. Many diverse multiphysics applications can be reduced, en route to 16815 their computational simulation, to a common algebraic coupling paradigm. 16816 Mathematical analysis of multiphysics coupling in this form is not always 16817 practical for realistic applications, but model problems representative of 16818 applications discussed herein can provide insight. A variety of software 16819 frameworks for multiphysics applications have been constructed and refined within 16820 disciplinary communities and executed on leading-edge computer systems. We examine 16821 several of these, expose some commonalities among them, and attempt to extrapolate 16822 best practices to future systems. From our study, we summarize challenges and 16823 forecast opportunities.} 16824} 16825 16826@Misc{ rosner10, 16827 author = {Robert {Rosner (Chair)}}, 16828 title = {{The Opportunities and Challenges of Exascale Computing}}, 16829 year = {2010}, 16830 howpublished = {Office of Science, U.S. Department of Energy}, 16831 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 16832} 16833 16834@Misc{ kogge2008exascale, 16835 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 16836 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 16837 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 16838 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 16839 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 16840 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 16841 howpublished = {DARPA}, 16842 year = {2008}, 16843 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 16844} 16845 16846@Misc{ doegrandchallengeworkshops, 16847 key = {Office of Science, U.S. Department of Energy}, 16848 title = {{Scientific Grand Challenges Workshop Series}}, 16849 howpublished = {Office of Science, U.S. Department of Energy, see 16850 \url{http://extremecomputing.labworks.org/workshops.stm}} 16851} 16852 16853@Misc{ lawrence2011, 16854 key = {Lawrence}, 16855 title = {{Ernest Orlando Lawrence Award Winners}}, 16856 howpublished = {U.S. Department of Energy, {\footnotesize 16857 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 16858 year = {2011} 16859} 16860 16861@Article{ murphy2000npi, 16862 title = {{A note on preconditioning for indefinite linear systems}}, 16863 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 16864 journal = {SIAM Journal on Scientific Computing}, 16865 volume = {21}, 16866 number = {6}, 16867 pages = {1969--1972}, 16868 year = {2000}, 16869 publisher = {Philadelphia, PA: SIAM, c1993-} 16870} 16871 16872@Article{ elman2011bouyancy, 16873 title = {Fast iterative solvers for buoyancy driven flow problems}, 16874 journal = {Journal of Computational Physics}, 16875 volume = {230}, 16876 number = {10}, 16877 pages = {3900 - 3914}, 16878 year = {2011}, 16879 note = {}, 16880 issn = {0021-9991}, 16881 doi = {10.1016/j.jcp.2011.02.014}, 16882 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 16883 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 16884 Adaptivity, Preconditioning, Algebraic multigrid} 16885} 16886 16887@Article{ dongarrabeckman11, 16888 author = {J. Dongarra and P. Beckman and et al.}, 16889 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 16890 journal = {Int. J. High Perf. Comput. Applics.}, 16891 volume = {25}, 16892 year = {2011}, 16893 pages = {3--60} 16894} 16895 16896@Article{ mandel1999energy, 16897 title = {Energy optimization of algebraic multigrid bases}, 16898 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 16899 journal = {Computing}, 16900 volume = {62}, 16901 number = {3}, 16902 pages = {205--228}, 16903 year = {1999}, 16904 publisher = {Springer} 16905} 16906 16907@Article{ vanek1996algebraic, 16908 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 16909 problems}, 16910 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 16911 journal = {Computing}, 16912 volume = {56}, 16913 number = {3}, 16914 pages = {179--196}, 16915 year = {1996}, 16916 publisher = {Springer} 16917} 16918 16919@Article{ vanek2001convergence, 16920 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 16921 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 16922 journal = {Numerische Mathematik}, 16923 volume = {88}, 16924 number = {3}, 16925 pages = {559--579}, 16926 year = {2001}, 16927 publisher = {Springer} 16928} 16929 16930@Article{ brannick2007algebraic, 16931 title = {Algebraic multigrid methods based on compatible relaxation and energy 16932 minimization}, 16933 author = {Brannick, J. and Zikatanov, L.}, 16934 journal = {Domain decomposition methods in science and engineering XVI}, 16935 pages = {15--26}, 16936 year = {2007}, 16937 publisher = {Springer} 16938} 16939 16940@Article{ brannickfalgout2010, 16941 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 16942 author = {James J. Brannick and Robert D. Falgout}, 16943 journal = {SIAM Journal on Scientific Computing}, 16944 volume = {32}, 16945 number = {3}, 16946 pages = {1393--1416}, 16947 url = {http://epubs.siam.org/doi/10.1137/090772216}, 16948 doi = {10.1137/090772216}, 16949 issn = {1064-8275}, 16950 year = {2010} 16951} 16952 16953@Article{ xu2004energy, 16954 title = {On an energy minimizing basis for algebraic multigrid methods}, 16955 author = {Xu, J. and Zikatanov, L.}, 16956 journal = {Computing and Visualization in Science}, 16957 volume = {7}, 16958 number = {3}, 16959 pages = {121--127}, 16960 year = {2004}, 16961 publisher = {Springer} 16962} 16963 16964@Article{ dblp:journals/toms/bakerhlt09, 16965 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 16966 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 16967 journal = {ACM Trans. Math. Softw.}, 16968 volume = {36}, 16969 number = {3}, 16970 year = {2009}, 16971 doi = {10.1145/1527286.1527287}, 16972 bibsource = {DBLP, http://dblp.uni-trier.de} 16973} 16974 16975@Article{ dblp:journals/siamsc/yanggbllhn05, 16976 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 16977 Parry Husbands and Esmond G. Ng}, 16978 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 16979 journal = {SIAM J. Scientific Computing}, 16980 volume = {27}, 16981 number = {3}, 16982 year = {2005}, 16983 pages = {873-892}, 16984 doi = {10.1137/040613767}, 16985 bibsource = {DBLP, http://dblp.uni-trier.de} 16986} 16987 16988@TechReport{ ml-guide, 16989 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 16990 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 16991 institution = {Sandia National Laboratories}, 16992 year = {2006}, 16993 number = {SAND2006-2649} 16994} 16995 16996@Article{ brannick06, 16997 title = {An energy-based AMG coarsening strategy}, 16998 volume = {13}, 16999 doi = {10.1002/nla.480}, 17000 number = {2-3}, 17001 journal = {Numerical Linear Algebra with Applications}, 17002 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 17003 and Ruge, J}, 17004 year = {2006}, 17005 pages = {133--148} 17006} 17007 17008@Article{ olson10, 17009 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 17010 title = {A new perspective on strength measures in algebraic multigrid}, 17011 journal = {Numerical Linear Algebra with Applications}, 17012 volume = {17}, 17013 number = {4}, 17014 pages = {713--733}, 17015 year = {2010}, 17016 publisher = {John Wiley \& Sons, Ltd.}, 17017 issn = {1099-1506}, 17018 doi = {10.1002/nla.669} 17019} 17020 17021@Article{ olson11, 17022 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 17023 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 17024 Minimization}, 17025 journal = {SIAM J. Sci. Comput.}, 17026 issue_date = {April 2011}, 17027 volume = {33}, 17028 issue = {2}, 17029 month = apr, 17030 year = {2011}, 17031 issn = {1064-8275}, 17032 pages = {966--991}, 17033 numpages = {26}, 17034 doi = {10.1137/100803031}, 17035 acmid = {2078825}, 17036 publisher = {Society for Industrial and Applied Mathematics}, 17037 address = {Philadelphia, PA}, 17038 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 17039 aggregation} 17040} 17041 17042@Article{ dorit2011, 17043 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 17044 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 17045 journal = {Multiscale Modeling {\&} Simulation}, 17046 volume = {9}, 17047 number = {1}, 17048 year = {2011}, 17049 pages = {407-423}, 17050 doi = {10.1137/100791142} 17051} 17052 17053@Article{ chen2011algebraic, 17054 title = {Algebraic distance on graphs}, 17055 author = {Chen, Jie and Safro, Ilya}, 17056 journal = {SIAM Journal on Scientific Computing}, 17057 volume = {33}, 17058 number = {6}, 17059 pages = {3468--3490}, 17060 year = {2011}, 17061 publisher = {SIAM} 17062} 17063 17064@InProceedings{ adams04, 17065 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 17066 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 17067 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 17068 half a billion degrees of freedom}, 17069 note = {Gordon Bell Award}, 17070 year = {2004} 17071} 17072 17073@Article{ adams03a, 17074 author = {Adams, M.~F.}, 17075 journal = {Numerical Linear Algebra with Applications}, 17076 number = {2-3}, 17077 pages = {141-153}, 17078 title = {Algebraic multigrid methods for constrained linear systems with applications to 17079 contact problems in solid mechanics}, 17080 volume = {11}, 17081 year = {2004} 17082} 17083 17084@Article{ adams-10a, 17085 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 17086 doi = {10.1016/j.jcp.2010.04.024}, 17087 issn = {0021-9991}, 17088 journal = {Journal of Computational Physics}, 17089 keywords = {Implicit magnetohydrodynamics}, 17090 number = {18}, 17091 pages = {6208 - 6219}, 17092 title = {Toward textbook multigrid efficiency for fully implicit resistive 17093 magnetohydrodynamics}, 17094 volume = {229}, 17095 year = {2010} 17096} 17097 17098@InProceedings{ adams98, 17099 address = {Copper Mountain, CO}, 17100 author = {Adams, M.~F.}, 17101 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 17102 title = {A Parallel Maximal Independent Set Algorithm}, 17103 year = {1998} 17104} 17105 17106@InProceedings{ madaypatera89, 17107 author = {Y. Maday and A. T. Patera}, 17108 title = {Spectral element methods for the {Navier-Stokes} equations}, 17109 editor = {A. K. Noor and J. T. Oden}, 17110 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 17111 pages = {71-–143}, 17112 publisher = {ASME}, 17113 address = {New York, NY}, 17114 year = {1989} 17115} 17116 17117@Article{ mishra2012mlmcfvm, 17118 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 17119 conservation laws in multi-dimensions}, 17120 journal = {Journal of Computational Physics}, 17121 volume = {231}, 17122 number = {8}, 17123 pages = {3365--3388}, 17124 year = {2012}, 17125 issn = {0021-9991}, 17126 doi = {10.1016/j.jcp.2012.01.011}, 17127 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 17128 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 17129 Carlo, Parallelization} 17130} 17131 17132@Article{ barth2011mlmcfe, 17133 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 17134 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 17135 Switzerland}, 17136 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 17137 stochastic coefficients}, 17138 journal = {Numerische Mathematik}, 17139 publisher = {Springer Berlin / Heidelberg}, 17140 issn = {0029-599X}, 17141 keyword = {Mathematics and Statistics}, 17142 pages = {123-161}, 17143 volume = {119}, 17144 issue = {1}, 17145 doi = {10.1007/s00211-011-0377-0}, 17146 year = {2011} 17147} 17148 17149@Article{ nguyen2011hybridizable, 17150 title = {Hybridizable discontinuous {G}alerkin methods}, 17151 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 17152 journal = {Spectral and High Order Methods for Partial Differential Equations}, 17153 pages = {63--84}, 17154 year = {2011}, 17155 publisher = {Springer} 17156} 17157 17158@Misc{ snyder-scidac3:proposal, 17159 author = {Philip {Snyder (PI)}}, 17160 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 17161 note = {proposal to DOE SciDAC3}, 17162 month = oct, 17163 year = {2011} 17164} 17165 17166@Misc{ wirth-scidac3:proposal, 17167 author = {Brian {Wirth (PI)}}, 17168 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 17169 through Leadership Class Computing}}, 17170 note = {proposal to DOE SciDAC3}, 17171 month = oct, 17172 year = {2011} 17173} 17174 17175@Misc{ cary-scidac3:proposal, 17176 author = {John {Cary (PI)}}, 17177 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 17178 Stability (IMMPACTS)}}, 17179 note = {proposal to DOE SciDAC3}, 17180 month = oct, 17181 year = {2011} 17182} 17183 17184@Misc{ vashista-scidac3:proposal, 17185 author = {Priya {Vashista (PI)}}, 17186 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 17187 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 17188 Multi-Petaflops Simulations}}, 17189 note = {proposal to DOE SciDAC3}, 17190 month = mar, 17191 year = {2012} 17192} 17193 17194@Article{ elemental2012, 17195 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 17196 Robert {v}an~{d}e~{G}eijn}, 17197 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 17198 journal = {{ACM} Transactions on Mathematical Software}, 17199 volume = {39}, 17200 number = {2}, 17201 year = {2013} 17202} 17203 17204@Misc{ elemental-web-page, 17205 author = {Jack Poulson}, 17206 title = {Elemental: Distributed memory dense linear algebra}, 17207 howpublished = {\url{http://libelemental.org}}, 17208 url = {http://libelemental.org/}, 17209 year = {2015} 17210} 17211 17212@Book{ scalesreport, 17213 title = {A Science-based Case for Large-scale Simulation}, 17214 editor = {D. E. Keyes}, 17215 publisher = {U.S. Department of Energy}, 17216 year = {2004}, 17217 url = {http://www.pnl.gov/scales} 17218} 17219 17220@InProceedings{ cilk95, 17221 address = {Santa Barbara, California}, 17222 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 17223 Leiserson and Keith H. Randall and Yuli Zhou}, 17224 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 17225 Parallel Programming (PPoPP)}, 17226 day = {19--21}, 17227 month = jul, 17228 pages = {207--216}, 17229 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 17230 year = {1995} 17231} 17232 17233@Misc{ valgrind-web-page, 17234 author = {Julian Seward}, 17235 title = {Valgrind}, 17236 url = {http://valgrind.org/}, 17237 howpublished = {\url{http://valgrind.org/}}, 17238 year = {2012} 17239} 17240 17241@Article{ blas79, 17242 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 17243 title = {Basic linear algebra subprograms for Fortran usage}, 17244 journal = {ACM Transactions on Mathematical Software}, 17245 volume = {5}, 17246 pages = {308--323}, 17247 year = {1979} 17248} 17249 17250@TechReport{ lapack90, 17251 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 17252 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 17253 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 17254 institution = {Computer Science Dept., University of Tennessee}, 17255 number = {CS-90-105}, 17256 month = may, 17257 year = {1990} 17258} 17259 17260@TechReport{ nvidiafermi, 17261 author = {NVIDIA}, 17262 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 17263 institution = {NVIDIA}, 17264 year = {2009} 17265} 17266 17267@Misc{ intelmic, 17268 author = {Many Core Group, Cambridge University}, 17269 title = {Intel Many Integrated Core Architecture}, 17270 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 17271 month = dec, 17272 year = {2010} 17273} 17274 17275@Article{ abusufahkucklawrie81, 17276 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 17277 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 17278 Transformations}, 17279 journal = {IEEE Trans. Comput.}, 17280 volume = {30}, 17281 number = {5}, 17282 pages = {341--356}, 17283 year = {1981} 17284} 17285 17286@InProceedings{ guobikshandifraguelagarzaranpadua08, 17287 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 17288 and Padua, David}, 17289 title = {Programming with tiles}, 17290 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 17291 parallel programming}, 17292 series = {PPoPP '08}, 17293 year = {2008}, 17294 isbn = {978-1-59593-795-7}, 17295 location = {Salt Lake City, UT}, 17296 pages = {111--122}, 17297 numpages = {12}, 17298 doi = {10.1145/1345206.1345225}, 17299 acmid = {1345225}, 17300 publisher = {ACM}, 17301 address = {New York, NY} 17302} 17303 17304@Article{ strout04, 17305 journal = {International Journal of High Performance Computing Applications}, 17306 year = {2004}, 17307 title = {Sparse Tiling for Stationary Iterative Methods}, 17308 month = feb, 17309 publisher = {Sage Publications}, 17310 pages = {95-114}, 17311 volume = {18}, 17312 number = {1}, 17313 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 17314} 17315 17316@Misc{ openclstandard, 17317 author = {Khronos Group}, 17318 title = {{OpenCL} 1.2 Specification}, 17319 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 17320 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 17321 year = {2011} 17322} 17323 17324@Misc{ stlguide, 17325 author = {SGI}, 17326 title = {Standard Template Library Programmer's Guide}, 17327 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 17328 url = {http://www.sgi.com/tech/stl/}, 17329 year = {2011} 17330} 17331 17332@Book{ stepanov09, 17333 author = {Alexander Stepanov and Paul McJones}, 17334 title = {Elements of Programming}, 17335 publisher = {Addison-Wesley}, 17336 isbn = {978-0-321-63537-2}, 17337 year = {2009} 17338} 17339 17340@Article{ bangerthhartmannkanschat2007, 17341 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 17342 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 17343 journal = {ACM Trans. Math. Softw.}, 17344 year = {2007}, 17345 volume = {33}, 17346 number = {4}, 17347 pages = {24/1--24/27} 17348} 17349 17350@Misc{ dealii-web-page, 17351 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 17352 title = {{deal.II}}, 17353 howpublished = {\url{http://www.dealii.org/}}, 17354 url = {http://www.dealii.org/}, 17355 year = {2012} 17356} 17357 17358@InBook{ siek2012, 17359 title = {The C++0x ``Concepts'' Effort}, 17360 author = {Jeremy G. Siek}, 17361 editor = {Jeremy Gibbons}, 17362 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 17363 UK, March 22-26, 2010, Revised Lectures}, 17364 pages = {175--216}, 17365 isbn = {978-3-642-32202-0}, 17366 doi = {10.1007/978-3-642-32202-0_4}, 17367 url = {http://arxiv.org/abs/1201.0027}, 17368 note = {\url{http://arxiv.org/abs/1201.0027}}, 17369 publisher = {Springer Berlin Heidelberg}, 17370 year = {2012} 17371} 17372 17373@Misc{ sharpclaw, 17374 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 17375 author = {Ketcheson, D. I. and Parsani, M.}, 17376 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 17377 PDEs,sharpclaw,software}, 17378 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 17379 PDEs,sharpclaw,software}, 17380 title = {{SharpClaw software}}, 17381 year = {2011} 17382} 17383 17384@Book{ leveque2002, 17385 title = {Finite volume methods for hyperbolic problems}, 17386 author = {Randall J LeVeque}, 17387 volume = {31}, 17388 year = {2002} 17389} 17390 17391@Misc{ clawpack45, 17392 note = {\url{http://www.clawpack.org}}, 17393 author = {LeVeque, R. J. and Berger, M. J.}, 17394 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 17395 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 17396 title = {{Clawpack Software version 4.5}}, 17397 url = {www.clawpack.org}, 17398 year = {2011} 17399} 17400 17401@Article{ nilsen2010, 17402 archiveprefix = {arXiv}, 17403 arxivid = {arXiv:1002.0705v1}, 17404 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 17405 eprint = {arXiv:1002.0705v1}, 17406 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 17407 parallelization of scientific codes by a function-centric approach in 17408 Python.pdf:pdf}, 17409 journal = {Computational Science \& Discovery}, 17410 keywords = {parallel,programming,python,software}, 17411 mendeley-tags = {parallel,programming,python,software}, 17412 pages = {015003}, 17413 publisher = {IOP Publishing}, 17414 title = {{Simplifying the parallelization of scientific codes by a function-centric 17415 approach in Python}}, 17416 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 17417 volume = {3}, 17418 year = {2010} 17419} 17420 17421@Book{ langtangen09, 17422 author = {Hans Petter Langtangen}, 17423 title = {Python Scripting for Computational Science}, 17424 publisher = {Springer}, 17425 series = {Texts in Computational Science and Engineering}, 17426 pages = {784}, 17427 isbn = {3540739157}, 17428 year = {2009} 17429} 17430 17431@Book{ numpyguide, 17432 author = {Travis E. Oliphant}, 17433 title = {Guide to Numpy}, 17434 publisher = {Trelgol}, 17435 year = {2008} 17436} 17437 17438@Misc{ pycuda, 17439 author = {Andreas Kl\"ockner}, 17440 title = {{PyCUDA}}, 17441 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 17442 year = {2011} 17443} 17444 17445@Misc{ pyopencl, 17446 author = {Andreas Kl\"ockner}, 17447 title = {{PyOpenCL}}, 17448 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 17449 year = {2011} 17450} 17451 17452@Article{ klockner2012, 17453 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 17454 Paul Ivanov and Ahmed Fasih}, 17455 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 17456 generation}, 17457 journal = {Parallel Computing}, 17458 volume = {38}, 17459 number = {3}, 17460 pages = {157--174}, 17461 year = {2012}, 17462 issn = {0167-8191}, 17463 doi = {10.1016/j.parco.2011.09.001} 17464} 17465 17466%%%%%% Matt Stuff %%%%%% 17467@Article{ morrabozdagknepleyrassvesselinov, 17468 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 17469 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 17470 Velimir Vesselinov}, 17471 journal = {Eos}, 17472 volume = {102}, 17473 doi = {10.1029/2021EO159258}, 17474 month = jun, 17475 year = {2021} 17476} 17477 17478@Misc{ knepley:icerm-workshop:2012, 17479 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 17480 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 17481 Models for Large-scale Simulations}, 17482 note = {Workshop sponsored by the Institute for Computational and Experimental Research 17483 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 17484 \url{http://icerm.brown.edu/tw12-1-exascale}}, 17485 year = {2012} 17486} 17487 17488@TechReport{ kirbyknepleyscott04, 17489 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 17490 title = {Optimal Evaluation of Finite Element Matrices}, 17491 type = {Technical Report}, 17492 number = {TR-2004-04}, 17493 institution = {University of Chicago}, 17494 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 17495 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 17496 pages = {14}, 17497 month = may, 17498 year = {2004} 17499} 17500 17501@TechReport{ kirbyknepleyscott10, 17502 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 17503 title = {Languages and Compilers for Variational Forms}, 17504 type = {Technical Report}, 17505 number = {TR-2010-09}, 17506 institution = {University of Chicago}, 17507 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 17508 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 17509 month = oct, 17510 year = {2010} 17511} 17512 17513@TechReport{ kirbyknepleyscott10b, 17514 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 17515 title = {Evaluation of the Action of Finite Element Operators}, 17516 type = {Technical Report}, 17517 number = {TR-2010-08}, 17518 institution = {University of Chicago}, 17519 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 17520 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 17521 month = oct, 17522 year = {2010} 17523} 17524 17525@TechReport{ bruneknepleyscott11, 17526 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 17527 title = {Exponential grids in high-dimensional space}, 17528 type = {Technical Report}, 17529 number = {TR-2011-07}, 17530 institution = {University of Chicago}, 17531 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 17532 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 17533 month = dec, 17534 year = {2011} 17535} 17536 17537@TechReport{ zheng11, 17538 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 17539 Zhang and Yaolin Shi}, 17540 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 17541 strongly variable viscosity based on {Matlab} and {CUDA}}, 17542 type = {Research Report}, 17543 number = {UMSI 2011/33}, 17544 institution = {University of Minnesota Supercomputing Institute}, 17545 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 17546 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 17547 month = mar, 17548 year = {2011} 17549} 17550 17551@InProceedings{ zheng2010, 17552 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 17553 Zhang and Yaolin Shi}, 17554 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 17555 booktitle = {Eos Transactions of the AGU}, 17556 organization = {American Geophysical Union}, 17557 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 17558 year = {2010} 17559} 17560 17561@InCollection{ terrelkirbyknepleyscott12, 17562 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 17563 and Garth N. Wells}, 17564 title = {Finite elements for incompressible fluids}, 17565 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17566 booktitle = {Automated solutions of differential equations by the finite element method}, 17567 series = {Lecture Notes in Computational Science and Engineering}, 17568 volume = {84}, 17569 pages = {163--169}, 17570 publisher = {Springer-Verlag}, 17571 year = {2012} 17572} 17573 17574@InCollection{ kirbyknepleyloggscottterrel12, 17575 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 17576 Andy R. Terrel}, 17577 title = {Discrete optimization of finite element matrix evaluation}, 17578 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17579 booktitle = {Automated solutions of differential equations by the finite element method}, 17580 series = {Lecture Notes in Computational Science and Engineering}, 17581 volume = {84}, 17582 pages = {385--397}, 17583 publisher = {Springer-Verlag}, 17584 year = {2012} 17585} 17586 17587@InCollection{ kirby12, 17588 author = {Robert C. Kirby}, 17589 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 17590 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 17591 booktitle = {Automated solutions of differential equations by the finite element method}, 17592 series = {Lecture Notes in Computational Science and Engineering}, 17593 volume = {84}, 17594 publisher = {Springer-Verlag}, 17595 year = {2012} 17596} 17597 17598@Article{ brownconveryhotesknepleypetropolous1993, 17599 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 17600 Labros Petropolous}, 17601 title = {Closed strings with low harmonics and kinks}, 17602 journal = {Physical Review D}, 17603 volume = {48}, 17604 number = {6}, 17605 year = {1993} 17606} 17607 17608@Article{ minimax1996, 17609 title = {MiniMax: What has been learned thus far}, 17610 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 17611 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 17612 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 17613 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 17614 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 17615 journal = {Nuovo Cimento}, 17616 volume = {19}, 17617 number = {1}, 17618 pages = {1045--1049}, 17619 year = {1996} 17620} 17621 17622@Article{ minimax1997, 17623 author = {Minimax Collaboration}, 17624 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 17625 Production}, 17626 journal = {Physical Review D}, 17627 volume = {55}, 17628 number = {9}, 17629 year = {1997} 17630} 17631 17632@Article{ minimax2000, 17633 author = {Minimax Collaboration}, 17634 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 17635 journal = {Physical Review D}, 17636 volume = {61}, 17637 number = {3}, 17638 year = {2000} 17639} 17640 17641@Article{ kirbyknepleyloggscott05, 17642 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 17643 title = {Optimizing the evaluation of finite element matrices}, 17644 journal = {SIAM Journal on Scientific Computing}, 17645 volume = {27}, 17646 number = {3}, 17647 pages = {741--758}, 17648 year = {2005} 17649} 17650 17651@Article{ bardhanknepleyanitescu2008, 17652 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 17653 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 17654 of Molecular Solvation}, 17655 journal = {Journal of Chemical Physics}, 17656 volume = {130}, 17657 number = {10}, 17658 pages = {104108}, 17659 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 17660 Research}, 17661 doi = {10.1063/1.3081148}, 17662 year = {2008} 17663} 17664 17665%Poster at Biophysical Society Fall Meeting 17666@Article{ bardhanknepley2017, 17667 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17668 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 17669 Hydration-Shell {Poisson}-{Boltzmann} Model}, 17670 journal = {Biophysical Journal}, 17671 volume = {110}, 17672 number = {3}, 17673 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 17674 doi = {10.1016/j.bpj.2015.11.1766}, 17675 year = {2017} 17676} 17677 17678@Article{ tabrizirahimigoossensknepleybardhan2018, 17679 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 17680 Interface Condition (SLIC) Continuum Dielectric Model}, 17681 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 17682 Matthew G. Knepley and Jaydeep P. Bardhan}, 17683 journal = {International Journal of Quantum Chemistry}, 17684 note = {Accepted}, 17685 year = {2018} 17686} 17687 17688@Article{ knepley2010, 17689 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 17690 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 17691 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 17692 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 17693 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 17694 title = {{Reproducible Research: addressing the need for data and code sharing in 17695 computational science}}, 17696 journal = {Computing in Science and Engineering}, 17697 volume = {12}, 17698 number = {5}, 17699 pages = {8--13}, 17700 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 17701 year = {2010} 17702} 17703 17704@Article{ ketchesonahmadiaknepley2011, 17705 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 17706 Hyperbolic PDE Codes}, 17707 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 17708 journal = {SIAM News}, 17709 volume = {44}, 17710 number = {7}, 17711 month = sep, 17712 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 17713 year = {2011} 17714} 17715 17716@Article{ yokotabardhanknepleybarbahamada2011, 17717 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 17718 Tsuyoshi Hamada}, 17719 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 17720 a billion unknowns}, 17721 journal = {Computer Physics Communications}, 17722 volume = {182}, 17723 number = {6}, 17724 pages = {1272--1283}, 17725 year = {2011}, 17726 issn = {0010-4655}, 17727 doi = {10.1016/j.cpc.2011.02.013}, 17728 url = {http://arxiv.org/abs/1007.4591} 17729} 17730 17731@Article{ bardhanknepley2011, 17732 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17733 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 17734 Results for Spherical Inclusions}, 17735 journal = {Journal of Chemical Physics}, 17736 volume = {135}, 17737 number = {12}, 17738 pages = {124107--124117}, 17739 url = {http://arxiv.org/abs/1109.0651}, 17740 note = {\url{http://arxiv.org/abs/1109.0651}}, 17741 year = {2011} 17742} 17743 17744@Article{ bruneknepleyscott2013, 17745 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 17746 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 17747 Graded Meshes}, 17748 journal = {SIAM Journal on Scientific Computing}, 17749 url = {http://arxiv.org/abs/1104.0261}, 17750 note = {\url{http://arxiv.org/abs/1104.0261}}, 17751 volume = {35}, 17752 number = {1}, 17753 pages = {A173--A191}, 17754 year = {2013} 17755} 17756 17757@Article{ bardhanknepley2012a, 17758 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17759 title = {Computational science and re-discovery: open-source implementations of 17760 ellipsoidal harmonics for problems in potential theory}, 17761 journal = {Computational Science \& Discovery}, 17762 volume = {5}, 17763 pages = {014006}, 17764 note = {\url{http://arxiv.org/abs/1204.0267}}, 17765 doi = {10.1088/1749-4699/5/1/014006}, 17766 year = {2012} 17767} 17768 17769@Article{ kreienkampetal2013, 17770 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 17771 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 17772 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 17773 contributions of molecular binding}, 17774 journal = {Molecular Based Mathematical Biology}, 17775 volume = {1}, 17776 pages = {124--150}, 17777 doi = {10.2478/mlbmb-2013-0007}, 17778 issn = {2299-3266}, 17779 month = jun, 17780 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 17781 year = {2013} 17782} 17783 17784@Article{ bardhanknepleybrune2015, 17785 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 17786 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 17787 Boundary-Integral Operators}, 17788 journal = {Molecular Based Mathematical Biology}, 17789 volume = {3}, 17790 number = {1}, 17791 pages = {1--22}, 17792 doi = {10.1515/mlbmb-2015-0001}, 17793 year = {2015} 17794} 17795 17796@Article{ bardhanknepley14, 17797 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 17798 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 17799 Conditions}, 17800 journal = {Journal of Chemical Physics}, 17801 volume = {141}, 17802 number = {13}, 17803 pages = {131103}, 17804 doi = {10.1063/1.4897324}, 17805 year = {2014} 17806} 17807 17808@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 17809 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 17810 Electrostatics}, 17811 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 17812 Matthew G. Knepley}, 17813 booktitle = {Proceedings of PIERS}, 17814 pages = {1215--1221}, 17815 month = jul, 17816 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 17817 year = {2015} 17818} 17819 17820@Article{ tabriziknepleybardhan2016, 17821 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 17822 condition at the solute-solvent interface}, 17823 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 17824 journal = {Molecular Physics}, 17825 volume = {114}, 17826 number = {16-17}, 17827 pages = {2558--2567}, 17828 doi = {10.1080/00268976.2016.1198503}, 17829 year = {2016} 17830} 17831 17832% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 17833@Article{ tabrizigoossensrahimiknepleybardhan2017, 17834 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 17835 Mixtures Using a Solvation-Layer Interface Condition}, 17836 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 17837 Matthew G. Knepley and Jaydeep P. Bardhan}, 17838 journal = {Journal of Chemical Physics}, 17839 volume = {146}, 17840 number = {9}, 17841 pages = {094103}, 17842 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 17843 eprint = {https://arxiv.org/abs/1611.02150}, 17844 doi = {10.1063/1.4977037}, 17845 note = {PMCID: PMC5336475}, 17846 year = {2017} 17847} 17848 17849@Article{ tabrizigoossenscooperknepleybardhan2017, 17850 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 17851 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 17852 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 17853 Matthew G. Knepley and Jaydeep P. Bardhan}, 17854 journal = {Journal of Chemical Theory and Computation}, 17855 year = {2017} 17856} 17857 17858@InProceedings{ mcclanahan2011, 17859 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 17860 K and Vuduc, Richard}, 17861 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 17862 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 17863 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 17864 year = {2011} 17865} 17866 17867@TechReport{ ghysels_ashby_meerbergen_vanroose_2012, 17868 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 17869 institution = {Intel Exascience Lab}, 17870 address = {Leuven, Belgium}, 17871 number = {04.2012.1}, 17872 type = {Tech. report}, 17873 title = {Hiding global communication latency in the {GMRES} algorithm on massively 17874 parallel machines}, 17875 url = {http://twna.ua.ac.be/sites/twna.ua.ac.be/files/latency_gmres.pdf}, 17876 year = {2012} 17877} 17878 17879@Article{ ghyselsashbymeerbergenvanroose2013, 17880 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 17881 title = {Hiding global communication latency in the {GMRES} algorithm on massively 17882 parallel machines}, 17883 journal = {SIAM Journal on Scientific Computing}, 17884 volume = {35}, 17885 number = {1}, 17886 pages = {C48--C71}, 17887 year = {2013} 17888} 17889 17890@Article{ ghyselsvanroose2014, 17891 author = {P. Ghysels and W. Vanroose}, 17892 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 17893 Algorithm}, 17894 journal = {Parallel Computing}, 17895 volume = {40}, 17896 number = {7}, 17897 pages = {224--238}, 17898 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 17899 doi = {10.1016/j.parco.2013.06.001}, 17900 year = {2014} 17901} 17902 17903@InProceedings{ strzodkagoddeke06, 17904 author = {R. Strzodka and D. G\"oddeke}, 17905 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 17906 from Low Precision Components}, 17907 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 17908 Computing Machines}, 17909 note = {FCCM ’06}, 17910 pages = {259--270}, 17911 year = {2006}, 17912 organization = {IEEE Computer Society} 17913} 17914 17915@InCollection{ jacquesnicolasvollaire12, 17916 author = {T. Jacques and L. Nicolas and C. Vollaire}, 17917 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 17918 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 17919 booktitle = {High-Performance Computing and Networking}, 17920 series = {Lecture Notes in Computer Science}, 17921 volume = {1593}, 17922 pages = {1025--1031}, 17923 publisher = {Springer}, 17924 year = {1999} 17925} 17926 17927@InProceedings{ hoeflerlumsdainerehm07, 17928 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 17929 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 17930 for MPI}}, 17931 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 17932 Networking, Storage and Analysis, SC07}, 17933 location = {Reno, NV}, 17934 publisher = {IEEE Computer Society/ACM}, 17935 source = {http://www.unixer.de/~htor/publications/}, 17936 month = nov, 17937 year = {2007} 17938} 17939 17940@InProceedings{ hoeflersiebretlumsdaine10, 17941 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 17942 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 17943 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 17944 Parallel Programming (PPoPP'10)}, 17945 month = jan, 17946 location = {Bangalore, India}, 17947 publisher = {ACM}, 17948 isbn = {978-1-60558-708-0}, 17949 source = {http://www.unixer.de/~htor/publications/}, 17950 pages = {159--168}, 17951 year = {2010} 17952} 17953 17954@Article{ ruppweinbubjungelgrasser15, 17955 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 17956 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 17957 journal = {ACM Transactions on Mathematical Software (TOMS)}, 17958 volume = {43}, 17959 number = {2}, 17960 pages = {11}, 17961 year = {2016}, 17962 publisher = {ACM} 17963} 17964 17965@Article{ bai_hu_reichel_1994, 17966 title = {A {Newton} basis {GMRES} implementation}, 17967 volume = {14}, 17968 url = {}, 17969 number = {}, 17970 journal = {IMA Journal of Numerical Analysis}, 17971 author = {Z. Bai and D. Hu and L. Reichel}, 17972 year = {1994}, 17973 pages = {563--581} 17974} 17975 17976@Article{ chronopoulos_gear_1989, 17977 title = {{S-step} iterative methods for symmetric linear systems}, 17978 volume = {25}, 17979 url = {}, 17980 number = {}, 17981 journal = {Journal of Computational and Applied Mathematics}, 17982 author = {A. T. Chronopoulos and C. W. Gear}, 17983 year = {1989}, 17984 pages = {153--168} 17985} 17986 17987@Article{ chronopoulos_1996, 17988 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 17989 author = {A. T. Chronopoulos and C. D. Swanson}, 17990 journal = {Parallel Computing}, 17991 volume = {22}, 17992 number = {5}, 17993 year = {1996}, 17994 pages = {623--641} 17995} 17996 17997@Article{ chronopoulos_2010, 17998 author = {A. T. Chronopoulos and A. Kucherov}, 17999 title = {Block {S-step} {Krylov} Iterative Methods}, 18000 journal = {Numerical Linear Algebra with Applications}, 18001 volume = {17}, 18002 number = {1}, 18003 pages = {3--15}, 18004 year = {2010} 18005} 18006 18007@Article{ sturler_vorst_1995, 18008 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 18009 distributed memory computers}, 18010 volume = {18}, 18011 url = {}, 18012 number = {}, 18013 journal = {Applied Numerical Mathematics}, 18014 author = {E. De Sturler and H. A. van der Vorst}, 18015 year = {1995}, 18016 pages = {441--459} 18017} 18018 18019@Article{ joubert_carey_1992, 18020 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 18021 I: Theory}, 18022 volume = {44}, 18023 url = {}, 18024 number = {}, 18025 journal = {International journal of computer mathematics}, 18026 author = {W. D. Joubert and G. F. Carey}, 18027 year = {1992}, 18028 pages = {243--267} 18029} 18030 18031@Article{ elman_saadsaylor_1986, 18032 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 18033 of linear equations}, 18034 volume = {7}, 18035 url = {}, 18036 number = {3}, 18037 journal = {SIAM Journal on Scientific and Statistical Computing}, 18038 author = {Howard Elman and Y. Saad and P. E. Saylor}, 18039 year = {1986}, 18040 pages = {840--855} 18041} 18042 18043@Article{ golub95innerand, 18044 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 18045 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 18046 journal = {SIAM J. Numer. Anal}, 18047 year = {1995}, 18048 volume = {35}, 18049 pages = {300--319} 18050} 18051 18052@Article{ golub_varga_1961, 18053 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 18054 and second-order {Richardson} iterative methods, parts {I} and {II}}, 18055 volume = {3}, 18056 url = {}, 18057 number = {}, 18058 journal = {Numer. Math.}, 18059 author = {Gene Golub and R.S. Varga}, 18060 year = {1961}, 18061 pages = {147--168} 18062} 18063 18064@Article{ el_maliki_guenette_fortin_2011, 18065 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 18066 element problems}, 18067 volume = {18}, 18068 doi = {10.1002/nla.757}, 18069 number = {5}, 18070 journal = {Numerical Linear Algebra with Applications}, 18071 author = {A. {El maliki} and R. Guenette and M. Fortin}, 18072 year = {2011}, 18073 pages = {789-803} 18074} 18075 18076@Article{ adavani2008multigrid, 18077 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 18078 Constraints}, 18079 author = {Adavani, S.S. and Biros, G.}, 18080 journal = {SIAM Journal on Scientific Computing}, 18081 volume = {31}, 18082 number = {1}, 18083 pages = {369--397}, 18084 year = {2008}, 18085 publisher = {Society for Industrial and Applied Mathematics} 18086} 18087 18088@Article{ horton1995space, 18089 title = {A space-time multigrid method for parabolic {PDE}s}, 18090 author = {Horton, G. and Vandewalle, S.}, 18091 journal = {SIAM Journal on Scientific Computing}, 18092 volume = {16}, 18093 number = {4}, 18094 pages = {848--864}, 18095 year = {1995} 18096} 18097 18098@Article{ lewis2005model, 18099 title = {Model problems for the multigrid optimization of systems governed by differential 18100 equations}, 18101 author = {Lewis, R.M. and Nash, S.G.}, 18102 journal = {SIAM Journal on Scientific Computing}, 18103 volume = {26}, 18104 number = {6}, 18105 pages = {1811--1837}, 18106 year = {2005}, 18107 publisher = {Philadelphia, PA: SIAM, c1993-} 18108} 18109 18110@Article{ nash2000mgopt, 18111 title = {A multigrid approach to discretized optimization problems}, 18112 author = {Nash, S.G.}, 18113 journal = {Optimization Methods and Software}, 18114 volume = {14}, 18115 number = {1-2}, 18116 pages = {99--116}, 18117 year = {2000}, 18118 publisher = {Taylor \& Francis} 18119} 18120 18121@Article{ borzi2009multigrid, 18122 title = {Multigrid Methods for {PDE} Optimization}, 18123 author = {Borz{\`i}, A. and Schulz, V.}, 18124 journal = {SIAM Review}, 18125 volume = {51}, 18126 pages = {361}, 18127 year = {2009} 18128} 18129 18130@Article{ borzi2005multigrid, 18131 title = {A multigrid scheme for elliptic constrained optimal control problems}, 18132 author = {Borz{\`i}, A. and Kunisch, K.}, 18133 journal = {Computational Optimization and Applications}, 18134 volume = {31}, 18135 number = {3}, 18136 pages = {309--333}, 18137 year = {2005}, 18138 publisher = {Springer} 18139} 18140 18141@Article{ borzi2003multigrid, 18142 title = {Multigrid methods for parabolic distributed optimal control problems}, 18143 author = {Borz{\`i}, A.}, 18144 journal = {Journal of Computational and Applied Mathematics}, 18145 volume = {157}, 18146 number = {2}, 18147 pages = {365--382}, 18148 year = {2003}, 18149 publisher = {Elsevier} 18150} 18151 18152@Article{ ito2002receding, 18153 title = {Receding horizon optimal control for infinite dimensional systems}, 18154 author = {Ito, K. and Kunisch, K.}, 18155 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 18156 volume = {8}, 18157 number = {1}, 18158 pages = {741--760}, 18159 year = {2002}, 18160 publisher = {Cambridge University Press} 18161} 18162 18163@Article{ schulz1998solving, 18164 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 18165 author = {Schulz, V.H.}, 18166 journal = {Computing and Visualization in Science}, 18167 volume = {1}, 18168 number = {2}, 18169 pages = {83--96}, 18170 year = {1998}, 18171 publisher = {Springer} 18172} 18173 18174@Article{ hazra2005aerodynamic, 18175 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 18176 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 18177 journal = {Journal of Computational Physics}, 18178 volume = {204}, 18179 number = {1}, 18180 pages = {46--64}, 18181 year = {2005}, 18182 publisher = {Elsevier} 18183} 18184 18185@Article{ mandel1985multilevel, 18186 title = {On multilevel iterative methods for integral equations of the second kind and 18187 related problems}, 18188 author = {Mandel, J.}, 18189 journal = {Numerische Mathematik}, 18190 volume = {46}, 18191 number = {1}, 18192 pages = {147--157}, 18193 year = {1985}, 18194 publisher = {Springer} 18195} 18196 18197@Article{ king1992multilevel, 18198 title = {Multilevel algorithms for ill-posed problems}, 18199 author = {King, J.T.}, 18200 journal = {Numerische Mathematik}, 18201 volume = {61}, 18202 number = {1}, 18203 pages = {311--334}, 18204 year = {1992}, 18205 publisher = {Springer} 18206} 18207 18208@Article{ kaltenbacher2001regularizing, 18209 title = {On the regularizing properties of a full multigrid method for ill-posed 18210 problems}, 18211 author = {Kaltenbacher, B.}, 18212 journal = {Inverse Problems}, 18213 volume = {17}, 18214 pages = {767}, 18215 year = {2001}, 18216 publisher = {IOP Publishing} 18217} 18218 18219@Article{ kaltenbacher2002multi, 18220 title = {A multi-grid method with a priori and a posteriori level choice for the 18221 regularization of nonlinear ill-posed problems}, 18222 author = {Kaltenbacher, B. and Schicho, J.}, 18223 journal = {Numerische Mathematik}, 18224 volume = {93}, 18225 number = {1}, 18226 pages = {77--107}, 18227 year = {2002}, 18228 publisher = {Springer} 18229} 18230 18231@Article{ burger2006regularizing, 18232 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 18233 author = {Burger, M. and Kaltenbacher, B.}, 18234 journal = {SIAM Journal on Numerical Analysis}, 18235 volume = {44}, 18236 pages = {153}, 18237 year = {2006} 18238} 18239 18240@Article{ draganescu2008optimal, 18241 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 18242 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 18243 journal = {Mathematics of Computation}, 18244 volume = {77}, 18245 number = {264}, 18246 pages = {2001--2038}, 18247 year = {2008} 18248} 18249 18250@Article{ bastian1998additive, 18251 title = {Additive and multiplicative multi-grid---a comparison}, 18252 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 18253 journal = {Computing}, 18254 volume = {60}, 18255 number = {4}, 18256 pages = {345--364}, 18257 year = {1998}, 18258 publisher = {Springer} 18259} 18260 18261@Article{ fournier2001multiplicative, 18262 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 18263 compressible flow computations on unstructured meshes}, 18264 author = {Fournier, L. and Lanteri, S.}, 18265 journal = {Applied Numerical Mathematics}, 18266 volume = {36}, 18267 number = {4}, 18268 pages = {401--426}, 18269 year = {2001}, 18270 publisher = {Elsevier} 18271} 18272 18273@Article{ chow2006survey, 18274 title = {A survey of parallelization techniques for multigrid solvers}, 18275 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 18276 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 18277 Simon, eds}, 18278 volume = {20}, 18279 pages = {179--201}, 18280 year = {2006} 18281} 18282 18283@InBook{ brandt2001multiscale, 18284 title = {Multiscale scientific computation: {R}eview 2001}, 18285 author = {Brandt, A.}, 18286 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 18287 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 18288 series = {Lecture Notes in Computational Science and Engineering}, 18289 year = {2001}, 18290 volume = {20}, 18291 pages = {3--96}, 18292 publisher = {Springer Verlag} 18293} 18294 18295@InCollection{ brandt2003multigrid, 18296 title = {Multigrid solvers and multilevel optimization strategies}, 18297 author = {Brandt, A. and Ron, D.}, 18298 booktitle = {Multilevel Optimization and VLSICAD}, 18299 editors = {J. Cong and J.R. Shinnerl}, 18300 pages = {1--69}, 18301 publisher = {Kluwer Academic Publishers}, 18302 year = {2003} 18303} 18304 18305@InBook{ brandt2009principles, 18306 title = {Principles of systematic upscaling}, 18307 author = {Brandt, A.}, 18308 booktitle = {Bridging the Scales in Science and Engineering}, 18309 editors = {J. Fish}, 18310 publisher = {Oxford University Press}, 18311 pages = {193--215}, 18312 year = {2009} 18313} 18314 18315@Article{ livne2004coarsening, 18316 title = {Coarsening by compatible relaxation}, 18317 author = {Livne, O.E.}, 18318 journal = {Numerical Linear Algebra with Applications}, 18319 volume = {11}, 18320 number = {2-3}, 18321 pages = {205--227}, 18322 year = {2004}, 18323 publisher = {Wiley Online Library} 18324} 18325 18326@InProceedings{ brandt1986stochastic, 18327 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 18328 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 18329 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 18330 Methods, held at Cologne, October 1-4, 1985}, 18331 volume = {1228}, 18332 pages = {65--98}, 18333 year = {1986}, 18334 organization = {Springer} 18335} 18336 18337@Article{ halko2011finding, 18338 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 18339 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 18340 Approximate Matrix Decompositions}, 18341 journal = {SIAM Review}, 18342 volume = {53}, 18343 number = {2}, 18344 year = {2011}, 18345 pages = {217-288}, 18346 doi = {10.1137/090771806} 18347} 18348 18349@InProceedings{ mhdy09, 18350 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 18351 booktitle = {Proceedings of SC09}, 18352 organization = {ACM}, 18353 title = {Minimizing communication in sparse matrix solvers}, 18354 doi = {10.1145/1654059.1654096}, 18355 year = {2009} 18356} 18357 18358@InProceedings{ vanrosendale83, 18359 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 18360 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 18361 author = {J. van Rosendale}, 18362 year = {1983}, 18363 publisher = {IEEE Computer Society} 18364} 18365 18366@PhDThesis{ vuduc95, 18367 title = {Quantitative performance modeling of scientific computations and creating 18368 locality in numerical algorithms}, 18369 author = {R. Vuduc}, 18370 journal = {Massachusetts Institute of Technology}, 18371 school = {Massachusetts Institute of Technology}, 18372 year = {1995} 18373} 18374 18375@Article{ simoncini2003flexible, 18376 title = {Flexible inner-outer {Krylov} subspace methods}, 18377 author = {Simoncini, V. and Szyld, D.B.}, 18378 journal = {SIAM Journal on Numerical Analysis}, 18379 pages = {2219--2239}, 18380 year = {2003}, 18381 publisher = {JSTOR} 18382} 18383 18384@Article{ parks2006recycling, 18385 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 18386 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 18387 journal = {SIAM Journal on Scientific Computing}, 18388 volume = {28}, 18389 number = {5}, 18390 pages = {1651--1674}, 18391 year = {2006}, 18392 publisher = {Society for Industrial and Applied Mathematics} 18393} 18394 18395@Article{ freund2003model, 18396 title = {Model reduction methods based on Krylov subspaces}, 18397 author = {Freund, R.W.}, 18398 journal = {Acta Numerica}, 18399 volume = {12}, 18400 number = {1}, 18401 pages = {267--319}, 18402 year = {2003}, 18403 publisher = {Cambridge Univ Press} 18404} 18405 18406@InBook{ gutknecht2006block, 18407 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 18408 an introduction}, 18409 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 18410 author = {Gutknecht, M.H.}, 18411 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 18412 publisher = {Anamaya Publishers}, 18413 location = {New Delhi}, 18414 pages = {420-447}, 18415 year = {2006} 18416} 18417 18418@Article{ moulton1998black, 18419 title = {The black box multigrid numerical homogenization algorithm}, 18420 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 18421 journal = {Journal of Computational Physics}, 18422 volume = {142}, 18423 number = {1}, 18424 pages = {80--108}, 18425 year = {1998}, 18426 publisher = {Elsevier} 18427} 18428 18429@Article{ neuss2001homogenization, 18430 title = {Homogenization and multigrid}, 18431 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 18432 journal = {Computing}, 18433 volume = {66}, 18434 number = {1}, 18435 pages = {1--26}, 18436 year = {2001}, 18437 publisher = {Springer} 18438} 18439 18440@Article{ bai2002krylov, 18441 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 18442 systems}, 18443 author = {Bai, Z.}, 18444 journal = {Applied Numerical Mathematics}, 18445 volume = {43}, 18446 number = {1}, 18447 pages = {9--44}, 18448 year = {2002}, 18449 publisher = {Elsevier} 18450} 18451 18452@InProceedings{ dong2003piecewise, 18453 title = {Piecewise polynomial nonlinear model reduction}, 18454 author = {Dong, N. and Roychowdhury, J.}, 18455 booktitle = {Design Automation Conference, 2003. Proceedings}, 18456 pages = {484--489}, 18457 year = {2003}, 18458 organization = {IEEE} 18459} 18460 18461@Article{ bond2009stable, 18462 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 18463 approximation and projection}, 18464 author = {Bond, B.N. and Daniel, L.}, 18465 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 18466 volume = {28}, 18467 number = {10}, 18468 pages = {1467--1480}, 18469 year = {2009}, 18470 publisher = {IEEE} 18471} 18472 18473@Article{ xin2000front, 18474 title = {Front Propagation in Heterogeneous Media}, 18475 author = {Xin, J.}, 18476 journal = {SIAM Review}, 18477 volume = {42}, 18478 number = {2}, 18479 pages = {161--230}, 18480 year = {2000}, 18481 publisher = {Society for Industrial and Applied Mathematics} 18482} 18483 18484@Article{ owhadi2011localized, 18485 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 18486 Nonseparated Scales and High Contrast}, 18487 author = {Owhadi, H. and Zhang, L.}, 18488 journal = {Multiscale Modeling and Simulation}, 18489 volume = {9}, 18490 pages = {1373}, 18491 year = {2011} 18492} 18493 18494@Article{ berlyand2010flux, 18495 title = {Flux norm approach to finite dimensional homogenization approximations with 18496 non-separated scales and high contrast}, 18497 author = {Berlyand, L. and Owhadi, H.}, 18498 journal = {Archive for rational mechanics and analysis}, 18499 volume = {198}, 18500 number = {2}, 18501 pages = {677--721}, 18502 year = {2010}, 18503 publisher = {Springer} 18504} 18505 18506@Article{ babuska2011optimal, 18507 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 18508 Application to Multiscale Problems}, 18509 author = {Babuska, I. and Lipton, R.}, 18510 journal = {Multiscale Modeling \& Simulation}, 18511 volume = {9}, 18512 pages = {373}, 18513 year = {2011} 18514} 18515 18516@Article{ boettinger2002phase, 18517 title = {Phase-Field Simulation of Solidification}, 18518 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 18519 journal = {Annual review of materials research}, 18520 volume = {32}, 18521 number = {1}, 18522 pages = {163--194}, 18523 year = {2002}, 18524 publisher = {Annual Reviews} 18525} 18526 18527@Article{ karma1998quantitative, 18528 title = {Quantitative phase-field modeling of dendritic growth in two and three 18529 dimensions}, 18530 author = {Karma, A. and Rappel, W.J.}, 18531 journal = {Physical Review E}, 18532 volume = {57}, 18533 number = {4}, 18534 pages = {4323}, 18535 year = {1998}, 18536 publisher = {APS} 18537} 18538 18539@Article{ chen2002phase, 18540 title = {Phase-field models for microstructure evolution}, 18541 author = {Chen, L.Q.}, 18542 journal = {Annual review of materials research}, 18543 volume = {32}, 18544 number = {1}, 18545 pages = {113--140}, 18546 year = {2002}, 18547 publisher = {Annual Reviews} 18548} 18549 18550@Article{ galbally2010reductionuq, 18551 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 18552 problems}, 18553 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 18554 journal = {International journal for numerical methods in engineering}, 18555 volume = {81}, 18556 number = {12}, 18557 pages = {1581--1608}, 18558 year = {2010}, 18559 publisher = {Wiley Online Library} 18560} 18561 18562@Article{ griebel1995abstract, 18563 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 18564 author = {Griebel, M. and Oswald, P.}, 18565 journal = {Numerische Mathematik}, 18566 volume = {70}, 18567 number = {2}, 18568 pages = {163--180}, 18569 year = {1995}, 18570 publisher = {Springer} 18571} 18572 18573@InProceedings{ voutchkov2006multiobjective, 18574 title = {Multiobjective optimization using surrogates}, 18575 author = {Voutchkov, I. and Keane, A.J.}, 18576 booktitle = {Adaptive Computing in Design and Manufacture}, 18577 pages = {167--175}, 18578 year = {2006}, 18579 publisher = {The MC Escher Company} 18580} 18581 18582@Article{ leary2001constraint, 18583 title = {A constraint mapping approach to the structural optimization of an expensive 18584 model using surrogates}, 18585 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 18586 journal = {Optimization and Engineering}, 18587 volume = {2}, 18588 number = {4}, 18589 pages = {385--398}, 18590 year = {2001}, 18591 publisher = {Springer} 18592} 18593 18594@InProceedings{ legresley2000airfoil, 18595 title = {Airfoil design optimization using reduced order models based on proper orthogonal 18596 decomposition}, 18597 author = {LeGresley, P.A. and Alonso, J.J.}, 18598 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 18599 year = {2000} 18600} 18601 18602@Book{ myers2009response, 18603 title = {Response surface methodology: process and product optimization using designed 18604 experiments}, 18605 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 18606 volume = {705}, 18607 year = {2009}, 18608 publisher = {John Wiley \& Sons} 18609} 18610 18611@Article{ carlberg2012gnat, 18612 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 18613 application to computational fluid dynamics and turbulent flows}, 18614 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 18615 journal = {arXiv}, 18616 volume = {1207.1349}, 18617 year = {2012} 18618} 18619 18620@Article{ biros2008multilevel, 18621 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 18622 author = {Biros, G. and Dogan, G.}, 18623 journal = {Inverse Problems}, 18624 volume = {24}, 18625 pages = {034010}, 18626 year = {2008}, 18627 publisher = {IOP Publishing} 18628} 18629 18630@Article{ rees2010optimal, 18631 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 18632 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 18633 journal = {SIAM Journal on Scientific Computing}, 18634 volume = {32}, 18635 pages = {271}, 18636 year = {2010} 18637} 18638 18639@Article{ rees2010block, 18640 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 18641 author = {Rees, T. and Stoll, M.}, 18642 journal = {Numerical Linear Algebra with Applications}, 18643 volume = {17}, 18644 number = {6}, 18645 pages = {977--996}, 18646 year = {2010}, 18647 publisher = {Wiley Online Library} 18648} 18649 18650@Article{ rees2011preconditioning, 18651 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 18652 Equations}, 18653 author = {Rees, T. and Wathen, A.J.}, 18654 journal = {SIAM Journal on Scientific Computing}, 18655 volume = {33}, 18656 number = {5}, 18657 pages = {2903--2926}, 18658 year = {2011}, 18659 publisher = {Society for Industrial and Applied Mathematics} 18660} 18661 18662@Article{ vogel2007fbicg, 18663 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 18664 author = {Vogel,J.A.}, 18665 journal = {Applied Mathematics and Computation}, 18666 volume = {188}, 18667 number = {1}, 18668 pages = {226–-233}, 18669 year = {2007}, 18670 publisher = {Elsevier} 18671} 18672 18673@Unpublished{ leehammond2010, 18674 author = {B. Lee and G.E. Hammond}, 18675 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 18676 Equation}, 18677 key = {multigrid}, 18678 note = {manuscript, 2010} 18679} 18680 18681@Article{ vandeneshop2004inexact, 18682 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 18683 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 18684 journal = {SIAM Journal on Matrix Analysis and Applications}, 18685 volume = {26}, 18686 number = {1}, 18687 pages = {125--153}, 18688 year = {2004} 18689} 18690 18691@Article{ fbicg.fbcgs, 18692 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 18693 author = {Judith A. Vogel}, 18694 journal = {Applied Mathematics and Computation}, 18695 volume = {188}, 18696 number = {1}, 18697 pages = {226--233}, 18698 year = {2007} 18699} 18700 18701@Article{ simoncini2003inexact, 18702 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 18703 Computing}, 18704 author = {Valeria Simoncini and Daniel B. Szyld}, 18705 journal = {SIAM Journal on Scientific Computing}, 18706 volume = {25}, 18707 number = {2}, 18708 pages = {454--477}, 18709 year = {2003} 18710} 18711 18712@Article{ fqmr, 18713 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 18714 author = {Daniel B. Szyld and Judith A. Vogel}, 18715 journal = {SIAM Journal on Scientific Computing}, 18716 volume = {23}, 18717 number = {2}, 18718 pages = {363--380}, 18719 year = {2001} 18720} 18721 18722@Article{ ipcg, 18723 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 18724 author = {Gene H. Golub and Qiang Ye}, 18725 journal = {SIAM Journal on Scientific Computing}, 18726 volume = {21}, 18727 number = {4}, 18728 pages = {1305--1320}, 18729 year = {1999} 18730} 18731 18732@Article{ idr.sonneveld, 18733 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 18734 Systems of Linear Equations}, 18735 author = {Peter Sonneveld and Martin B. van Gijzen}, 18736 journal = {SIAM Journal on Scientific Computing}, 18737 volume = {31}, 18738 number = {2}, 18739 pages = {1035--1062}, 18740 year = {2008} 18741} 18742 18743@Article{ flexiblecg, 18744 title = {Flexible {Conjugate Gradients}}, 18745 author = {Yvan Notay}, 18746 journal = {SIAM Journal on Scientific Computing}, 18747 volume = {22}, 18748 number = {4}, 18749 pages = {1444--1460}, 18750 year = {2000} 18751} 18752 18753@Article{ generalizedcg, 18754 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 18755 Variable-Step Preconditioning}, 18756 author = {O. Axelsson and P. S. Vassilevski}, 18757 journal = {SIAM Journal on Matrix Analysis and Applications}, 18758 volume = {12}, 18759 number = {4}, 18760 pages = {625--644}, 18761 year = {1991} 18762} 18763 18764@Article{ bicg, 18765 title = {{Conjugate Gradient} methods for indefinite systems}, 18766 author = {R. Fletcher}, 18767 journal = {Lecture Notes in Mathematics}, 18768 volume = {506}, 18769 pages = {73--89}, 18770 year = {1976} 18771} 18772 18773@Article{ idr.bcgs, 18774 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 18775 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 18776 journal = {Applied Numerical Mathematics}, 18777 volume = {60}, 18778 pages = {1100--1114}, 18779 year = {2010} 18780} 18781 18782@Article{ idr.bcgsl, 18783 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 18784 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 18785 journal = {SIAM J. Sci. Comput.}, 18786 volume = {32}, 18787 number = {5}, 18788 pages = {2687--2709}, 18789 year = {2010} 18790} 18791 18792@Article{ idr.min.sync, 18793 title = {Minimizing synchronization in {IDR(s)}}, 18794 author = {T.P. Collignon and M.B. van Gijzen}, 18795 journal = {Numerical Linear Algebra with Applications}, 18796 volume = {18}, 18797 number = {5}, 18798 pages = {805--825}, 18799 year = {2011} 18800} 18801 18802@TechReport{ flexible.idr, 18803 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 18804 Sparse Linear Systems}, 18805 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 18806 institution = {Delft University of Technology}, 18807 number = {11-06}, 18808 year = {2011} 18809} 18810 18811@Article{ vangenuchten1980, 18812 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 18813 Soils}, 18814 author = {M. Th. van Genuchten}, 18815 journal = {Soil Science Society of America Journal}, 18816 volume = {44}, 18817 pages = {892--898}, 18818 year = {1980} 18819} 18820 18821@Article{ gmresr94, 18822 title = {{GMRESR}: a family of nested {GMRES} methods}, 18823 author = {H. A. Van der Vorst and C. Vuik}, 18824 journal = {Numerical Linear Algebra with Applications}, 18825 volume = {1}, 18826 number = {4}, 18827 pages = {369--386}, 18828 year = {1994} 18829} 18830 18831@Article{ knepley10, 18832 author = {Matthew G. Knepley}, 18833 title = {Removing the Barrier to Scalability in Parallel FMM}, 18834 journal = {CoRR}, 18835 volume = {abs/1008.2410}, 18836 note = {\url{http://arxiv.org/abs/1008.2410}}, 18837 year = {2010} 18838} 18839 18840@Article{ teng1998, 18841 author = {Shang-Hua Teng}, 18842 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 18843 N-Body Simulation}, 18844 journal = {SIAM J. Sci. Comput.}, 18845 volume = {19}, 18846 number = {2}, 18847 month = mar, 18848 pages = {635--656}, 18849 year = {1998}, 18850 issn = {1064-8275}, 18851 numpages = {22}, 18852 doi = {10.1137/S1064827595288942}, 18853 acmid = {289842}, 18854 issue_date = {March 1998}, 18855 publisher = {Society for Industrial and Applied Mathematics}, 18856 address = {Philadelphia, PA}, 18857 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 18858 parallel processing, partitioning, scientific computing, the fast multipole 18859 method, tree-codes} 18860} 18861 18862@InProceedings{ skinnerkramer05, 18863 author = {David Skinner and William Kramer}, 18864 title = {Understanding the causes of performance variability in HPC workloads}, 18865 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 18866 International}, 18867 organization = {IEEE}, 18868 pages = {137--149}, 18869 year = {2005} 18870} 18871 18872@Article{ notay_2000, 18873 author = {Yvan Notay}, 18874 title = {Flexible {Conjugate Gradients}}, 18875 journal = {SIAM Journal on Scientific Computing}, 18876 volume = {22}, 18877 number = {4}, 18878 year = {2000}, 18879 pages = {1444--1460} 18880} 18881 18882@Article{ bereux1996, 18883 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 18884 computations}, 18885 author = {Fran{\c{c}}ois B{\'e}reux}, 18886 journal = {Computer Methods in Applied Mechanics and Engineering}, 18887 volume = {133}, 18888 number = {1-2}, 18889 pages = {93--124}, 18890 year = {1996} 18891} 18892 18893@Article{ pawlowski2006globalization, 18894 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 18895 fully coupled solution of the {N}avier-{S}tokes equations}, 18896 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 18897 journal = {SIAM Review}, 18898 volume = {48}, 18899 number = {4}, 18900 pages = {700--721}, 18901 year = {2006}, 18902 publisher = {SIAM} 18903} 18904 18905@Article{ roppshadid2009, 18906 title = {Stability of operator splitting methods for systems with indefinite operators: 18907 Advection--diffusion--reaction systems}, 18908 author = {David L Ropp and John N Shadid}, 18909 journal = {Journal of Computational Physics}, 18910 volume = {228}, 18911 number = {9}, 18912 pages = {3508--3516}, 18913 year = {2009} 18914} 18915 18916@Article{ brown1985experiments, 18917 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 18918 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 18919 journal = {SIAM Journal on Scientific and Statistical Computing}, 18920 volume = {6}, 18921 number = {2}, 18922 pages = {297--313}, 18923 year = {1985}, 18924 publisher = {SIAM} 18925} 18926 18927@Article{ bicgsl_1993, 18928 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 18929 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 18930 Spectrum}, 18931 journal = {Electronic Transactions on Numerical Analysis}, 18932 volume = {1}, 18933 year = {1993}, 18934 pages = {11--32} 18935} 18936 18937@Book{ brandt2011revised, 18938 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 18939 Edition}, 18940 author = {Achi Brandt and Oren Livne}, 18941 year = {2011}, 18942 publisher = {SIAM} 18943} 18944 18945@Article{ axelsson1990algebraic, 18946 title = {Algebraic multilevel preconditioning methods, {II}}, 18947 author = {Axelsson, O. and Vassilevski, P.S.}, 18948 journal = {SIAM Journal on Numerical Analysis}, 18949 volume = {27}, 18950 number = {6}, 18951 pages = {1569--1590}, 18952 year = {1990}, 18953 publisher = {SIAM} 18954} 18955 18956@Article{ zulehner2002analysis, 18957 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 18958 author = {Zulehner, W.}, 18959 journal = {Mathematics of computation}, 18960 volume = {71}, 18961 number = {238}, 18962 pages = {479--506}, 18963 year = {2002} 18964} 18965 18966@Article{ pralet2010, 18967 author = {L. Giraud and A. Haidar and S. Pralet}, 18968 title = {Using multiple levels of parallelism to enhance the performance of domain 18969 decomposition solvers}, 18970 journal = {Parallel Computing}, 18971 volume = {36}, 18972 number = {5-6}, 18973 pages = {285--296}, 18974 year = {2010} 18975} 18976 18977@Book{ brennerscottfem, 18978 title = {The Mathematical Theory of Finite Element Methods}, 18979 author = {Susanne C. Brenner and L. Ridgway Scott}, 18980 edition = {3rd Edition}, 18981 series = {Texts in Applied Mathematics}, 18982 year = {2008}, 18983 publisher = {Springer-Verlag} 18984} 18985 18986@Book{ ortega1987iterative, 18987 title = {Iterative solution of nonlinear equations in several variables}, 18988 author = {Ortega, James M and Rheinboldt, Werner C}, 18989 volume = {30}, 18990 publisher = {Society for Industrial and Applied Mathematics}, 18991 year = {1987} 18992} 18993 18994@InBook{ rheinboldtch6, 18995 author = {Werner C. Rheinboldt}, 18996 title = {6. Combinations of Processes}, 18997 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 18998 chapter = {6}, 18999 pages = {59--74}, 19000 doi = {10.1137/1.9781611970012.ch6}, 19001 year = {1998} 19002} 19003 19004@Article{ allgowerbohmerpotrarheinboldt86, 19005 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 19006 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 19007 journal = {SIAM Journal on Numerical Analysis}, 19008 volume = {23}, 19009 number = {1}, 19010 pages = {160-169}, 19011 year = {1986}, 19012 doi = {10.1137/0723011} 19013} 19014 19015@Article{ rheinboldt76, 19016 author = {Werner C. Rheinboldt}, 19017 title = {On measures of ill-conditioning for nonlinear equations}, 19018 journal = {Mathematics of Computation}, 19019 volume = {30}, 19020 number = {133}, 19021 pages = {104--111}, 19022 year = {1976} 19023} 19024 19025@Article{ little61, 19026 author = {John D. C. Little}, 19027 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 19028 journal = {Operations Research}, 19029 volume = {9}, 19030 number = {3}, 19031 pages = {383--387}, 19032 note = {\url{http://www.jstor.org/stable/167570}}, 19033 year = {1961} 19034} 19035 19036@Misc{ top500, 19037 author = {{TOP500 Supercomputer Sites}}, 19038 url = {http://www.top500.org}, 19039 year = {2013} 19040} 19041 19042@Misc{ hassediagram, 19043 author = {Wikipedia}, 19044 title = {Hasse Diagram}, 19045 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 19046 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 19047 year = {2015} 19048} 19049 19050@Misc{ groupoid, 19051 author = {Wikipedia}, 19052 title = {Groupoid}, 19053 url = {https://en.wikipedia.org/wiki/Groupoid}, 19054 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 19055 year = {2015} 19056} 19057 19058@Misc{ cwcomplex, 19059 author = {Wikipedia}, 19060 title = {{CW} complex}, 19061 url = {http://en.wikipedia.org/wiki/CW_complex}, 19062 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 19063 year = {2015} 19064} 19065 19066@Misc{ linearalgebra, 19067 author = {Wikipedia}, 19068 title = {Linear Algebra}, 19069 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 19070 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 19071 year = {2015} 19072} 19073 19074@Misc{ amdahlslaw, 19075 author = {Wikipedia}, 19076 title = {Amdahl's Law}, 19077 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 19078 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 19079 year = {2015} 19080} 19081 19082@Misc{ gustafsonslaw, 19083 author = {Wikipedia}, 19084 title = {Gustafson's Law}, 19085 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 19086 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 19087 year = {2015} 19088} 19089 19090@InProceedings{ amdahl1967, 19091 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 19092 Capabilities}, 19093 author = {Gene M. Amdahl}, 19094 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 19095 series = {AFIPS '67 (Spring)}, 19096 location = {Atlantic City, New Jersey}, 19097 pages = {483--485}, 19098 numpages = {3}, 19099 doi = {10.1145/1465482.1465560}, 19100 acmid = {1465560}, 19101 publisher = {ACM}, 19102 address = {New York, NY, USA}, 19103 year = {1967} 19104} 19105 19106@Article{ gustafson1988, 19107 title = {Reevaluating {Amdahl}'s Law}, 19108 author = {Gustafson, John L.}, 19109 journal = {Communications of the ACM}, 19110 volume = {31}, 19111 number = {5}, 19112 month = may, 19113 issn = {0001-0782}, 19114 pages = {532--533}, 19115 doi = {10.1145/42411.42415}, 19116 acmid = {42415}, 19117 year = {1988} 19118} 19119 19120@Book{ eijkhout2014, 19121 title = {Introduction to High Performance Scientific Computing}, 19122 author = {Victor Eijkhout}, 19123 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 19124 publisher = {TACC}, 19125 year = {2014} 19126} 19127 19128@Article{ korelc2002multilanguage, 19129 title = {Multi-language and multi-environment generation of nonlinear finite element 19130 codes}, 19131 author = {Korelc, J.}, 19132 journal = {Engineering with Computers}, 19133 volume = {18}, 19134 number = {4}, 19135 pages = {312--327}, 19136 year = {2002}, 19137 publisher = {Springer} 19138} 19139 19140@TechReport{ taylor2011feap, 19141 title = {{FEAP}: A Finite Element Analysis Program}, 19142 subtitle = {Version 8.3 User Manual}, 19143 author = {R. L. Taylor}, 19144 year = {2011}, 19145 institution = {University of California, Berkeley} 19146} 19147 19148@Article{ bergeraftosmismurman2005, 19149 title = {Analysis of slope limiters on irregular grids}, 19150 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 19151 journal = {AIAA paper}, 19152 volume = {490}, 19153 pages = {2005}, 19154 year = {2005} 19155} 19156 19157@InProceedings{ ferreirabridgesbrightwell08, 19158 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 19159 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 19160 Noise Injection}, 19161 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 19162 series = {SC '08}, 19163 year = {2008}, 19164 isbn = {978-1-4244-2835-9}, 19165 location = {Austin, Texas}, 19166 pages = {19:1--19:12}, 19167 articleno = {19}, 19168 numpages = {12}, 19169 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 19170 acmid = {1413390}, 19171 publisher = {IEEE Press}, 19172 address = {Piscataway, NJ} 19173} 19174 19175@Article{ banach22, 19176 author = {Stefan Banach}, 19177 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 19178 \'equations int\'egrales}, 19179 journal = {Fund. Math.}, 19180 volume = {3}, 19181 pages = {133--181}, 19182 year = {1922} 19183} 19184 19185@Article{ bangerthbursteddeheisterkronbichler2012, 19186 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 19187 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 19188 Element Codes}, 19189 journal = {ACM Trans. Math. Softw.}, 19190 issue_date = {December 2011}, 19191 volume = {38}, 19192 number = {2}, 19193 month = jan, 19194 year = {2012}, 19195 issn = {0098-3500}, 19196 pages = {14:1--14:28}, 19197 articleno = {14}, 19198 numpages = {28}, 19199 doi = {10.1145/2049673.2049678}, 19200 acmid = {2049678}, 19201 publisher = {ACM}, 19202 address = {New York, NY, USA}, 19203 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 19204 design} 19205} 19206 19207@Article{ eisenstatwalker1994, 19208 author = {Stanley Eisenstat and Homer Walker}, 19209 title = {Globally Convergent Inexact {N}ewton Methods}, 19210 journal = {SIAM Journal on Optimization}, 19211 volume = {4}, 19212 number = {2}, 19213 pages = {393--422}, 19214 year = {1994}, 19215 doi = {10.1137/0804022} 19216} 19217 19218@Book{ blumcuckershubsmale98, 19219 title = {Complexity and Real Computation}, 19220 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 19221 year = {1998}, 19222 publisher = {Springer} 19223} 19224 19225@Article{ caili2011, 19226 author = {Cai, X.-C. and Li, X.}, 19227 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 19228 Elimination for Problems with High Local Nonlinearity}, 19229 journal = {SIAM Journal on Scientific Computing}, 19230 volume = {33}, 19231 number = {2}, 19232 pages = {746-762}, 19233 year = {2011}, 19234 doi = {10.1137/080736272} 19235} 19236 19237@Article{ cai2009, 19238 author = {X.-C. Cai}, 19239 title = { Nonlinear overlapping domain decomposition methods}, 19240 journal = {Lecture Notes in Computational Science}, 19241 volume = {70}, 19242 pages = {217-224}, 19243 year = {2009} 19244} 19245 19246@Article{ lanzkronrosewilkes1996, 19247 title = {An analysis of approximate nonlinear elimination}, 19248 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 19249 journal = {SIAM Journal on Scientific Computing}, 19250 volume = {17}, 19251 number = {2}, 19252 pages = {538--559}, 19253 year = {1996}, 19254 publisher = {SIAM} 19255} 19256 19257@TechReport{ gropp1993sowing, 19258 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 19259 author = {Gropp, W}, 19260 year = {1995}, 19261 number = {ANL/MCS-TM-208}, 19262 institution = {Argonne National Laboratory} 19263} 19264 19265@TechReport{ gropp1993sowing2, 19266 title = {Users Manual for doctext: Producing Documentation from Source Code}, 19267 author = {Gropp, W}, 19268 year = {1995}, 19269 number = {ANL/MCS-TM-206}, 19270 institution = {Argonne National Laboratory} 19271} 19272 19273@TechReport{ gropp1993simplified, 19274 title = {Simplified Linear Equation Solvers users manual}, 19275 author = {Gropp, W and Smith, B}, 19276 year = {1993}, 19277 number = {ANL--93/8}, 19278 institution = {Argonne National Laboratory} 19279} 19280 19281@Misc{ simplifiedbsd, 19282 author = {{University of California, Berkeley}}, 19283 title = {Simplified {Berkeley} Software Distribution License}, 19284 note = {see 19285 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 19286} 19287 19288@Book{ chaconstraub14, 19289 author = {Scott Chacon and Ben Straub}, 19290 title = {Pro Git}, 19291 publisher = {Apress}, 19292 year = {2014}, 19293 pages = {456}, 19294 note = {Available online at \url{http://git-scm.com/book/}} 19295} 19296 19297@Misc{ bitbucket, 19298 author = {Atlassian}, 19299 title = {Bitbucket}, 19300 note = {Platform available from \url{http://bitbucket.org}} 19301} 19302 19303@Misc{ gitworkflows, 19304 author = {GitWorkflows}, 19305 note = {Available at 19306 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 19307} 19308 19309@Misc{ figshare, 19310 author = {FigShare}, 19311 note = {Available at \url{http://palgrave.figshare.com/}} 19312} 19313 19314@InProceedings{ beazley1996swig, 19315 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 19316 {C++}}, 19317 author = {Beazley, David M}, 19318 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 19319 pages = {129--139}, 19320 year = {1996} 19321} 19322 19323@Misc{ softwareproductivityworkshopreport14, 19324 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 19325 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 19326 title = {Software Productivity for Extreme-Scale Science}, 19327 note = {Report on DOE Workshop, January 13-14, 2014}, 19328 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 19329 year = {2014} 19330} 19331 19332@Misc{ softwareproductivitywhitepaper13, 19333 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 19334 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 19335 Tang}, 19336 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 19337 Capability of Extreme-Scale Computing}, 19338 note = {whitepaper submitted to DOE, available via 19339 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 19340 year = {2013} 19341} 19342 19343@Misc{ ideas:project, 19344 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 19345 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 19346 howpublished = {\url{http://ideas-productivity.org}}, 19347 year = {2015} 19348} 19349 19350@TechReport{ keyesmcinneswoodwardetal2012, 19351 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 19352 and B. Sheehan}, 19353 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 19354 institution = {Argonne National Laboratory}, 19355 number = {ANL/MCS-TM-330}, 19356 month = oct, 19357 year = {2012} 19358} 19359 19360@Misc{ sawsfs-web-page, 19361 author = {Surtai Han and Barry Smith and Hong Zhang}, 19362 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 19363 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 19364 year = {2015} 19365} 19366 19367@Misc{ sawshk-web-page, 19368 author = {Surtai Han and Barry Smith and Hong Zhang}, 19369 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 19370 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 19371 year = {2015} 19372} 19373 19374@Misc{ sawsnestk-web-page, 19375 author = {Surtai Han and Barry Smith and Hong Zhang}, 19376 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 19377 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 19378 year = {2015} 19379} 19380 19381@Misc{ m2acs:project, 19382 author = {M. {Anitescu et al.}}, 19383 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 19384 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 19385 year = {2015} 19386} 19387 19388@Misc{ hssmn13, 19389 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 19390 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 19391 Developing Mathematical Libraries and Simulation Codes}, 19392 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 19393 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 19394 year = {2013} 19395} 19396 19397@Misc{ atpesc:website, 19398 key = {{Argonne Training Program for Extreme-Scale Computing}}, 19399 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 19400 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 19401 year = {2018} 19402} 19403 19404@Article{ barraultmadaynguyenpatera2004, 19405 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 19406 title = {An empirical interpolation method: application to efficient reduced-basis 19407 discretization of partial differential equations}, 19408 journal = {Comptes Rendus Mathematique}, 19409 volume = {339}, 19410 number = {9}, 19411 pages = {667--672}, 19412 year = {2004}, 19413 issn = {1631-073X}, 19414 doi = {10.1016/j.crma.2004.08.006} 19415} 19416 19417@Article{ simongogotsi08, 19418 title = {Materials for electrochemical capacitors}, 19419 author = {Patrice Simon and Yury Gogotsi}, 19420 journal = {Nature Materials}, 19421 volume = {7}, 19422 number = {11}, 19423 pages = {845--854}, 19424 year = {2008}, 19425 doi = {10.1038/nmat2297} 19426} 19427 19428@Article{ vladsinghrollandmelinteajayangohy14, 19429 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 19430 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 19431 Gohy}, 19432 journal = {Scientific Reports}, 19433 volume = {4}, 19434 year = {2014}, 19435 doi = {10.1038/srep04315} 19436} 19437 19438@Article{ lichengshashurinkeidar12, 19439 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 19440 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 19441 journal = {Graphene}, 19442 volume = {1}, 19443 number = {1}, 19444 pages = {1--13}, 19445 year = {2012}, 19446 doi = {10.4236/graphene.2012.11001} 19447} 19448 19449@Article{ miller07, 19450 title = {A Brief History of Supercapacitors}, 19451 author = {John R. Miller}, 19452 journal = {Battery and Energy Storage Technology}, 19453 pages = {61--78}, 19454 year = {2007} 19455} 19456 19457@Book{ deshpande14, 19458 title = {Ultracapacitors: Future of Energy Storage}, 19459 author = {R. P. Deshpande}, 19460 publisher = {McGraw Hill Education}, 19461 isbn = {978-9339214050}, 19462 pages = {452}, 19463 year = {2014} 19464} 19465 19466@Article{ hojowboggs10, 19467 title = {Historical introduction to capacitor technology}, 19468 author = {J. Ho and T.R. Jow and S. Boggs}, 19469 journal = {IEEE Electrical Insulation Magazine}, 19470 month = jan, 19471 volume = {26}, 19472 number = {1}, 19473 pages = {20--25}, 19474 year = {2010}, 19475 doi = {10.1109/MEI.2010.5383924}, 19476 issn = {0883-7554} 19477} 19478 19479@Article{ gillespie14, 19480 title = {A review of steric interactions of ions: Why some theories succeed and others 19481 fail to acount for ion size}, 19482 author = {Dirk Gillespie}, 19483 journal = {Microfluidics and Nanofluidics}, 19484 volume = {18}, 19485 number = {5-6}, 19486 pages = {717--738}, 19487 year = {2015} 19488} 19489 19490@Article{ gillespievaliskoboda05, 19491 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 19492 title = {Density functional theory of the electrical double layer: the RFD functional}, 19493 journal = {J. Phys.: Condens. Matter}, 19494 volume = {17}, 19495 pages = {6609--6626}, 19496 year = {2005} 19497} 19498 19499@Article{ valiskobodagillespie07, 19500 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 19501 title = {Selective adsorption of ions with different diameter and valence at 19502 highly-charged interfaces}, 19503 journal = {J. Phys. Chem. C}, 19504 volume = {111}, 19505 pages = {15575--15585}, 19506 year = {2007} 19507} 19508 19509@Article{ gillespie08, 19510 author = {Dirk Gillespie}, 19511 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 19512 case study}, 19513 journal = {Biophys. J.}, 19514 volume = {94}, 19515 pages = {1169--1184}, 19516 year = {2008} 19517} 19518 19519@Article{ liwuwang15, 19520 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 19521 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 19522 journal = {Biophysical Journal}, 19523 volume = {94}, 19524 number = {3}, 19525 pages = {737--746}, 19526 doi = {10.1529/biophysj.107.112508}, 19527 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 19528 year = {2015} 19529} 19530 19531@Article{ gillespie12, 19532 title = {High energy conversion efficiency in nanofluidic channels}, 19533 author = {Dirk Gillespie}, 19534 journal = {Nano Letters}, 19535 volume = {12}, 19536 pages = {1410--1416}, 19537 year = {2012} 19538} 19539 19540@Article{ dieterich79, 19541 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 19542 author = {James H. Dieterich}, 19543 journal = {Journal of Geophysical Research: Solid Earth}, 19544 volume = {84}, 19545 number = {B5}, 19546 pages = {2161--2168}, 19547 year = {1979}, 19548 publisher = {Wiley Online Library} 19549} 19550 19551@Article{ bodakovacsgillespiekristof14, 19552 title = {Selective transport through a model calcium channel studied by Local Equilibrium 19553 Monte Carlo simulations coupled to the Nernst--Planck equation}, 19554 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 19555 Krist{\'o}f}, 19556 journal = {Journal of Molecular Liquids}, 19557 volume = {189}, 19558 pages = {100--112}, 19559 year = {2014}, 19560 publisher = {Elsevier} 19561} 19562 19563@Article{ brandt05, 19564 title = {Multiscale solvers and systematic upscaling in computational physics}, 19565 author = {Brandt, A}, 19566 journal = {Computer Physics Communications}, 19567 volume = {169}, 19568 number = {1}, 19569 pages = {438--441}, 19570 year = {2005}, 19571 publisher = {Elsevier} 19572} 19573 19574@Article{ rosenfeld89, 19575 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 19576 density-functional theory of freezing}, 19577 author = {Yaakov Rosenfeld}, 19578 journal = {Physical review letters}, 19579 volume = {63}, 19580 number = {9}, 19581 pages = {980}, 19582 year = {1989}, 19583 publisher = {APS} 19584} 19585 19586@Article{ schindlermitchellmccabecummingslevan13, 19587 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 19588 Approach}, 19589 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 19590 M Douglas LeVan}, 19591 journal = {The Journal of Physical Chemistry C}, 19592 volume = {117}, 19593 number = {41}, 19594 pages = {21337--21350}, 19595 year = {2013}, 19596 publisher = {ACS Publications} 19597} 19598 19599@Misc{ tramonto, 19600 author = {Laura Frink and et. al.}, 19601 title = {TRAMONTO 3.0 web site}, 19602 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 19603 year = {2014} 19604} 19605 19606@InCollection{ zhongyuenmoresiknepley15, 19607 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 19608 title = {Numerical Methods for Mantle Convection}, 19609 booktitle = {Treatise on Geophysics}, 19610 publisher = {Elsevier}, 19611 volume = {7}, 19612 editor = {Gerald Schubert}, 19613 edition = {Second Edition}, 19614 year = {2015} 19615} 19616 19617@Article{ richarson1911, 19618 author = {Lewis Fry Richardson}, 19619 title = {The approximate arithmetical solution by finite differences of physical problems 19620 including differential equations, with an application to the stresses in a masonry 19621 dam}, 19622 journal = {Philosophical Transactions of the Royal Society A}, 19623 volume = {210}, 19624 number = {459--470}, 19625 pages = {307--357}, 19626 doi = {10.1098/rsta.1911.0009}, 19627 year = {1911} 19628} 19629 19630@Article{ kirkwood34, 19631 author = {John G. Kirkwood}, 19632 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 19633 Application to Zwitterions}, 19634 journal = {The Journal of Chemical Physics}, 19635 volume = {2}, 19636 number = {7}, 19637 year = {1934} 19638} 19639 19640@TechReport{ schoof1994exodus, 19641 title = {{EXODUS II}: a finite element data model}, 19642 author = {Larry A Schoof and Victor R Yarberry}, 19643 institution = {Sandia National Laboratories}, 19644 number = {SAND92-2137}, 19645 address = {Albuquerque, NM}, 19646 year = {1994} 19647} 19648 19649@Misc{ poirier1998cgns, 19650 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 19651 and Fancis Y Enomoto}, 19652 title = {The CGNS system}, 19653 note = {AIAA Paper 98-3007}, 19654 year = {1998} 19655} 19656 19657@Article{ geuzaine2009gmsh, 19658 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 19659 facilities}, 19660 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 19661 journal = {International Journal for Numerical Methods in Engineering}, 19662 volume = {79}, 19663 number = {11}, 19664 pages = {1309--1331}, 19665 year = {2009}, 19666 publisher = {Wiley Online Library} 19667} 19668 19669@Article{ si2015, 19670 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 19671 author = {Hang Si}, 19672 journal = {ACM Trans. on Mathematical Software}, 19673 volume = {41}, 19674 number = {2}, 19675 month = feb, 19676 doi = {10.1145/2629697}, 19677 year = {2015} 19678} 19679 19680@TechReport{ blackerbohnhoffedwards1994, 19681 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 19682 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 19683 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 19684 year = {1994} 19685} 19686 19687@Article{ bjorck1994, 19688 title = {Numerics of Gram-Schmidt orthogonalization}, 19689 author = {{\AA}ke Bj{\"o}rck}, 19690 journal = {Linear Algebra and Its Applications}, 19691 volume = {197}, 19692 pages = {297--316}, 19693 year = {1994}, 19694 publisher = {Elsevier} 19695} 19696 19697@PhDThesis{ yood05, 19698 author = {Charles Nelson Yood}, 19699 title = {Argonne National Laboratory and the Emergence of Computer and Computational 19700 Science, 1946--1992}, 19701 school = {The Pennsylvania State University}, 19702 month = aug, 19703 year = {2005} 19704} 19705 19706@Article{ fearnleysander79, 19707 title = {Hermann Grassmann and the Creation of Linear Algebra}, 19708 author = {Desmond Fearnley-Sander}, 19709 journal = {The American Mathematical Monthly}, 19710 volume = {86}, 19711 pages = {809--817}, 19712 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 19713 year = {1979} 19714} 19715 19716@InCollection{ knepley2012, 19717 author = {Matthew G. Knepley}, 19718 title = {Programming Languages for Scientific Computing}, 19719 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 19720 publisher = {Springer}, 19721 year = {2012}, 19722 editor = {Bj\"orn Engquist}, 19723 doi = {10.1007/978-3-540-70529-1}, 19724 url = {http://arxiv.org/abs/1209.1711} 19725} 19726 19727@InBook{ knepley2015, 19728 title = {Programming Languages for Scientific Computing}, 19729 author = {Matthew G. Knepley}, 19730 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 19731 editor = {Bj{\"o}rn Engquist}, 19732 publisher = {Springer Berlin Heidelberg}, 19733 address = {Berlin, Heidelberg}, 19734 pages = {1173--1181}, 19735 isbn = {978-3-540-70529-1}, 19736 doi = {10.1007/978-3-540-70529-1_250}, 19737 year = {2015} 19738} 19739 19740@Book{ hughes2000, 19741 author = {Thomas J. R. Hughes}, 19742 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 19743 series = {Dover Civil and Mechanical Engineering}, 19744 pages = {704}, 19745 year = {2000}, 19746 isbn = {978-0486411811}, 19747 publisher = {Dover} 19748} 19749 19750@Article{ roache2002, 19751 title = {Code verification by the method of manufactured solutions}, 19752 author = {Patrick J. Roache}, 19753 journal = {Journal of Fluids Engineering}, 19754 volume = {124}, 19755 number = {1}, 19756 pages = {4--10}, 19757 year = {2002}, 19758 publisher = {American Society of Mechanical Engineers} 19759} 19760 19761@InCollection{ rokosgorman13, 19762 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 19763 author = {Georgios Rokos and Gerard Gorman}, 19764 booktitle = {Facing the Multicore-Challenge III}, 19765 series = {Lecture Notes in Computer Science}, 19766 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 19767 publisher = {Springer Berlin Heidelberg}, 19768 volume = {7686}, 19769 pages = {143-144}, 19770 doi = {10.1007/978-3-642-35893-7_22}, 19771 isbn = {978-3-642-35892-0}, 19772 year = {2013} 19773} 19774 19775@Misc{ hdf5:homepage, 19776 author = {{The HDF Group}}, 19777 title = {The {HDF5} Homepage}, 19778 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 19779 year = {2015} 19780} 19781 19782@Misc{ paraview:homepage, 19783 author = {Kitware}, 19784 title = {The {ParaView} Homepage}, 19785 howpublished = {\url{http://www.paraview.org/}}, 19786 year = {2015} 19787} 19788 19789@Misc{ xdmf:homepage, 19790 author = {Kitware}, 19791 title = {The Extensible Data Model and Format ({XDMF})}, 19792 howpublished = {\url{http://www.xdmf.org/}}, 19793 year = {2015} 19794} 19795 19796@Article{ cullerkarp1993, 19797 title = {LogP: Towards a realistic model of parallel computation}, 19798 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 19799 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 19800 journal = {SIGPLAN Notices}, 19801 volume = {28}, 19802 number = {7}, 19803 pages = {1--12}, 19804 year = {1993}, 19805 publisher = {ACM} 19806} 19807 19808@Article{ aggarwalvitter1988, 19809 title = {The input/output complexity of sorting and related problems}, 19810 author = {Alok Aggarwal and Jeffrey Vitter}, 19811 journal = {Communications of the ACM}, 19812 volume = {31}, 19813 number = {9}, 19814 pages = {1116--1127}, 19815 year = {1988}, 19816 publisher = {ACM} 19817} 19818 19819@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 19820 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 19821 Chandramowlishwaran and Richard Vuduc}, 19822 title = {Balance principles for algorithm-architecture co-design}, 19823 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 19824 month = may, 19825 address = {Berkeley, CA, USA}, 19826 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 19827 year = {2011} 19828} 19829 19830@Article{ williamswatermanpatterson2009, 19831 title = {Roofline: an insightful visual performance model for multicore architectures}, 19832 author = {Samuel Williams and Andrew Waterman and David Patterson}, 19833 journal = {Communications of the ACM}, 19834 volume = {52}, 19835 number = {4}, 19836 pages = {65--76}, 19837 year = {2009}, 19838 publisher = {ACM} 19839} 19840 19841@Misc{ roofline-web-page, 19842 author = {Samuel Williams and {et. al.}}, 19843 title = {{R}oofline {P}erformance {M}odel}, 19844 key = {Roofline}, 19845 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 19846 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 19847} 19848 19849@Misc{ roofline-talk2008, 19850 author = {Samuel Williams and David Patterson}, 19851 title = {{R}oofline {P}erformance {M}odel}, 19852 key = {Roofline}, 19853 year = {2008}, 19854 note = {ParLab Summer Retreat}, 19855 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 19856 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 19857} 19858 19859@Article{ lee2006, 19860 title = {The problem with threads}, 19861 author = {Edward A Lee}, 19862 journal = {Computer}, 19863 volume = {39}, 19864 number = {5}, 19865 pages = {33--42}, 19866 year = {2006}, 19867 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 19868 publisher = {IEEE Computer Society Press} 19869} 19870 19871@Article{ hoefler2012, 19872 title = {{Optimization principles for collective neighborhood communications}}, 19873 author = {Torsten Hoefler and Timo Schneider}, 19874 journal = {International Conference for High Performance Computing, Networking, Storage and 19875 Analysis, SC}, 19876 doi = {10.1109/SC.2012.86}, 19877 isbn = {9781467308069}, 19878 issn = {21674329}, 19879 year = {2012} 19880} 19881 19882@Book{ grahamknuthpatashnik1989, 19883 title = {Concrete Mathematics}, 19884 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 19885 publisher = {Addison-Wesley}, 19886 year = {1989} 19887} 19888 19889@Book{ jackson1962, 19890 title = {Classical Electrodynamics}, 19891 author = {John David Jackson}, 19892 publisher = {John Wiley \& Sons}, 19893 year = {1962} 19894} 19895 19896@Article{ leveque2013, 19897 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 19898 author = {Randall J. LeVeque}, 19899 journal = {SIAM News}, 19900 volume = {46}, 19901 number = {3}, 19902 month = apr, 19903 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 19904 year = {2013} 19905} 19906 19907@InProceedings{ wang2014, 19908 title = {Fjos: Practical, predictable, and efficient system support for fork/join 19909 parallelism}, 19910 author = {Qi Wang and Gabriel Parmer}, 19911 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 19912 20th}, 19913 pages = {25--36}, 19914 year = {2014}, 19915 organization = {IEEE} 19916} 19917 19918@Article{ fangsaad2009, 19919 author = {Haw-ren Fang and Yousef Saad}, 19920 title = {Two classes of multisecant methods for nonlinear acceleration}, 19921 journal = {Numerical Linear Algebra with Applications}, 19922 volume = {16}, 19923 number = {3}, 19924 pages = {197--221}, 19925 year = {2009}, 19926 doi = {10.1002/nla.617} 19927} 19928 19929@Misc{ hpcchallenge, 19930 title = {HPC Challenge}, 19931 author = {Jack Dongarra and Piotr Luszczek and others}, 19932 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 19933 year = {2015} 19934} 19935 19936@InProceedings{ hoeflerschneiderlumsdaine2008, 19937 title = {Accurately measuring collective operations at massive scale}, 19938 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 19939 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 19940 Processing (IPDPS)}, 19941 pages = {1--8}, 19942 year = {2008}, 19943 doi = {10.1109/IPDPS.2008.4536494}, 19944 organization = {IEEE} 19945} 19946 19947@Book{ potraptak1984, 19948 title = {Nondiscrete Induction and Iterative Processes}, 19949 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 19950 series = {Research Notes in Mathematics}, 19951 year = {1984}, 19952 publisher = {Pitman} 19953} 19954 19955@Book{ pilz1977, 19956 title = {Near-rings: the theory and its applications}, 19957 author = {G{\"u}nter Pilz}, 19958 year = {1977}, 19959 publisher = {New York} 19960} 19961 19962@Article{ birkenjameson2009, 19963 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 19964 author = {Philipp Birken and Antony Jameson}, 19965 journal = {International Journal for Numerical Methods in Fluids}, 19966 volume = {62}, 19967 number = {5}, 19968 pages = {565--573}, 19969 publisher = {John Wiley \& Sons, Ltd.}, 19970 doi = {10.1002/fld.2030}, 19971 issn = {1097-0363}, 19972 year = {2010} 19973} 19974 19975@Article{ anderson1965, 19976 title = {Iterative procedures for nonlinear integral equations}, 19977 author = {Donald G Anderson}, 19978 journal = {Journal of the ACM (JACM)}, 19979 volume = {12}, 19980 number = {4}, 19981 pages = {547--560}, 19982 year = {1965}, 19983 publisher = {ACM} 19984} 19985 19986@Article{ ptak1966, 19987 title = {Some metric aspects of the open mapping and closed graph theorems}, 19988 author = {Vlastimil Pt{\'a}k}, 19989 journal = {Mathematische Annalen}, 19990 volume = {163}, 19991 number = {2}, 19992 pages = {95--104}, 19993 year = {1966}, 19994 publisher = {Springer} 19995} 19996 19997@Article{ ptak1974, 19998 title = {A quantitative refinement of the closed graph theorem}, 19999 author = {Vlastimil Pt{\'a}k}, 20000 journal = {Czechoslovak Mathematical Journal}, 20001 volume = {24}, 20002 number = {3}, 20003 pages = {503--506}, 20004 year = {1974}, 20005 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 20006} 20007 20008@Article{ ptak1975, 20009 title = {The rate of convergence of {Newton's} process}, 20010 author = {Vlastimil Pt{\'a}k}, 20011 journal = {Numerische Mathematik}, 20012 volume = {25}, 20013 number = {3}, 20014 pages = {279--285}, 20015 year = {1975}, 20016 publisher = {Springer} 20017} 20018 20019@Article{ ptak1976, 20020 title = {Nondiscrete mathematical induction and iterative existence proofs}, 20021 author = {Vlastimil Pt{\'a}k}, 20022 journal = {Linear algebra and its applications}, 20023 volume = {13}, 20024 number = {3}, 20025 pages = {223--238}, 20026 year = {1976}, 20027 publisher = {Elsevier} 20028} 20029 20030@Article{ ptak1977, 20031 title = {What should be a rate of convergence?}, 20032 author = {Vlastimil Pt{\'a}k}, 20033 journal = {RAIRO-Analyse num{\'e}rique}, 20034 volume = {11}, 20035 number = {3}, 20036 pages = {279--286}, 20037 year = {1977} 20038} 20039 20040@Article{ potraptak1980, 20041 title = {Sharp error bounds for {Newton's} process}, 20042 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 20043 journal = {Numerische Mathematik}, 20044 volume = {34}, 20045 number = {1}, 20046 pages = {63--72}, 20047 year = {1980}, 20048 publisher = {Springer} 20049} 20050 20051@Article{ liesen2014, 20052 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 20053 author = {J{\"o}rg Liesen}, 20054 journal = {IMA Journal of Numerical Analysis}, 20055 doi = {10.1093/imanum/drv037}, 20056 archiveprefix = {arXiv}, 20057 eprint = {1405.2683}, 20058 primaryclass = {math-na}, 20059 year = {2015} 20060} 20061 20062@Book{ traub1964, 20063 title = {Iterative Methods for the Solution of Equations}, 20064 author = {Joseph F Traub}, 20065 year = {1964}, 20066 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 20067} 20068 20069@InProceedings{ shalfvecpar2010, 20070 title = {Exascale Computing Technology Challenges}, 20071 author = {John Shalf and Sudip Dosanjh and John Morrison}, 20072 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 20073 pages = {1–-25}, 20074 year = {2010} 20075} 20076 20077@Article{ frechet1907, 20078 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 20079 author = {Maurice Ren\'e Fr\'echet}, 20080 journal = {C. R. Acad. Sci. Paris}, 20081 volume = {144}, 20082 pages = {1414--1416}, 20083 year = {1907} 20084} 20085 20086@Article{ riesz1907, 20087 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 20088 author = {Frigyes Riesz}, 20089 journal = {C. R. Acad. Sci. Paris}, 20090 volume = {144}, 20091 pages = {1409--1411}, 20092 year = {1907} 20093} 20094 20095@Article{ riesz1909, 20096 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 20097 author = {Frigyes Riesz}, 20098 journal = {C. R. Acad. Sci. Paris}, 20099 volume = {149}, 20100 pages = {974--977}, 20101 year = {1909} 20102} 20103 20104@Misc{ rieszmarkovkakutanirepresentationtheorem, 20105 author = {Wikipedia}, 20106 title = {Riesz-Markov-Kakutani Representation Theorem}, 20107 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 20108 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 20109 year = {2015} 20110} 20111 20112@Article{ markov1938, 20113 title = {On mean values and exterior densities}, 20114 author = {Andrey Markov}, 20115 journal = {Rec. Math. Moscou}, 20116 volume = {4}, 20117 pages = {165--190}, 20118 year = {1938} 20119} 20120 20121@Article{ kakutani1941, 20122 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 20123 space of continuous functions.)}, 20124 author = {Shizuo Kakutani}, 20125 journal = {Ann. of Math.}, 20126 volume = {2}, 20127 number = {42}, 20128 pages = {994--1024}, 20129 doi = {10.2307/1968778}, 20130 year = {1941} 20131} 20132 20133@Article{ michoskimeyersonisaacwaelbroeck2014, 20134 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 20135 tokamaks}, 20136 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 20137 journal = {Journal of Computational Physics}, 20138 volume = {274}, 20139 pages = {898--919}, 20140 year = {2014}, 20141 publisher = {Elsevier} 20142} 20143 20144@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 20145 title = {Extreme-scale AMR}, 20146 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 20147 Stadler and Tim Warburton and Lucas Wilcox}, 20148 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 20149 Computing, Networking, Storage and Analysis}, 20150 pages = {1--12}, 20151 year = {2010}, 20152 organization = {IEEE Computer Society}, 20153 doi = {10.1109/SC.2010.25} 20154} 20155 20156@InProceedings{ isaacbursteddeghattas2012, 20157 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 20158 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 20159 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 20160 International}, 20161 pages = {426--437}, 20162 year = {2012}, 20163 organization = {IEEE}, 20164 doi = {10.1109/IPDPS.2012.47} 20165} 20166 20167@Article{ isaacpetrastadlerghattas2015, 20168 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 20169 through inference to prediction for large-scale problems, with application to flow 20170 of the {Antarctic} ice sheet}, 20171 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 20172 journal = {Journal of Computational Physics}, 20173 volume = {296}, 20174 pages = {348--368}, 20175 year = {2015}, 20176 publisher = {Elsevier}, 20177 doi = {10.1016/j.jcp.2015.04.047} 20178} 20179 20180@Article{ isaacbursteddewilcoxghattas2015, 20181 title = {Recursive Algorithms for Distributed Forests of Octrees}, 20182 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 20183 journal = {SIAM Journal on Scientific Computing}, 20184 volume = {37}, 20185 number = {5}, 20186 pages = {C497-C531}, 20187 eprint = {1406.0089}, 20188 eprinttype = {arXiv}, 20189 year = {2015}, 20190 doi = {10.1137/140970963} 20191} 20192 20193@Article{ isaacstadlerghattas2015, 20194 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 20195 elements on nonconforming and anisotropic meshes, with application to ice sheet 20196 dynamics}, 20197 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 20198 journal = {SIAM Journal on Scientific Computing}, 20199 number = {6}, 20200 pages = {804--833}, 20201 volume = {37}, 20202 year = {2015}, 20203 doi = {10.1137/140974407} 20204} 20205 20206@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 20207 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 20208 earth's mantle}, 20209 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 20210 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 20211 Alessandro Curioni and Omar Ghattas}, 20212 booktitle = {Proceedings of the International Conference for High Performance Computing, 20213 Networking, Storage and Analysis}, 20214 pages = {5}, 20215 year = {2015}, 20216 organization = {ACM}, 20217 doi = {10.1145/2807591.2807675} 20218} 20219 20220@Article{ bunchhopcroft1974, 20221 title = {Triangular factorization and inversion by fast matrix multiplication}, 20222 author = {James R Bunch and John E Hopcroft}, 20223 journal = {Mathematics of Computation}, 20224 volume = {28}, 20225 number = {125}, 20226 pages = {231--236}, 20227 doi = {10.2307/2005828}, 20228 year = {1974} 20229} 20230 20231@Article{ nemirovsky1991, 20232 title = {On optimality of Krylov's information when solving linear operator equations}, 20233 author = {A.S Nemirovsky}, 20234 journal = {Journal of Complexity}, 20235 volume = {7}, 20236 number = {2}, 20237 pages = {121--130}, 20238 doi = {10.1016/0885-064X(91)90001-E}, 20239 year = {1991} 20240} 20241 20242@Misc{siamcseprize, 20243 author = {{PETSc Team}}, 20244 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 20245 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 20246 url = {https://www.siam.org/prizes/sponsored/cse.php}, 20247 year = {2015} 20248} 20249 20250@Article{ rathgeber2017, 20251 title = {Firedrake: automating the finite element method by composing abstractions}, 20252 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 20253 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 20254 Graham R and Kelly, Paul HJ}, 20255 archiveprefix = {arXiv}, 20256 journal = {ACM Transaction on Mathematical Software}, 20257 eprint = {1501.01809}, 20258 volume = {43}, 20259 issue = {3}, 20260 number = {24}, 20261 year = {2017}, 20262 url = {http://arxiv.org/abs/1501.01809} 20263} 20264 20265@Article{ kirby2006b, 20266 title = {Topological optimization of the evaluation of finite element matrices}, 20267 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 20268 journal = {SIAM Journal on Scientific Computing}, 20269 volume = {28}, 20270 number = {1}, 20271 pages = {224--240}, 20272 year = {2006}, 20273 publisher = {SIAM} 20274} 20275 20276@Article{ luporini2015, 20277 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 20278 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 20279 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 20280 Assembly}, 20281 journal = {ACM Trans. Archit. Code Optim.}, 20282 issue_date = {January 2015}, 20283 volume = {11}, 20284 number = {4}, 20285 month = jan, 20286 year = {2015}, 20287 issn = {1544-3566}, 20288 pages = {57:1--57:25}, 20289 articleno = {57}, 20290 numpages = {25}, 20291 doi = {10.1145/2687415}, 20292 acmid = {2687415}, 20293 publisher = {ACM}, 20294 address = {New York, NY, USA}, 20295 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 20296 optimizations} 20297} 20298 20299@Article{ markall2012, 20300 title = {Finite element assembly strategies on multi- and many-core architectures}, 20301 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 20302 C. D. and Sherwin, S. J.}, 20303 journal = {International Journal for Numerical Methods in Fluids}, 20304 year = {2013}, 20305 volume = {71}, 20306 pages = {80--97}, 20307 doi = {10.1002/fld.3648} 20308} 20309 20310@Article{ markall2010, 20311 title = {Towards generating optimised finite element solvers for GPUs from high-level 20312 specifications}, 20313 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 20314 journal = {Procedia Computer Science}, 20315 volume = {1}, 20316 number = {1}, 20317 pages = {1815--1823}, 20318 year = {2010}, 20319 note = {{ICCS} 2010}, 20320 doi = {10.1016/j.procs.2010.04.203} 20321} 20322 20323@Article{ longkirbywaanders2010, 20324 title = {Unified embedded parallel finite element computations via software-based 20325 Fr{\'e}chet differentiation}, 20326 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 20327 journal = {SIAM Journal on Scientific Computing}, 20328 volume = {32}, 20329 number = {6}, 20330 pages = {3323--3351}, 20331 year = {2010}, 20332 publisher = {SIAM} 20333} 20334 20335@Article{ kirby2010, 20336 title = {From functional analysis to iterative methods}, 20337 author = {Robert C Kirby}, 20338 journal = {SIAM review}, 20339 volume = {52}, 20340 number = {2}, 20341 pages = {269--293}, 20342 year = {2010}, 20343 publisher = {SIAM} 20344} 20345 20346@Article{ kirby2014, 20347 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 20348 author = {Robert C Kirby}, 20349 journal = {SIAM Journal on Scientific Computing}, 20350 volume = {36}, 20351 number = {2}, 20352 pages = {A846--A868}, 20353 year = {2014}, 20354 publisher = {SIAM} 20355} 20356 20357@Article{ kirby2011, 20358 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 20359 author = {Robert C Kirby}, 20360 journal = {Numerische Mathematik}, 20361 volume = {117}, 20362 number = {4}, 20363 pages = {631--652}, 20364 year = {2011}, 20365 publisher = {Springer} 20366} 20367 20368@Article{ arnoldfalkwinther2006, 20369 title = {Finite element exterior calculus, homological techniques, and applications}, 20370 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 20371 journal = {Acta numerica}, 20372 volume = {15}, 20373 pages = {1--155}, 20374 year = {2006}, 20375 publisher = {Cambridge Univ Press} 20376} 20377 20378@Article{ arnoldlogg2014, 20379 title = {Periodic table of the finite elements}, 20380 author = {Douglas Arnold and Anders Logg}, 20381 month = nov, 20382 journal = {SIAM News}, 20383 year = {2014} 20384} 20385 20386@Article{ janssonhoffmanjansson2012, 20387 title = {Framework for massively parallel adaptive finite element computational fluid 20388 dynamics on tetrahedral meshes}, 20389 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 20390 journal = {SIAM Journal on Scientific Computing}, 20391 volume = {34}, 20392 number = {1}, 20393 pages = {C24--C41}, 20394 year = {2012}, 20395 publisher = {SIAM} 20396} 20397 20398@Article{ rogneshamcottermcrae2013, 20399 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 20400 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 20401 journal = {Geoscientific Model Development}, 20402 volume = {6}, 20403 number = {6}, 20404 pages = {2099--2119}, 20405 year = {2013}, 20406 publisher = {Copernicus GmbH} 20407} 20408 20409@Book{ loggmardalwells2012, 20410 title = {Automated solution of differential equations by the finite element method: The 20411 FEniCS book}, 20412 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 20413 volume = {84}, 20414 year = {2012}, 20415 publisher = {Springer Science \& Business Media} 20416} 20417 20418@Article{ cotterkirby2014, 20419 title = {Mixed finite elements for global tide models}, 20420 author = {Colin J Cotter and Robert C Kirby}, 20421 archiveprefix = {arXiv}, 20422 journal = {Submitted}, 20423 eprint = {1410.0045}, 20424 year = {2014}, 20425 url = {http://arxiv.org/abs/1410.0045} 20426} 20427 20428@Article{ kirbykieu2015, 20429 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 20430 author = {Robert C Kirby and Thinh Tri Kieu}, 20431 journal = {Numerische Mathematik}, 20432 volume = {130}, 20433 number = {2}, 20434 pages = {257--291}, 20435 year = {2015}, 20436 publisher = {Springer} 20437} 20438 20439@Article{ brennankirby2015, 20440 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 20441 model}, 20442 author = {Brian Brennan and Robert C Kirby}, 20443 journal = {Submitted to Computers and Mathematics with Applications}, 20444 year = {2015} 20445} 20446 20447@Article{ howlekirbydillon2013, 20448 title = {Block preconditioners for coupled physics problems}, 20449 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 20450 journal = {SIAM Journal on Scientific Computing}, 20451 volume = {35}, 20452 number = {5}, 20453 pages = {S368--S385}, 20454 year = {2013}, 20455 publisher = {SIAM} 20456} 20457 20458@Book{ malekstrakos2014, 20459 title = {Preconditioning and the conjugate gradient method in the context of solving 20460 PDEs}, 20461 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 20462 volume = {1}, 20463 year = {2014}, 20464 publisher = {SIAM} 20465} 20466 20467@Article{ desturler1995, 20468 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 20469 distributed memory computers}, 20470 author = {E. de Sturler and H.A. van der Vorst}, 20471 journal = {Applied Numerical Mathematics}, 20472 volume = {18}, 20473 number = {4}, 20474 pages = {441--459}, 20475 year = {1995}, 20476 doi = {10.1016/0168-9274(95)00079-A} 20477} 20478 20479@Article{ velicmaymoresi2009, 20480 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 20481 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 20482 journal = {Journal of Mathematical Modelling and Algorithms}, 20483 volume = {8}, 20484 number = {3}, 20485 pages = {343--355}, 20486 year = {2009}, 20487 publisher = {Springer} 20488} 20489 20490@Article{ may2012, 20491 title = {Volume reconstruction of point cloud data sets derived from computational 20492 geodynamic simulations}, 20493 author = {May, DA}, 20494 journal = {Geochemistry, Geophysics, Geosystems}, 20495 volume = {13}, 20496 number = {5}, 20497 year = {2012}, 20498 publisher = {Wiley Online Library} 20499} 20500 20501@Article{ quenettehodkinson2010, 20502 title = {StgDomain--scalable parallel domain software components for particle-in-cell 20503 finite element methods}, 20504 author = {Quenette, Steve and Hodkinson, Luke}, 20505 journal = {Concurrency and Computation: Practice and Experience}, 20506 volume = {22}, 20507 number = {12}, 20508 pages = {1593--1603}, 20509 year = {2010}, 20510 publisher = {Wiley Online Library} 20511} 20512 20513@Book{ velic2005, 20514 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 20515 author = {Velic, Mirko}, 20516 year = {2005}, 20517 publisher = {Monash University} 20518} 20519 20520@Article{ velicknepleymay2016, 20521 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 20522 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 20523 note = {in preparation}, 20524 year = {2016} 20525} 20526 20527@Article{ traubwozniakowski1979, 20528 title = {Convergence and complexity of Newton iteration for operator equations}, 20529 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 20530 journal = {Journal of the ACM (JACM)}, 20531 volume = {26}, 20532 number = {2}, 20533 pages = {250--258}, 20534 year = {1979}, 20535 publisher = {ACM} 20536} 20537 20538@Article{ sterck2013, 20539 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 20540 author = {Hans De Sterck}, 20541 journal = {Numerical Linear Algebra with Applications}, 20542 volume = {20}, 20543 number = {3}, 20544 pages = {453--471}, 20545 year = {2013} 20546} 20547 20548@Article{ sterckwinlaw2015, 20549 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 20550 tensor approximation}, 20551 author = {Hans De Sterck and Manda Winlaw}, 20552 journal = {Numerical Linear Algebra with Applications}, 20553 volume = {22}, 20554 number = {3}, 20555 pages = {410--432}, 20556 year = {2015} 20557} 20558 20559@Article{ sterckhowse2015, 20560 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 20561 approximate {Tucker} tensor decompositions}, 20562 author = {Hans De Sterck and Alexander Howse}, 20563 journal = {SIAM Journal on Scientific Computing}, 20564 note = {submitted}, 20565 year = {2015} 20566} 20567 20568@Book{ ladevezesimmonds1999, 20569 title = {Nonlinear computational structural mechanics: {N}ew approaches and 20570 non-incremental methods of calculation}, 20571 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 20572 series = {{M}echanical {E}ngineering {S}eries}, 20573 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 20574 isbn = {9780387985947}, 20575 lccn = {98029990}, 20576 year = {1999}, 20577 publisher = {Springer} 20578} 20579 20580@InProceedings{ walkerwoodwardyang2010, 20581 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 20582 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 20583 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 20584 year = {2010} 20585} 20586 20587@Article{ lottwalkerwoodwardyang2012, 20588 title = {An accelerated {P}icard method for nonlinear systems related to variably 20589 saturated flow}, 20590 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 20591 journal = {Advances in Water Resources}, 20592 volume = {38}, 20593 number = {0}, 20594 pages = {92--101}, 20595 doi = {10.1016/j.advwatres.2011.12.013}, 20596 year = {2012} 20597} 20598 20599@TechReport{ mohrrude1998, 20600 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 20601 author = {Marcus Mohr and Ulrich R\"ude}, 20602 type = {Technical Report}, 20603 number = {394}, 20604 institution = {University of Augsburg}, 20605 year = {1998} 20606} 20607 20608@InProceedings{ mohr2000, 20609 title = {Low Communication Parallel Multigrid}, 20610 author = {Mohr, Marcus}, 20611 booktitle = {Euro-Par 2000 Parallel Processing}, 20612 pages = {806--814}, 20613 year = {2000}, 20614 organization = {Springer} 20615} 20616 20617@Article{ brandtdiskin1994, 20618 title = {Multigrid solvers on decomposed domains}, 20619 author = {Achi Brandt and Boris Diskin}, 20620 journal = {Contemporary Mathematics}, 20621 volume = {157}, 20622 year = {1994}, 20623 publisher = {AMERICAN MATHEMATICAL SOCIETY} 20624} 20625 20626@InProceedings{ prabhuetal2011, 20627 title = {A Survey of the Practice of Computational Science}, 20628 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 20629 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 20630 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 20631 David I.}, 20632 booktitle = {State of the Practice Reports}, 20633 series = {SC '11}, 20634 year = {2011}, 20635 isbn = {978-1-4503-1139-7}, 20636 location = {Seattle, Washington}, 20637 pages = {19:1--19:12}, 20638 articleno = {19}, 20639 numpages = {12}, 20640 doi = {10.1145/2063348.2063374}, 20641 acmid = {2063374}, 20642 publisher = {ACM}, 20643 address = {New York, NY, USA} 20644} 20645 20646@PhDThesis{ dinarthesis1979, 20647 title = {Fast methods for the numerical solution of boundary value problems}, 20648 author = {N. Dinar}, 20649 school = {Weizmann Institute of Science}, 20650 year = {1979} 20651} 20652 20653@Article{ thomasdiskinbrandt2001, 20654 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 20655 high Reynolds number wakes and boundary layers}, 20656 author = {James L Thomas and Boris Diskin and Achi Brandt}, 20657 journal = {Computers \& fluids}, 20658 volume = {30}, 20659 number = {7}, 20660 pages = {853--874}, 20661 year = {2001}, 20662 publisher = {Elsevier} 20663} 20664 20665@Article{ greenbaumptakstrakos1996, 20666 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 20667 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 20668 journal = {SIAM Journal on Matrix Analysis and Applications}, 20669 volume = {17}, 20670 number = {3}, 20671 pages = {465--469}, 20672 year = {1996}, 20673 publisher = {SIAM} 20674} 20675 20676@Article{ nangiapatankarbhalla2019, 20677 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 20678 density ratio multiphase flows}, 20679 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 20680 journal = {Journal of Computational Physics}, 20681 volume = {398}, 20682 pages = {108804}, 20683 year = {2019} 20684} 20685 20686@Article{ bhallanangiadafnakisbraccomattiazzo2019, 20687 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 20688 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 20689 library}, 20690 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 20691 Bracco and Giuliana Mattiazzo}, 20692 journal = {Applied Ocean Research}, 20693 note = {In press}, 20694 year = {2019} 20695} 20696 20697@Article{ bhallagriffithpatankardonev2013, 20698 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 20699 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 20700 Alexander Donev}, 20701 journal = {Journal of Chemical Physics}, 20702 volume = {139}, 20703 number = {21}, 20704 pages = {214112}, 20705 year = {2013} 20706} 20707 20708@Article{ bhallabalegriffithpatankar2014, 20709 title = {Fully resolved immersed electrohydrodynamics for particle motion, 20710 electrolocation, and self-propulsion}, 20711 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 20712 Patankar}, 20713 journal = {Journal of Computational Physics}, 20714 volume = {256}, 20715 pages = {88--108}, 20716 year = {2014} 20717} 20718 20719@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 20720 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 20721 multiblob approach}, 20722 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 20723 and Boyce E. Griffith and Alexander Donev}, 20724 journal = {Communications in Applied Mathematics and Computational Science}, 20725 volume = {11}, 20726 number = {2}, 20727 pages = {217--296}, 20728 year = {2016} 20729} 20730 20731@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 20732 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 20733 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 20734 P.J. Kahrilas and Neelesh A. Patankar}, 20735 journal = {Journal of Computational Physics}, 20736 volume = {298}, 20737 pages = {446--465}, 20738 year = {2015} 20739} 20740 20741@Article{ balenevelnbhallamaciverpatankar2015, 20742 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 20743 and vertebrates}, 20744 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 20745 A. Patankar}, 20746 journal = {PLoS Biology}, 20747 volume = {13}, 20748 number = {4}, 20749 pages = {1--22}, 20750 year = {2015} 20751} 20752 20753@Article{ balehaobhallapatankar2014, 20754 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 20755 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 20756 journal = {Proceedings of the National Academy of Sciences}, 20757 volume = {111}, 20758 number = {21}, 20759 pages = {7517--7521}, 20760 year = {2014} 20761} 20762 20763@Article{ bhallabalegriffithpatankar2013, 20764 title = {A unified mathematical framework and an adaptive numerical method for 20765 fluid--structure interaction with rigid, deforming, and elastic bodies}, 20766 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 20767 Patankar}, 20768 journal = {Journal of Computational Physics}, 20769 volume = {250}, 20770 pages = {446--476}, 20771 year = {2013}, 20772 publisher = {Elsevier} 20773} 20774 20775@Article{ takeikatz2013, 20776 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 20777 Governing equations and linearized analysis}, 20778 author = {Yasuko Takei and Richard F. Katz}, 20779 journal = {Journal of Fluid Mechanics}, 20780 volume = {734}, 20781 issn = {1469-7645}, 20782 pages = {424--455}, 20783 numpages = {32}, 20784 doi = {10.1017/jfm.2013.482}, 20785 month = nov, 20786 year = {2013} 20787} 20788 20789@Misc{ stewart2011, 20790 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 20791 author = {G. W. Stewart}, 20792 note = {Translated with commentary by G. W. Stewart}, 20793 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 20794 year = {2011} 20795} 20796 20797@Article{ douglisnirenberg1955, 20798 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 20799 author = {Avron Douglis and Louis Nirenberg}, 20800 journal = {Communications on Pure and Applied Mathematics}, 20801 volume = {8}, 20802 pages = {503--538}, 20803 year = {1955} 20804} 20805 20806@Article{ gorelickgalunsharonbasribrandt2006, 20807 title = {Shape Representation and Classification Using the Poisson Equation}, 20808 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 20809 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 20810 volume = {28}, 20811 number = {12}, 20812 pages = {1991--2005}, 20813 year = {2006} 20814} 20815 20816@Article{ salsbury2006, 20817 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 20818 solvation energies}, 20819 author = {Freddie R. Salsbury Jr.}, 20820 journal = {Molecular Physics}, 20821 volume = {104}, 20822 number = {08}, 20823 pages = {1299--1309}, 20824 year = {2006} 20825} 20826 20827@Article{ sigalov2006, 20828 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 20829 approximation}, 20830 author = {G. Sigalov and A. Fenley and A. Onufriev}, 20831 journal = {Journal of Chemical Physics}, 20832 volume = {124}, 20833 number = {124902}, 20834 year = {2006} 20835} 20836 20837@Article{ dennard1974, 20838 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 20839 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 20840 Andre R LeBlanc}, 20841 journal = {IEEE Journal of Solid-State Circuits}, 20842 volume = {9}, 20843 number = {5}, 20844 pages = {256--268}, 20845 year = {1974} 20846} 20847 20848@Article{ zeegeijn2015, 20849 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 20850 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 20851 journal = {ACM Transactions on Mathematical Software}, 20852 volume = {41}, 20853 number = {3}, 20854 pages = {14:1--14:33}, 20855 month = jun, 20856 year = {2015}, 20857 issue_date = {jun}, 20858 doi = {10.1145/2764454} 20859} 20860 20861@Article{ campbell1976, 20862 title = {Assessing the Impact of Planned Social Change}, 20863 author = {Donald T. Campbell}, 20864 journal = {Occasional Paper Series, The Public Affairs Center}, 20865 number = {8}, 20866 publisher = {Dartmouth College}, 20867 year = {1976} 20868} 20869 20870@Article{ smaldinomcelreath2016, 20871 title = {The natural selection of bad science}, 20872 author = {Paul E. Smaldino and Richard McElreath}, 20873 journal = {Royal Society Open Science}, 20874 volume = {3}, 20875 number = {9}, 20876 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 20877 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 20878 doi = {10.1098/rsos.160384}, 20879 year = {2016}, 20880 publisher = {The Royal Society} 20881} 20882 20883@Article{ harlowwelch1965, 20884 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 20885 free surface}, 20886 author = {Francis H Harlow and J Eddie Welch}, 20887 journal = {Physics of fluids}, 20888 volume = {8}, 20889 number = {12}, 20890 pages = {2182--2189}, 20891 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 20892 year = {1965} 20893} 20894 20895@Article{ diskinthomasmineck2005, 20896 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 20897 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 20898 journal = {SIAM Journal on Scientific Computing}, 20899 volume = {27}, 20900 number = {1}, 20901 pages = {108--129}, 20902 doi = {10.1137/030601521}, 20903 issn = {1064-8275}, 20904 year = {2005} 20905} 20906 20907@TechReport{ scott2012, 20908 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 20909 Computer Science}, 20910 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 20911 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 20912 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 20913 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 20914 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 20915 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 20916 Yuen}, 20917 institution = {University of Chicago}, 20918 number = {2012-02}, 20919 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 20920 year = {2012} 20921} 20922 20923@Article{ paigesaunders1975, 20924 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 20925 author = {C. C. Paige and M. A. Saunders}, 20926 journal = {SIAM Journal on Numerical Analysis}, 20927 volume = {12}, 20928 pages = {617--629}, 20929 year = {1975} 20930} 20931 20932@Article{ roth2010, 20933 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 20934 author = {Roland Roth}, 20935 journal = {J. Phys. Cond. Mat.}, 20936 volume = {22}, 20937 pages = {063102}, 20938 year = {2010} 20939} 20940 20941@Article{ wu2008, 20942 title = {Density functional theory for liquid structure and thermodynamics}, 20943 author = {J. Z. Wu}, 20944 journal = {Struct. Bond.}, 20945 doi = {10.1007/430_2008_3}, 20946 year = {2008} 20947} 20948 20949@Article{ goel2008, 20950 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 20951 by {Monte Carlo} simulations and density functional theory}, 20952 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 20953 journal = {J. Chem. Phys.}, 20954 volume = {129}, 20955 pages = {154707}, 20956 year = {2008} 20957} 20958 20959@Article{ marchxiaoyubiros2015, 20960 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 20961 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 20962 journal = {SIAM Journal on Scientific Computing (to appear)}, 20963 year = {2015} 20964} 20965 20966@InProceedings{ yangduraiswamigumerovdavis2003, 20967 title = {Improved fast gauss transform and efficient kernel density estimation}, 20968 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 20969 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 20970 pages = {664--671}, 20971 year = {2003}, 20972 organization = {IEEE} 20973} 20974 20975@Article{ fornberglarssonflyer2011, 20976 title = {Stable computations with Gaussian radial basis functions}, 20977 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 20978 journal = {SIAM Journal on Scientific Computing}, 20979 volume = {33}, 20980 number = {2}, 20981 pages = {869--892}, 20982 year = {2011}, 20983 publisher = {SIAM} 20984} 20985 20986@InProceedings{ srinivasanqiduraiswami2010, 20987 title = {GPUML: Graphical processors for speeding up kernel machines}, 20988 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 20989 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 20990 Implementations, and Applications}, 20991 year = {2010} 20992} 20993 20994@Article{ jadamecbillen2010, 20995 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 20996 a slab edge}, 20997 author = {Margarete A Jadamec and Magali I Billen}, 20998 journal = {Nature}, 20999 volume = {465}, 21000 number = {7296}, 21001 pages = {338--341}, 21002 year = {2010} 21003} 21004 21005@Article{ jadamecbillen2012, 21006 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 21007 numerical models of the Alaska slab edge}, 21008 author = {Margarete A Jadamec and Magali I Billen}, 21009 journal = {Journal of Geophysical Research: Solid Earth}, 21010 volume = {117}, 21011 number = {B2}, 21012 year = {2012} 21013} 21014 21015@Article{ jadamec2015, 21016 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 21017 author = {Margarete A Jadamec}, 21018 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 21019 volume = {211}, 21020 pages = {135}, 21021 year = {2015} 21022} 21023 21024@Article{ durancejadamecfalloonnicholls2012, 21025 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 21026 olivine-hosted melt inclusions and geochemical modelling with insights from 21027 geodynamic models}, 21028 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 21029 journal = {Australian Journal of Earth Sciences}, 21030 volume = {59}, 21031 number = {6}, 21032 pages = {913--931}, 21033 year = {2012} 21034} 21035 21036@Article{ sharplesmoresijadamecrevote2015, 21037 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 21038 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 21039 journal = {Journal of Geophysical Research: Solid Earth}, 21040 volume = {120}, 21041 number = {6}, 21042 pages = {4379--4404}, 21043 year = {2015} 21044} 21045 21046@Article{ hayniejadamec2017, 21047 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 21048 geodynamic models}, 21049 author = {Kirstie L Haynie and Margarete A Jadamec}, 21050 journal = {Tectonics}, 21051 note = {in review}, 21052 year = {2017} 21053} 21054 21055@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 21056 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 21057 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 21058 Lithgow-Bertelloni and Wenbo Xu}, 21059 journal = {Geophysical Journal International}, 21060 volume = {179}, 21061 number = {2}, 21062 pages = {1169--1185}, 21063 year = {2009} 21064} 21065 21066@Article{ zhong2006, 21067 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 21068 plume excess temperature, and upper mantle temperature}, 21069 author = {Shijie Zhong}, 21070 journal = {Journal of Geophysical Research: Solid Earth}, 21071 volume = {111}, 21072 number = {B4}, 21073 year = {2006} 21074} 21075 21076@Article{ billenhirth2007, 21077 title = {Rheologic controls on slab dynamics}, 21078 author = {Magali I Billen and Greg Hirth}, 21079 journal = {Geochemistry, Geophysics, Geosystems}, 21080 volume = {8}, 21081 number = {8}, 21082 year = {2007} 21083} 21084 21085@Article{ hirthkohlstedt2003, 21086 title = {Rheology of the upper mantle and the mantle wedge: A view from the 21087 experimentalists}, 21088 author = {Greg Hirth and David Kohlstedt}, 21089 journal = {Inside the subduction Factory}, 21090 pages = {83--105}, 21091 year = {2003} 21092} 21093 21094@Article{ longsilver2008, 21095 title = {The subduction zone flow field from seismic anisotropy: A global view}, 21096 author = {Maureen D Long and Paul G Silver}, 21097 journal = {science}, 21098 volume = {319}, 21099 number = {5861}, 21100 pages = {315--318}, 21101 year = {2008} 21102} 21103 21104@Article{ karatowu1993, 21105 title = {Rheology of the upper mantle: A synthesis}, 21106 author = {Shun-ichiro Karato and Patrick Wu}, 21107 journal = {Science}, 21108 volume = {260}, 21109 number = {5109}, 21110 pages = {771--778}, 21111 year = {1993} 21112} 21113 21114@Article{ long2013mantle, 21115 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 21116 for wedge processes}, 21117 author = {Long, Maureen D and Wirth, Erin A}, 21118 journal = {Journal of Geophysical Research: Solid Earth}, 21119 volume = {118}, 21120 number = {2}, 21121 pages = {583--606}, 21122 year = {2013}, 21123 publisher = {Wiley Online Library} 21124} 21125 21126@Article{ hoernle2008arc, 21127 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 21128 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 21129 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 21130 Alvarado, Guillermo and Protti, Marino and others}, 21131 journal = {Nature}, 21132 volume = {451}, 21133 number = {7182}, 21134 pages = {1094--1097}, 21135 year = {2008}, 21136 publisher = {Nature Publishing Group} 21137} 21138 21139@Article{ savage1999, 21140 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 21141 splitting?}, 21142 author = {MK Savage}, 21143 journal = {Reviews of Geophysics}, 21144 volume = {37}, 21145 number = {1}, 21146 pages = {65--106}, 21147 year = {1999} 21148} 21149 21150@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 21151 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 21152 of airborne contaminants}, 21153 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 21154 Omar Ghattas and Bart Van Bloemen Waanders}, 21155 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 21156 pages = {43}, 21157 year = {2005}, 21158 organization = {IEEE Computer Society} 21159} 21160 21161@Article{ draganescusoane2013, 21162 title = {Multigrid solution of a distributed optimal control problem constrained by the 21163 {Stokes} equations}, 21164 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 21165 journal = {Applied Mathematics and Computation}, 21166 volume = {219}, 21167 number = {10}, 21168 pages = {5622--5634}, 21169 year = {2013} 21170} 21171 21172@Article{ zhonggurnis1995, 21173 title = {Mantle convection with plates and mobile, faulted plate margins}, 21174 author = {Shijie Zhong and Michael Gurnis}, 21175 journal = {Science}, 21176 volume = {267}, 21177 number = {5199}, 21178 pages = {838}, 21179 year = {1995} 21180} 21181 21182@Article{ studerbobinchahidmousavicandesdahan2012, 21183 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 21184 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 21185 and Emmanuel Candes and Maxime Dahan}, 21186 journal = {Proceedings of the National Academy of Sciences}, 21187 volume = {109}, 21188 number = {26}, 21189 pages = {E1679--E1687}, 21190 year = {2012} 21191} 21192 21193@Article{ borsukhigdonstowreckhow2001, 21194 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 21195 matter loading in estuaries and coastal zones}, 21196 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 21197 journal = {Ecological Modelling}, 21198 volume = {143}, 21199 number = {3}, 21200 pages = {165--181}, 21201 year = {2001} 21202} 21203 21204@Article{ liebermanwillcox2012, 21205 title = {Goal-oriented inference: Approach, linear theory, and application to advection 21206 diffusion}, 21207 author = {Chad Lieberman and Karen Willcox}, 21208 journal = {SIAM Journal on Scientific Computing}, 21209 volume = {34}, 21210 number = {4}, 21211 pages = {A1880--A1904}, 21212 year = {2012} 21213} 21214 21215@Article{ chaillatbiros2012, 21216 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 21217 frequencies and multiple sources for the scalar {Helmholtz} equation}, 21218 author = {St{\'e}phanie Chaillat and George Biros}, 21219 journal = {Journal of Computational Physics}, 21220 volume = {231}, 21221 number = {12}, 21222 pages = {4403--4421}, 21223 year = {2012} 21224} 21225 21226@Article{ farhattezaurdjellouli2002, 21227 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 21228 problems by a regularized {Newton} method}, 21229 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 21230 journal = {Inverse problems}, 21231 volume = {18}, 21232 number = {5}, 21233 pages = {1229}, 21234 year = {2002} 21235} 21236 21237@Article{ orozcoghattas1992, 21238 title = {Massively parallel aerodynamic shape optimization}, 21239 author = {Orozco, Carlos E and Ghattas, ON}, 21240 journal = {Computing Systems in Engineering}, 21241 volume = {3}, 21242 number = {1-4}, 21243 pages = {311--320}, 21244 year = {1992} 21245} 21246 21247@Article{ reutheralonsorimlingerjameson1999, 21248 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 21249 adjoint formulation on distributed memory parallel computers}, 21250 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 21251 journal = {Computers \& fluids}, 21252 volume = {28}, 21253 number = {4}, 21254 pages = {675--700}, 21255 year = {1999} 21256} 21257 21258@Article{ rudistadlerghattas2016, 21259 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 21260 Heterogeneous Viscosity}, 21261 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 21262 journal = {ArXiv e-prints}, 21263 archiveprefix = {arXiv}, 21264 primaryclass = {math.NA}, 21265 eprint = {1607.03936}, 21266 month = jul, 21267 year = {2016} 21268} 21269 21270@Article{ borzikunisch2006, 21271 title = {A globalization strategy for the multigrid solution of elliptic optimal control 21272 problems}, 21273 author = {Borzi, A and Kunisch, K}, 21274 journal = {Optimisation Methods and Software}, 21275 volume = {21}, 21276 number = {3}, 21277 pages = {445--459}, 21278 year = {2006} 21279} 21280 21281@Article{ nash2000, 21282 title = {A multigrid approach to discretized optimization problems}, 21283 author = {Stephen G Nash}, 21284 journal = {Optimization Methods and Software}, 21285 volume = {14}, 21286 number = {1-2}, 21287 pages = {99--116}, 21288 year = {2000} 21289} 21290 21291@Article{ jameson1983, 21292 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 21293 method}, 21294 author = {Antony Jameson}, 21295 journal = {Applied mathematics and computation}, 21296 volume = {13}, 21297 number = {3-4}, 21298 pages = {327--355}, 21299 year = {1983} 21300} 21301 21302@Article{ billen2008, 21303 title = {Modeling the dynamics of subducting slabs}, 21304 author = {Magali I Billen}, 21305 journal = {Annu. Rev. Earth Planet. Sci.}, 21306 volume = {36}, 21307 pages = {325--356}, 21308 year = {2008} 21309} 21310 21311@Article{ gerya2011, 21312 title = {Future directions in subduction modeling}, 21313 author = {Taras Gerya}, 21314 journal = {Journal of Geodynamics}, 21315 volume = {52}, 21316 number = {5}, 21317 pages = {344--378}, 21318 year = {2011} 21319} 21320 21321@Article{ tackley2000, 21322 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 21323 theory}, 21324 author = {Paul J Tackley}, 21325 journal = {Science}, 21326 volume = {288}, 21327 number = {5473}, 21328 pages = {2002--2007}, 21329 year = {2000} 21330} 21331 21332@Article{ caseydewey1984, 21333 title = {Initiation of subduction zones along transform and accreting plate boundaries, 21334 triple-junction evolution, and forearc spreading centres—implications for 21335 ophiolitic geology and obduction}, 21336 author = {JF Casey and JF Dewey}, 21337 journal = {Geological Society, London, Special Publications}, 21338 volume = {13}, 21339 number = {1}, 21340 pages = {269--290}, 21341 year = {1984} 21342} 21343 21344@Article{ doughertyclayton2014, 21345 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 21346 in the {South Cocos} plate}, 21347 author = {Sara L Dougherty and Robert W Clayton}, 21348 journal = {Journal of Geophysical Research: Solid Earth}, 21349 volume = {119}, 21350 number = {4}, 21351 pages = {3424--3447}, 21352 year = {2014} 21353} 21354 21355@Article{ syracusemaceiraprietozhangammon2016, 21356 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 21357 velocity from the joint inversion of seismic and gravity data}, 21358 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 21359 Charles J Ammon}, 21360 journal = {Earth and Planetary Science Letters}, 21361 volume = {444}, 21362 pages = {139--149}, 21363 year = {2016} 21364} 21365 21366@Article{ bowergurnisflament2015, 21367 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 21368 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 21369 journal = {Physics of the Earth and Planetary Interiors}, 21370 volume = {238}, 21371 pages = {8--22}, 21372 year = {2015} 21373} 21374 21375@Book{ ciarlet1976, 21376 title = {Numerical analysis of the finite element method}, 21377 author = {Philippe G Ciarlet}, 21378 volume = {59}, 21379 year = {1976}, 21380 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 21381} 21382 21383@InProceedings{ liumellorcrummey2013, 21384 title = {A data-centric profiler for parallel programs}, 21385 author = {Xu Liu and John Mellor-Crummey}, 21386 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 21387 Storage and Analysis (SC)}, 21388 pages = {1--12}, 21389 year = {2013}, 21390 organization = {IEEE} 21391} 21392 21393@InCollection{ ernstgander2012, 21394 title = {Why it is difficult to solve Helmholtz problems with classical iterative 21395 methods}, 21396 author = {Oliver G Ernst and Martin J Gander}, 21397 booktitle = {Numerical analysis of multiscale problems}, 21398 pages = {325--363}, 21399 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 21400 year = {2012} 21401} 21402 21403@Article{ warburtonkarniadakis1999, 21404 title = {A discontinuous Galerkin method for the viscous {MHD} equations}, 21405 author = {Timothy C Warburton and George E Karniadakis}, 21406 journal = {Journal of Computational Physics}, 21407 volume = {152}, 21408 number = {2}, 21409 pages = {608--641}, 21410 year = {1999} 21411} 21412 21413@Article{ salahsoulaimanihabashi2001, 21414 title = {A finite element method for magnetohydrodynamics}, 21415 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 21416 journal = {Computer Methods in Applied Mechanics and Engineering}, 21417 volume = {43}, 21418 number = {190}, 21419 pages = {5867--5892}, 21420 year = {2001} 21421} 21422 21423@Article{ nesliturktezersezgin2005, 21424 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 21425 author = {Ali I Nesliturk and M Tezer-Sezgin}, 21426 journal = {Computer methods in applied mechanics and engineering}, 21427 volume = {194}, 21428 number = {9}, 21429 pages = {1201--1224}, 21430 year = {2005} 21431} 21432 21433@Article{ strakschellart2016, 21434 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 21435 Upwellings: Insights from Analog Models}, 21436 author = {Vincent Strak and Wouter P Schellart}, 21437 journal = {Journal of Geophysical Research: Solid Earth}, 21438 year = {2016} 21439} 21440 21441@InBook{ kirbyloggrognesterrel2012, 21442 title = {Common and unusual finite elements}, 21443 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 21444 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 21445 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 21446 FEniCS Book}, 21447 publisher = {Springer Berlin Heidelberg}, 21448 address = {Berlin, Heidelberg}, 21449 pages = {95--119}, 21450 isbn = {978-3-642-23099-8}, 21451 doi = {10.1007/978-3-642-23099-8_3}, 21452 year = {2012} 21453} 21454 21455@InBook{ kirbymardal2012, 21456 author = {Robert C. Kirby and Kent-Andre Mardal}, 21457 title = {Constructing general reference finite elements}, 21458 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 21459 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 21460 FEniCS Book}, 21461 publisher = {Springer Berlin Heidelberg}, 21462 address = {Berlin, Heidelberg}, 21463 pages = {121--132}, 21464 isbn = {978-3-642-23099-8}, 21465 doi = {10.1007/978-3-642-23099-8_4}, 21466 year = {2012} 21467} 21468 21469@Book{ wriggers2008, 21470 title = {Nonlinear finite element methods}, 21471 author = {Peter Wriggers}, 21472 publisher = {Springer Science \& Business Media}, 21473 year = {2008} 21474} 21475 21476@Book{ zienkiewicztaylor1977, 21477 title = {The finite element method}, 21478 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 21479 publisher = {McGraw-hill London}, 21480 volume = {3}, 21481 year = {1977} 21482} 21483 21484@Article{ rogneskirbylogg2009, 21485 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 21486 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 21487 journal = {SIAM Journal on Scientific Computing}, 21488 volume = {31}, 21489 number = {6}, 21490 pages = {4130--4151}, 21491 year = {2009} 21492} 21493 21494@Book{ kelley03, 21495 title = {Solving nonlinear equations with Newton's method}, 21496 author = {Carl T. Kelley}, 21497 publisher = {SIAM}, 21498 year = {2003} 21499} 21500 21501@Article{ turing1937, 21502 title = {The Chemical Basis of Morphogenesis}, 21503 author = {A. M. Turing}, 21504 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 21505 volume = {237}, 21506 number = {641}, 21507 pages = {37--72}, 21508 doi = {10.1098/rstb.1952.0012}, 21509 issn = {0080-4622}, 21510 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 21511 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 21512 year = {1952} 21513} 21514 21515@Article{ fabienknepleymillsriviere2017, 21516 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 21517 multigrid method}, 21518 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 21519 Rivi\`ere}, 21520 journal = {SIAM Journal on Scientific Computing}, 21521 url = {https://arxiv.org/abs/1705.09907}, 21522 volume = {41}, 21523 number = {2}, 21524 pages = {C73--C96}, 21525 doi = {10.1137/17M1128903}, 21526 year = {2018} 21527} 21528 21529@Article{ fabienknepleyriviere2018, 21530 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 21531 porous media}, 21532 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 21533 journal = {International Journal for Numerical Methods in Engineering}, 21534 doi = {10.1002/nme.5919}, 21535 year = {2018} 21536} 21537 21538@Article{ fabienknepleyriviere2020, 21539 title = {A high order hybridizable discontinuous Galerkin method for incompressible 21540 miscible displacement in heterogeneous media}, 21541 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 21542 journal = {Results in Applied Mathematics}, 21543 url = {https://arxiv.org/abs/1809.00747}, 21544 volume = {8}, 21545 doi = {10.1016/j.rinam.2019.100089}, 21546 year = {2020} 21547} 21548 21549@Article{ fabienknepleyriviere2019b, 21550 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 21551 second order elliptic problems}, 21552 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 21553 journal = {Journal of Numerical Mathematics}, 21554 doi = {10.1515/jnma-2019-0027}, 21555 year = {2019} 21556} 21557 21558@Article{ fabien2019, 21559 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 21560 Elasticity}, 21561 author = {Maurice S. Fabien}, 21562 journal = {Communications in Computational Physics}, 21563 volume = {27}, 21564 number = {2}, 21565 pages = {513--545}, 21566 issn = {1991-7120}, 21567 doi = {10.4208/cicp.OA-2018-0235}, 21568 year = {2019} 21569} 21570 21571@Unpublished{ awanoufabienguzmanstern2020, 21572 title = {Hybridization and postprocessing in finite element exterior calculus}, 21573 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 21574 eprint = {2008.00149}, 21575 note = {preprint}, 21576 primaryclass = {math.NA}, 21577 year = {2020} 21578} 21579 21580@Article{ chaabanegiraultrivierethompson2018, 21581 title = {A stable enriched Galerkin element for the Stokes problem}, 21582 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 21583 journal = {Applied Numerical Mathematics}, 21584 volume = {132}, 21585 pages = {1--21}, 21586 issn = {0168-9274}, 21587 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 21588 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 21589 year = {2018} 21590} 21591 21592@Article{ thompsonriviereknepley2018, 21593 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 21594 Resuscitation In The Small Intestine}, 21595 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 21596 journal = {Mathematical Medicine and Biology}, 21597 doi = {10.1093/imammb/dqz00}, 21598 year = {2019} 21599} 21600 21601@Article{ kevrekidisthompsongoriely2020, 21602 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 21603 Diseases}, 21604 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 21605 journal = {Physics Letters A}, 21606 volume = {384}, 21607 number = {36}, 21608 pages = {126935}, 21609 year = {2020} 21610} 21611 21612@Article{ mardalrognesthompson2021, 21613 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 21614 {Stokes-Biot} Stability Revisited}, 21615 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 21616 journal = {BIT Numerical Mathematics}, 21617 pages = {1--36}, 21618 year = {2021} 21619} 21620 21621@Article{ piersantileethompsonmardalrognes2021, 21622 title = {Parameter robust preconditioning by congruence for multiple-network 21623 poroelasticity}, 21624 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 21625 Rognes, Marie E}, 21626 journal = {SIAM Journal on Scientific Computing}, 21627 volume = {43}, 21628 number = {4}, 21629 pages = {B984--B1007}, 21630 year = {2021}, 21631 publisher = {SIAM} 21632} 21633 21634@InProceedings{ actorfuentesriviere2020b, 21635 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 21636 Level Set Equation and Deep Learning for Image Segmentation}, 21637 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 21638 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 21639 year = {2020} 21640} 21641 21642@Article{ actorfuentesriviere2020, 21643 title = {Robust Regularized Networks in the Presence of Noise}, 21644 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 21645 journal = {Medical Image Analysis}, 21646 note = {In revision}, 21647 year = {2020} 21648} 21649 21650@Book{ byerly1893, 21651 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 21652 ellipsoidal harmonics, with applications to problems in mathematical physics}, 21653 author = {William Elwood Byerly}, 21654 publisher = {Dover}, 21655 year = {1893} 21656} 21657 21658@Book{ hobson1931, 21659 title = {The theory of spherical and ellipsoidal harmonics}, 21660 author = {Ernest William Hobson}, 21661 year = {1931}, 21662 publisher = {CUP Archive} 21663} 21664 21665@Book{ dassios2012, 21666 title = {Ellipsoidal harmonics: theory and applications}, 21667 author = {George Dassios}, 21668 volume = {146}, 21669 year = {2012}, 21670 publisher = {Cambridge University Press} 21671} 21672 21673@Book{ miller1977, 21674 title = {Symmetry and separation of variables}, 21675 author = {Miller, Jr, Willard}, 21676 year = {1977}, 21677 address = {Reading, MA}, 21678 publisher = {Addison-Wesley Publishing Co., Inc.} 21679} 21680 21681@TechReport{ epanet-users-manual, 21682 author = {Lewis A. Rossman}, 21683 title = {{EPANET 2} Users Manual}, 21684 institution = {Water Supply and Water Resources Division, National Risk Management Research 21685 Laboratory, Cincinnati, OH 45268}, 21686 year = {2000} 21687} 21688 21689@Article{ klocknerbarnettgreengardoneil2013, 21690 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 21691 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 21692 O'Neil}, 21693 journal = {Journal of Computational Physics}, 21694 volume = {252}, 21695 pages = {332--349}, 21696 year = {2013} 21697} 21698 21699@Article{ turcksinkronbichlerbangerth2016, 21700 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 21701 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 21702 journal = {ACM Transactions on Mathematical Software)}, 21703 volume = {43}, 21704 number = {1}, 21705 pages = {2}, 21706 year = {2016} 21707} 21708 21709@Article{ vitushkin1954, 21710 title = {On {Hilbert's} thirteenth problem}, 21711 author = {A. G. Vitushkin}, 21712 journal = {Dokl. Akad. Nauk SSSR}, 21713 volume = {95}, 21714 pages = {701--704}, 21715 year = {1954} 21716} 21717 21718@Article{ kolmogorov1957, 21719 title = {On the representation of continuous functions of several variables as 21720 superpositions of continuous functions of one variable and addition}, 21721 author = {Andrei N. Kolmogorov}, 21722 journal = {Dokl. Akad. Nauk SSSR}, 21723 pages = {953--956}, 21724 volume = {114:5}, 21725 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 21726 year = {1957} 21727} 21728 21729@Article{ fridman1967, 21730 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 21731 Theorem}}, 21732 author = {B. L. Fridman}, 21733 journal = {Dokl. Akad. Nauk SSR}, 21734 volume = {177:5}, 21735 pages = {1019--1022}, 21736 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 21737 year = {1967} 21738} 21739 21740@Article{ sprecher1972, 21741 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 21742 author = {David Sprecher}, 21743 journal = {Journal of Mathematical Analysis and Applications}, 21744 volume = {38}, 21745 pages = {208--213}, 21746 year = {1972} 21747} 21748 21749@Article{ diaconisshahshahani1984, 21750 title = {On nonlinear functions of linear combinations}, 21751 author = {Persi Diaconis and Mehrdad Shahshahani}, 21752 journal = {SIAM Journal on Scientific and Statistical Computing}, 21753 volume = {5}, 21754 number = {1}, 21755 pages = {175--191}, 21756 year = {1984}, 21757 publisher = {SIAM} 21758} 21759 21760@InProceedings{ hechtnielsen1987, 21761 title = {Kolmogorov's mapping neural network existence theorem}, 21762 author = {R. Hecht-Nielsen}, 21763 booktitle = {Proceedings of the International Conference on Neural Networks}, 21764 volume = {III}, 21765 pages = {11--14}, 21766 publisher = {IEEE Press}, 21767 year = {1987} 21768} 21769 21770@InProceedings{ hechtnielsen1989, 21771 title = {Theory of the back-propagation neural network}, 21772 author = {R. Hecht-Nielsen}, 21773 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 21774 volume = {I}, 21775 pages = {593--608}, 21776 publisher = {IEEE Press}, 21777 year = {1989} 21778} 21779 21780@Article{ girosipoggio1989, 21781 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 21782 author = {Federico Girosi and Tomaso Poggio}, 21783 journal = {Neural Computation}, 21784 volume = {1}, 21785 number = {4}, 21786 pages = {465--469}, 21787 year = {1989}, 21788 publisher = {MIT Press} 21789} 21790 21791@InBook{ koppen2002, 21792 title = {On the Training of a Kolmogorov Network}, 21793 author = {Mario K\"oppen}, 21794 pages = {474--9}, 21795 publisher = {ICANN 2002, LNCS 2415}, 21796 year = {2002} 21797} 21798 21799@PhDThesis{ bryant2008, 21800 title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in 21801 applications with low and high dimensional data}, 21802 author = {Donald W Bryant}, 21803 school = {University of Central Florida}, 21804 year = {2008} 21805} 21806 21807@InCollection{ griebel2006, 21808 title = {Sparse Grids for Higher Dimensional Problems}, 21809 author = {Michael Griebel}, 21810 booktitle = {Foundations of Computational Mathematics}, 21811 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 21812 publisher = {Cambridge University Press}, 21813 pages = {106--161}, 21814 doi = {10.1017/CBO9780511721571.004}, 21815 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 21816 month = jun, 21817 day = {29}, 21818 year = {2006} 21819} 21820 21821@Article{ braungriebel2009, 21822 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 21823 author = {Jurgen Bra\"un and Michael Griebel}, 21824 journal = {Constructive Approximation}, 21825 pages = {653--675}, 21826 volume = {30}, 21827 year = {2009} 21828} 21829 21830@InProceedings{ lenifougerolletruchetet2009, 21831 title = {Kolmogorov superposition theorem and its application to wavelet image 21832 decompositions}, 21833 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 21834 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 21835 of the SPIE}, 21836 pages = {724804--724804}, 21837 doi = {10.1117/12.805916}, 21838 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 21839 year = {2009} 21840} 21841 21842@Article{ oseledets2011, 21843 title = {Tensor-train decomposition}, 21844 author = {Ivan V Oseledets}, 21845 journal = {SIAM Journal on Scientific Computing}, 21846 volume = {33}, 21847 number = {5}, 21848 pages = {2295--2317}, 21849 year = {2011} 21850} 21851 21852@PhDThesis{ liu2015, 21853 title = {Kolmogorov superposition theorem and its applications}, 21854 author = {Xing Liu}, 21855 school = {Imperial College London}, 21856 year = {2015} 21857} 21858 21859@Article{ lecunbengiohinton2015, 21860 title = {Deep learning}, 21861 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 21862 journal = {Nature}, 21863 volume = {521}, 21864 number = {7553}, 21865 pages = {436--444}, 21866 year = {2015} 21867} 21868 21869@Book{ trefethen2013, 21870 title = {Approximation theory and approximation practice}, 21871 author = {Lloyd N Trefethen}, 21872 publisher = {SIAM}, 21873 year = {2013} 21874} 21875 21876@Article{ butlergrahammattiswalsh2017, 21877 title = {A measure-theoretic interpretation of sample based numerical integration with 21878 applications to inverse and prediction problems under uncertainty}, 21879 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 21880 journal = {SIAM Journal on Scientific Computing}, 21881 volume = {39}, 21882 number = {5}, 21883 pages = {A2072--A2098}, 21884 year = {2017} 21885} 21886 21887@Article{ logg2009, 21888 title = {Efficient representation of computational meshes}, 21889 author = {Anders Logg}, 21890 journal = {International Journal of Computational Science and Engineering}, 21891 volume = {4}, 21892 number = {4}, 21893 pages = {283--295}, 21894 year = {2009} 21895} 21896 21897@Article{ agelekandersonbangerthbarth2017, 21898 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 21899 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 21900 journal = {ACM Transactions on Mathematical Software (TOMS)}, 21901 volume = {44}, 21902 number = {1}, 21903 pages = {5}, 21904 year = {2017} 21905} 21906 21907@Article{ actorknepley2018, 21908 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 21909 Superposition Theorem}}, 21910 author = {Jonas Actor and Matthew G. Knepley}, 21911 journal = {SIAM Journal on Numerical Analysis}, 21912 note = {In review}, 21913 url = {}, 21914 year = {2018} 21915} 21916 21917@Book{ driscollhaletrefethen2014, 21918 title = {Chebfun guide}, 21919 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 21920 publisher = {Pafnuty Publications, Oxford}, 21921 year = {2014} 21922} 21923 21924@Article{ johntobiska2000, 21925 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 21926 solution of the incompressible Navier-Stokes equations}, 21927 author = {Volker John and Lutz Tobiska}, 21928 journal = {International Journal for Numerical Methods in Fluids}, 21929 volume = {33}, 21930 number = {4}, 21931 pages = {453--473}, 21932 year = {2000} 21933} 21934 21935@Article{ vanka1986, 21936 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 21937 author = {S. P. Vanka}, 21938 journal = {Computer Methods in Applied Mechanics and Engineering}, 21939 volume = {59}, 21940 number = {1}, 21941 pages = {29--48}, 21942 year = {1986} 21943} 21944 21945@Article{ bartelgunther2018, 21946 author = {Andreas Bartel and Michael G\"unther}, 21947 title = {{PDAEs} in refined electrical network modeling}, 21948 journal = {SIAM Review}, 21949 volume = {60}, 21950 number = {1}, 21951 pages = {56--91}, 21952 doi = {10.1137/17M1113643}, 21953 year = {2018} 21954} 21955 21956@Article{ matpower, 21957 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 21958 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 21959 systems research and education}, 21960 journal = {IEEE Transactions on Power Systems}, 21961 volume = {26}, 21962 number = {1}, 21963 pages = {12--19}, 21964 year = {2011}, 21965 doi = {10.1109/TPWRS.2010.2051168} 21966} 21967 21968@Article{ betrieyan2018, 21969 author = {G. Betrie and E. Yan}, 21970 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 21971 Energy and Water Nexus}, 21972 journal = {Applied Energy, Submitted}, 21973 volume = {}, 21974 number = {}, 21975 pages = {}, 21976 doi = {}, 21977 year = {2018} 21978} 21979 21980@Article{ faeth2012, 21981 author = {P. Faeth}, 21982 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 21983 journal = {Environment: Science and Policy for Sustainable Development}, 21984 volume = {54(1)}, 21985 number = {1}, 21986 pages = {4--19}, 21987 year = {2012}, 21988 doi = {10.1080/00139157.2012.639595} 21989} 21990 21991@InProceedings{ hagberg2008, 21992 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 21993 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 21994 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 21995 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 21996 year = {2008}, 21997 pages = {11--15} 21998} 21999 22000@Misc{ simulink-web-page, 22001 author = {Mathworks}, 22002 title = {{SIMULINK} web page}, 22003 note = {\url{https://www.mathworks.com/products/simulink.html}}, 22004 year = {2017} 22005} 22006 22007@Misc{ labview-web-page, 22008 author = {National Instruments}, 22009 title = {{LabVIEW} web page}, 22010 note = {\url{http://www.ni.com/labview/}}, 22011 key = {labview}, 22012 year = {2017} 22013} 22014 22015@Misc{ modelica-web-page, 22016 author = {Modelica Association}, 22017 title = {Modelica web page}, 22018 note = {\url{https://www.modelica.org/}}, 22019 year = {2017} 22020} 22021 22022@InProceedings{ yangsc16, 22023 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 22024 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 22025 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 22026 Computing, Networking, Storage and Analysis}, 22027 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 22028 Dynamics}, 22029 note = {Gordon Bell Award}, 22030 year = {2016} 22031} 22032 22033@InProceedings{ bekassc15, 22034 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 22035 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 22036 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 22037 Computing, Networking, Storage and Analysis}, 22038 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 22039 Earth's Mantle}, 22040 note = {Gordon Bell Award}, 22041 year = {2015} 22042} 22043 22044@Misc{ improving-software-whitepaper2017, 22045 author = {M. Heroux and L.C. McInnes}, 22046 title = {Improving and accelerating scientific discovery through better software}, 22047 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 22048 doi = {10.6084/m9.figshare.5339692}, 22049 year = {2017} 22050} 22051 22052@Misc{ doe:40thanniversarycollection, 22053 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 22054 changed the face of science}, 22055 key = {Department of Energy, Office of Science}, 22056 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 22057 year = {2017} 22058} 22059 22060@Misc{ siam:fellowsprogram, 22061 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 22062 key = {SIAM}, 22063 howpublished = {\url{http://www.siam.org/prizes/fellows}} 22064} 22065 22066@Misc{ r-and-d100:awards2009, 22067 title = {{R\&D100 Award Winners 2009}}, 22068 key = {{R\&D100 Award Winners 2009}}, 22069 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 22070} 22071 22072@Misc{ xsdk:website, 22073 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 22074 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 22075 howpublished = {\url{https://xsdk.info}} 22076} 22077 22078@Misc{ xsdk-community-installation-policies2017, 22079 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 22080 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 22081 note = {version 0.3, November 7, 2017}, 22082 doi = {10.6084/m9.figshare.4495133}, 22083 year = {2017} 22084} 22085 22086@Misc{ xsdk-community-package-policies2017, 22087 title = {{xSDK} Community Package Policies}, 22088 author = {B. Smith and R. Bartlett and {xSDK developers}}, 22089 note = {version 0.3, November 7, 2017}, 22090 doi = {10.6084/m9.figshare.4495136}, 22091 year = {2017} 22092} 22093 22094@Misc{ ideas-what-are-interoperable-libraries, 22095 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 22096 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 22097 Ulrike Yang and {all xSDK developers}}, 22098 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 22099 \url{https://ideas-productivity.org/resources/howtos/}}, 22100 year = {2016} 22101} 22102 22103@Misc{ ideas-productivity:website, 22104 title = {{IDEAS Scientific Software Productivity Project}}, 22105 key = {IDEAS Scientific Software Productivity Project}, 22106 howpublished = {\url{https://ideas-productivity.org}} 22107} 22108 22109@Misc{ ecp:website, 22110 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 22111 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 22112 note = {\url{https://exascaleproject.org}}, 22113 year = {2018} 22114} 22115 22116@Misc{ siam-cse-jan2018, 22117 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 22118 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 22119 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 22120 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 22121 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 22122 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 22123 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 22124 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 22125 title = {Research and Education in Computational Science and Engineering}, 22126 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 22127 Review}}, 22128 year = {2018} 22129} 22130 22131@Misc{ doe-appliedmathpimeeting2017, 22132 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 22133 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 22134 Willcox and Steven Lee}, 22135 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 22136 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 22137 year = {2017} 22138} 22139 22140@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 22141 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 22142 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 22143 Sciences}}, 22144 note = {available via 22145 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 22146 year = {2015} 22147} 22148 22149@Misc{ sisc-specialissueintro, 22150 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 22151 Software'} and {'Big Data in CSE'}}, 22152 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 22153 month = nov, 22154 year = {2016}, 22155 journal = {SIAM J. Sci. Comput.}, 22156 doi = {10.1137/16N974188} 22157} 22158 22159@Article{ xsdk-foundations2017, 22160 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 22161 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 22162 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 22163 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 22164 journal = {Supercomputing Frontiers and Innovations}, 22165 month = feb, 22166 year = {2017}, 22167 note = {available via \url{https://arxiv.org/abs/1702.08425}} 22168} 22169 22170@Misc{ deal.ii:website, 22171 title = {{{deal.II}: An open-source finite element library}}, 22172 author = {Wolfgang Bangerth and others}, 22173 howpublished = {\url{http://www.dealii.org}}, 22174 year = {2018} 22175} 22176 22177@Misc{ fission-gas-scidac:website, 22178 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 22179 author = {A. David {Andersson (PI)}}, 22180 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 22181 year = {2018} 22182} 22183 22184@Misc{ tokamak-disruption-scidac:project, 22185 title = {{Tokamak Disruption Simulation}}, 22186 author = {Xianzhu {Tang (PI)}}, 22187 howpublished = {SciDAC project}, 22188 year = {2018} 22189} 22190 22191@InProceedings{ duplyakin2018memory, 22192 title = {Evaluating Active Learning with Cost and Memory Awareness}, 22193 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 22194 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 22195 pages = {214--223}, 22196 year = {2018}, 22197 organization = {IEEE}, 22198 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 22199} 22200 22201@InProceedings{ duplyakin2016active, 22202 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 22203 title = {Active Learning in Performance Analysis}, 22204 booktitle = {Proceedings of the IEEE Cluster Conference}, 22205 year = {2016}, 22206 month = sep, 22207 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 22208 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 22209} 22210 22211@Misc{ xgc1:website, 22212 title = {{XGC1 project website}}, 22213 author = {C. S. Chang and others}, 22214 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 22215 year = {2018} 22216} 22217 22218@Misc{ wdmapp-bhattacharjee-ecp:website, 22219 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 22220 Plasmas}}, 22221 author = {A. Bhattacharjee and others}, 22222 note = {ECP application project}, 22223 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 22224 year = {2018} 22225} 22226 22227@Misc{ subsurface-steefel-ecp:website, 22228 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 22229 and Mechanics}}, 22230 note = {ECP application project}, 22231 author = {C. Steefel and others}, 22232 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 22233 year = {2018} 22234} 22235 22236@Article{ chombo-crunch:2014, 22237 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 22238 with Carbon Sequestration}, 22239 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 22240 journal = {Computing in Science and Engineering}, 22241 volume = {16}, 22242 issue = {6}, 22243 year = {2014}, 22244 pages = {22--31}, 22245 doi = {10.1109/MCSE.2014.77} 22246} 22247 22248@Article{ courantfriedrichslewy1967, 22249 title = {On the partial difference equations of mathematical physics}, 22250 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 22251 journal = {IBM journal of Research and Development}, 22252 volume = {11}, 22253 number = {2}, 22254 pages = {215--234}, 22255 year = {1967}, 22256 publisher = {IBM} 22257} 22258 22259@Article{ erway2017solving, 22260 title = {On solving large-scale limited-memory quasi-Newton equations}, 22261 author = {Erway, Jennifer B and Marcia, Roummel F}, 22262 journal = {Linear Algebra and its Applications}, 22263 volume = {515}, 22264 pages = {196--225}, 22265 year = {2017}, 22266 publisher = {Elsevier} 22267} 22268 22269@Article{ griewank2012broyden, 22270 title = {Broyden updating, the good and the bad!}, 22271 author = {Griewank, Andreas}, 22272 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 22273 pages = {301--315}, 22274 year = {2012} 22275} 22276 22277@Book{ tarantola2005, 22278 title = {Inverse problem theory and methods for model parameter estimation}, 22279 author = {Albert Tarantola}, 22280 volume = {89}, 22281 year = {2005}, 22282 publisher = {SIAM} 22283} 22284 22285@Article{ rutkaikristof2010, 22286 title = {Dynamic Monte Carlo simulation in mixtures}, 22287 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 22288 journal = {The Journal of Chemical Physics}, 22289 volume = {132}, 22290 number = {10}, 22291 pages = {104107}, 22292 year = {2010}, 22293 publisher = {AIP} 22294} 22295 22296@Book{ vogel2002, 22297 title = {Computational methods for inverse problems}, 22298 author = {Curtis R Vogel}, 22299 volume = {23}, 22300 year = {2002}, 22301 publisher = {SIAM} 22302} 22303 22304@Article{ malqvistpeterseim2014, 22305 title = {Localization of elliptic multiscale problems}, 22306 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 22307 journal = {Mathematics of Computation}, 22308 volume = {83}, 22309 number = {290}, 22310 pages = {2583--2603}, 22311 year = {2014} 22312} 22313 22314@Article{ brandtbrannickkahllivshits2011, 22315 title = {Bootstrap {AMG}}, 22316 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 22317 journal = {SIAM Journal on Scientific Computing}, 22318 volume = {33}, 22319 number = {2}, 22320 pages = {612--632}, 22321 year = {2011} 22322} 22323 22324@InProceedings{ barralalauzet2014, 22325 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 22326 moving mesh strategy}, 22327 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 22328 booktitle = {44th AIAA Fluid Dynamics Conference}, 22329 pages = {2773}, 22330 year = {2014} 22331} 22332 22333@InProceedings{ barralalauzetloseille2015, 22334 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 22335 problems involving moving geometries}, 22336 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 22337 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 22338 pages = {2039}, 22339 year = {2015} 22340} 22341 22342@Article{ barralolivieralauzet2017, 22343 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 22344 problems with body-fitted moving geometries}, 22345 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 22346 journal = {Journal of Computational Physics}, 22347 volume = {331}, 22348 pages = {157--187}, 22349 year = {2017} 22350} 22351 22352@Article{ ibanezbarralkrakosloseillemichalpark2017, 22353 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 22354 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 22355 Michal and Mike Park}, 22356 journal = {Procedia engineering}, 22357 volume = {203}, 22358 pages = {154--166}, 22359 year = {2017} 22360} 22361 22362@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 22363 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 22364 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 22365 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 22366 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 22367 pages = {1103}, 22368 year = {2018} 22369} 22370 22371@InProceedings{ barralangeloudiskramergormanpiggott2018, 22372 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 22373 modelling}, 22374 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 22375 and Matthew D Piggott}, 22376 booktitle = {EGU General Assembly Conference Abstracts}, 22377 volume = {20}, 22378 pages = {19168}, 22379 year = {2018} 22380} 22381 22382@Article{ principe2009, 22383 title = {{Mathematical models for thermally coupled low speed flows}}, 22384 author = {Javier Principe and Ramon Codina}, 22385 journal = {Advances in Theoretical and Applied Mechanics}, 22386 volume = {2}, 22387 number = {1-4}, 22388 pages = {93--112}, 22389 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 22390 year = {2009} 22391} 22392 22393@Book{ vandervorst2003, 22394 title = {Iterative {K}rylov Methods for Large Linear Systems}, 22395 author = {van der Vorst, H.}, 22396 isbn = {9780521818285}, 22397 publisher = {Cambridge University Press}, 22398 year = {2003} 22399} 22400 22401@Book{ peres2006, 22402 author = {Asher Peres}, 22403 title = {Quantum theory: concepts and methods}, 22404 volume = {57}, 22405 publisher = {Springer Science \& Business Media}, 22406 year = {2006} 22407} 22408 22409@Book{ kuttler2012, 22410 title = {Linear algebra: theory and applications}, 22411 author = {Kenneth Kuttler}, 22412 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 22413 year = {2012} 22414} 22415 22416@Book{ elman_silvester_wathen_2014, 22417 place = {Oxford}, 22418 title = {Finite elements and fast iterative solvers: with applications in incompressible 22419 fluid dynamics}, 22420 publisher = {Oxford University Press}, 22421 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 22422 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 22423 year = {2014} 22424} 22425 22426@Article{ alametal2007, 22427 title = {An evaluation of the ORNL Cray XT3}, 22428 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 22429 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 22430 journal = {International Journal of High Performance Computing Applications}, 22431 volume = {22}, 22432 number = {1}, 22433 pages = {52--80}, 22434 doi = {10.1177/1094342007085019}, 22435 year = {2007} 22436} 22437 22438@Article{ plazacarey2000, 22439 title = {Local refinement of simplicial grids based on the skeleton}, 22440 author = {Plaza, A. and Carey, Graham F.}, 22441 journal = {Applied Numerical Mathematics}, 22442 doi = {10.1016/S0168-9274(99)00022-7}, 22443 issn = {01689274}, 22444 volume = {32}, 22445 number = {2}, 22446 pages = {195--218}, 22447 year = {2000} 22448} 22449 22450@Article{ carsonstrakos2020, 22451 title = {On the cost of iterative computations}, 22452 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 22453 journal = {Phil. Trans. R. Soc. A}, 22454 volume = {378}, 22455 number = {20190050}, 22456 doi = {10.1098/rsta.2019.0050}, 22457 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 22458 year = {2020} 22459} 22460 22461@Article{ schoberl1999, 22462 title = {Multigrid methods for a parameter dependent problem in primal variables}, 22463 author = {Joachim Sch{\"o}berl}, 22464 journal = {Numerische Mathematik}, 22465 volume = {84}, 22466 number = {1}, 22467 pages = {97--119}, 22468 year = {1999} 22469} 22470 22471@Article{ wuleexuzikatanov2008, 22472 title = {Convergence analysis on iterative methods for semidefinite systems}, 22473 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 22474 journal = {Journal of Computational Mathematics}, 22475 pages = {797--815}, 22476 year = {2008} 22477} 22478 22479@Article{ maierrannacher2016, 22480 title = {Duality-based adaptivity in finite element discretization of heterogeneous 22481 multiscale problems}, 22482 author = {Maier, Matthias and Rannacher, Rolf}, 22483 journal = {Journal of Numerical Mathematics}, 22484 volume = {24}, 22485 number = {3}, 22486 pages = {167--187}, 22487 year = {2016} 22488} 22489 22490@Article{ maierrannacher2018, 22491 title = {A duality-based optimization approach for model adaptivity in heterogeneous 22492 multiscale problems}, 22493 author = {Maier, Matthias and Rannacher, Rolf}, 22494 journal = {Multiscale Modeling \& Simulation}, 22495 volume = {16}, 22496 number = {1}, 22497 pages = {412--428}, 22498 year = {2018} 22499} 22500 22501@Article{ margetismaierluskin2017, 22502 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 22503 metamaterial sheet}, 22504 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 22505 journal = {Studies in Applied Mathematics}, 22506 volume = {139}, 22507 number = {4}, 22508 pages = {599--625}, 22509 year = {2017} 22510} 22511 22512@Article{ maiermargetisluskin2017b, 22513 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 22514 approximation and validation}, 22515 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 22516 journal = {Journal of Computational Physics}, 22517 volume = {339}, 22518 pages = {126--145}, 22519 year = {2017} 22520} 22521 22522@Article{ maiermargetisluskin2018, 22523 title = {Generation of surface plasmon-polaritons by edge effects}, 22524 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 22525 journal = {Communications in Mathematical Sciences}, 22526 volume = {16}, 22527 number = {1}, 22528 pages = {77--95}, 22529 url = {http://arxiv.org/abs/1702.00848}, 22530 year = {2018} 22531} 22532 22533@Article{ maiermattheakiskaxirasluskinmargetis2018, 22534 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 22535 metamaterials}, 22536 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 22537 Mitchell and Margetis, Dionisios}, 22538 journal = {Physical Review B}, 22539 volume = {97}, 22540 number = {3}, 22541 pages = {035307}, 22542 year = {2018} 22543} 22544 22545@Article{ maiermattheakiskaxirasluskinmargetis2019, 22546 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 22547 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 22548 Mitchell and Margetis, Dionisios}, 22549 journal = {Proceedings of the Royal Society A}, 22550 volume = {475}, 22551 number = {2230}, 22552 pages = {20190220}, 22553 year = {2019} 22554} 22555 22556@Article{ maiermargetisluskin2020, 22557 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 22558 two scales}, 22559 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 22560 journal = {Physical Review B}, 22561 volume = {102}, 22562 number = {7}, 22563 pages = {075308}, 22564 year = {2020} 22565} 22566 22567@Article{ margetismaierstauberlowluskin2020, 22568 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 22569 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 22570 Luskin, Mitchell}, 22571 journal = {Journal of Physics A: Mathematical and Theoretical}, 22572 volume = {53}, 22573 number = {5}, 22574 pages = {055201}, 22575 year = {2020} 22576} 22577 22578@Article{ maiermargetismellet2020, 22579 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 22580 structures}, 22581 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 22582 journal = {Journal of Computational and Applied Mathematics}, 22583 volume = {377}, 22584 pages = {112909}, 22585 year = {2020} 22586} 22587 22588@Article{ maierkronbichler2021, 22589 title = {Efficient parallel 3D computation of the compressible Euler equations with an 22590 invariant-domain preserving second-order finite-element scheme}, 22591 author = {Maier, Matthias and Kronbichler, Martin}, 22592 journal = {ACM Transactions on Parallel Computing}, 22593 volume = {8}, 22594 number = {3}, 22595 pages = {1--30}, 22596 year = {2021} 22597} 22598 22599@Article{ guermondmaierpopovtomas2021, 22600 title = {Second-order invariant domain preserving approximation of the compressible 22601 Navier--Stokes equations}, 22602 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 22603 journal = {Computer Methods in Applied Mechanics and Engineering}, 22604 volume = {375}, 22605 pages = {113608}, 22606 year = {2021} 22607} 22608 22609@Article{ liliptonmaier2021, 22610 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 22611 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 22612 eprint = {2009.12166}, 22613 archiveprefix = {arXiv}, 22614 primaryclass = {phys.optics}, 22615 year = {2021} 22616} 22617 22618@Article{ songmaierluskin2020, 22619 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 22620 gradient-index graphene waveguides}, 22621 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 22622 journal = {Journal of Computational Physics}, 22623 volume = {423}, 22624 pages = {109871}, 22625 year = {2020} 22626} 22627 22628@Article{ songmaierluskin2019, 22629 title = {Adaptive finite element simulations of waveguide configurations involving 22630 parallel 2D material sheets}, 22631 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 22632 journal = {Computer Methods in Applied Mechanics and Engineering}, 22633 volume = {351}, 22634 pages = {20--34}, 22635 year = {2019} 22636} 22637 22638% 22639% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 22640% 22641% 22642@Unpublished{ rob1, 22643 author = {Rob Kunz}, 22644 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 22645 State University}, 22646 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 22647 sponsors = {U.S. Navy, NRC}, 22648 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 22649 simulations, including lake warming by power plants}, 22650 dates = {Oct 3 and 4, 2002}, 22651 email = {rfk@wt.arl.psu.edu} 22652} 22653 22654@Unpublished{ au1, 22655 author = {Feng Wang and William Appelbe}, 22656 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 22657 url = {http://www.vpac.org}, 22658 sponsors = { }, 22659 note = {Using PETSc for a Variety of Geophysical Simulations}, 22660 dates = {Nov 22, 2002} 22661} 22662 22663@Unpublished{ carl1, 22664 author = {Carl Sovinec}, 22665 institution = {Applied Physics, University of Wisconsin}, 22666 url = {http://nimrodteam.org}, 22667 sponsors = {DOE Office of Fusion Research}, 22668 note = {Investigating using PETSc for NIMROD}, 22669 dates = {Nov 21, 2002}, 22670 email = {sovinec@engr.wisc.edu} 22671} 22672 22673@Unpublished{ au1b, 22674 author = {Pablo Carrica and Robert Wilson}, 22675 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 22676 url = {http://}, 22677 sponsors = {Office of Naval Research}, 22678 note = {Using PETSc for a hydrodynamics of ships and submarines}, 22679 dates = {Sept, 2002}, 22680 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 22681} 22682 22683% ------------------- TAO References ---------------------- 22684@Article{ benson:2001:csp, 22685 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 22686 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 22687 journal = {{ACM} Transactions on Mathematical Software}, 22688 volume = {27}, 22689 number = {3}, 22690 month = sep, 22691 year = {2001}, 22692 pages = {361--376} 22693} 22694 22695@TechReport{ tao-user-ref-2000, 22696 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 22697 title = {{TAO} Users Manual}, 22698 year = {2000}, 22699 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 22700 number = {ANL/MCS-TM-242}, 22701 note = {See \url{http://www.mcs.anl.gov/tao}} 22702} 22703 22704% ------------------- Optimization References ---------------------- 22705@Book{ optguide93, 22706 title = {Optimization Software Guide}, 22707 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 22708 publisher = {SIAM Publications}, 22709 address = {Philadelphia}, 22710 year = {1993} 22711} 22712 22713@InProceedings{ more84, 22714 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 22715 Hillstrom}, 22716 title = {The {MINPACK} Project}, 22717 booktitle = {Sources and Development of Mathematical Software}, 22718 editor = {Wayne R. Cowell}, 22719 year = {1984}, 22720 pages = {88--111} 22721} 22722 22723@Article{ steihaug:83, 22724 author = {Trond Steihaug}, 22725 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 22726 journal = {SIAM J. Numer. Anal.}, 22727 volume = {20}, 22728 year = {1983}, 22729 pages = {626--637}, 22730 key = {steihaug92 ! trust_region} 22731} 22732 22733@TechReport{ minpack2test, 22734 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 22735 title = {The {MINPACK-2} Test Problem Collection}, 22736 institution = {Argonne National Laboratory}, 22737 year = {1991}, 22738 number = {ANL/MCS-TM-150}, 22739 key = {more91 ! MINPACK-2} 22740} 22741 22742@TechReport{ hohmann:94, 22743 author = {Andreas Hohmann}, 22744 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 22745 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 22746 year = {1994}, 22747 number = {SC-94-4}, 22748 key = {Hohmann94} 22749} 22750 22751@TechReport{ meza:94, 22752 author = {Juan C. Meza}, 22753 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 22754 institution = {Sandia National Laboratory}, 22755 year = {1994}, 22756 number = {SAND94-8225}, 22757 key = {Meza94} 22758} 22759 22760@Book{ nw99, 22761 author = {Jorge Nocedal and Stephen J. Wright}, 22762 title = {Numerical Optimization}, 22763 year = {1999}, 22764 publisher = {Springer-Verlag}, 22765 address = {New York} 22766} 22767 22768@Book{ dennis:83, 22769 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 22770 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 22771 publisher = {Prentice-Hall, Inc.}, 22772 address = {Englewood Cliffs, NJ}, 22773 year = {1983} 22774} 22775 22776@TechReport{ more:92, 22777 author = {Jorge J. Mor\'{e} and David Thuente}, 22778 title = {Line search algorithms with guaranteed sufficient decrease}, 22779 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 22780 year = {1992}, 22781 number = {MCS-P330-1092} 22782} 22783 22784@Article{ more-toraldo, 22785 author = {Jorge J. Mor\'e and G. Toraldo}, 22786 journal = {SIOPT}, 22787 pages = {93--113}, 22788 title = {On the solution of large quadratic programming problems with bound constraints}, 22789 volume = {1}, 22790 year = {1991} 22791} 22792 22793@Article{ byrd:1995:lma, 22794 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 22795 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 22796 journal = {SIAM Journal on Scientific Computing}, 22797 volume = {16}, 22798 number = {5}, 22799 pages = {1190--1208}, 22800 month = sep, 22801 year = {1995}, 22802 coden = {SJOCE3}, 22803 issn = {1064-8275 (print), 1095-7197 (electronic)}, 22804 mrclass = {90C30 (65K05)}, 22805 mrnumber = {96e:90039}, 22806 mrreviewer = {Henry Wolkowicz}, 22807 bibdate = {Fri Dec 4 16:17:35 MST 1998} 22808} 22809 22810@Article{ lin_c3, 22811 author = {C.-J. Lin and J. J. Mor\'e}, 22812 title = {Newton's method for large bound-constrained optimization problems}, 22813 year = {1999}, 22814 journal = {SIOPT}, 22815 volume = {9(4)}, 22816 pages = {1100--1127}, 22817 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 22818} 22819 22820@TechReport{ dolan2, 22821 author = {E. Dolan and J. J. Mor\'{e}}, 22822 title = {Benchmarking Optimization Software with Performance Profiles}, 22823 year = {2001}, 22824 month = jan, 22825 number = {ANL/MCS-P861-1200}, 22826 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 22827 address = {Argonne, IL}, 22828 url = {http://www.mcs.anl.gov/~more/cops/} 22829} 22830 22831@InProceedings{ owlqn, 22832 author = {Galen Andrew and Jianfeng Gao}, 22833 title = {Scalable training of L1-regularized log-linear models}, 22834 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 22835 pages = {33--40}, 22836 year = {2007} 22837} 22838 22839@Article{ bmrm, 22840 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 22841 title = {Bundle methods for regularized risk minimization}, 22842 year = {2010}, 22843 journal = {Journal of Machine Learning Research}, 22844 volume = {11}, 22845 pages = {311--365} 22846} 22847 22848% ------------------- Component Software References ---------------------- 22849@InProceedings{ cca99, 22850 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 22851 McInnes and S. Parker and B. Smolinski}, 22852 title = {Toward a Common Component Architecture for High-Performance Scientific 22853 Computing}, 22854 booktitle = {Proceedings of {High Performance Distributed Computing}}, 22855 pages = {115--124}, 22856 year = {1999}, 22857 note = {See \url{http://cca-forum.org}} 22858} 22859 22860@Book{ szyperski98, 22861 author = {Clemens Szyperski}, 22862 title = {Component Software: Beyond Object-Oriented Programming}, 22863 publisher = {ACM Press}, 22864 address = {New York}, 22865 year = {1998} 22866} 22867 22868@Article{ broy98, 22869 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 22870 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 22871 Stal and Clemens Szyperski}, 22872 title = {What Characterizes a (Software) Component?}, 22873 journal = {Software -- Concepts and Tools}, 22874 publisher = {Springer-Verlag}, 22875 year = {1998}, 22876 volume = {19}, 22877 pages = {49--56} 22878} 22879 22880@Article{ componentware:94, 22881 author = {Jon Udell}, 22882 title = {Componentware}, 22883 journal = {Byte}, 22884 volume = {may}, 22885 pages = {46--56}, 22886 year = {1994}, 22887 key = {Udell94 ! componentware} 22888} 22889 22890@Misc{ cca-web-page, 22891 author = {{Common Component Architecture Forum}}, 22892 note = {See \url{http://cca-forum.org}} 22893} 22894 22895% --------------- References for Tools Used by TAO Developers ----------------- 22896 22897% 22898% tohtml: Used to generate on-line TAO users manual and manual pages 22899% 22900@TechReport{ tohtml, 22901 author = {William Gropp}, 22902 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 22903 institution = {Argonne National Laboratory}, 22904 number = {ANL/MCS-TM-00}, 22905 month = jan, 22906 year = {1995}, 22907 key = {tohtml} 22908} 22909 22910% 22911% doctext: Used to generate tex version of TAO manual pages 22912% 22913@TechReport{ doctext, 22914 author = {William Gropp}, 22915 title = {Users Manual for doctext: Producing documentation from {C} source code}, 22916 institution = {Argonne National Laboratory}, 22917 number = {ANL/MCS-TM-00}, 22918 month = jan, 22919 year = {1995}, 22920 key = {doctext} 22921} 22922 22923% 22924% bfort: Used to generate TAO Fortran interface 22925% 22926@TechReport{ bfort, 22927 author = {William Gropp}, 22928 title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, 22929 institution = {Argonne National Laboratory}, 22930 number = {ANL/MCS-TM-208}, 22931 month = mar, 22932 year = {1995}, 22933 key = {doctext} 22934} 22935 22936% ------------------------- PETSc References ------------------------------ 22937@InProceedings{ petsc, 22938 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 22939 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 22940 Libraries}, 22941 booktitle = {Modern Software Tools in Scientific Computing}, 22942 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 22943 publisher = {Birkhauser Press}, 22944 pages = {163--202}, 22945 year = {1997} 22946} 22947 22948% ------------------------- Misc Other References ------------------------------ 22949@Misc{ indeps-web-page, 22950 title = {{InDEPS} {W}eb page}, 22951 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 22952 author = {et al. Robert Armstrong}, 22953 institution = {Sandia National Laboratory}, 22954 key = {{InDEPS} {W}eb page} 22955} 22956 22957@Misc{ pooma, 22958 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 22959 chitectures}, 22960 year = {1996}, 22961 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 22962 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 22963} 22964 22965@Misc{ isis++-web-page, 22966 title = {{ISIS++} {W}eb Page}, 22967 note = {See \url{http://ca.sandia.gov/isis}}, 22968 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 22969 institution = {Sandia National Laboratories} 22970} 22971 22972@Misc{ trilinos-web-page, 22973 title = {{Trilinos} {W}eb Page}, 22974 note = {See 22975 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 22976 author = {Mike Heroux et al.}, 22977 institution = {Sandia National Laboratories} 22978} 22979 22980@Misc{ alice-web-page, 22981 title = {{ALICE} {W}eb page}, 22982 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 22983 Argonne National Laboratory}, 22984 key = {{ALICE} {W}eb page} 22985} 22986 22987@Misc{ autodiff-webpage, 22988 author = {{Computational Differentiation Project}}, 22989 note = {See \url{http://www.mcs.anl.gov/autodiff}} 22990} 22991 22992@Misc{ coool-home-page, 22993 author = {Lydia Deng and Wences Gouveia and John Scales}, 22994 title = {{The CWP Object-Oriented Optimization Library}}, 22995 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 22996} 22997 22998@Misc{ rice-inversion-home-page, 22999 author = {Mark S. Gokenbach and William W. Symes}, 23000 title = {{The Hilbert Class Library}}, 23001 note = {See \url{http://www.trip.caam.rice.edu/}} 23002} 23003 23004@Misc{ opt++-home-page, 23005 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 23006 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 23007} 23008 23009@Article{ gockenbach:1999:ccl, 23010 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 23011 title = {C++ Classes for Linking Optimization with Complex Simulations}, 23012 journal = {{ACM} Transactions on Mathematical Software}, 23013 volume = {25}, 23014 number = {2}, 23015 month = jun, 23016 year = {1999}, 23017 pages = {191-212}, 23018 abstract = {The object-oriented programming paradigm can be used to overcome the 23019 incompatibilities between off-the-shelf optimization software and application 23020 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 23021 objects arising in optimization problems, such as vectors, linear operators, and 23022 so forth, as C++ classes, making it possible to write optimization code in a 23023 natural fashion, while allowing application software such as simulators to use the 23024 most convenient data structures and programming style. In spite of the poor 23025 reputation C++ has for runtime performance, the use of mixed-language programming 23026 allows performance equal to that achieved by standard Fortran packages, as 23027 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 23028 accepted = {April 1999}, 23029 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 23030} 23031 23032@Misc{ neos-guide, 23033 author = {{The Optimization Software Guide}}, 23034 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 23035} 23036 23037@Article{ boyd, 23038 title = {Distributed optimization and statistical learning via the alternating direction 23039 method of multipliers}, 23040 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 23041 Jonathan and others}, 23042 journal = {Foundations and Trends{\textregistered} in Machine learning}, 23043 volume = {3}, 23044 number = {1}, 23045 pages = {1-122}, 23046 year = {2011}, 23047 publisher = {Now Publishers, Inc.} 23048} 23049 23050@Misc{ :alertsys, 23051 title = {page{ALERT}}, 23052 organization = {Alert Systems, Inc}, 23053 address = {Madison, Wisconsin}, 23054 note = {http://www.alertsys.com/} 23055} 23056 23057@Manual{ :cmfortran, 23058 title = {{CM} {F}ortran Language Reference Manual}, 23059 organization = {Thinking Machines Corporation}, 23060 year = {1994}, 23061 address = {Cambridge, MA} 23062} 23063 23064@Manual{ :cmmd, 23065 title = {{CMMD} Reference Manual, Version 3.0}, 23066 organization = {Thinking Machines Corporation}, 23067 year = {1993}, 23068 address = {Cambridge, MA} 23069} 23070 23071@Manual{ :cmssl, 23072 title = {{CMSSL} for {CM} {F}ortran}, 23073 volume = {I}, 23074 organization = {Thinking Machines Corporation}, 23075 year = {1994}, 23076 address = {Cambridge, MA} 23077} 23078 23079@Misc{ :condor, 23080 author = {M. Livny}, 23081 title = {{PI}, The {Condor} Project, High Throughput Computing}, 23082 howpublished = {www.cs.wisc.edu/condor} 23083} 23084 23085@Manual{ :connection, 23086 title = {Connection Machine {CM}--5 Technical Summary}, 23087 organization = {Thinking Machines Corporation}, 23088 year = {1993}, 23089 address = {Cambridge, MA} 23090} 23091 23092@Manual{ :cplex, 23093 title = {{CPLEX} Optimizer}, 23094 organization = {ILOG CPLEX Division}, 23095 address = {889 Alder Avenue, Incline Village, Nevada}, 23096 note = {http://www.cplex.com/} 23097} 23098 23099@Manual{ :cplextm, 23100 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 23101 (Version 2.0)}, 23102 organization = {CPLEX Optimization Inc.}, 23103 year = {1992}, 23104 address = {Incline Village, Nevada} 23105} 23106 23107@Misc{ :fatcop, 23108 author = {M. C. Ferris}, 23109 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 23110 Solver}, 23111 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 23112} 23113 23114@Misc{ :metaneos, 23115 author = {S. J. Wright}, 23116 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 23117 howpublished = {www-unix.mcs.anl.gov/metaneos} 23118} 23119 23120@InCollection{ gropp.more:optimization, 23121 author = {W. Gropp and J. J. Mor\'e}, 23122 title = {Optimization environments and the {NEOS} Server}, 23123 booktitle = {Approximation Theory and Optimization}, 23124 pages = {167--182}, 23125 publisher = {Cambridge University Press}, 23126 year = {1997}, 23127 editor = {M. D. Buhmann and A. Iserles} 23128} 23129 23130@Article{ czyzyk.mesnier.ea:neos, 23131 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 23132 title = {The {NEOS} Server}, 23133 journal = {IEEE Journal on Computational Science and Engineering}, 23134 volume = {5}, 23135 year = {1998}, 23136 pages = {68--75} 23137} 23138 23139@Book{ :osl, 23140 title = {Handbook for {IBM OSL}}, 23141 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 23142 year = {1994}, 23143 publisher = {Boyd and Fraser}, 23144 address = {Danvers, Massachusetts} 23145} 23146 23147@Manual{ :pro-matlab, 23148 title = {{PRO}--{MATLAB} User's Guide}, 23149 organization = {The MathWorks, Inc.}, 23150 year = {1989}, 23151 address = {21 Eliot Street, South Natick, MA 01760} 23152} 23153 23154@Misc{ :prostate, 23155 key = {Biomedical}, 23156 title = {Biomedical Business International Newsletter}, 23157 howpublished = {pp. 72--75}, 23158 year = {1996} 23159} 23160 23161@Misc{ :sipcase, 23162 key = {Natural}, 23163 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 23164 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 23165} 23166 23167@Book{ aarts.korst:simulated, 23168 author = {E. Aarts and J. Korst}, 23169 title = {Simulated Annealing and Boltzman Machines}, 23170 year = {1990}, 23171 publisher = {John Wiley \& Sons}, 23172 address = {Chichester} 23173} 23174 23175@TechReport{ aarts.laarhoven.ea:local-search-based, 23176 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 23177 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 23178 institution = {Centre for Quantitative Methods}, 23179 year = {1991}, 23180 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 23181 number = {106}, 23182 type = {CQM-Not} 23183} 23184 23185@Article{ aashtiani.magnanti:equilibria, 23186 author = {H. Z. Aashtiani and T. L. Magnanti}, 23187 title = {Equilibria on a congested transportation network}, 23188 journal = {SIAM Journal on Algebraic and Discrete Methods}, 23189 volume = {2}, 23190 year = {1981}, 23191 pages = {213--226} 23192} 23193 23194@Article{ ablow.brigham:analog, 23195 author = {C. M. Ablow and G. Brigham}, 23196 title = {An Analog Solution of Programming Problems}, 23197 journal = {Operations Research}, 23198 year = {1955}, 23199 volume = {3}, 23200 pages = {388--394} 23201} 23202 23203@Article{ achuthan.grabowski.ea:optimal, 23204 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 23205 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 23206 journal = {Opsearch}, 23207 year = {1981}, 23208 volume = {18}, 23209 pages = {117--138} 23210} 23211 23212@Book{ adelman.robinson:income, 23213 author = {I. Adelman and S. Robinson}, 23214 title = {Income Distribution Policy in Developing Countries}, 23215 publisher = {Stanford University Press}, 23216 year = {1978}, 23217 address = {Stanford, California} 23218} 23219 23220@Article{ adler.resende.ea:implementation, 23221 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 23222 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 23223 journal = {Mathematical Programming}, 23224 year = {1989}, 23225 volume = {44}, 23226 pages = {297--336} 23227} 23228 23229@TechReport{ aeberhard.coomans.ea:comparison, 23230 author = {S. Aeberhard and D. Coomans and O. de Vel}, 23231 title = {Comparison of Classifiers in High Dimensional Settings}, 23232 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 23233 University of North Queensland}, 23234 year = {1992}, 23235 number = {92-02}, 23236 type = {Technical Report} 23237} 23238 23239@Article{ aganagic.cottle:constructive, 23240 author = {M. Aganagi\'{c} and R. W. Cottle}, 23241 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 23242 Minors}, 23243 journal = {Mathematical Programming}, 23244 year = {1987}, 23245 volume = {37}, 23246 pages = {223--231} 23247} 23248 23249@TechReport{ aganagic:iterative, 23250 author = {M. Aganagi\'{c}}, 23251 title = {Iterative Methods for the Linear Complementarity Problem}, 23252 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 23253 University}, 23254 year = {1978}, 23255 type = {SOL}, 23256 number = {78-10}, 23257 address = {Stanford, California} 23258} 23259 23260@Book{ ahlfors:complex, 23261 author = {L. V. Ahlfors}, 23262 title = {Complex Analysis}, 23263 publisher = {McGraw--Hill Book Company}, 23264 address = {New York}, 23265 series = {International Series in Pure and Applied Mathematics}, 23266 edition = {Second}, 23267 year = {1966} 23268} 23269 23270@Article{ ahn:solution, 23271 author = {B--H. Ahn}, 23272 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 23273 journal = {Journal of Optimization Theory and Applications}, 23274 year = {1981}, 23275 volume = {33}, 23276 pages = {175--185} 23277} 23278 23279@Article{ al-fahed.stavroulakis.ea:hard, 23280 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 23281 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 23282 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 23283 volume = {71}, 23284 year = {1991}, 23285 pages = {257--265} 23286} 23287 23288@Article{ al-fahed.stavroulakis.ea:linear, 23289 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 23290 title = {A linear complementarity approach to the frictionless gripper}, 23291 journal = {International Journal of Robotic Research}, 23292 volume = {11}, 23293 year = {1992}, 23294 pages = {112--122} 23295} 23296 23297@Article{ al-khayyal.falk:jointly, 23298 author = {F. A. Al--Khayyal and J. E. Falk}, 23299 title = {Jointly Constrained Biconvex Programming}, 23300 journal = {Mathematics of Operations Research}, 23301 year = {1983}, 23302 volume = {8}, 23303 pages = {273--286} 23304} 23305 23306@Article{ al-khayyal.kyparisis:finite, 23307 author = {F. A. Al--Khayyal and J. Kyparisis}, 23308 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 23309 Inequalities}, 23310 journal = {Journal of Optimization Theory and Applications}, 23311 year = {1991}, 23312 volume = {70}, 23313 pages = {319--332} 23314} 23315 23316@PhDThesis{ al-khayyal:biconvex, 23317 author = {F. A. Al--Khayyal}, 23318 title = {Biconvex Programming and Biconcave Minimization}, 23319 year = {1977}, 23320 school = {The George Washington University} 23321} 23322 23323@Article{ alart.curnier:mixed, 23324 author = {P. Alart and A. Curnier}, 23325 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 23326 solution methods}, 23327 journal = {Computer Methods in Applied Mechanics and Engineering}, 23328 volume = {92}, 23329 year = {1991}, 23330 pages = {353--375} 23331} 23332 23333@Misc{ alexander.kellog.ea:piecewise, 23334 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 23335 title = {Piecewise smooth continuation}, 23336 howpublished = {Manuscript}, 23337 year = {1979} 23338} 23339 23340@InCollection{ alexander.li.ea:piecewise, 23341 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 23342 title = {Piecewise smooth homotopies}, 23343 booktitle = {Homotopy Methods and Global Convergence}, 23344 pages = {1--14}, 23345 publisher = {Plenum Press}, 23346 year = {1983}, 23347 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 23348 address = {New York} 23349} 23350 23351@InCollection{ alexander:topological, 23352 author = {J.~C. Alexander}, 23353 title = {The topological theory of an embedding method}, 23354 booktitle = {Continuation Methods}, 23355 pages = {37--68}, 23356 publisher = {Academic Press}, 23357 year = {1978}, 23358 editor = {H. Wacker}, 23359 address = {New York} 23360} 23361 23362@Book{ allen:probability, 23363 author = {A. O. Allen}, 23364 title = {Probability, Statistics and Queueing Theory}, 23365 publisher = {Academic Press}, 23366 year = {1990}, 23367 address = {London}, 23368 edition = {Second} 23369} 23370 23371@Book{ allgower.georg:numerical, 23372 author = {E. L. Allgower and K. Georg}, 23373 title = {Numerical Continuation Methods, An Introduction}, 23374 publisher = {Springer-Verlag}, 23375 year = {1990}, 23376 address = {Berlin} 23377} 23378 23379@InProceedings{ allgower.georg:predictor-corrector, 23380 crossref = {bachem.grotschel.ea:mathematical}, 23381 author = {E. L. Allgower and K. Georg}, 23382 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 23383 Zero Points of Nonlinear Mappings}, 23384 pages = {15--56} 23385} 23386 23387@Article{ aluffi-pentini.parisi.ea:algorithm, 23388 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 23389 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 23390 Algorithm}, 23391 journal = {ACM Transactions on Mathematical Software}, 23392 year = {1988}, 23393 volume = {14}, 23394 pages = {366--380} 23395} 23396 23397@Article{ anandalingam.friesz:hierarchical, 23398 author = {G. Anandalingam and T. L. Friesz}, 23399 title = {Hierarchical Optimization: An Introduction}, 23400 journal = {Annals of Operations Research}, 23401 year = {1992}, 23402 volume = {34}, 23403 pages = {1--11} 23404} 23405 23406@Article{ anandalingam.white:solution, 23407 author = {G. Anandalingam and D. J. White}, 23408 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 23409 Functions}, 23410 journal = {IEEE Transactions on Automatic Control}, 23411 year = {1990}, 23412 volume = {35}, 23413 number = {10}, 23414 pages = {1170--1173} 23415} 23416 23417@Article{ andersen.andersen:presolving, 23418 author = {E. Andersen and K. Andersen}, 23419 title = {Presolving in Linear Programming}, 23420 year = {1995}, 23421 journal = {Mathematical Programming}, 23422 volume = {71}, 23423 pages = {221--245} 23424} 23425 23426@InProceedings{ andersen.ye:homogeneous, 23427 author = {E. Andersen and Y. Ye}, 23428 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 23429 Equality Constraints}, 23430 crossref = {ferris.pang:complementarity}, 23431 pages = {1--11} 23432} 23433 23434@Book{ anderson.bai.ea:lapack, 23435 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 23436 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 23437 Sorensen}, 23438 title = {{LAPACK} User's Guide}, 23439 publisher = {SIAM}, 23440 year = {1995}, 23441 address = {Philadelphia, Pennsylvania}, 23442 edition = {Second} 23443} 23444 23445@Article{ anderson.ferris:direct, 23446 author = {E. J. Anderson and M. C. Ferris}, 23447 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 23448 year = {2001}, 23449 journal = {SIAM Journal on Optimization, forthcoming}, 23450 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 23451 key = {55} 23452} 23453 23454@InProceedings{ anderson.ferris:genetic, 23455 author = {E. J. Anderson and M. C. Ferris}, 23456 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 23457 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 23458 Waterloo, Ontario, Canada, May 28--30}, 23459 publisher = {University of Waterloo Press}, 23460 key = {14}, 23461 year = {1990} 23462} 23463 23464@Article{ anderson.ferris:genetic*1, 23465 author = {E. J. Anderson and M. C. Ferris}, 23466 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 23467 Problem}, 23468 journal = {ORSA Journal on Computing}, 23469 year = {1994}, 23470 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 23471 volume = {6}, 23472 pages = {161--173}, 23473 key = {22} 23474} 23475 23476@InProceedings{ anderson.ferris:parallel, 23477 author = {E. J. Anderson and M. C. Ferris}, 23478 title = {Parallel Genetic Algorithms in Optimization}, 23479 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 23480 Computing, Chicago, Illinois, December 11-13}, 23481 year = {1989}, 23482 key = {12} 23483} 23484 23485@Unpublished{ anderson.lewis:primal, 23486 author = {E. J. Anderson and A. S. Lewis}, 23487 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 23488 note = {In preparation} 23489} 23490 23491@Book{ anderson.nash:linear, 23492 author = {E. J. Anderson and P. Nash}, 23493 title = {Linear Programming in Infinite--Dimensional Spaces}, 23494 year = {1987}, 23495 publisher = {John Wiley \& Sons}, 23496 address = {Chichester} 23497} 23498 23499@InProceedings{ anderson:primal, 23500 author = {E. J. Anderson}, 23501 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 23502 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 23503 Programming, Cambridge, September 1984}, 23504 year = {1985}, 23505 editor = {E. J. Anderson and A. B. Philpott}, 23506 publisher = {Springer-Verlag}, 23507 address = {Berlin} 23508} 23509 23510@Article{ andradottir:method, 23511 author = {S. Andrad\'{o}ttir}, 23512 title = {A Method of Discrete Stochastic Optimization}, 23513 journal = {Management Science}, 23514 year = {1995}, 23515 volume = {41}, 23516 pages = {1946--1961} 23517} 23518 23519@Article{ andradottir:global, 23520 author = {S. Andrad\'{o}ttir}, 23521 title = {A Global Search Method for Discrete Stochastic Optimization}, 23522 journal = {SIAM Journal on Optimization}, 23523 year = {1996}, 23524 volume = {6}, 23525 pages = {513--530} 23526} 23527 23528@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 23529 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 23530 title = {An infeasible--interior--point predictor--corrector algorithm for the 23531 {P}$_x$--geometric {LCP}}, 23532 institution = {Department of Mathematics, The University of Iowa}, 23533 address = {Iowa City, Iowa}, 23534 year = {1994}, 23535 number = {62}, 23536 type = {Reports on Computational Mathematics} 23537} 23538 23539@TechReport{ anitescu.potra:formulating, 23540 author = {M. Anitescu and F. A. Potra}, 23541 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 23542 Linear Complementarity Problems}, 23543 institution = {Department of Mathematics, The University of Iowa}, 23544 year = {1996}, 23545 type = {Report}, 23546 number = {93}, 23547 address = {Iowa City, Iowa} 23548} 23549 23550@Article{ anstreicher.lee.ea:crashing, 23551 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 23552 title = {Crashing a Maximum-Weight Complementarity Basis}, 23553 journal = {Mathematical Programming}, 23554 year = {1992}, 23555 volume = {54}, 23556 pages = {281--294} 23557} 23558 23559@Article{ anstreicher:combined, 23560 author = {K. M. Anstreicher}, 23561 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 23562 programming}, 23563 journal = {Mathematical Programming}, 23564 year = {1991}, 23565 volume = {52}, 23566 pages = {429--440} 23567} 23568 23569@Article{ anstreicher:combined*1, 23570 author = {K. M. Anstreicher}, 23571 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 23572 journal = {Mathematical Programming}, 23573 year = {1989}, 23574 volume = {43}, 23575 pages = {209--223} 23576} 23577 23578@InCollection{ arbenz.gander.ea:remote, 23579 author = {P. Arbenz and W. Gander and M. Oettli}, 23580 title = {The Remote Computational System}, 23581 booktitle = {High-Performance Computation and Networks}, 23582 publisher = {Springer-Verlag}, 23583 year = {1996}, 23584 volume = {1067}, 23585 series = {Lecture Notes in Computer Science}, 23586 pages = {662--667} 23587} 23588 23589@InCollection{ arcus:comsoal, 23590 author = {A. L. Arcus}, 23591 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 23592 booktitle = {Readings in Production and Operations Management}, 23593 year = {1966}, 23594 editor = {E. S. Buffa}, 23595 publisher = {John Wiley \& Sons}, 23596 address = {New York} 23597} 23598 23599@TechReport{ arioli.chan.ea:computing, 23600 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 23601 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 23602 Optimization Calculations}, 23603 institution = {CERFACS}, 23604 year = {1993}, 23605 number = {TR/PA/93/34} 23606} 23607 23608@Article{ armijo:minimization, 23609 author = {L. Armijo}, 23610 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 23611 Derivatives}, 23612 journal = {Pacific Journal of Mathematics}, 23613 year = {1966}, 23614 volume = {16}, 23615 pages = {1--3} 23616} 23617 23618@Article{ arrow.debreu:existence, 23619 author = {K. Arrow and G. Debreu}, 23620 title = {Existence of Equilibrium for a Competitive Economy}, 23621 journal = {Econometrica}, 23622 year = {1954}, 23623 volume = {22}, 23624 pages = {265--290} 23625} 23626 23627@InCollection{ arrow.solow:gradient, 23628 author = {K. J. Arrow and R. M. Solow}, 23629 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 23630 booktitle = {Studies in Linear and Nonlinear Programming}, 23631 year = {1958}, 23632 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 23633 publisher = {Stanford University Press}, 23634 address = {Stanford, California}, 23635 pages = {166--176} 23636} 23637 23638@Book{ aubin.ekeland:nonlinear, 23639 author = {J.-P. Aubin and I. Ekeland}, 23640 title = {Applied nonlinear analysis}, 23641 publisher = {John Wiley \& Sons}, 23642 address = {New York}, 23643 year = {1984} 23644} 23645 23646@Article{ auchmuty:variational, 23647 author = {G. Auchmuty}, 23648 title = {Variational Principles for Variational Inequalities}, 23649 journal = {Numerical Functional Analysis and Optimization}, 23650 year = {1989}, 23651 volume = {10}, 23652 pages = {863--874} 23653} 23654 23655@Book{ auerbach.kotlikoff:dynamic, 23656 author = {A. J. Auerbach and L. J. Kotlikoff}, 23657 title = {Dynamic Fiscal Policy}, 23658 publisher = {Cambridge University Press}, 23659 address = {Cambridge, England}, 23660 year = {1987} 23661} 23662 23663@InProceedings{ ault.deutsch.ea:interpolating, 23664 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 23665 title = {Interpolating Subspaces in Approximation Theory}, 23666 booktitle = {Approximation Theory}, 23667 year = {1970}, 23668 editor = {A. Talbot}, 23669 publisher = {Academic Press}, 23670 address = {London} 23671} 23672 23673@Article{ auslender.crouzeix:global, 23674 author = {A. A. Auslender and J.--P. Crouzeix}, 23675 title = {Global Regularity Theorems}, 23676 journal = {Mathematics of Operations Research}, 23677 year = {1988}, 23678 volume = {13}, 23679 pages = {243--253} 23680} 23681 23682@Article{ auslender.haddou:interior-proximal, 23683 author = {A. Auslender and M. Haddou}, 23684 title = {An interior-proximal method for convex linearly constrained problems and its 23685 extension to variational inequalities}, 23686 year = {1995}, 23687 journal = {Mathematical Programming}, 23688 pages = {77--100}, 23689 volume = {71} 23690} 23691 23692@Article{ auslender:convergence, 23693 author = {A. Auslender}, 23694 title = {Convergence of stationary sequences for variational inequalities with maximal 23695 monotone operators}, 23696 journal = {Applied Mathematics and Optimization}, 23697 volume = {28}, 23698 year = {1993}, 23699 pages = {161--172} 23700} 23701 23702@Book{ auslender:optimization, 23703 author = {A. Auslender}, 23704 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 23705 year = {1976}, 23706 publisher = {Masson}, 23707 address = {Paris} 23708} 23709 23710@TechReport{ averick.carter.ea:minpack-2, 23711 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 23712 title = {The {MINPACK-2} Test Problem Collection}, 23713 institution = {Argonne National Laboratory}, 23714 year = {1992}, 23715 address = {Argonne, Illinois}, 23716 number = {MCS-P153-0692} 23717} 23718 23719@TechReport{ axline.billups.ea:guidelines, 23720 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 23721 title = {Guidelines for Software Security ({U})}, 23722 institution = {SNL}, 23723 year = {1989}, 23724 month = oct, 23725 address = {Albuquerque, New Mexico}, 23726 number = {SAND88-2955} 23727} 23728 23729@Article{ ayres.walter:greenhouse, 23730 author = {R. U. Ayres and J. Walter}, 23731 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 23732 journal = {Environmental and Resource Economics}, 23733 year = {1991}, 23734 volume = {1}, 23735 pages = {237--270} 23736} 23737 23738@PhDThesis{ bagley:behaviour, 23739 author = {J. D. Bagley}, 23740 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 23741 Algorithms}, 23742 year = {1967}, 23743 school = {University of Michigan} 23744} 23745 23746@Article{ bain.stewart:application, 23747 author = {R. S. Bain and W. E. Stewart}, 23748 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 23749 Algebraic Equation Systems}, 23750 journal = {Computers in Chemical Engineering}, 23751 year = {1991}, 23752 volume = {15}, 23753 pages = {203--208} 23754} 23755 23756@Article{ baker.lasdon:successive, 23757 author = {T. E. Baker and L. S. Lasdon}, 23758 title = {Successive Linear Programming at {E}xxon}, 23759 journal = {Management Science}, 23760 year = {1985}, 23761 volume = {31}, 23762 pages = {264--274} 23763} 23764 23765@InProceedings{ baker:reducing, 23766 crossref = {grefenstette:genetic}, 23767 author = {J. E. Baker}, 23768 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 23769 pages = {14--21} 23770} 23771 23772@Article{ balas.zemel:algorithm, 23773 author = {E. Balas and E. Zemel}, 23774 title = {An Algorithm for Large Zero--One Knapsack Problems}, 23775 journal = {Operations Research}, 23776 year = {1980}, 23777 volume = {28}, 23778 pages = {1132--1154} 23779} 23780 23781@Book{ ballard.fullerton.ea:general, 23782 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 23783 title = {A General Equilibrium Model for Tax Policy Evaluation}, 23784 publisher = {The University of Chicago Press}, 23785 year = {1985}, 23786 series = {National Bureau of Economic Research Monograph} 23787} 23788 23789@InProceedings{ balog.angelos.ea:dose, 23790 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 23791 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 23792 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 23793 Radiation Therapy, Salt Lake City}, 23794 year = {1997}, 23795 editor = {D. D. Leavitt and G. Starkshall}, 23796 publisher = {Medical Physics Publishing}, 23797 address = {St. Louis, Missouri}, 23798 pages = {323--326} 23799} 23800 23801@Article{ baraff:fast, 23802 author = {D. Baraff}, 23803 title = {Fast contact force computation for nonpenetrating rigid bodies}, 23804 journal = {Computer Graphics (Proceedings SIGRAPH)}, 23805 year = {1994}, 23806 pages = {23--34}, 23807 volume = {28} 23808} 23809 23810@Article{ baraff:issues, 23811 author = {D. Baraff}, 23812 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 23813 journal = {Algorithmica}, 23814 volume = {10}, 23815 year = {1993}, 23816 pages = {292--352} 23817} 23818 23819@Book{ barrett.berry.ea:templates, 23820 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 23821 Methods}, 23822 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 23823 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 23824 year = {1994}, 23825 publisher = {SIAM}, 23826 address = {Philadelphia, Pennsylvania} 23827} 23828 23829@Article{ bard:algorithm, 23830 author = {J. F. Bard}, 23831 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 23832 journal = {Mathematics of Operations Research}, 23833 year = {1983}, 23834 volume = {8}, 23835 pages = {260--272} 23836} 23837 23838@Article{ bard:convex, 23839 author = {J. F. Bard}, 23840 title = {Convex Two-Level Optimization}, 23841 journal = {Mathematical Programming}, 23842 year = {1988}, 23843 volume = {40}, 23844 pages = {15--27} 23845} 23846 23847@InCollection{ bard:eclectic, 23848 author = {Y. Bard}, 23849 title = {An Eclectic Approach to Nonlinear Programming}, 23850 booktitle = {Optimization}, 23851 publisher = {University of Queensland Press}, 23852 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 23853 year = {1972}, 23854 address = {St. Lucia, Queensland, Australia}, 23855 pages = {116--128} 23856} 23857 23858@Article{ barnes:variation, 23859 author = {E. R. Barnes}, 23860 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 23861 journal = {Mathematical Programming}, 23862 year = {1986}, 23863 volume = {36}, 23864 pages = {174--182} 23865} 23866 23867@Article{ bartels.golub:simplex, 23868 author = {R. H. Bartels and G. H. Golub}, 23869 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 23870 journal = {Communications of the Asociation for Computing Machinery}, 23871 year = {1969}, 23872 volume = {12}, 23873 pages = {266--268} 23874} 23875 23876@Article{ barton.ivey:nelder, 23877 author = {R. Barton and J. S. Ivey}, 23878 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 23879 journal = {Management Science}, 23880 year = {1996}, 23881 volume = {42}, 23882 number = {7}, 23883 pages = {954--973} 23884} 23885 23886@Article{ battiti:first-, 23887 author = {R. Battiti}, 23888 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 23889 {N}ewton's Method}, 23890 journal = {Neural Computation}, 23891 year = {1992}, 23892 volume = {4}, 23893 pages = {141--166} 23894} 23895 23896@Article{ baudet:asynchronous, 23897 author = {G. M. Baudet}, 23898 title = {Asynchronous iterative methods for multiprocesors}, 23899 journal = {Journal of the Association for Computing Machinery}, 23900 year = {1978}, 23901 volume = {25}, 23902 pages = {226--244} 23903} 23904 23905@InProceedings{ baum.haussler:what, 23906 author = {E. B. Baum and D. Haussler}, 23907 title = {What Size Net Gives Valid Generalization}, 23908 booktitle = {Advances in Neural Information Processing Systems I}, 23909 year = {1989}, 23910 editor = {D. S. Touretzky}, 23911 publisher = {Morgan Kaufmann}, 23912 address = {San Mateo, California}, 23913 pages = {81--90} 23914} 23915 23916@Misc{ baum:private, 23917 author = {E. B. Baum}, 23918 title = {Private Communication}, 23919 year = {1992}, 23920 address = {NEC Research Institute, Princeton, New Jersey} 23921} 23922 23923@Book{ bazaraa.sherali.ea:nonlinear, 23924 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 23925 title = {Nonlinear Programming}, 23926 edition = {Second}, 23927 publisher = {John Wiley and Sons}, 23928 address = {New York}, 23929 year = {1993} 23930} 23931 23932@Book{ bazaraa.shetty:nonlinear, 23933 author = {M. S. Bazaraa and C. M. Shetty}, 23934 title = {Nonlinear Programming: Theory and Algorithms}, 23935 publisher = {John Wiley \& Sons}, 23936 year = {1979}, 23937 address = {New York, New York} 23938} 23939 23940@Article{ beale:cycling, 23941 author = {E. M. L. Beale}, 23942 title = {Cycling in the Dual Simplex Method}, 23943 journal = {Naval Research Logistics Quarterly}, 23944 year = {1955}, 23945 volume = {2}, 23946 pages = {103--107} 23947} 23948 23949@InProceedings{ becker.cun:improving, 23950 author = {S. Becker and Y. le Cun}, 23951 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 23952 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 23953 year = {1988}, 23954 editor = {D. S. Touretzky}, 23955 publisher = {Morgan Kaufmann}, 23956 address = {San Mateo, California}, 23957 pages = {29--37} 23958} 23959 23960@Book{ ben-israel.ben-tal.ea:optimality, 23961 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 23962 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 23963 year = {1981}, 23964 publisher = {John Wiley \& Sons}, 23965 address = {New York} 23966} 23967 23968@Article{ ben-israel:newton-raphson, 23969 author = {A. Ben--Israel}, 23970 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 23971 journal = {Journal of Mathematical Analysis and its Applications}, 23972 year = {1966}, 23973 volume = {15}, 23974 pages = {243--252} 23975} 23976 23977@Article{ ben-tal.melman.ea:curved, 23978 author = {A. Ben--Tal and A. Melman and J. Zowe}, 23979 title = {Curved Search Methods for Unconstrained Optimization}, 23980 journal = {Optimization}, 23981 year = {1990}, 23982 volume = {21}, 23983 pages = {669--695}, 23984 publisher = {John Wiley \& Sons}, 23985 address = {New York} 23986} 23987 23988@InProceedings{ bennett.ferris.ea:genetic, 23989 crossref = {belew.booker:fourth}, 23990 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 23991 title = {A Genetic Algorithm for Database Query Optimization}, 23992 pages = {400--407}, 23993 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 23994 key = {19} 23995} 23996 23997@Article{ bennett.mangasarian:bilinear, 23998 author = {K. P. Bennett and O. L. Mangasarian}, 23999 title = {Bilinear Separation of Two Sets in n-Space}, 24000 journal = {Computational Optimization and Applications}, 24001 year = {1993}, 24002 volume = {2}, 24003 pages = {207--227} 24004} 24005 24006@Article{ bennett.mangasarian:multicategory, 24007 author = {K. P. Bennett and O. L. Mangasarian}, 24008 title = {Multicategory Separation via Linear Programming}, 24009 journal = {Optimization Methods and Software}, 24010 year = {1993}, 24011 volume = {3}, 24012 pages = {27--39} 24013} 24014 24015@InProceedings{ bennett.mangasarian:neural, 24016 author = {K. P. Bennett and O. L. Mangasarian}, 24017 title = {Neural Network Training via Linear Programming}, 24018 booktitle = {Advances in Optimization and Parallel Computing}, 24019 year = {1992}, 24020 editor = {P. M. Pardalos}, 24021 publisher = {North Holland}, 24022 address = {Amsterdam}, 24023 pages = {56--67} 24024} 24025 24026@Article{ bennett.mangasarian:robust, 24027 author = {K. P. Bennett and O. L. Mangasarian}, 24028 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 24029 journal = {Optimization Methods and Software}, 24030 year = {1992}, 24031 volume = {1}, 24032 pages = {23--34} 24033} 24034 24035@Article{ bennett.mangasarian:serial, 24036 author = {K. P. Bennett and O. L. Mangasarian}, 24037 title = {Serial and Parallel Multicategory Separation}, 24038 journal = {SIAM Journal on Optimization}, 24039 year = {1994}, 24040 volume = {4}, 24041 pages = {722--734} 24042} 24043 24044@TechReport{ bennett.wu.ea:support, 24045 author = {K. P. Bennett and D. Wu and L. Auslender}, 24046 title = {On Support Vector Decision Trees for Database Marketing}, 24047 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 24048 year = {1998}, 24049 optkey = {}, 24050 opttype = {RPI Math Report}, 24051 optnumber = {98-100}, 24052 optaddress = {Troy, New York}, 24053 optmonth = {}, 24054 optnote = {}, 24055 optannote = {} 24056} 24057 24058@InProceedings{ bennett:decision, 24059 author = {K. P. Bennett}, 24060 title = {Decision Tree Construction Via Linear Programming}, 24061 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 24062 Society Conference}, 24063 year = {1992}, 24064 editor = {M. Evans}, 24065 address = {Utica, Illinois}, 24066 pages = {97--101} 24067} 24068 24069@Book{ berge.ghouila-houri:programming, 24070 author = {C. Berge and A. Ghouila-Houri}, 24071 title = {Programming, Games and Transportation Networks}, 24072 year = {1965}, 24073 publisher = {John Wiley \& Sons}, 24074 address = {New York} 24075} 24076 24077@Book{ berge:topological, 24078 author = {C. Berge}, 24079 title = {Topological Spaces}, 24080 year = {1963}, 24081 publisher = {McMillan}, 24082 address = {New York} 24083} 24084 24085@TechReport{ berkelaar.jansen.ea:basis, 24086 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 24087 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 24088 Complementarity Problems}, 24089 institution = {Department of Econometrics and Operations Research}, 24090 year = {1996}, 24091 address = {Erasmus University, Rotterdam, The Netherlands} 24092} 24093 24094@Article{ bertsekas.baz:distributed, 24095 author = {D. P. Bertsekas and D. El Baz}, 24096 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 24097 journal = {SIAM Journal on Control and Optimization}, 24098 year = {1987}, 24099 volume = {25}, 24100 pages = {74--85} 24101} 24102 24103@Article{ bertsekas.gafni:projection, 24104 author = {D. P. Bertsekas and E. M. Gafni}, 24105 title = {Projection Methods for Variational Inequalities with Application to the Traffic 24106 Assignment Problem}, 24107 journal = {Mathematical Programming Study}, 24108 year = {1982}, 24109 volume = {17}, 24110 pages = {139--159} 24111} 24112 24113@Article{ bertsekas.hossein.ea:relaxation, 24114 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 24115 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 24116 journal = {SIAM Journal on Control and Optimization}, 24117 year = {1987}, 24118 volume = {25}, 24119 pages = {1219--1243} 24120} 24121 24122@Unpublished{ bertsekas.tseng:partial, 24123 author = {D. P. Bertsekas and P. Tseng}, 24124 title = {Partial Proximal Minimization for Convex Programming}, 24125 year = {1991}, 24126 note = {Manuscript} 24127} 24128 24129@Article{ bertsekas.tsitsiklis:analysis, 24130 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 24131 title = {An Analysis of Stochastic Shortest Path Problems}, 24132 journal = {Mathematics of Operations Research}, 24133 year = {1991}, 24134 volume = {16}, 24135 pages = {580--595} 24136} 24137 24138@Book{ bertsekas.tsitsiklis:parallel, 24139 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 24140 title = {Parallel and Distributed Computation: Numerical Methods}, 24141 publisher = {Prentice-Hall, Inc}, 24142 year = {1989}, 24143 address = {Englewood Cliffs, New Jersey} 24144} 24145 24146@Book{ bertsekas:constrained, 24147 author = {D. P. Bertsekas}, 24148 title = {Constrained Optimization and Lagrange Multiplier Methods}, 24149 year = {1982}, 24150 publisher = {Academic Press}, 24151 address = {New York} 24152} 24153 24154@Book{ bertsekas:dynamic, 24155 author = {D. P. Bertsekas}, 24156 title = {Dynamic Programming and Optimal Control}, 24157 publisher = {Athena Scientific}, 24158 year = {1995}, 24159 address = {Belmont MA} 24160} 24161 24162@Article{ bertsekas:enlarging, 24163 author = {D. P. Bertsekas}, 24164 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 24165 Optimization}, 24166 journal = {Journal of Optimization Theory and Applications}, 24167 year = {1982}, 24168 volume = {36}, 24169 pages = {221--252} 24170} 24171 24172@Article{ bertsekas:goldstein-levitin-poljak, 24173 author = {D. P. Bertsekas}, 24174 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 24175 journal = {IEEE Transactions on Automatic Control}, 24176 year = {1976}, 24177 volume = {AC-21}, 24178 pages = {174--184} 24179} 24180 24181@Article{ bertsekas:multiplier, 24182 author = {D. P. Bertsekas}, 24183 title = {Multiplier Methods: {A} Survey}, 24184 journal = {Automatica}, 24185 year = {1976}, 24186 volume = {12}, 24187 pages = {133--145} 24188} 24189 24190@Article{ bertsekas:necessary, 24191 author = {D. P. Bertsekas}, 24192 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 24193 journal = {Mathematical Programming}, 24194 year = {1975}, 24195 volume = {9}, 24196 pages = {87--99} 24197} 24198 24199@Book{ bertsekas:nonlinear, 24200 author = {D. P. Bertsekas}, 24201 title = {Nonlinear Programming}, 24202 publisher = {Athena Scientific}, 24203 year = {1995}, 24204 address = {Belmont, Massachusetts} 24205} 24206 24207@Article{ bertsekas:projected, 24208 author = {Dimitri P. Bertsekas}, 24209 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 24210 journal = {SIAM Journal on Control and Optimization}, 24211 year = {1982}, 24212 volume = {20}, 24213 pages = {221--246} 24214} 24215 24216@Article{ billups.dirkse.ea:comparison, 24217 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 24218 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 24219 journal = {Computational Optimization and Applications}, 24220 year = {1997}, 24221 pages = {3--25}, 24222 volume = {7}, 24223 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 24224 key = {51} 24225} 24226 24227@Article{ billups.ferris:convergence, 24228 author = {S. C. Billups and M. C. Ferris}, 24229 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 24230 Starting Points}, 24231 journal = {SIAM Journal on Optimization}, 24232 year = {1996}, 24233 volume = {6}, 24234 pages = {316--325}, 24235 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 24236 key = {34} 24237} 24238 24239@TechReport{ billups.ferris:convergence*1, 24240 author = {S. C. Billups and M. C. Ferris}, 24241 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 24242 Points}, 24243 institution = {Computer Sciences Department, University of Wisconsin}, 24244 year = {1993}, 24245 address = {Madison, Wisconsin}, 24246 number = {1180}, 24247 note = {Revised version in SIAM Journal on Optimization.} 24248} 24249 24250@Article{ billups.ferris:qpcomp, 24251 author = {S. C. Billups and M. C. Ferris}, 24252 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 24253 year = {1997}, 24254 journal = {Mathematical Programming}, 24255 pages = {533--562}, 24256 volume = {76}, 24257 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 24258 key = {47} 24259} 24260 24261@Article{ billups.ferris:solutions, 24262 author = {S. C. Billups and M. C. Ferris}, 24263 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 24264 journal = {Mathematics of Operations Research}, 24265 volume = {24}, 24266 pages = {219--236}, 24267 year = {1999}, 24268 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 24269 key = {42}, 24270 institution = {Computer Sciences Department, University of Wisconsin}, 24271 address = {Madison, Wisconsin}, 24272 type = {Mathematical Programming Technical Report}, 24273 number = {94--15} 24274} 24275 24276@TechReport{ billups.murata.ea:users, 24277 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 24278 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 24279 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 24280 institution = {SNL}, 24281 year = {1994}, 24282 month = jan, 24283 address = {Albuquerque, New Mexico}, 24284 number = {SAND91--1482} 24285} 24286 24287@TechReport{ billups.speight.ea:nonmonotone, 24288 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 24289 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 24290 Problems}, 24291 institution = {Department of Mathematics, University of Colorado}, 24292 year = {1999}, 24293 address = {Denver, Colorado} 24294} 24295 24296@PhDThesis{ billups:algorithms, 24297 author = {S. C. Billups}, 24298 title = {Algorithms for Complementarity Problems and Generalized Equations}, 24299 school = {University of Wisconsin--Madison}, 24300 year = {1995}, 24301 address = {Madison, Wisconsin}, 24302 month = aug 24303} 24304 24305@MastersThesis{ billups:augmented, 24306 author = {S. C. Billups}, 24307 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 24308 school = {Virginia Tech}, 24309 year = {1985}, 24310 address = {Blacksburg, Virginia} 24311} 24312 24313@TechReport{ billups:homotopy, 24314 author = {S. C. Billups}, 24315 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 24316 institution = {Department of Mathematics, University of Colorado}, 24317 year = {1998}, 24318 address = {Denver, Colorado} 24319} 24320 24321@Article{ billups:improving, 24322 author = {S. C. Billups}, 24323 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 24324 Proximal Perturbations}, 24325 year = {2000}, 24326 journal = {Mathematical Programming}, 24327 volume = {87}, 24328 pages = {153--176} 24329} 24330 24331@Book{ birge.louveaux:introduction, 24332 author = {J. R. Birge and R. Louveaux}, 24333 title = {Introduction to Stochastic Programming}, 24334 publisher = {Springer}, 24335 address = {New York}, 24336 year = {1997} 24337} 24338 24339@TechReport{ bischof.carle.ea:adifor, 24340 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 24341 title = {{ADIFOR} 2.0 User's Guide}, 24342 institution = {Argonne National Laboratory}, 24343 year = {1995}, 24344 address = {Argonne, Illinois}, 24345 number = {ANL/MCS--TM--192}, 24346 type = {Mathematics and Computer Science Division Report} 24347} 24348 24349@Book{ bisschop.entriken:aimms, 24350 author = {J. Bisschop and R. Entriken}, 24351 title = {{AIMMS} -- The Modeling System}, 24352 year = {1993}, 24353 publisher = {Paragon Decision Technology}, 24354 address = {Haarlem, The Netherlands} 24355} 24356 24357@Article{ bisschop.meeraus:development, 24358 author = {J. Bisschop and A. Meeraus}, 24359 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 24360 Environment}, 24361 journal = {Mathematical Programming Study}, 24362 year = {1982}, 24363 volume = {20}, 24364 pages = {1--29} 24365} 24366 24367@Misc{ bixby.ceria.ea:miplib, 24368 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 24369 title = {{MIPLIB} 3.0}, 24370 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 24371} 24372 24373@InProceedings{ bjorkman.klarbring.ea:sequential, 24374 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 24375 Sj{\"{o}}din}, 24376 title = {Sequential quadratic programming for non-linear elastic contact problems}, 24377 editor = {J. Herskovits}, 24378 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 24379 Systems}, 24380 volume = {2}, 24381 year = {1993}, 24382 pages = {301--308} 24383} 24384 24385@Article{ bjorkman:path, 24386 author = {G. Bj{\"o}rkman}, 24387 title = {Path Following and Critical Points for Contact Problems}, 24388 journal = {Computational Mechanics}, 24389 volume = {10}, 24390 pages = {231--246}, 24391 year = {1992} 24392} 24393 24394@Article{ bjorkman:solution, 24395 author = {G. Bj{\"o}rkman}, 24396 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 24397 of Linear Complementarity Problems}, 24398 journal = {International Journal for Numerical Methods in Engineering}, 24399 volume = {31}, 24400 pages = {1553--1566}, 24401 year = {1991} 24402} 24403 24404@Article{ bland:pivot, 24405 author = {R. G. Bland}, 24406 title = {New Pivot Rules for the Simplex Method}, 24407 journal = {Mathematics of Operations Research}, 24408 year = {1977}, 24409 volume = {2}, 24410 pages = {103--107} 24411} 24412 24413@Article{ block.levin:boundedness, 24414 author = {H. D. Block and S. A. Levin}, 24415 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 24416 Inequalities}, 24417 journal = {Proceedings of the American Mathematical Society}, 24418 year = {1970}, 24419 volume = {26}, 24420 pages = {229--235} 24421} 24422 24423@Book{ bloomer:power, 24424 author = {J. Bloomer}, 24425 title = {Power Programming with {RPC}}, 24426 publisher = {O'Reilly and Associates, Inc.}, 24427 address = {Sebastopol, CA}, 24428 year = {1992} 24429} 24430 24431@InProceedings{ blum.rivest:training, 24432 author = {A. Blum and R. L. Rivest}, 24433 title = {Training a 3-Node Neural Network is {NP}-Complete}, 24434 booktitle = {Advances in Neural Information Processing Systems I}, 24435 year = {1989}, 24436 editor = {D. S. Touretzky}, 24437 publisher = {Morgan Kaufmann}, 24438 address = {San Mateo, California}, 24439 pages = {494--501} 24440} 24441 24442@InProceedings{ boehringer.ferris.ea:exemptions, 24443 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 24444 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 24445 from a General Equilibrium Model for Six {EU} Countries}, 24446 key = {49}, 24447 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 24448 year = {1995} 24449} 24450 24451@Article{ boender.kan:bayesian, 24452 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 24453 title = {Bayesian Stopping Rules for Global Optimization}, 24454 journal = {Mathematical Programming}, 24455 year = {1987}, 24456 volume = {37}, 24457 pages = {59--80} 24458} 24459 24460@Article{ boggs:convergence, 24461 author = {P. T. Boggs}, 24462 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 24463 Problems}, 24464 journal = {Mathematics of Computation}, 24465 year = {1976}, 24466 volume = {30}, 24467 pages = {512--522} 24468} 24469 24470@InProceedings{ bolzon.cochetti.ea:computing, 24471 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 24472 title = {On computing all solutions in decohesion}, 24473 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 24474 International Congress of Theoretical and Applied Mechanics}, 24475 year = {1996}, 24476 address = {Kyoto} 24477} 24478 24479@InProceedings{ bolzon.maier.ea:holonomic, 24480 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 24481 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 24482 study of mathematical programming approaches}, 24483 booktitle = {Fracture Mechanics of Concrete Structures}, 24484 editor = {F. H. Wittmann}, 24485 series = {Second International Conference on Fracture Mechanics of Concrete Structures 24486 (FRAMCOS 2)}, 24487 year = {1995}, 24488 publisher = {Aedificatio Publishers}, 24489 pages = {885--898} 24490} 24491 24492@InProceedings{ bolzon.maier.ea:holonomic*1, 24493 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 24494 title = {On holonomic structural analysis as a complementarity problem}, 24495 booktitle = {APCOM96, Seoul}, 24496 year = {1996} 24497} 24498 24499@Article{ bolzon.maier.ea:multiplicity, 24500 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 24501 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 24502 journal = {Computational Mechanics}, 24503 year = {1997}, 24504 volume = {19}, 24505 pages = {511--516} 24506} 24507 24508@Article{ bongartz.conn.ea:cute, 24509 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 24510 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 24511 year = {1995}, 24512 journal = {{ACM} Transactions on Mathematical Software}, 24513 volume = {21}, 24514 pages = {123--160} 24515} 24516 24517@Article{ boppana:eigenvalues, 24518 author = {R. Boppana}, 24519 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 24520 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 24521 pages = {280--285}, 24522 year = {1987} 24523} 24524 24525@Article{ bortfeld.kahler.ea:x-ray, 24526 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 24527 title = {{X}-ray field compensation with multileaf collimators}, 24528 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24529 year = {1994}, 24530 volume = {28}, 24531 number = {3}, 24532 pages = {723--730} 24533} 24534 24535@Article{ bortfeld.schlegel:optimization, 24536 author = {T. Bortfeld and W. Schlegel}, 24537 title = {Optimization of beam orientations in radiation therapy: some theoretical 24538 considerations}, 24539 journal = {Physics in Medicine and Biology}, 24540 year = {1993}, 24541 volume = {38}, 24542 number = {2}, 24543 pages = {291--304} 24544} 24545 24546@Article{ borwein:stability, 24547 author = {J. M. Borwein}, 24548 title = {Stability and regular points of inequality systems}, 24549 journal = {Journal of Optimization Theory and Applications}, 24550 year = {1986}, 24551 volume = {48}, 24552 pages = {9--52} 24553} 24554 24555@Article{ boyer:present, 24556 author = {A. L. Boyer}, 24557 title = {Present and Future Developments in Radiotherapy Treatment Units}, 24558 journal = {Seminars in Radiation Oncology}, 24559 year = {1995}, 24560 volume = {5}, 24561 number = {2}, 24562 pages = {146--155} 24563} 24564 24565@Article{ bracken.mcgill:mathematical, 24566 author = {J. Bracken and J. T. McGill}, 24567 title = {Mathematical programs with optimization problems in the constraints}, 24568 journal = {Operations Research}, 24569 volume = {21}, 24570 year = {1973}, 24571 pages = {37--44} 24572} 24573 24574@Article{ bradley.fayyad.ea:mathematical, 24575 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 24576 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 24577 journal = {INFORMS Journal on Computing}, 24578 year = {1999}, 24579 volume = {11}, 24580 pages = {217--238} 24581} 24582 24583@TechReport{ bradley.mangasarian.ea:clustering, 24584 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 24585 title = {Clustering via Concave Minimization}, 24586 institution = {Computer Sciences Department, University of Wisconsin}, 24587 year = {1996}, 24588 type = {Mathematical Programming Technical Report}, 24589 number = {96-03}, 24590 address = {Madison, Wisconsin} 24591} 24592 24593@TechReport{ bradley.mangasarian.ea:feature, 24594 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 24595 title = {Feature Selection via Mathematical Programming}, 24596 institution = {Computer Sciences Department, University of Wisconsin}, 24597 year = {1995}, 24598 type = {Mathematical Programming Technical Report}, 24599 number = {95-21}, 24600 address = {Madison, Wisconsin} 24601} 24602 24603@Article{ bradley.mangasarian:massive, 24604 author = {P. S. Bradley and O. L. Mangasarian}, 24605 title = {Massive Data Discrimination via Linear Support Vector Machines}, 24606 year = {2000}, 24607 journal = {Optimization Methods and Software}, 24608 volume = {13}, 24609 pages = {1-10} 24610} 24611 24612@PhDThesis{ brady:condition, 24613 author = {L. Brady}, 24614 title = {Condition Constants for Solutions of Convex Inequalities}, 24615 year = {1988}, 24616 address = {Madison, Wisconsin}, 24617 school = {Computer Sciences Department, University of Wisconsin} 24618} 24619 24620@Article{ braess:uber, 24621 author = {D. Braess}, 24622 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 24623 journal = {Unternehmensforschung}, 24624 year = {1968}, 24625 volume = {12}, 24626 pages = {258--268} 24627} 24628 24629@Article{ brahme:optimization, 24630 author = {A. Brahme}, 24631 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 24632 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24633 year = {1993}, 24634 volume = {25}, 24635 pages = {373--375} 24636} 24637 24638@Article{ brahme:stationary, 24639 author = {A. Brahme}, 24640 title = {Optimization of stationary and moving beam radiation therapy techniques}, 24641 journal = {Radiother. Oncol.}, 24642 year = {1988}, 24643 volume = {12}, 24644 pages = {129--140} 24645} 24646 24647@InCollection{ brahme:treatment, 24648 author = {A. Brahme}, 24649 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 24650 booktitle = {Radiation Therapy Physics}, 24651 publisher = {Springer-Verlag}, 24652 year = {1995}, 24653 editor = {A. R. Smith}, 24654 address = {Berlin}, 24655 pages = {209--246} 24656} 24657 24658@TechReport{ branch:getting, 24659 author = {M. A. Branch}, 24660 title = {Getting {CUTE} with {M}atlab}, 24661 institution = {Cornell University}, 24662 year = {1994}, 24663 type = {Cornell Theory Center Report}, 24664 number = {CTC94TR194}, 24665 address = {Ithaca, New York} 24666} 24667 24668@Article{ brearley.mitra.ea:analysis, 24669 author = {A. Brearley and G. Mitra and H. Williams}, 24670 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 24671 Algorithm}, 24672 journal = {Mathematical Programming}, 24673 year = {1975}, 24674 volume = {8}, 24675 pages = {54--83} 24676} 24677 24678@Article{ bredensteiner.bennett:feature, 24679 author = {E. Bredensteiner and K. Bennett}, 24680 title = {Feature Minimization within Decision Trees}, 24681 journal = {Computational Optimization and Applications}, 24682 year = {1998}, 24683 volume = {10}, 24684 pages = {111--126} 24685} 24686 24687@Article{ bregman:relaxation, 24688 author = {L. M. Bregman}, 24689 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 24690 Application to the Solution of Problems in Convex Programming}, 24691 journal = {USSR Computational Mathematics and Mathematical Physics}, 24692 year = {1967}, 24693 volume = {7}, 24694 pages = {200--217} 24695} 24696 24697@Book{ brenner.hall:making, 24698 author = {D. J. Brenner and E. J. Hall}, 24699 title = {Making the Radiation Therapy Decision}, 24700 publisher = {Contemporary Books}, 24701 year = {1996}, 24702 address = {Chicago, IL} 24703} 24704 24705@Book{ brent:algorithms, 24706 author = {R. P. Brent}, 24707 title = {Algorithms for Minimization without Derivatives}, 24708 publisher = {Prentice-Hall, Inc}, 24709 year = {1973}, 24710 address = {Englewood Cliffs, New Jersey} 24711} 24712 24713@Article{ brewster.mohan.ea:three, 24714 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 24715 title = {Three dimensional conformal treatment planning with multileaf collimators}, 24716 journal = {International Journal of Radiation Oncology, Biology and Physics}, 24717 year = {1995}, 24718 volume = {33}, 24719 number = {5}, 24720 pages = {1081--1089} 24721} 24722 24723@Article{ brezis.lions:produits, 24724 author = {H. Br\'{e}zis and P.--L. Lions}, 24725 title = {Produits Infinis de Resolvantes}, 24726 journal = {Israel Journal of Mathematics}, 24727 year = {1978}, 24728 volume = {29}, 24729 pages = {329--345} 24730} 24731 24732@Book{ brezis:operateurs, 24733 author = {H. Br\'{e}zis}, 24734 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 24735 Espaces de Hilbert}, 24736 publisher = {North-Holland}, 24737 address = {Amsterdam}, 24738 year = {1973} 24739} 24740 24741@Book{ brooke.kendrick.ea:gams, 24742 author = {A. Brooke and D. Kendrick and A. Meeraus}, 24743 title = {{GAMS}: {A} User's Guide}, 24744 year = {1988}, 24745 publisher = {The Scientific Press}, 24746 address = {South San Francisco, CA} 24747} 24748 24749@Article{ brown.demarzo.ea:computing, 24750 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 24751 title = {Computing Equilibria when Asset Markets Are Incomplete}, 24752 journal = {Econometrica}, 24753 year = {1996}, 24754 volume = {64}, 24755 pages = {1--28} 24756} 24757 24758@Article{ bruck:iterative, 24759 author = {R. E. Bruck}, 24760 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 24761 in {H}ilbert Space}, 24762 journal = {Bulletin of the American Mathematical Society}, 24763 year = {1975}, 24764 volume = {81}, 24765 pages = {890--892} 24766} 24767 24768@Article{ bunch.parlett:direct, 24769 author = {J. R. Bunch and B. N. Parlett}, 24770 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 24771 journal = {SIAM Journal on Numerical Analysis}, 24772 year = {1971}, 24773 volume = {8}, 24774 pages = {639--655} 24775} 24776 24777@Article{ burachik.iusem.ea:enlargement, 24778 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 24779 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 24780 year = {1997}, 24781 journal = {Set-Valued Analysis, forthcoming} 24782} 24783 24784@TechReport{ burachik.iusem:generalized, 24785 author = {R. S. Burachik and A. N. Iusem}, 24786 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 24787 Problem}, 24788 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 24789 year = {1995}, 24790 type = {Working Paper}, 24791 address = {Rio de Janeiro} 24792} 24793 24794@Article{ burachik.iusem:generalized*1, 24795 author = {R. S. Burachik and A. N. Iusem}, 24796 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 24797 {A} {H}ilbert Space}, 24798 year = {1998}, 24799 journal = {SIAM Journal on Optimization}, 24800 volume = {8}, 24801 pages = {197--216} 24802} 24803 24804@Article{ burdakov:globally, 24805 author = {O. P. Burdakov}, 24806 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 24807 of Nonlinear Equations}, 24808 journal = {Soviet Mathematics Doklady}, 24809 year = {1980}, 24810 volume = {22}, 24811 pages = {376--379} 24812} 24813 24814@Article{ burges:tutorial, 24815 author = {C. J. C. Burges}, 24816 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 24817 journal = {Data Mining and Knowledge Discovery}, 24818 volume = {2}, 24819 number = {2}, 24820 pages = {121-167}, 24821 year = {1998} 24822} 24823 24824@Article{ burke.ferris.ea:clarke, 24825 author = {J. V. Burke and M. C. Ferris and M. Qian}, 24826 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 24827 journal = {Journal of Mathematical Analysis and its Applications}, 24828 year = {1992}, 24829 volume = {166}, 24830 pages = {199--213}, 24831 key = {16} 24832} 24833 24834@Unpublished{ burke.ferris.ea:least, 24835 author = {J. V. Burke and M. C. Ferris and L. Qi}, 24836 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 24837 year = {1994}, 24838 month = mar, 24839 note = {Manuscript}, 24840 key = {999} 24841} 24842 24843@Article{ burke.ferris:characterization, 24844 author = {J. V. Burke and M. C. Ferris}, 24845 title = {Characterization of Solution Sets of Convex Programs}, 24846 journal = {Operations Research Letters}, 24847 year = {1991}, 24848 volume = {10}, 24849 pages = {57--60}, 24850 key = {10} 24851} 24852 24853@Article{ burke.ferris:gauss-newton, 24854 author = {J. V. Burke and M. C. Ferris}, 24855 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 24856 journal = {Mathematical Programming}, 24857 year = {1995}, 24858 volume = {71}, 24859 pages = {179--194}, 24860 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 24861 key = {32} 24862} 24863 24864@Article{ burke.ferris:weak, 24865 author = {J. V. Burke and M. C. Ferris}, 24866 title = {Weak Sharp Minima in Mathematical Programming}, 24867 journal = {SIAM Journal on Control and Optimization}, 24868 year = {1993}, 24869 volume = {31}, 24870 pages = {1340--1359}, 24871 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 24872 key = {23} 24873} 24874 24875@Article{ burke.more.ea:convergence, 24876 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 24877 title = {Convergence Properties of Trust Region Methods for Linear and Convex 24878 Constraints}, 24879 journal = {Mathematical Programming}, 24880 year = {1990}, 24881 volume = {47}, 24882 pages = {305--336} 24883} 24884 24885@Article{ burke.more:exposing, 24886 author = {J. V. Burke and J. J. Mor\'{e}}, 24887 title = {Exposing Constraints}, 24888 journal = {SIAM Journal on Optimization}, 24889 year = {1994}, 24890 volume = {4}, 24891 pages = {573--595} 24892} 24893 24894@Article{ burke.more:identification, 24895 author = {J. V. Burke and J. J. Mor\'{e}}, 24896 title = {On the Identification of Active Constraints}, 24897 journal = {SIAM Journal on Numerical Analysis}, 24898 year = {1988}, 24899 volume = {25}, 24900 pages = {1197--1211} 24901} 24902 24903@Article{ burke.poliquin:optimality, 24904 author = {J. V. Burke and R. A. Poliquin}, 24905 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 24906 journal = {Mathematical Programming}, 24907 year = {1992}, 24908 volume = {57}, 24909 pages = {103--120} 24910} 24911 24912@Article{ burke.tseng:unified, 24913 author = {J. V. Burke and P. Tseng}, 24914 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 24915 journal = {SIAM Journal on Optimization}, 24916 year = {1996}, 24917 volume = {6}, 24918 pages = {265--282} 24919} 24920 24921@Article{ burke.xu:global, 24922 author = {J. V. Burke and S. Xu}, 24923 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 24924 Linear Complementarity Problems}, 24925 year = {1998}, 24926 journal = {Mathematics of Operations Research}, 24927 volume = {23}, 24928 pages = {719--735} 24929} 24930 24931@TechReport{ burke:algorithms, 24932 author = {J. V. Burke}, 24933 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 24934 Inequalities that have both Global and Quadratic Convergence Properties}, 24935 institution = {Argonne National Laboratory}, 24936 year = {1985}, 24937 address = {Argonne, Illinois}, 24938 number = {ANL/MCS--TM--54}, 24939 type = {Mathematics and Computer Science Division Report} 24940} 24941 24942@Article{ burke:descent, 24943 author = {J. V. Burke}, 24944 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 24945 journal = {Mathematical Programming}, 24946 year = {1985}, 24947 volume = {33}, 24948 pages = {260--279} 24949} 24950 24951@Article{ burke:exact, 24952 author = {J. V. Burke}, 24953 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 24954 journal = {SIAM Journal on Control and Optimization}, 24955 year = {1991}, 24956 volume = {29}, 24957 pages = {968--998} 24958} 24959 24960@Article{ burke:identification, 24961 author = {J. V. Burke}, 24962 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 24963 journal = {SIAM Journal on Numerical Analysis}, 24964 year = {1990}, 24965 volume = {27}, 24966 pages = {1081--1102} 24967} 24968 24969@Article{ burke:robust, 24970 author = {J. V. Burke}, 24971 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 24972 journal = {SIAM Journal on Optimization}, 24973 year = {1992}, 24974 volume = {2}, 24975 pages = {325--347} 24976} 24977 24978@Article{ burke:second, 24979 author = {J. V. Burke}, 24980 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 24981 journal = {Mathematical Programming}, 24982 year = {1987}, 24983 volume = {38}, 24984 pages = {287--302} 24985} 24986 24987@Article{ burke:sequential, 24988 author = {J. V. Burke}, 24989 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 24990 Programs}, 24991 journal = {Journal of Mathematical Analysis and its Applications}, 24992 year = {1989}, 24993 volume = {139}, 24994 pages = {319--351} 24995} 24996 24997@Article{ burman.kutcher.ea:fitting, 24998 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 24999 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 25000 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25001 year = {1991}, 25002 optvolume = {21}, 25003 optpages = {123-135} 25004} 25005 25006@TechReport{ busovaca:handling, 25007 author = {S. Busovaca}, 25008 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 25009 institution = {University of Waterloo}, 25010 year = {1985}, 25011 address = {Ontario}, 25012 number = {CS85 34}, 25013 type = {Technical Report} 25014} 25015 25016@Article{ butler.martin:method, 25017 author = {T. Butler and A. V. Martin}, 25018 title = {On a Method of {C}ourant for Minimizing Functionals}, 25019 journal = {Journal of Mathematical Physics}, 25020 year = {1962}, 25021 volume = {41}, 25022 pages = {291--299} 25023} 25024 25025@Article{ calamai.more:projected, 25026 author = {P. H. Calamai and J. J. Mor\'{e}}, 25027 title = {Projected Gradient Methods for Linearly Constrained Problems}, 25028 journal = {Mathematical Programming}, 25029 year = {1987}, 25030 volume = {39}, 25031 pages = {93--116} 25032} 25033 25034@Article{ cao.ferris:genetic, 25035 author = {M. Cao and M. C. Ferris}, 25036 title = {Genetic Algorithms in Optimization}, 25037 journal = {Journal of Undergraduate Mathematics and its Applications}, 25038 year = {1991}, 25039 volume = {12}, 25040 pages = {81--90}, 25041 key = {17} 25042} 25043 25044@Article{ cao.ferris:interior, 25045 author = {M. Cao and M. C. Ferris}, 25046 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 25047 journal = {Journal of Optimization Theory and Applications}, 25048 year = {1994}, 25049 volume = {83}, 25050 pages = {269--283}, 25051 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 25052 key = {28} 25053} 25054 25055@Article{ cao.ferris:lineality, 25056 author = {M. Cao and M. C. Ferris}, 25057 title = {Lineality Removal for Copositive--Plus Normal Maps}, 25058 year = {1995}, 25059 volume = {2}, 25060 pages = {1--10}, 25061 journal = {Communications on Applied Nonlinear Analysis}, 25062 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 25063 key = {38} 25064} 25065 25066@Article{ cao.ferris:pc, 25067 author = {M. Cao and M. C. Ferris}, 25068 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 25069 journal = {Linear Algebra and Its Applications}, 25070 year = {1996}, 25071 volume = {246}, 25072 pages = {299--312}, 25073 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 25074 key = {37} 25075} 25076 25077@Article{ cao.ferris:pivotal, 25078 author = {M. Cao and M. C. Ferris}, 25079 title = {A Pivotal Method for Affine Variational Inequalities}, 25080 journal = {Mathematics of Operations Research}, 25081 year = {1996}, 25082 volume = {21}, 25083 pages = {44--64}, 25084 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 25085 key = {29} 25086} 25087 25088@PhDThesis{ cao:piecewise, 25089 author = {M. Cao}, 25090 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 25091 school = {Computer Sciences Department, University of Wisconsin}, 25092 year = {1994}, 25093 address = {Madison, Wisconsin}, 25094 note = {Technical Report 1210} 25095} 25096 25097@Article{ caroe.schultz:dual, 25098 author = {C. C. Car{\o}e and R. Schultz}, 25099 title = {Dual Decomposition in Stochastic Integer Programming}, 25100 journal = {Operations Research Letters}, 25101 volume = {24}, 25102 pages = {37-45}, 25103 year = {1999} 25104} 25105 25106@Article{ carol.targovnik.ea:initial, 25107 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 25108 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 25109 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 25110 conformal radiation therapy system}, 25111 journal = {Stereotactic and Functional Neurosurgery}, 25112 year = {1996}, 25113 volume = {66}, 25114 pages = {30--34} 25115} 25116 25117@Article{ carolan.hill.ea:empirical, 25118 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 25119 Wichmann}, 25120 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 25121 Applications}, 25122 journal = {Operations Research}, 25123 year = {1990}, 25124 volume = {38}, 25125 pages = {240--248} 25126} 25127 25128@Article{ carroll:created, 25129 author = {C. W. Carroll}, 25130 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 25131 Systems}, 25132 journal = {Operations Research}, 25133 year = {1961}, 25134 volume = {9}, 25135 pages = {169--184} 25136} 25137 25138@PhDThesis{ carroll:operations, 25139 author = {C. W. Carroll}, 25140 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 25141 Process}, 25142 year = {1959}, 25143 address = {Appleton, Wisconsin}, 25144 school = {Institute of Paper Chemistry} 25145} 25146 25147@TechReport{ casanova.dongarra:netsolve, 25148 author = {H. Casanova and J. Dongarra}, 25149 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 25150 institution = {University of Tennessee}, 25151 year = {1996}, 25152 type = {Technical Report} 25153} 25154 25155@TechReport{ cavalier.soyster:computational, 25156 author = {T. M. Cavalier and A. L. Soyster}, 25157 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 25158 institution = {Pennsylvania State University}, 25159 year = {1985}, 25160 address = {Pennsylvania}, 25161 number = {85-105}, 25162 type = {ISME Working Paper} 25163} 25164 25165@TechReport{ censor.iusem.ea:interior-point, 25166 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 25167 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 25168 Problem with Paramonotone Operators}, 25169 institution = {University of Haifa}, 25170 year = {1994}, 25171 type = {Working Paper} 25172} 25173 25174@Article{ censor.lent:iterative, 25175 author = {Y. Censor and A. Lent}, 25176 title = {An Iterative Row-Action Method for Interval Convex Programming}, 25177 journal = {Journal of Optimization Theory and Applications}, 25178 year = {1981}, 25179 volume = {34}, 25180 pages = {275--291} 25181} 25182 25183@InCollection{ censor.pierro.ea:iterative, 25184 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 25185 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 25186 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 25187 XXIV}, 25188 publisher = {Banach Center}, 25189 year = {1987}, 25190 editor = {A. J. Wakulicz}, 25191 address = {Warsaw, Poland} 25192} 25193 25194@Article{ censor.segman:block-iterative, 25195 author = {Y. Censor and J. Segman}, 25196 title = {On Block-Iterative Entropy Maximization}, 25197 journal = {Journal of Information and Optimization Science}, 25198 year = {1987}, 25199 volume = {8}, 25200 pages = {275--291} 25201} 25202 25203@Article{ censor.zenios:proximal, 25204 author = {Y. Censor and S. A. Zenios}, 25205 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 25206 journal = {Journal of Optimization Theory and Applications}, 25207 year = {1992}, 25208 volume = {73}, 25209 pages = {451--464} 25210} 25211 25212@Article{ censor:parallel, 25213 author = {Yair Censor}, 25214 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 25215 Therapy}, 25216 journal = {Mathematical Programming}, 25217 year = {1988}, 25218 volume = {42}, 25219 pages = {307--325} 25220} 25221 25222@Article{ censor:row-action, 25223 author = {Yair Censor}, 25224 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 25225 journal = {SIAM Review}, 25226 year = {1981}, 25227 volume = {23}, 25228 pages = {444--466} 25229} 25230 25231@Article{ chajakis.zenios:synchronous, 25232 author = {E. D. Chajakis and S. A. Zenios}, 25233 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 25234 Nonlinear Network Optimization}, 25235 journal = {Parallel Computing}, 25236 year = {1990}, 25237 note = {To appear} 25238} 25239 25240@Article{ chamberlain.powell.ea:watchdog, 25241 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 25242 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 25243 Optimization}, 25244 journal = {Mathematical Programming Study}, 25245 year = {1982}, 25246 volume = {16}, 25247 pages = {1--17} 25248} 25249 25250@Article{ chan.pang:generalized, 25251 author = {D. Chan and J. S. Pang}, 25252 title = {The Generalized Quasi-Variational Inequality Problem}, 25253 journal = {Mathematics of Operations Research}, 25254 volume = {7}, 25255 pages = {211--222}, 25256 year = {1982} 25257} 25258 25259@Article{ charalambous:nonlinear, 25260 author = {C. Charalambous}, 25261 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 25262 journal = {Mathematical Programming}, 25263 year = {1977}, 25264 volume = {12}, 25265 pages = {195--225} 25266} 25267 25268@Article{ charnes.cooper.ea:duality, 25269 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 25270 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 25271 journal = {Proceedings of the National Academy of Sciences of the United States}, 25272 year = {1962}, 25273 pages = {783--786} 25274} 25275 25276@Book{ charnes.cooper.ea:introduction, 25277 author = {A. Charnes and W. W. Cooper and A. Henderson}, 25278 title = {An Introduction to Linear Programming}, 25279 year = {1953}, 25280 publisher = {John Wiley \& Sons}, 25281 address = {New York} 25282} 25283 25284@TechReport{ charnes.semple:practical, 25285 author = {A. Charnes and J. Semple}, 25286 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 25287 institution = {CCS}, 25288 year = {1991}, 25289 address = {Austin, Texas}, 25290 number = {663}, 25291 type = {Research Report} 25292} 25293 25294@InProceedings{ charnes:fundamental, 25295 author = {A. Charnes}, 25296 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 25297 booktitle = {Computer and Information Sciences}, 25298 year = {1964}, 25299 editor = {J. T. Lou and R. H. Wilcox}, 25300 publisher = {Spartan Books}, 25301 address = {Washington, D.C.}, 25302 pages = {67--74} 25303} 25304 25305@TechReport{ chen.chen.ea:penalized, 25306 author = {B. Chen and X. Chen and C. Kanzow}, 25307 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 25308 Numerical Results}, 25309 institution = {Institute of Applied Mathematics, University of Hamburg}, 25310 year = {1997}, 25311 type = {Preprint}, 25312 number = {126}, 25313 address = {Hamburg, Germany} 25314} 25315 25316@Article{ chen.chen:global, 25317 author = {B. Chen and X. Chen}, 25318 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 25319 ${R}_0$ {NCP} or Monotone {NCP}}, 25320 journal = {SIAM Journal on Optimization}, 25321 year = {1999}, 25322 volume = {9}, 25323 pages = {624--645} 25324} 25325 25326@Article{ chen.ferris.ea:fatcop, 25327 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 25328 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 25329 Solver}, 25330 journal = {Annals of Operations Research, forthcoming}, 25331 year = {2000}, 25332 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 25333 key = {89}, 25334 type = {Data Mining Institute Technical Report}, 25335 institution = {Computer Sciences Department, University of Wisconsin}, 25336 address = {Madison, Wisconsin}, 25337 number = {99-11} 25338} 25339 25340@TechReport{ chen.ferris:fatcop, 25341 author = {Q. Chen and M. C. Ferris}, 25342 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 25343 type = {Mathematical Programming Technical Report}, 25344 institution = {Computer Sciences Department, University of Wisconsin}, 25345 address = {Madison, Wisconsin}, 25346 year = {1999}, 25347 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 25348 number = {99-05}, 25349 key = {81}, 25350 annote = {Submitted to {\em SIOPT}} 25351} 25352 25353@Article{ chen.florian:nonlinear, 25354 author = {Y. Chen and M. Florian}, 25355 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 25356 Optimality Conditions}, 25357 journal = {Optimization}, 25358 year = {1995}, 25359 volume = {32}, 25360 pages = {193--209} 25361} 25362 25363@TechReport{ chen.florian:o-d, 25364 author = {Y. Chen and M. Florian}, 25365 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 25366 optimality conditions}, 25367 type = {Publication}, 25368 number = {CRT-94-56}, 25369 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 25370 address = {Montr\'eal, Canada}, 25371 year = {1994} 25372} 25373 25374@Article{ chen.harker:continuation, 25375 author = {B. Chen and P. T. Harker}, 25376 title = {A Continuation Method for Monotone Variational Inequalities}, 25377 journal = {Mathematical Programming}, 25378 volume = {69}, 25379 pages = {237--253}, 25380 year = {1995} 25381} 25382 25383@Article{ chen.harker:non-interior, 25384 author = {B. Chen and P. T. Harker}, 25385 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 25386 journal = {SIAM Journal on Matrix Analysis and Applications}, 25387 year = {1993}, 25388 volume = {14}, 25389 pages = {1168--1190} 25390} 25391 25392@Article{ chen.harker:smooth, 25393 author = {B. Chen and P. T. Harker}, 25394 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 25395 journal = {SIAM Journal on Optimization}, 25396 year = {1997}, 25397 volume = {7}, 25398 pages = {403--420} 25399} 25400 25401@Article{ chen.mangasarian:class, 25402 author = {Chunhui Chen and O. L. Mangasarian}, 25403 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 25404 journal = {Computational Optimization and Applications}, 25405 year = {1996}, 25406 volume = {5}, 25407 pages = {97--138} 25408} 25409 25410@Article{ chen.mangasarian:smoothing, 25411 author = {Chunhui Chen and O. L. Mangasarian}, 25412 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 25413 journal = {Mathematical Programming}, 25414 year = {1995}, 25415 volume = {78}, 25416 pages = {51--70} 25417} 25418 25419@Article{ chen.nashed.ea:convergence, 25420 author = {X. Chen and Z. Nashed and L. Qi}, 25421 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 25422 using Adaptive Outer Inverses}, 25423 year = {1997}, 25424 journal = {SIAM Journal on Optimization}, 25425 volume = {7}, 25426 pages = {445--462} 25427} 25428 25429@Article{ chen.qi.ea:global, 25430 author = {X. Chen and L. Qi and D. Sun}, 25431 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 25432 Application to General Box Constrained Variational Inequalities}, 25433 year = {1998}, 25434 journal = {Mathematics of Computation}, 25435 volume = {67}, 25436 pages = {519--540} 25437} 25438 25439@Article{ chen.teboulle:convergence, 25440 author = {G. Chen and M. Teboulle}, 25441 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 25442 Functions}, 25443 journal = {SIAM Journal on Optimization}, 25444 year = {1993}, 25445 volume = {3}, 25446 pages = {538--543} 25447} 25448 25449@Article{ chen.ye:homotopy-smoothing, 25450 author = {X.~Chen and Y.~Ye}, 25451 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 25452 year = {1999}, 25453 journal = {SIAM Journal on Control and Optimization}, 25454 volume = {37}, 25455 pages = {589--616} 25456} 25457 25458@PhDThesis{ chen:forward-backward, 25459 author = {G. H.--G. Chen}, 25460 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 25461 school = {University of Washington}, 25462 year = {1994} 25463} 25464 25465@PhDThesis{ chen:smoothing, 25466 author = {Chunhui Chen}, 25467 title = {Smoothing Methods in Mathematical Programming}, 25468 school = {Computer Sciences Department, University of Wisconsin}, 25469 year = {1995}, 25470 address = {Madison, Wisconsin}, 25471 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 25472 annote = {Mathematical Programming Technical Report 95-12} 25473} 25474 25475@Book{ cheney:introduction, 25476 author = {E. W. Cheney}, 25477 title = {Introduction to Approximation Theory}, 25478 year = {1966}, 25479 publisher = {McGraw--Hill}, 25480 address = {New York} 25481} 25482 25483@Article{ cho.kuterdem.ea:spherical, 25484 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 25485 title = {A spherical dose model for radiosurgery treatment planning}, 25486 journal = {Physics in Medicine and Biology}, 25487 year = {1998}, 25488 volume = {43}, 25489 pages = {3145--3148} 25490} 25491 25492@Article{ cho.lee.ea:optimization, 25493 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 25494 title = {Optimization of intensity modulated beams with volume constraints using two 25495 methods: cost function minimization and projection onto convex sets}, 25496 journal = {Medical Physics}, 25497 year = {1998}, 25498 volume = {25}, 25499 number = {4}, 25500 pages = {435--443} 25501} 25502 25503@Article{ choi.desarbo.ea:product, 25504 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 25505 title = {Product Positioning Under Price Competition}, 25506 journal = {Management Science}, 25507 year = {1990}, 25508 volume = {36}, 25509 pages = {175--199} 25510} 25511 25512@Article{ chow.mallet-parret.ea:finding, 25513 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 25514 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 25515 One}, 25516 journal = {Mathematics of Computing}, 25517 year = {1978}, 25518 volume = {32}, 25519 pages = {887--899} 25520} 25521 25522@Article{ christopherson:mathematical, 25523 author = {D. G. Christopherson}, 25524 title = {A new mathematical method for the solution of film lubrication problems}, 25525 journal = {Proceedings of the Institute of Mechanical Engineers}, 25526 volume = {146}, 25527 year = {1941}, 25528 pages = {126--135} 25529} 25530 25531@TechReport{ chun.lee.ea:implementation, 25532 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 25533 title = {An Implementation of the Bundle Decomposition Algorithm}, 25534 institution = {Department of Industrial Engineering, University of Wisconsin}, 25535 year = {1991}, 25536 address = {Madison, Wisconsin}, 25537 number = {91-6} 25538} 25539 25540@Article{ chung:np-completeness, 25541 author = {S.--J. Chung}, 25542 title = {{NP}-Completeness of the Linear Complementarity Problem}, 25543 journal = {Journal of Optimization Theory and Applications}, 25544 volume = {60}, 25545 year = {1989}, 25546 pages = {393--399} 25547} 25548 25549@Book{ chvatal:linear, 25550 author = {V. Chv\'atal}, 25551 title = {Linear Programming}, 25552 year = {1983}, 25553 publisher = {W. H. Freeman and Company}, 25554 address = {New York} 25555} 25556 25557@Book{ ciarlet:finite, 25558 author = {P. G. Ciarlet}, 25559 title = {The Finite Element Method for Elliptic Problems}, 25560 year = {1978}, 25561 publisher = {North-Holland}, 25562 address = {New York} 25563} 25564 25565@Article{ cinquini.contro:optimal, 25566 author = {C. Cinquini and R. Contro}, 25567 title = {Optimal design of beams discretized by elastic plastic finite element}, 25568 journal = {Computers \& Structures}, 25569 volume = {20}, 25570 year = {1985}, 25571 pages = {475--585} 25572} 25573 25574@Book{ clarke:optimization, 25575 author = {F. H. Clarke}, 25576 title = {Optimization and Nonsmooth Analysis}, 25577 year = {1983}, 25578 publisher = {John Wiley \& Sons}, 25579 address = {New York} 25580} 25581 25582@InProceedings{ cleveland.smith:genetic, 25583 crossref = {schaeffer:third}, 25584 author = {G. A. Cleveland and S. F. Smith}, 25585 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 25586 pages = {160--169} 25587} 25588 25589@Book{ cochran:sampling, 25590 author = {W. Cochran}, 25591 title = {Sampling Techniques}, 25592 publisher = {Wiley}, 25593 year = {1977}, 25594 address = {New York}, 25595 edition = {Third} 25596} 25597 25598@Article{ coleman.conn:nonlinear, 25599 author = {T. F. Coleman and A. R. Conn}, 25600 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 25601 journal = {Mathematical Programming}, 25602 year = {1982}, 25603 volume = {24}, 25604 pages = {123--136} 25605} 25606 25607@Article{ coleman.conn:nonlinear*1, 25608 author = {T. F. Coleman and A. R. Conn}, 25609 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 25610 journal = {Mathematical Programming}, 25611 year = {1982}, 25612 volume = {24}, 25613 pages = {137--161} 25614} 25615 25616@TechReport{ coleman.liu:interior, 25617 author = {T. F. Coleman and J. Liu}, 25618 title = {An interior newton method for quadratic programming}, 25619 institution = {Dept. of Computer Science, Cornell University}, 25620 year = {1993}, 25621 number = {TR 93-1388}, 25622 address = {Ithaca, NY}, 25623 month = oct 25624} 25625 25626@Article{ coleman.more:estimation, 25627 author = {T. F. Coleman and J. J. Mor\'{e}}, 25628 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 25629 journal = {SIAM Journal on Numerical Analysis}, 25630 year = {1983}, 25631 volume = {20}, 25632 pages = {187--209} 25633} 25634 25635@Manual{ coleman.verma:admat, 25636 author = {T. F. Coleman and A. Verma}, 25637 title = {{ADMAT} User Guide}, 25638 year = {2000} 25639} 25640 25641@TechReport{ colville:comparative, 25642 author = {A. R. Colville}, 25643 title = {A Comparative Study on Nonlinear Programming Codes}, 25644 institution = {IBM New York Scientific Center}, 25645 year = {1968}, 25646 month = jun, 25647 number = {320--2949}, 25648 type = {Technical Report} 25649} 25650 25651@Article{ comi.maier:extremum, 25652 author = {C. Comi and G. Maier}, 25653 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 25654 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 25655 journal = {European Journal Mechanics A/Solids}, 25656 volume = {9}, 25657 year = {1990}, 25658 pages = {563--585} 25659} 25660 25661@Misc{ condon.dahl.ea:implementing, 25662 author = {T. Condon and H. Dahl and S. Devarajan}, 25663 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 25664 Model}, 25665 year = {1987}, 25666 howpublished = {{DRD} Discussion Paper 290}, 25667 note = {The World Bank, Washington DC} 25668} 25669 25670@Book{ conn.gould.ea:lancelot, 25671 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 25672 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 25673 (Release {A})}, 25674 year = {1992}, 25675 publisher = {Springer Verlag}, 25676 address = {Heidelberg, Berlin}, 25677 series = {Springer Series in Computational Mathematics}, 25678 number = {17} 25679} 25680 25681@Article{ conn.gould.ea:numerical, 25682 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 25683 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 25684 Nonlinear Optimization}, 25685 journal = {Mathematical Programming}, 25686 year = {1996}, 25687 volume = {75}, 25688 pages = {73--110} 25689} 25690 25691@Book{ cgt, 25692 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 25693 title = {Trust-Region Methods}, 25694 year = {2000}, 25695 publisher = {SIAM}, 25696 address = {Philadelphia, Pennsylvania} 25697} 25698 25699@InCollection{ conn.toint:algorithm, 25700 author = {A. R. Conn and Ph. L. Toint}, 25701 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 25702 Optimization}, 25703 booktitle = {Nonlinear Optimization and Applications}, 25704 editor = {G. Di Pillo and F. Giannessi}, 25705 year = {1996}, 25706 publisher = {Plenum Press}, 25707 address = {New York} 25708} 25709 25710@Article{ conry.seireg:mathematical, 25711 author = {T. F. Conry and A. Seireg}, 25712 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 25713 journal = {{ASME} Transactions Journal of Applied Mechanics}, 25714 volume = {93}, 25715 year = {1971}, 25716 pages = {387--392} 25717} 25718 25719@Article{ cook.gerards.ea:sensitivity, 25720 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 25721 title = {Sensitivity Results in Integer Linear Programming}, 25722 journal = {Mathematical Programming}, 25723 year = {1986}, 25724 volume = {34}, 25725 pages = {251--264} 25726} 25727 25728@Article{ cook:taxonomy, 25729 author = {S. A. Cook}, 25730 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 25731 journal = {Information and Control}, 25732 year = {1985}, 25733 volume = {64}, 25734 pages = {2--22} 25735} 25736 25737@Article{ cooper:gradient, 25738 author = {R. E. M. Cooper}, 25739 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 25740 journal = {Radiology}, 25741 year = {1978}, 25742 volume = {128}, 25743 pages = {235--243} 25744} 25745 25746@Article{ cormack:problem, 25747 author = {A. M. Cormack}, 25748 title = {A problem in roatation therapy with x-rays}, 25749 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25750 year = {1987}, 25751 volume = {13}, 25752 pages = {623--630} 25753} 25754 25755@Article{ cormack:problem*1, 25756 author = {A. M. Cormack}, 25757 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 25758 symmetry}, 25759 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25760 year = {1987}, 25761 volume = {13}, 25762 pages = {1921--1925} 25763} 25764 25765@Article{ cottle.dantzig:complementary, 25766 author = {R. W. Cottle and G. B. Dantzig}, 25767 title = {Complementary Pivot Theory of Mathematical Programming}, 25768 journal = {Linear Algebra and Its Applications}, 25769 year = {1968}, 25770 volume = {1}, 25771 pages = {103--125} 25772} 25773 25774@Article{ cottle.dantzig:generalization, 25775 author = {R. W. Cottle and G. B. Dantzig}, 25776 title = {A Generalization of the Linear Complementarity Problem}, 25777 journal = {Journal of Combinatorial Theory}, 25778 year = {1970}, 25779 volume = {8}, 25780 pages = {79--90} 25781} 25782 25783@Book{ cottle.giannessi.ea:variational, 25784 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 25785 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 25786 year = {1980}, 25787 publisher = {John Wiley \& Sons}, 25788 address = {New York} 25789} 25790 25791@InCollection{ cottle.goheen:special, 25792 author = {R. W. Cottle and M. S. Goheen}, 25793 title = {A Special Class of Large Quadratic Programs}, 25794 pages = {361--390}, 25795 crossref = {mangasarian.meyer.ea:nonlinear*3} 25796} 25797 25798@Article{ cottle.golub.ea:solution, 25799 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 25800 title = {On the Solution of Large Structured Complementarity Problems: The Block 25801 Partitioned Case}, 25802 journal = {Applied Mathematics and Optimization}, 25803 year = {1978}, 25804 volume = {4}, 25805 pages = {347--363} 25806} 25807 25808@Book{ cottle.pang.ea:linear, 25809 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 25810 title = {The Linear Complementarity Problem}, 25811 year = {1992}, 25812 publisher = {Academic Press}, 25813 address = {Boston} 25814} 25815 25816@Article{ cottle.pang.ea:sufficient, 25817 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 25818 title = {Sufficient Matrices and the Linear Complementarity Problem}, 25819 journal = {Linear Algebra and Its Applications}, 25820 year = {1989}, 25821 volume = {114/115}, 25822 pages = {231--249} 25823} 25824 25825@PhDThesis{ cottle:nonlinear, 25826 author = {R. W. Cottle}, 25827 title = {Nonlinear programs with positively bounded {J}acobians}, 25828 school = {Department of Mathematics, University of California}, 25829 year = {1964}, 25830 address = {Berkeley, California} 25831} 25832 25833@Article{ cottle:nonlinear*1, 25834 author = {R. W. Cottle}, 25835 title = {Nonlinear programs with positively bounded {J}acobians}, 25836 journal = {Journal of the Society for Industrial and Applied Mathematics}, 25837 volume = {14}, 25838 year = {1966}, 25839 pages = {147--158} 25840} 25841 25842@InCollection{ cottle:principal, 25843 author = {R. W. Cottle}, 25844 title = {The principal pivoting method of quadratic programming}, 25845 booktitle = {Mathematics of the Decision Sciences, Part 1}, 25846 publisher = {American Mathematical Society}, 25847 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 25848 address = {Providence, Rhode Island}, 25849 year = {1968}, 25850 pages = {144--162} 25851} 25852 25853@Unpublished{ courant:calculus, 25854 author = {R. Courant}, 25855 title = {Calculus of Variations and Supplementary Notes and Exercises}, 25856 year = {1956}, 25857 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 25858 New York University} 25859} 25860 25861@Article{ courant:variational, 25862 author = {R. Courant}, 25863 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 25864 journal = {Bulletin of the American Mathematical Society}, 25865 year = {1943}, 25866 volume = {49}, 25867 pages = {1--23} 25868} 25869 25870@Book{ cristianini.shawe-taylor:introduction, 25871 author = {N. Cristianini and J. Shawe-Taylor}, 25872 title = {An Introduction to Support Vector Machines}, 25873 publisher = {Cambridge University Press}, 25874 address = {Cambridge}, 25875 year = {2000} 25876} 25877 25878@Article{ cromme:strong, 25879 author = {L. Cromme}, 25880 title = {Strong Uniqueness}, 25881 journal = {Numerische Mathematik}, 25882 year = {1978}, 25883 volume = {29}, 25884 pages = {179--193} 25885} 25886 25887@Article{ crowder.johnson.ea:solving, 25888 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 25889 title = {Solving Large Scale Zero-One Linear Programming Problems}, 25890 journal = {Operations Research}, 25891 year = {1983}, 25892 volume = {31}, 25893 pages = {803--834} 25894} 25895 25896@Article{ cryer.dempster:equivalence, 25897 author = {C. W. Cryer and M. A. H. Dempster}, 25898 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 25899 Lattice {H}ilbert Spaces}, 25900 journal = {SIAM Journal on Control and Optimization}, 25901 year = {1980}, 25902 volume = {18}, 25903 pages = {76--89} 25904} 25905 25906@Article{ cryer:method, 25907 author = {C. W. Cryer}, 25908 title = {The method of {C}hristopherson for solving free boundary problems for infinite 25909 journal bearings by means of finite differences}, 25910 journal = {Mathematics of Computation}, 25911 volume = {25}, 25912 year = {1971}, 25913 pages = {435--553} 25914} 25915 25916@Article{ cryer:solution, 25917 author = {C. W. Cryer}, 25918 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 25919 journal = {SIAM Journal on Control and Optimization}, 25920 year = {1971}, 25921 volume = {9}, 25922 pages = {385--392} 25923} 25924 25925@Article{ cryer:solution*1, 25926 author = {C. W. Cryer}, 25927 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 25928 journal = {SIAM Journal on Control}, 25929 year = {1971}, 25930 volume = {9}, 25931 pages = {385--392} 25932} 25933 25934@Manual{ culler:split-c, 25935 author = {D. Culler}, 25936 title = {The Split--{C} Programming Language}, 25937 organization = {Computer Science Department, University of California, Berkeley} 25938} 25939 25940@InProceedings{ cun.denker.ea:optimal, 25941 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 25942 title = {Optimal Brain Damage}, 25943 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 25944 year = {1990}, 25945 editor = {D. S. Touretzky}, 25946 publisher = {Morgan Kaufmann}, 25947 address = {San Mateo, California}, 25948 pages = {598--605} 25949} 25950 25951@TechReport{ czyzyk.mehrotra.ea:pcx, 25952 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 25953 title = {{PCx} Users Guide}, 25954 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 25955 University}, 25956 year = {1996}, 25957 type = {Technical Report}, 25958 number = {OTC 96/01} 25959} 25960 25961@TechReport{ czyzyk.mesnier.ea:network-enabled, 25962 address = {Argonne, Illinois}, 25963 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 25964 institution = {Argonne National Laboratory}, 25965 number = {MCS-P615-0996}, 25966 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 25967 type = {Preprint}, 25968 year = {1996} 25969} 25970 25971@Article{ czyzyk.wisniewski.ea:optimization, 25972 title = {Optimization Case Studies in the {NEOS} Guide}, 25973 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 25974 journal = {SIAM Review}, 25975 volume = {41}, 25976 pages = {148--163}, 25977 year = {1999} 25978} 25979 25980@Article{ dai.laan.ea:simplicial, 25981 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 25982 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 25983 Polyhedron}, 25984 journal = {SIAM Journal on Optimization}, 25985 year = {1991}, 25986 volume = {1}, 25987 pages = {151--165} 25988} 25989 25990@Article{ dai.talman:linear, 25991 author = {Y. Dai and D. Talman}, 25992 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 25993 journal = {Mathematics of Operations Research}, 25994 year = {1993}, 25995 pages = {635--644} 25996} 25997 25998@Book{ daniel:approximate, 25999 author = {J. W. Daniel}, 26000 title = {The approximate minimization of functionals}, 26001 year = {1971}, 26002 publisher = {Prentice-Hall, Inc}, 26003 address = {Englewood Cliffs, New Jersey} 26004} 26005 26006@Article{ danskin:theory, 26007 author = {J. M. Danskin}, 26008 title = {The Theory of Min--Max, with Applications}, 26009 journal = {SIAM Journal on Applied Mathematics}, 26010 year = {1964}, 26011 volume = {14}, 26012 pages = {641--664} 26013} 26014 26015@Book{ danskin:theory*1, 26016 author = {J. M. Danskin}, 26017 title = {The Theory of Min--Max}, 26018 year = {1967}, 26019 publisher = {Springer-Verlag}, 26020 address = {New York} 26021} 26022 26023@InCollection{ dantzig.cottle:positive, 26024 author = {G. B. Dantzig and R. W. Cottle}, 26025 title = {Positive (semi-)definite programming}, 26026 booktitle = {Nonlinear Programming}, 26027 publisher = {North-Holland}, 26028 editor = {J. Abadie}, 26029 address = {Amsterdam}, 26030 year = {1967}, 26031 pages = {55--73} 26032} 26033 26034@Article{ dantzig.manne:complementarity, 26035 author = {G. B. Dantzig and A. S. Manne}, 26036 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 26037 Proportions}, 26038 journal = {Journal of Economic Theory}, 26039 year = {1974}, 26040 volume = {9}, 26041 pages = {312--323} 26042} 26043 26044@Article{ dantzig.wolfe:decomposition, 26045 author = {G. B. Dantzig and P. Wolfe}, 26046 title = {Decomposition Principle for Linear Programs}, 26047 journal = {Operations Research}, 26048 year = {1960}, 26049 volume = {8}, 26050 pages = {101--111} 26051} 26052 26053@Book{ dantzig:linear, 26054 author = {G. B. Dantzig}, 26055 title = {Linear Programming and Extensions}, 26056 year = {1963}, 26057 publisher = {Princeton University Press}, 26058 address = {Princeton, New Jersey} 26059} 26060 26061@Manual{ dash:xpress-mp, 26062 title = {{XPRESS-MP} User Guide}, 26063 organization = {Dash Associates}, 26064 address = {Blisworth House, Blisworth, Northants, UK}, 26065 note = {http://www.dashopt.com/} 26066} 26067 26068@Book{ davis:handbook, 26069 author = {L. D. Davis}, 26070 title = {The Handbook of Genetic Algorithms}, 26071 year = {1990}, 26072 publisher = {Van Nostrand Reinhold} 26073} 26074 26075@TechReport{ davis:users, 26076 author = {T. A. Davis}, 26077 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 26078 type = {{Technical Report}}, 26079 year = {1993}, 26080 institution = {Computer and Information Sciences Department, University of Florida}, 26081 address = {Gainesville, Florida} 26082} 26083 26084@TechReport{ dax:computation, 26085 author = {A. Dax}, 26086 title = {The Computation of Descent Directions at Degenerate Points}, 26087 institution = {Hydrological Service of Israel}, 26088 year = {1985}, 26089 type = {Technical Report} 26090} 26091 26092@Article{ dax:note, 26093 author = {A. Dax}, 26094 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 26095 Problem}, 26096 journal = {Mathematical Programming}, 26097 year = {1986}, 26098 volume = {36}, 26099 pages = {72--80} 26100} 26101 26102@Article{ deasy:multiple, 26103 author = {J. O. Deasy}, 26104 title = {Multiple local minima in radiotherapy optimization problems with dose volume 26105 constraints}, 26106 journal = {Medical Physics}, 26107 year = {1997}, 26108 optvolume = {24}, 26109 optnumber = {7}, 26110 optpages = {1157-1161} 26111} 26112 26113@Article{ deboor.ron:computational, 26114 author = {C. {deBoor} and A. Ron}, 26115 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 26116 journal = {Mathematics of Computation}, 26117 year = {1992}, 26118 volume = {58}, 26119 pages = {705--727} 26120} 26121 26122@Article{ debremaecker.ferris.ea:compressional, 26123 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 26124 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 26125 Problems}, 26126 year = {2000}, 26127 key = {82}, 26128 journal = {Engineering Fracture Mechanics}, 26129 volume = {66}, 26130 pages = {287--303} 26131} 26132 26133@Article{ debremaecker.ferris:comparison, 26134 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 26135 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 26136 year = {2000}, 26137 key = {90}, 26138 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 26139 journal = {Engineering Fracture Mechanics}, 26140 volume = {66}, 26141 pages = {601--605}, 26142 institution = {Computer Sciences Department, University of Wisconsin}, 26143 address = {Madison, Wisconsin}, 26144 number = {00-01} 26145} 26146 26147@Article{ dedonato.maier:mathematical, 26148 author = {O. {De~Donato} and G. Maier}, 26149 title = {Mathematical programming methods for the inelastic analysis of reinforced 26150 concrete frames allowing for limited rotation capacity}, 26151 journal = {International Journal for Numerical Methods in Engineering}, 26152 volume = {4}, 26153 year = {1972}, 26154 pages = {307--329} 26155} 26156 26157@Book{ deimling:nonlinear, 26158 author = {K. Deimling}, 26159 title = {Nonlinear Functional Analysis}, 26160 publisher = {Springer-Verlag}, 26161 year = {1985} 26162} 26163 26164@PhDThesis{ dejong:analysis, 26165 author = {K. A. De~Jong}, 26166 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 26167 year = {1975}, 26168 school = {University of Michigan}, 26169 note = {Dissertation Abstracts International 36(10), 5140B} 26170} 26171 26172@Article{ deleone.mangasarian.ea:multi-sweep, 26173 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 26174 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 26175 Linear Complementarity Problem}, 26176 journal = {Annals of Operations Research}, 26177 year = {1990}, 26178 volume = {22}, 26179 pages = {43--54} 26180} 26181 26182@InCollection{ deleone.mangasarian:serial, 26183 author = {R. {De~Leone} and O. L. Mangasarian}, 26184 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 26185 {L}agrangian Successive Overrelaxation}, 26186 booktitle = {Optimization, Parallel Processing and Applications}, 26187 publisher = {Springer-Verlag}, 26188 year = {1988}, 26189 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 26190 volume = {304}, 26191 series = {Lecture Notes in Economics and Mathematical Systems}, 26192 pages = {103--124}, 26193 address = {Berlin} 26194} 26195 26196@TechReport{ deluca.facchinei.ea:combining, 26197 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26198 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 26199 Complementarity Problems: Theory and Numerical Results}, 26200 type = {Preprint}, 26201 institution = {Institute of Applied Mathematics, University of Hamburg}, 26202 year = {1996} 26203} 26204 26205@TechReport{ deluca.facchinei.ea:general, 26206 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26207 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 26208 Numerical Results}, 26209 type = {Preprint}, 26210 institution = {Institute of Applied Mathematics, University of Hamburg}, 26211 year = {1997} 26212} 26213 26214@Article{ deluca.facchinei.ea:semismooth, 26215 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26216 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 26217 Problems}, 26218 journal = {Mathematical Programming}, 26219 volume = {75}, 26220 pages = {407--439}, 26221 year = {1996} 26222} 26223 26224@Article{ deluca.facchinei.ea:theoretical, 26225 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 26226 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 26227 Complementarity Problems}, 26228 year = {1999}, 26229 journal = {Computational Optimization and Applications, forthcoming} 26230} 26231 26232@Article{ demarzo.eaves:computing, 26233 author = {P. M. DeMarzo and B. C. Eaves}, 26234 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 26235 journal = {Journal of Mathematical Economics}, 26236 year = {1996}, 26237 volume = {26}, 26238 pages = {479--497} 26239} 26240 26241@Article{ dembo.steihaug:truncated, 26242 author = {R. S. Dembo and T. Steihaug}, 26243 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 26244 Optimization}, 26245 journal = {Mathematical Programming}, 26246 year = {1983}, 26247 volume = {26}, 26248 pages = {190--212} 26249} 26250 26251@Article{ dembo:performance, 26252 author = {R. S. Dembo}, 26253 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 26254 journal = {Mathematical Programming Study}, 26255 year = {1986}, 26256 volume = {26}, 26257 pages = {245--248} 26258} 26259 26260@Article{ demoor.vandenberghe.ea:generalized, 26261 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 26262 title = {The generalized linear complementarity problem and an algorithm to find all its 26263 solutions}, 26264 journal = {Mathematical Programming}, 26265 volume = {57}, 26266 year = {1992}, 26267 pages = {415--426} 26268} 26269 26270@Book{ demyanov.vasilev:nondifferentiable, 26271 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 26272 title = {Nondifferentiable Optimization}, 26273 publisher = {Optimization Software, Inc.}, 26274 year = {1985}, 26275 address = {New York} 26276} 26277 26278@Book{ dennis.schnabel:numerical, 26279 author = {J. E. Dennis and R. B. Schnabel}, 26280 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 26281 year = {1983}, 26282 publisher = {Prentice-Hall, Inc}, 26283 address = {Englewood Cliffs, New Jersey} 26284} 26285 26286@Article{ dennis.torczon:direct, 26287 author = {J. E. Dennis and V. Torczon}, 26288 title = {Direct Search Methods on Parallel Machines}, 26289 journal = {SIAM Journal on Optimization}, 26290 year = {1991}, 26291 volume = {1}, 26292 pages = {448--474} 26293} 26294 26295@TechReport{ depierro.iusem:convergence, 26296 author = {A. R. {De~Pierro} and A. N. Iusem}, 26297 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 26298 Linear Complementarity Problems}, 26299 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 26300 year = {1990}, 26301 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 26302} 26303 26304@Article{ depierro.iusem:relaxed, 26305 author = {A. R. {De~Pierro} and A. N. Iusem}, 26306 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 26307 journal = {Journal of Optimization Theory and Applications}, 26308 year = {1986}, 26309 volume = {51}, 26310 pages = {421--440} 26311} 26312 26313@Book{ dervis.melo.ea:general, 26314 author = {K. Dervis and J. de Melo and S. Robinson}, 26315 title = {General Equilibrium Models of Development Policy}, 26316 publisher = {Cambridge University Press}, 26317 year = {1982}, 26318 address = {Cambridge, England} 26319} 26320 26321@Article{ deschutter.demoor:minimal, 26322 author = {B. {De~Schutter} and B. {De~Moor}}, 26323 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 26324 Problem}, 26325 journal = {Systems \& Control Letters}, 26326 year = {1995}, 26327 pages = {103--111} 26328} 26329 26330@Article{ desilets.golden.ea:predicting, 26331 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 26332 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 26333 journal = {Computers \& Operations Research}, 26334 year = {1992}, 26335 volume = {19}, 26336 pages = {277--285} 26337} 26338 26339@PhDThesis{ desilva:sensitivity, 26340 author = {A. H. DeSilva}, 26341 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 26342 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 26343 Production}, 26344 school = {George Washington University}, 26345 address = {Washington, D.C.}, 26346 year = {1978} 26347} 26348 26349@TechReport{ dijkstra:cooperating, 26350 author = {E. W. Dijkstra}, 26351 title = {Cooperating Sequential Processes}, 26352 institution = {Technological University}, 26353 year = {1965}, 26354 address = {Eindhoven, The Netherlands}, 26355 number = {EWD--123}, 26356 type = {Technical Report} 26357} 26358 26359@Article{ dikin:iterative, 26360 author = {I. I. Dikin}, 26361 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 26362 journal = {Soviet Mathematics Doklady}, 26363 year = {1967}, 26364 volume = {8}, 26365 pages = {674--675} 26366} 26367 26368@InCollection{ dipillo.grippo.ea:class, 26369 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 26370 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 26371 booktitle = {System Modelling and Optimization}, 26372 year = {1981}, 26373 editor = {R. F. Drenick and F. Kozin}, 26374 publisher = {Springer-Verlag}, 26375 address = {Berlin} 26376} 26377 26378@Article{ dipillo.grippo:augmented, 26379 author = {G. Di~Pillo and L. Grippo}, 26380 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 26381 Problems}, 26382 journal = {Journal of Optimization Theory and Applications}, 26383 year = {1982}, 26384 volume = {36}, 26385 pages = {495--519} 26386} 26387 26388@Article{ dipillo.grippo:class, 26389 author = {G. Di~Pillo and L. Grippo}, 26390 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 26391 journal = {SIAM Journal on Control and Optimization}, 26392 year = {1979}, 26393 volume = {17}, 26394 pages = {618--628} 26395} 26396 26397@Article{ dipillo.grippo:continuously, 26398 author = {G. Di~Pillo and L. Grippo}, 26399 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 26400 Problems with Inequality Constraints}, 26401 journal = {SIAM Journal on Control and Optimization}, 26402 year = {1985}, 26403 volume = {23}, 26404 pages = {72--84} 26405} 26406 26407@Article{ dipillo.grippo:exact, 26408 author = {G. Di~Pillo and L. Grippo}, 26409 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 26410 Programming Problems}, 26411 journal = {Mathematical Programming}, 26412 year = {1986}, 26413 volume = {36}, 26414 pages = {1--18} 26415} 26416 26417@TechReport{ dirkse.ferris.ea:gams, 26418 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 26419 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 26420 institution = {Computer Sciences Department, University of Wisconsin}, 26421 year = {1994}, 26422 address = {Madison, Wisconsin}, 26423 number = {94-07}, 26424 type = {Mathematical Programming Technical Report}, 26425 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 26426 key = {25} 26427} 26428 26429@InProceedings{ dirkse.ferris:crash, 26430 crossref = {ferris.pang:complementarity}, 26431 author = {S. P. Dirkse and M. C. Ferris}, 26432 title = {Crash Techniques for Large-Scale Complementarity Problems}, 26433 pages = {40--61}, 26434 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 26435 key = {52} 26436} 26437 26438@Article{ dirkse.ferris:mcplib, 26439 author = {S. P. Dirkse and M. C. Ferris}, 26440 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 26441 journal = {Optimization Methods and Software}, 26442 pages = {319--345}, 26443 volume = {5}, 26444 year = {1995}, 26445 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 26446 key = {36} 26447} 26448 26449@InCollection{ dirkse.ferris:modeling, 26450 author = {S. P. Dirkse and M. C. Ferris}, 26451 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 26452 year = {1999}, 26453 pages = {127--148}, 26454 editor = {M. Fukushima and L. Qi}, 26455 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 26456 publisher = {Kluwer Academic Publishers}, 26457 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 26458 key = {62} 26459} 26460 26461@Article{ dirkse.ferris:path, 26462 author = {S. P. Dirkse and M. C. Ferris}, 26463 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 26464 Complementarity Problems}, 26465 journal = {Optimization Methods and Software}, 26466 pages = {123--156}, 26467 volume = {5}, 26468 year = {1995}, 26469 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 26470 key = {33} 26471} 26472 26473@Article{ dirkse.ferris:pathsearch, 26474 author = {S. P. Dirkse and M. C. Ferris}, 26475 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 26476 journal = {Annals of Operations Research}, 26477 vol = {68}, 26478 year = {1996}, 26479 pages = {211--232}, 26480 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 26481 key = {39} 26482} 26483 26484@InCollection{ dirkse.ferris:traffic, 26485 author = {S. P. Dirkse and M. C. Ferris}, 26486 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 26487 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 26488 Management}, 26489 publisher = {Springer-Verlag}, 26490 year = {1998}, 26491 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 26492 series = {NATO ASI Series F}, 26493 volume = {166}, 26494 pages = {136--163}, 26495 key = {61}, 26496 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 26497} 26498 26499@PhDThesis{ dirkse:robust, 26500 author = {S. P. Dirkse}, 26501 title = {Robust Solution of Mixed Complementarity Problems}, 26502 school = {Computer Sciences Department, University of Wisconsin}, 26503 year = {1994}, 26504 address = {Madison, Wisconsin}, 26505 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26506 annote = {Mathematical Programming Technical Report 94-12} 26507} 26508 26509@TechReport{ dixon.mills:neural, 26510 author = {L. C. Dixon and D. J. Mills}, 26511 title = {Neural Nets for Massively Parallel Optimisation}, 26512 institution = {Hatfield Polytechnic}, 26513 year = {1992}, 26514 address = {Hatfield, Hertforshire, England}, 26515 number = {Numerical Optimisation Centre Technical Report No. 259} 26516} 26517 26518@Article{ dontchev:local, 26519 author = {A. L. Dontchev}, 26520 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 26521 journal = {C.R. Acad. Sci. Paris Series I}, 26522 year = {1996}, 26523 volume = {332}, 26524 pages = {327--331} 26525} 26526 26527@Article{ douglas.rachford:numerical, 26528 author = {J. Douglas and H. H. Rachford}, 26529 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 26530 Variables}, 26531 journal = {Transactions of the American Mathematical Society}, 26532 year = {1956}, 26533 volume = {82}, 26534 pages = {421--439} 26535} 26536 26537@Article{ drud:conopt, 26538 author = {A. Drud}, 26539 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 26540 Problems}, 26541 journal = {Mathematical Programming}, 26542 year = {1985}, 26543 volume = {31}, 26544 pages = {153--191} 26545} 26546 26547@Article{ dsouza.meyer.ea:mixed, 26548 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 26549 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 26550 Optimization}, 26551 journal = {Medical Physics}, 26552 year = {1999}, 26553 key = {85}, 26554 volume = {26}, 26555 number = {6}, 26556 pages = {1099} 26557} 26558 26559@TechReport{ dsouza.meyer.ea:mixed*1, 26560 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 26561 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 26562 Optimization}, 26563 year = {1999}, 26564 key = {87}, 26565 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 26566 institution = {Computer Sciences Department, University of Wisconsin}, 26567 address = {Madison, Wisconsin}, 26568 number = {99-08}, 26569 type = {Mathematical Programming Technical Report}, 26570 annote = {Submitted to } 26571} 26572 26573@Article{ dsouza.meyer.ea:iterative, 26574 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 26575 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 26576 Brachytherapy Treatment Optimization}, 26577 year = {2000}, 26578 key = {96}, 26579 journal = {Physics and Medicine in Biology, forthcoming} 26580} 26581 26582@Article{ du.yu.ea:multileaf, 26583 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 26584 G. Gustafson and A. Martinez and J. W. Wong}, 26585 title = {A multileaf collimator field prescription preparation system for conventional 26586 radiotherapy}, 26587 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26588 year = {1994}, 26589 volume = {30}, 26590 number = {3}, 26591 pages = {707--714} 26592} 26593 26594@Article{ duda.fossum:pattern, 26595 author = {R. O. Duda and H. Fossum}, 26596 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 26597 Discriminant Functions}, 26598 journal = {IEEE Transactions on Electronic Computers}, 26599 year = {1966}, 26600 volume = {15}, 26601 pages = {220--232} 26602} 26603 26604@Book{ duda.hart:pattern, 26605 author = {R. O. Duda and P. E. Hart}, 26606 title = {Pattern Classification and Scene Analysis}, 26607 year = {1973}, 26608 publisher = {John Wiley \& Sons}, 26609 address = {New York} 26610} 26611 26612@Book{ duff.erisman.ea:direct, 26613 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 26614 title = {Direct Methods for Sparse Matrices}, 26615 publisher = {Oxford University Press}, 26616 year = {1986}, 26617 address = {Oxford, England} 26618} 26619 26620@InCollection{ duffin:infinite, 26621 author = {R. J. Duffin}, 26622 title = {Infinite Programs}, 26623 booktitle = {Linear Inequalities and Related Systems}, 26624 year = {1975}, 26625 editor = {H. W. Kuhn and A. W. Tucker}, 26626 publisher = {Princeton University Press}, 26627 address = {Princeton, New Jersey}, 26628 pages = {157--170} 26629} 26630 26631@Article{ dunn.sachs:effect, 26632 author = {J. C. Dunn and E. Sachs}, 26633 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 26634 journal = {Applied Mathematics and Optimization}, 26635 year = {1983}, 26636 volume = {10}, 26637 pages = {143--157} 26638} 26639 26640@Article{ dunn:convergence, 26641 author = {J. C. Dunn}, 26642 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 26643 journal = {Journal of Optimization Theory and Applications}, 26644 year = {1987}, 26645 volume = {55}, 26646 pages = {203--216} 26647} 26648 26649@Article{ dunn:global, 26650 author = {J. C. Dunn}, 26651 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 26652 Gradient Processes}, 26653 journal = {SIAM Journal on Control and Optimization}, 26654 year = {1981}, 26655 volume = {19}, 26656 pages = {368--400} 26657} 26658 26659@Article{ dunn:rates, 26660 author = {J. C. Dunn}, 26661 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 26662 Nonsingular Extremals}, 26663 journal = {SIAM Journal on Control and Optimization}, 26664 year = {1979}, 26665 volume = {17}, 26666 pages = {187--211} 26667} 26668 26669@Article{ dupuis.simha:sampling, 26670 author = {P. Dupuis and R. Simha}, 26671 title = {On Sampling-Controlled Stochastic Approximation}, 26672 journal = {{IEEE} Transactions on Automatic Control}, 26673 year = {1991}, 26674 volume = {36}, 26675 pages = {915--924} 26676} 26677 26678@TechReport{ eager.ferris.ea:models, 26679 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 26680 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 26681 institution = {Computer Sciences Department, University of Wisconsin}, 26682 year = {1999}, 26683 type = {Technical Report}, 26684 number = {1402}, 26685 address = {Madison, Wisconsin}, 26686 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 26687 key = {84} 26688} 26689 26690@InProceedings{ eager.ferris.ea:optimized, 26691 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 26692 title = {Optimized Regional Caching for On-Demand Data Delivery}, 26693 year = {1999}, 26694 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 26695 volume = {3654}, 26696 address = {Bellingham, Washington}, 26697 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 26698 key = {69}, 26699 pages = {301--316}, 26700 annote = {18 percent acceptance rate} 26701} 26702 26703@Article{ eager.ferris.ea:optimized*1, 26704 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 26705 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 26706 journal = {Performance Evaluation}, 26707 year = {2000}, 26708 key = {72}, 26709 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 26710 volume = {42}, 26711 pages = {163--185} 26712} 26713 26714@InProceedings{ eager.vernon:dynamic, 26715 author = {D. L. Eager and M. K. Vernon}, 26716 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 26717 year = {1998}, 26718 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 26719 ({MIS '98})}, 26720 pages = {18--32}, 26721 address = {Istanbul, Turkey} 26722} 26723 26724@Article{ eaves.lemke:equivalence, 26725 author = {B. C. Eaves and C. E. Lemke}, 26726 title = {Equivalence of {LCP} and {PLS}}, 26727 journal = {Mathematics of Operations Research}, 26728 year = {1981}, 26729 volume = {6}, 26730 pages = {475--484} 26731} 26732 26733@Article{ eaves.rothblum:relationships, 26734 author = {B. C. Eaves and U. G. Rothblum}, 26735 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 26736 journal = {Linear Algebra and Its Applications}, 26737 year = {1990}, 26738 volume = {132}, 26739 pages = {1--63} 26740} 26741 26742@Article{ eaves:basic, 26743 author = {B. C. Eaves}, 26744 title = {On the Basic Theorem of Complementarity}, 26745 journal = {Mathematical Programming}, 26746 year = {1971}, 26747 volume = {1}, 26748 pages = {68--87} 26749} 26750 26751@Article{ eaves:computing, 26752 author = {B. C. Eaves}, 26753 title = {Computing Stationary Points}, 26754 journal = {Mathematical Programming Study}, 26755 year = {1978}, 26756 volume = {7}, 26757 pages = {1--14} 26758} 26759 26760@InCollection{ eaves:computing*1, 26761 author = {B. C. Eaves}, 26762 title = {Computing Stationary Points, Again}, 26763 pages = {391--405}, 26764 crossref = {mangasarian.meyer.ea:nonlinear*3} 26765} 26766 26767@Article{ eaves:homotopies, 26768 author = {B. C. Eaves}, 26769 title = {Homotopies for Computation of Fixed Points}, 26770 journal = {Mathematical Programming}, 26771 year = {1972}, 26772 volume = {3}, 26773 pages = {1--22} 26774} 26775 26776@Article{ eaves:linear, 26777 author = {B. C. Eaves}, 26778 title = {The Linear Complementarity Problem}, 26779 journal = {Management Science}, 26780 year = {1971}, 26781 volume = {17}, 26782 pages = {612--634} 26783} 26784 26785@Article{ eaves:quadratic, 26786 author = {B. C. Eaves}, 26787 title = {On Quadratic Programming}, 26788 journal = {Management Science}, 26789 year = {1971}, 26790 volume = {17}, 26791 pages = {698--711} 26792} 26793 26794@InProceedings{ eaves:short, 26795 author = {B. C. Eaves}, 26796 title = {A Short Course in Solving Equations with {PL} Homotopies}, 26797 booktitle = {Nonlinear Programming}, 26798 organization = {American Mathematical Society}, 26799 year = {1976}, 26800 editor = {R. W. Cottle and C. E. Lemke}, 26801 publisher = {SIAM--AMS Proceedings}, 26802 address = {Providence, RI}, 26803 pages = {73--143} 26804} 26805 26806@InCollection{ ebiefung.kostreva:global, 26807 author = {A. A. Ebiefung and M. M. Kostreva}, 26808 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 26809 Class of Polynomial Complementarity Problems}, 26810 editors = {C. Floudas and P. Pardalos}, 26811 booktitle = {Recent Advances in Global Optimization}, 26812 publisher = {Princeton University Press}, 26813 pages = {102--124}, 26814 year = {1991} 26815} 26816 26817@TechReport{ ebiefung.kostreva:z-matrices, 26818 author = {A. A. Ebiefung and M. M. Kostreva}, 26819 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 26820 institution = {Department of Mathematical Sciences, Clemson University}, 26821 year = {1991}, 26822 number = {608}, 26823 address = {Clemson, South Carolina} 26824} 26825 26826@TechReport{ eckstein.bertsekas:alternating, 26827 author = {J. Eckstein and D. P. Bertsekas}, 26828 title = {An Alternating Direction Method for Linear Programming}, 26829 institution = {Harvard Business School}, 26830 year = {1990}, 26831 type = {Working Paper}, 26832 number = {90-063}, 26833 address = {Boston, MA} 26834} 26835 26836@Article{ eckstein.bertsekas:douglas-rachford, 26837 author = {J. Eckstein and D. P. Bertsekas}, 26838 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 26839 Maximal Monotone Operators}, 26840 journal = {Mathematical Programming}, 26841 year = {1992}, 26842 pages = {293--318}, 26843 volume = {55} 26844} 26845 26846@Article{ eckstein.bertsekas:douglas-rachford*1, 26847 author = {J. Eckstein and D. P. Bertsekas}, 26848 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 26849 for Maximal Monotone Operators}, 26850 journal = {Mathematical Programming}, 26851 year = {1991}, 26852 note = {To appear} 26853} 26854 26855@TechReport{ eckstein.ferris:operator, 26856 author = {J. Eckstein and M. C. Ferris}, 26857 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 26858 institution = {Thinking Machines Corporation}, 26859 year = {1992}, 26860 address = {Cambridge, MA 02142}, 26861 number = {239}, 26862 type = {TMC}, 26863 key = {26} 26864} 26865 26866@Article{ eckstein.ferris:operator*1, 26867 author = {J. Eckstein and M. C. Ferris}, 26868 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 26869 Parallel Application to Optimal Control}, 26870 volume = {10}, 26871 pages = {218--235}, 26872 year = {1998}, 26873 journal = {INFORMS Journal on Computing}, 26874 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 26875 key = {44} 26876} 26877 26878@Article{ eckstein.ferris:smooth, 26879 author = {J. Eckstein and M. C. Ferris}, 26880 title = {Smooth Methods of Multipliers for Complementarity Problems}, 26881 key = {58}, 26882 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 26883 year = {1999}, 26884 journal = {Mathematical Programming}, 26885 volume = {86}, 26886 pages = {65--90} 26887} 26888 26889@InProceedings{ eckstein.hart.ea:resource, 26890 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 26891 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 26892 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 26893 year = {1997}, 26894 note = {www.cs.sandia.gov/ISUG97} 26895} 26896 26897@Article{ eckstein:alternating, 26898 author = {J. Eckstein}, 26899 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 26900 CM-2}}, 26901 journal = {ORSA Journal on Computing}, 26902 year = {to appear} 26903} 26904 26905@Article{ eckstein:approximate, 26906 author = {J. Eckstein}, 26907 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 26908 year = {1998}, 26909 journal = {Mathematical Programming}, 26910 volume = {83}, 26911 pages = {113--124} 26912} 26913 26914@Article{ eckstein:communication, 26915 author = {J. Eckstein}, 26916 title = {How Much Communication Does Parallel Branch and Bound Need}, 26917 journal = {{INFORMS} Journal on Computing}, 26918 volume = {9}, 26919 year = {1997}, 26920 pages = {15--29} 26921} 26922 26923@Article{ eckstein:distributed, 26924 author = {J. Eckstein}, 26925 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 26926 Integer Programming on the {CM}-5}, 26927 journal = {Computational Optimization and Applications}, 26928 volume = {7}, 26929 pages = {199--220}, 26930 year = {1997} 26931} 26932 26933@TechReport{ eckstein:lions-mercier, 26934 author = {J. Eckstein}, 26935 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 26936 as instances of the Proximal Point Algorithm}, 26937 institution = {MIT}, 26938 year = {1988}, 26939 address = {Cambridge, Massachusetts}, 26940 number = {LIDS-P-1769} 26941} 26942 26943@Article{ eckstein:nonlinear, 26944 author = {J. Eckstein}, 26945 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 26946 to Convex Programming}, 26947 journal = {Mathematics of Operations Research}, 26948 year = {1993}, 26949 pages = {202--226}, 26950 volume = {18} 26951} 26952 26953@Article{ eckstein:parallel, 26954 author = {J. Eckstein}, 26955 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 26956 {CM}-5}, 26957 journal = {SIAM Journal on Optimization}, 26958 volume = {4}, 26959 pages = {794--814}, 26960 year = {1994} 26961} 26962 26963@TechReport{ eckstein:smooth, 26964 author = {J. Eckstein}, 26965 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 26966 institution = {Rutgers Center for Operations Research, Rutgers University}, 26967 address = {New Brunswick, New Jersey}, 26968 year = {1996}, 26969 type = {Research Report}, 26970 number = {27-96} 26971} 26972 26973@PhDThesis{ eckstein:splitting, 26974 author = {J. Eckstein}, 26975 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 26976 Optimization}, 26977 school = {Massachusetts Institute of Technology}, 26978 year = {1989}, 26979 address = {Cambridge, MA}, 26980 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 26981} 26982 26983@Article{ eglese:simulated, 26984 author = {R. W. Eglese}, 26985 title = {Simulated Annealing: {A} Tool for Operational Research}, 26986 journal = {European Journal of Operations Research}, 26987 year = {1990}, 26988 volume = {46}, 26989 pages = {271--281} 26990} 26991 26992@Book{ ekeland.temam:convex, 26993 author = {I. Ekeland and R. Temam}, 26994 title = {Convex Analysis and Variational Problems}, 26995 year = {1976}, 26996 publisher = {North--Holland}, 26997 address = {Amsterdam} 26998} 26999 27000@Article{ ekeland:variational, 27001 author = {I. Ekeland}, 27002 title = {On the Variational Principle}, 27003 journal = {Journal of Mathematical Analysis and Applications}, 27004 year = {1974}, 27005 volume = {47}, 27006 pages = {324--353} 27007} 27008 27009@TechReport{ el-bakry.tapia.ea:formulation, 27010 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 27011 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 27012 for nonlinear programming}, 27013 type = {{Technical Report TR92-40}}, 27014 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 27015 year = {1992} 27016} 27017 27018@Article{ eldersveld.saunders:block, 27019 author = {S. K. Eldersveld and M. A. Saunders}, 27020 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 27021 journal = {SIAM Journal on Matrix Analysis and Applications}, 27022 year = {1992}, 27023 volume = {13}, 27024 pages = {191--201} 27025} 27026 27027@Article{ elster.neumaier:grid, 27028 author = {C. Elster and A. Neumaier}, 27029 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 27030 journal = {{IMA} Journal of Numerical Analysis}, 27031 year = {1995}, 27032 volume = {15}, 27033 pages = {585--608} 27034} 27035 27036@Article{ epema.livny.ea:worldwide, 27037 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 27038 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 27039 journal = {Journal on Future Generations of Computer Systems}, 27040 year = {1996}, 27041 volume = {12}, 27042 pages = {53--65} 27043} 27044 27045@Book{ ermoliev.editors:numerical, 27046 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 27047 title = {Numerical Techniques for Stochastic Optimization Problems}, 27048 year = {1988}, 27049 publisher = {Springer-Verlag}, 27050 address = {Berlin} 27051} 27052 27053@TechReport{ evett.spiehler:rule, 27054 author = {I. W. Evett and E. J. Spiehler}, 27055 title = {Rule Induction in Forensic Science}, 27056 institution = {Central Research Establishment, Home Office Forensic Science Service}, 27057 year = {1987}, 27058 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 27059 type = {Technical Report} 27060} 27061 27062@Article{ evtushenko.purtov:sufficient, 27063 author = {Y. G. Evtushenko and V. A. Purtov}, 27064 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 27065 journal = {Soviet Mathematics Doklady}, 27066 year = {1984}, 27067 volume = {30}, 27068 pages = {313--316} 27069} 27070 27071@Article{ facchinei.fischer.ea:regularity, 27072 author = {F. Facchinei and A. Fischer and C. Kanzow}, 27073 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 27074 journal = {SIAM Journal on Optimization}, 27075 year = {1998}, 27076 volume = {8}, 27077 pages = {850--869} 27078} 27079 27080@Article{ facchinei.fischer.ea:semismooth, 27081 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 27082 Constraints}, 27083 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 27084 journal = {Complementarity and Variational Problems: State of the Art}, 27085 volume = {92}, 27086 pages = {76}, 27087 year = {1997} 27088} 27089 27090@TechReport{ facchinei.fischer.ea:simply, 27091 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 27092 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 27093 Variational Inequalities}, 27094 institution = {University of Hamburg}, 27095 year = {1996} 27096} 27097 27098@Article{ facchinei.jiang.ea:smoothing, 27099 author = {F. Facchinei and H. Jiang and L. Qi}, 27100 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 27101 year = {1999}, 27102 journal = {Mathematical Programming}, 27103 volume = {85}, 27104 pages = {107--134} 27105} 27106 27107@Article{ facchinei.kanzow:nonsmooth, 27108 author = {F. Facchinei and C. Kanzow}, 27109 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 27110 Complementarity Problems}, 27111 year = {1997}, 27112 journal = {Mathematical Programming}, 27113 volume = {76}, 27114 pages = {493--512} 27115} 27116 27117@Article{ facchinei.kanzow:unconstrained, 27118 author = {F. Facchinei and C. Kanzow}, 27119 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 27120 {L}agrangian}, 27121 year = {1997}, 27122 journal = {Journal of Optimization Theory and Applications}, 27123 volume = {92}, 27124 pages = {99--115} 27125} 27126 27127@TechReport{ facchinei.pang:total, 27128 author = {F. Facchinei and J. S. Pang}, 27129 title = {Total stability of variational inequalities}, 27130 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 27131 year = {1988}, 27132 type = {Manuscript}, 27133 address = {Roma, Italy} 27134} 27135 27136@Article{ facchinei.soares:merit, 27137 author = {F. Facchinei and J. Soares}, 27138 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 27139 Algorithm}, 27140 journal = {SIAM Journal on Optimization}, 27141 year = {1997}, 27142 volume = {7}, 27143 pages = {225--247} 27144} 27145 27146@InCollection{ facchinei.soares:testing, 27147 author = {F. Facchinei and J. Soares}, 27148 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 27149 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 27150 publisher = {Plenum Press}, 27151 address = {New York}, 27152 editor = {F. Giannessi and A. Maugeri}, 27153 year = {1995}, 27154 pages = {69--83} 27155} 27156 27157@InProceedings{ fahlman.lebiere:cascade-correlation, 27158 author = {S. E. Fahlman and C. Lebiere}, 27159 title = {The cascade-correlation learning architecture}, 27160 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 27161 year = {1990}, 27162 editor = {D. S. Touretzky}, 27163 publisher = {Morgan Kaufmann}, 27164 address = {San Mateo, California}, 27165 pages = {524--532} 27166} 27167 27168@InProceedings{ fang.geiser.ea:software, 27169 author = {G. Fang and B. Geiser and T. R. Mackie}, 27170 title = {Software system for {UW}/{GE} tomotherapy prototype}, 27171 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 27172 Radiation Therapy, Salt Lake City}, 27173 year = {1997}, 27174 editor = {D. D. Leavitt and G. Starkshall}, 27175 publisher = {Medical Physics Publishing}, 27176 address = {St. Louis, Missouri}, 27177 pages = {332--334} 27178} 27179 27180@Book{ fang.puthenpura:linear, 27181 author = {S.--C. Fang and S. Puthenpura}, 27182 title = {Linear Optimization and Extensions}, 27183 year = {1993}, 27184 publisher = {Prentice-Hall, Inc}, 27185 address = {Englewood Cliffs, New Jersey} 27186} 27187 27188@Article{ fayard.plateau:algorithm, 27189 author = {D. Fayard and G. Plateau}, 27190 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 27191 journal = {Computing}, 27192 year = {1982}, 27193 volume = {28}, 27194 pages = {269--287} 27195} 27196 27197@Book{ feller:introduction, 27198 author = {W. Feller}, 27199 title = {An Introduction to Probability Theory and its Applications}, 27200 publisher = {John Wiley \& Sons}, 27201 year = {1968}, 27202 address = {New York} 27203} 27204 27205@Article{ ferris.fourer.ea:expressing, 27206 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 27207 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 27208 journal = {SIAM Journal on Optimization}, 27209 volume = {9}, 27210 pages = {991--1009}, 27211 year = {1999}, 27212 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 27213 key = {65}, 27214 institution = {Computer Sciences Department, University of Wisconsin}, 27215 address = {Madison, Wisconsin}, 27216 number = {98-02}, 27217 type = {Mathematical Programming Technical Report} 27218} 27219 27220@TechReport{ ferris.horn:nlp2mcp, 27221 author = {M. C. Ferris and J. D. Horn}, 27222 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 27223 problems}, 27224 year = {1998}, 27225 institution = {Computer Sciences Department, University of Wisconsin}, 27226 note = {In preparation} 27227} 27228 27229@Article{ ferris.horn:partitioning, 27230 author = {M. C. Ferris and J. D. Horn}, 27231 title = {Partitioning Mathematical Programs for Parallel Solution}, 27232 year = {1998}, 27233 volume = {80}, 27234 pages = {35--62}, 27235 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 27236 journal = {Mathematical Programming}, 27237 key = {40} 27238} 27239 27240@Article{ ferris.kanzow.ea:feasible, 27241 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 27242 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 27243 year = {1999}, 27244 journal = {Mathematical Programming}, 27245 volume = {86}, 27246 pages = {475--497}, 27247 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 27248 key = {67} 27249} 27250 27251@InCollection{ ferris.kanzow:complementarity, 27252 author = {M. C. Ferris and C. Kanzow}, 27253 title = {Complementarity and Related Problems: {A} Survey}, 27254 booktitle = {Handbook of Applied Optimization, forthcoming}, 27255 key = {74}, 27256 publisher = {Oxford University Press}, 27257 year = {2000}, 27258 editor = {P. M. Pardalos and M. G. C. Resende}, 27259 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 27260 institution = {Computer Sciences Department, University of Wisconsin}, 27261 address = {Madison, Wisconsin}, 27262 number = {98-17}, 27263 type = {Mathematical Programming Technical Report} 27264} 27265 27266@Article{ ferris.lucidi.ea:nonmonotone, 27267 author = {M. C. Ferris and S. Lucidi and M. Roma}, 27268 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 27269 journal = {Computational Optimization and Applications}, 27270 volume = {6}, 27271 pages = {117--136}, 27272 year = {1996}, 27273 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 27274 key = {43} 27275} 27276 27277@TechReport{ ferris.lucidi:globally, 27278 author = {M. C. Ferris and S. Lucidi}, 27279 title = {Globally Convergent Methods for Nonlinear Equations}, 27280 institution = {Computer Sciences Department, University of Wisconsin}, 27281 year = {1991}, 27282 address = {Madison, Wisconsin}, 27283 number = {1030}, 27284 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 27285 key = {21} 27286} 27287 27288@Article{ ferris.lucidi:nonmonotone, 27289 author = {M. C. Ferris and S. Lucidi}, 27290 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 27291 journal = {Journal of Optimization Theory and Applications}, 27292 year = {1994}, 27293 volume = {81}, 27294 pages = {53--71}, 27295 key = {30} 27296} 27297 27298@Article{ ferris.mangasarian:breast, 27299 author = {M. C. Ferris and O. L. Mangasarian}, 27300 title = {Breast Cancer Diagnosis via Linear Programming}, 27301 key = {50}, 27302 journal = {{IEEE} Computational Science and Engineering}, 27303 year = {1995}, 27304 volume = {2}, 27305 pages = {70--71} 27306} 27307 27308@Article{ ferris.mangasarian:error, 27309 author = {M. C. Ferris and O. L. Mangasarian}, 27310 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 27311 Inequalities}, 27312 journal = {Annals of Operations Research}, 27313 year = {1993}, 27314 volume = {47}, 27315 pages = {293--305}, 27316 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 27317 key = {24} 27318} 27319 27320@Article{ ferris.mangasarian:finite, 27321 author = {M. C. Ferris and O. L. Mangasarian}, 27322 title = {Finite Perturbation of Convex Programs}, 27323 journal = {Applied Mathematics and Optimization}, 27324 year = {1991}, 27325 volume = {23}, 27326 pages = {263--273}, 27327 key = {08} 27328} 27329 27330@Book{ ferris.mangasarian:linear, 27331 author = {M. C. Ferris and O. L. Mangasarian}, 27332 title = {Linear Programming via {MATLAB}}, 27333 publisher = {in preparation}, 27334 year = {1995}, 27335 address = {Madison, Wisconsin} 27336} 27337 27338@Article{ ferris.mangasarian:minimum, 27339 author = {M. C. Ferris and O. L. Mangasarian}, 27340 title = {Minimum Principle Sufficiency}, 27341 journal = {Mathematical Programming}, 27342 year = {1992}, 27343 volume = {57}, 27344 pages = {1--14}, 27345 key = {11} 27346} 27347 27348@Article{ ferris.mangasarian:parallel, 27349 author = {M. C. Ferris and O. L. Mangasarian}, 27350 title = {Parallel Constraint Distribution}, 27351 journal = {SIAM Journal on Optimization}, 27352 year = {1991}, 27353 volume = {1}, 27354 pages = {487--500}, 27355 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 27356 key = {18} 27357} 27358 27359@Article{ ferris.mangasarian:parallel*1, 27360 author = {M. C. Ferris and O. L. Mangasarian}, 27361 title = {Parallel Variable Distribution}, 27362 journal = {SIAM Journal on Optimization}, 27363 year = {1994}, 27364 volume = {4}, 27365 pages = {815--832}, 27366 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 27367 key = {31} 27368} 27369 27370@Article{ ferris.meeraus.ea:computing, 27371 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 27372 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 27373 journal = {Optimization Methods and Software}, 27374 year = {1999}, 27375 volume = {10}, 27376 pages = {669--685}, 27377 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 27378 key = {45} 27379} 27380 27381@Article{ ferris.mesnier.ea:neos, 27382 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 27383 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 27384 {I}nternet}, 27385 year = {2000}, 27386 journal = {{ACM} Transactions on Mathematical Software}, 27387 key = {54}, 27388 volume = {26}, 27389 pages = {1--18}, 27390 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 27391 institution = {Computer Sciences Department, University of Wisconsin}, 27392 address = {Madison, Wisconsin}, 27393 number = {96-08}, 27394 type = {Mathematical Programming Technical Report}, 27395 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 27396 Argonne National Laboratory}, 27397 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 27398 1996} 27399} 27400 27401@InCollection{ ferris.meyer:models, 27402 author = {M. C. Ferris and R. R. Meyer}, 27403 title = {Models and Solution for On-Demand Data Delivery Problems}, 27404 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 27405 key = {80}, 27406 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 27407 Problems}, 27408 editor = {P. M. Pardalos}, 27409 series = {Nonconvex Optimization and its Applications}, 27410 volume = {42}, 27411 address = {Dordrect}, 27412 year = {2000}, 27413 pages = {175--188}, 27414 publisher = {Kluwer}, 27415 type = {Mathematical Programming Technical Report}, 27416 institution = {Computer Sciences Department, University of Wisconsin}, 27417 number = {99-04} 27418} 27419 27420@InProceedings{ ferris.munson.ea:homotopy, 27421 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 27422 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 27423 booktitle = {Numerical Analysis 1999}, 27424 key = {88}, 27425 year = {2000}, 27426 editor = {D. F. Griffiths and G. A. Watson}, 27427 series = {Research Notes in Mathematics}, 27428 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 27429 address = {London}, 27430 pages = {143--167}, 27431 publisher = {Chapman and Hall}, 27432 institution = {Computer Sciences Department, University of Wisconsin}, 27433 number = {99-09}, 27434 type = {Mathematical Programming Technical Report} 27435} 27436 27437@TechReport{ ferris.munson.ea:practical, 27438 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 27439 title = {A Practical Approach to Sample-Path Simulation Optimization}, 27440 type = {Data Mining Institute Technical Report}, 27441 institution = {Computer Sciences Department, University of Wisconsin}, 27442 address = {Madison, Wisconsin}, 27443 year = {2000}, 27444 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 27445 number = {00-03}, 27446 key = {92}, 27447 annote = {To appear in WSC 2000} 27448} 27449 27450@InCollection{ ferris.munson:case, 27451 author = {M. C. Ferris and T. S. Munson}, 27452 title = {Case Studies in Complementarity: Improving Model Formulation}, 27453 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 27454 key = {73}, 27455 pages = {79--98}, 27456 publisher = {Springer Verlag}, 27457 year = {1999}, 27458 editor = {M. Th\'{e}ra and R. Tichatschke}, 27459 number = {477}, 27460 series = {Lecture Notes in Economics and Mathematical Systems}, 27461 address = {Berlin}, 27462 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 27463 type = {Mathematical Programming Technical Report}, 27464 institution = {Computer Sciences Department, University of Wisconsin} 27465} 27466 27467@Article{ ferris.munson:complementarity, 27468 author = {M. C. Ferris and T. S. Munson}, 27469 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 27470 year = {2000}, 27471 volume = {24}, 27472 pages = {165--188}, 27473 journal = {Journal of Economic Dynamics and Control}, 27474 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 27475 key = {70}, 27476 type = {Mathematical Programming Technical Report}, 27477 institution = {Computer Sciences Department, University of Wisconsin}, 27478 address = {Madison, Wisconsin}, 27479 number = {98-12} 27480} 27481 27482@Misc{ ferris.munson:condor, 27483 author = {M. C. Ferris and T. S. Munson}, 27484 title = {Condor Modeling Language Interface}, 27485 organization = {Computer Sciences Department, University of Wisconsin}, 27486 address = {Madison, Wisconsin}, 27487 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 27488} 27489 27490@Manual{ ferris.munson:gams, 27491 author = {M. C. Ferris and T. S. Munson}, 27492 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 27493 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 27494} 27495 27496@Article{ ferris.munson:interfaces, 27497 author = {M. C. Ferris and T. S. Munson}, 27498 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 27499 journal = {Computational Optimization and Applications}, 27500 volume = {12}, 27501 pages = {207--227}, 27502 year = {1999}, 27503 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 27504 key = {63}, 27505 institution = {Computer Sciences Department, University of Wisconsin}, 27506 address = {Madison, Wisconsin}, 27507 number = {97-12}, 27508 type = {Mathematical Programming Technical Report} 27509} 27510 27511@TechReport{ ferris.munson:interior, 27512 author = {M. C. Ferris and T. S. Munson}, 27513 title = {Interior Point Methods for Massive Support Vector Machines}, 27514 institution = {Computer Sciences Department, University of Wisconsin}, 27515 year = {2000}, 27516 key = {94}, 27517 type = {Data Mining Institute Technical Report}, 27518 number = {00-05}, 27519 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 27520 address = {Madison, Wisconsin}, 27521 annote = {Submitted to SIOPT} 27522} 27523 27524@Article{ ferris.munson:linear, 27525 author = {M. C. Ferris and T. S. Munson}, 27526 title = {Linear Programming for Emergency Broadcast Systems}, 27527 year = {1999}, 27528 journal = {{SIAG/OPT} Newsletter}, 27529 volume = {10}, 27530 pages = {6--8}, 27531 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 27532 key = {76}, 27533 type = {Mathematical Programming Technical Report}, 27534 institution = {Computer Sciences Department, University of Wisconsin}, 27535 address = {Madison, Wisconsin}, 27536 number = {98-20} 27537} 27538 27539@Article{ ferris.munson:modeling, 27540 author = {M. C. Ferris and T. S. Munson}, 27541 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 27542 year = {2000}, 27543 journal = {Mathematical Programming}, 27544 volume = {88}, 27545 pages = {487--506}, 27546 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 27547 key = {71}, 27548 type = {Mathematical Programming Technical Report}, 27549 institution = {Computer Sciences Department, University of Wisconsin}, 27550 address = {Madison, Wisconsin}, 27551 number = {98-13} 27552} 27553 27554@TechReport{ ferris.munson:preprocessing, 27555 author = {M. C. Ferris and T. S. Munson}, 27556 title = {Preprocessing Complementarity Problems}, 27557 type = {Mathematical Programming Technical Report}, 27558 institution = {Computer Sciences Department, University of Wisconsin}, 27559 address = {Madison, Wisconsin}, 27560 year = {1999}, 27561 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 27562 number = {99-07}, 27563 key = {86}, 27564 annote = {Submitted to ICCP 99} 27565} 27566 27567@TechReport{ ferris.munson:semismooth, 27568 author = {M. C. Ferris and T. S. Munson}, 27569 title = {Semismooth Support Vector Machines}, 27570 institution = {Computer Sciences Department, University of Wisconsin}, 27571 year = {2000}, 27572 key = {97}, 27573 type = {Data Mining Institute Technical Report}, 27574 number = {00-09}, 27575 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 27576 address = {Madison, Wisconsin}, 27577 annote = {Submitted to Math Prog B} 27578} 27579 27580@Article{ ferris.pang:engineering, 27581 author = {M. C. Ferris and J. S. Pang}, 27582 title = {Engineering and Economic Applications of Complementarity Problems}, 27583 year = {1997}, 27584 journal = {SIAM Review}, 27585 volume = {39}, 27586 pages = {669--713}, 27587 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 27588 key = {46} 27589} 27590 27591@Article{ ferris.pang:nondegenerate, 27592 author = {M. C. Ferris and J. S. Pang}, 27593 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 27594 journal = {SIAM Journal on Control and Optimization}, 27595 year = {1996}, 27596 volume = {34}, 27597 pages = {244--263}, 27598 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 27599 key = {35} 27600} 27601 27602@Article{ ferris.philpott:affine, 27603 author = {M. C. Ferris and A. B. Philpott}, 27604 title = {On Affine Scaling and Semi--Infinite Programming}, 27605 journal = {Mathematical Programming}, 27606 year = {1992}, 27607 volume = {56}, 27608 pages = {361--364}, 27609 key = {15} 27610} 27611 27612@Article{ ferris.philpott:interior, 27613 author = {M. C. Ferris and A. B. Philpott}, 27614 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 27615 journal = {Mathematical Programming}, 27616 year = {1989}, 27617 volume = {43}, 27618 pages = {257--276}, 27619 key = {04} 27620} 27621 27622@Article{ ferris.philpott:performance, 27623 author = {M. C. Ferris and A. B. Philpott}, 27624 title = {On the Performance of {K}armarkar's Algorithm}, 27625 journal = {Journal of the Operational Research Society}, 27626 year = {1988}, 27627 volume = {39}, 27628 pages = {257--270}, 27629 key = {03} 27630} 27631 27632@InCollection{ ferris.ralph:projected, 27633 author = {M. C. Ferris and D. Ralph}, 27634 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 27635 Maps}, 27636 booktitle = {Recent Advances in Nonsmooth Optimization}, 27637 publisher = {World Scientific Publishers}, 27638 year = {1995}, 27639 pages = {57--87}, 27640 editor = {D. Du and L. Qi and R. Womersley}, 27641 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 27642 key = {41} 27643} 27644 27645@Article{ ferris.ruszczynski:robust, 27646 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 27647 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 27648 year = {2000}, 27649 journal = {Networks}, 27650 volume = {35}, 27651 pages = {181--194}, 27652 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 27653 key = {60} 27654} 27655 27656@InCollection{ ferris.rutherford:accessing, 27657 author = {M. C. Ferris and T. F. Rutherford}, 27658 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 27659 booktitle = {Nonlinear Optimization and Applications}, 27660 key = {48}, 27661 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 27662 editor = {G. Di Pillo and F. Giannessi}, 27663 year = {1996}, 27664 pages = {141--153}, 27665 publisher = {Plenum Press}, 27666 address = {New York} 27667} 27668 27669@InCollection{ ferris.shepard:optimizing, 27670 author = {M. C. Ferris and D. M. Shepard}, 27671 title = {Optimization of Gamma Knife Radiosurgery}, 27672 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 27673 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 27674 publisher = {AMS}, 27675 year = {2000}, 27676 optseries = {DIMACS}, 27677 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 27678 key = {91}, 27679 type = {Data Mining Institute Technical Report}, 27680 institution = {Computer Sciences Department, University of Wisconsin}, 27681 address = {Madison, Wisconsin}, 27682 number = {00-01} 27683} 27684 27685@InCollection{ ferris.sinapiromsaran:formulating, 27686 author = {M. C. Ferris and K. Sinapiromsaran}, 27687 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 27688 booktitle = {Optimization}, 27689 key = {77}, 27690 publisher = {Springer-Verlag}, 27691 year = {2000}, 27692 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 27693 volume = {481}, 27694 series = {Lecture Notes in Economics and Mathematical Systems}, 27695 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 27696 type = {Mathematical Programming Technical Report}, 27697 institution = {Computer Sciences Department, University of Wisconsin}, 27698 address = {Madison, Wisconsin}, 27699 number = {98-21} 27700} 27701 27702@Article{ ferris.tin-loi:limit, 27703 author = {M. C. Ferris and F. Tin-Loi}, 27704 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 27705 Complementarity Constraints}, 27706 year = {2001}, 27707 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 27708 key = {78}, 27709 journal = {International Journal of Mechanical Sciences}, 27710 pages = {209--224}, 27711 volume = {43}, 27712 type = {Mathematical Programming Technical Report}, 27713 institution = {Computer Sciences Department, University of Wisconsin}, 27714 address = {Madison, Wisconsin}, 27715 number = {99-01} 27716} 27717 27718@Article{ ferris.tin-loi:nonlinear, 27719 author = {M. C. Ferris and F. Tin-Loi}, 27720 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 27721 Elastoplasticity}, 27722 year = {1998}, 27723 key = {64}, 27724 volume = {6}, 27725 pages = {857--870}, 27726 journal = {Structural Engineering and Mechanics} 27727} 27728 27729@Article{ ferris.tin-loi:solution, 27730 author = {M. C. Ferris and F. Tin-Loi}, 27731 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 27732 and Complementarity Constraints}, 27733 year = {1999}, 27734 journal = {Computer Methods in Applied Mechanics and Engineering}, 27735 volume = {174}, 27736 pages = {107--120}, 27737 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 27738 key = {66} 27739} 27740 27741@Article{ ferris.vlach:scheduling, 27742 author = {M. C. Ferris and M. Vlach}, 27743 title = {Scheduling with Earliness and Tardiness Penalties}, 27744 journal = {Naval Research Logistics Quarterly}, 27745 year = {1992}, 27746 volume = {39}, 27747 pages = {229--245}, 27748 key = {13} 27749} 27750 27751@TechReport{ ferris.zavriev:linear, 27752 author = {M. C. Ferris and S. K Zavriev}, 27753 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 27754 institution = {Computer Sciences Department, University of Wisconsin}, 27755 year = {1996}, 27756 key = {56}, 27757 address = {Madison, Wisconsin}, 27758 type = {Mathematical Programming Technical Report}, 27759 number = {96--12}, 27760 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 27761} 27762 27763@Article{ ferris:finite, 27764 author = {M. C. Ferris}, 27765 title = {Finite Termination of the Proximal Point Algorithm}, 27766 journal = {Mathematical Programming}, 27767 year = {1991}, 27768 volume = {50}, 27769 pages = {359--366}, 27770 key = {06} 27771} 27772 27773@Article{ ferris:iterative, 27774 author = {M. C. Ferris}, 27775 title = {Iterative Linear Programming Solution of Convex Programs}, 27776 journal = {Journal of Optimization Theory and Applications}, 27777 year = {1990}, 27778 volume = {65}, 27779 pages = {53--65}, 27780 key = {07} 27781} 27782 27783@Article{ ferris:linear, 27784 author = {M. C. Ferris}, 27785 title = {The Linear Complementarity Problem}, 27786 journal = {Bulletin of the American Mathematical Society}, 27787 year = {1993}, 27788 volume = {28}, 27789 pages = {169--175}, 27790 key = {27} 27791} 27792 27793@MastersThesis{ ferris:linear*1, 27794 author = {M. C. Ferris}, 27795 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 27796 Solving a Class of Structural Optimization Problems}, 27797 year = {1985}, 27798 school = {University of Cambridge}, 27799 address = {England}, 27800 key = {01} 27801} 27802 27803@TechReport{ ferris:matlab, 27804 author = {M. C. Ferris}, 27805 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 27806 institution = {Computer Sciences Department, University of Wisconsin}, 27807 year = {1998}, 27808 address = {Madison, Wisconsin}, 27809 type = {Mathematical Programming Technical Report}, 27810 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 27811 number = {98-19}, 27812 key = {75} 27813} 27814 27815@Article{ ferris:parallel, 27816 author = {M. C. Ferris}, 27817 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 27818 journal = {Mathematics of Operations Research}, 27819 year = {1994}, 27820 volume = {19}, 27821 pages = {645--658}, 27822 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 27823 key = {20} 27824} 27825 27826@TechReport{ ferris:parallel*1, 27827 author = {M. C. Ferris}, 27828 title = {Parallel Solution of Extremely Large Knapsack Problems}, 27829 institution = {Computer Sciences Department, University of Wisconsin}, 27830 year = {1989}, 27831 address = {Madison, Wisconsin}, 27832 number = {842}, 27833 key = {09} 27834} 27835 27836@PhDThesis{ ferris:weak, 27837 author = {M. C. Ferris}, 27838 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 27839 year = {1988}, 27840 school = {University of Cambridge}, 27841 address = {England}, 27842 key = {02} 27843} 27844 27845@TechReport{ ferris:weak*1, 27846 author = {M. C. Ferris}, 27847 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 27848 institution = {Computer Sciences Department, University of Wisconsin}, 27849 year = {1988}, 27850 address = {Madison, Wisconsin}, 27851 number = {779}, 27852 key = {05} 27853} 27854 27855@Book{ fiacco.mccormick:nonlinear, 27856 author = {A. V. Fiacco and G. P. McCormick}, 27857 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 27858 year = {1968}, 27859 publisher = {John Wiley \& Sons}, 27860 address = {New York}, 27861 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 27862} 27863 27864@Book{ fiacco:introduction, 27865 author = {A. V. Fiacco}, 27866 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 27867 year = {1983}, 27868 publisher = {Academic Press}, 27869 address = {New York} 27870} 27871 27872@Article{ fiedler.ptak:matrices, 27873 author = {M. Fiedler and V. Pt\'{a}k}, 27874 title = {On matrices with nonpositive off-diagonal elements and positive principal 27875 minors}, 27876 journal = {Czechoslovak Mathematics Journal}, 27877 volume = {12}, 27878 pages = {382--400}, 27879 year = {1962} 27880} 27881 27882@Article{ fischer.kanzow:finite, 27883 author = {A. Fischer and C. Kanzow}, 27884 title = {On Finite Termination of an Iterative Method for Linear Complementarity 27885 Problems}, 27886 journal = {Mathematical Programming}, 27887 volume = {74}, 27888 pages = {279--292}, 27889 year = {1996} 27890} 27891 27892@TechReport{ fischer:constrained, 27893 author = {A. Fischer}, 27894 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 27895 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 27896 year = {1995}, 27897 type = {Technical Report}, 27898 number = {MATH-NM-10-1995}, 27899 address = {Dresden} 27900} 27901 27902@Article{ fischer:local, 27903 author = {A. Fischer}, 27904 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 27905 weak conditions}, 27906 journal = {Optimization Methods and Software}, 27907 year = {1995}, 27908 volume = {6}, 27909 pages = {83--107} 27910} 27911 27912@InCollection{ fischer:ncp-function, 27913 author = {A. Fischer}, 27914 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 27915 booktitle = {Recent Advances in Nonsmooth Optimization}, 27916 publisher = {World Scientific Publishers}, 27917 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 27918 year = {1995}, 27919 pages = {88--105} 27920} 27921 27922@Article{ fischer:newton-type, 27923 author = {A. Fischer}, 27924 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 27925 Problems}, 27926 journal = {Journal of Optimization Theory and Applications}, 27927 year = {1995}, 27928 volume = {86}, 27929 pages = {585--608} 27930} 27931 27932@Article{ fischer:solution, 27933 author = {A. Fischer}, 27934 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 27935 Functions}, 27936 year = {1997}, 27937 journal = {Mathematical Programming}, 27938 pages = {513--532} 27939} 27940 27941@Article{ fischer:special, 27942 author = {A. Fischer}, 27943 title = {A Special {N}ewton--Type Optimization Method}, 27944 journal = {Optimization}, 27945 year = {1992}, 27946 volume = {24}, 27947 pages = {269--284} 27948} 27949 27950@Article{ fisher:use, 27951 author = {R. A. Fisher}, 27952 title = {The Use of Multiple Measurements in Taxonomic Problems}, 27953 journal = {Annual Eugenics}, 27954 year = {1936}, 27955 volume = {7}, 27956 number = {Part II}, 27957 pages = {179--188} 27958} 27959 27960@Book{ fishman:principles, 27961 author = {G. Fishman}, 27962 title = {Principles of Discrete Event Simulation}, 27963 publisher = {Wiley}, 27964 address = {New York, NY}, 27965 year = {1978} 27966} 27967 27968@Article{ fitchard.aldridge.ea:registration, 27969 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 27970 title = {Registration of Synthetic Tomographic Projection Data Sets Using 27971 Cross-Correlation}, 27972 journal = {Physics in Medicine and Biology}, 27973 year = {1998}, 27974 volume = {43}, 27975 pages = {1645--1657} 27976} 27977 27978@Article{ fletcher.matthews:stable, 27979 author = {R. Fletcher and S. P. J. Matthews}, 27980 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 27981 journal = {Mathematical Programming}, 27982 year = {1984}, 27983 volume = {30}, 27984 pages = {267--284} 27985} 27986 27987@TechReport{ fletcher.maza:nonlinear, 27988 author = {R. Fletcher and E. Sainz de la Maza}, 27989 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 27990 Programming}, 27991 institution = {Department of Mathematical Sciences}, 27992 year = {1987}, 27993 address = {The University, Dundee, Scotland}, 27994 number = {NA/100}, 27995 type = {Numerical Analysis Report} 27996} 27997 27998@InCollection{ fletcher:class, 27999 author = {R. Fletcher}, 28000 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 28001 Properties}, 28002 booktitle = {Integer and Nonlinear Programming}, 28003 year = {1970}, 28004 editor = {J. Abadie}, 28005 publisher = {North--Holland}, 28006 address = {Amsterdam}, 28007 pages = {157--173} 28008} 28009 28010@Article{ fletcher:exact, 28011 author = {R. Fletcher}, 28012 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 28013 journal = {Mathematical Programming}, 28014 year = {1973}, 28015 volume = {5}, 28016 pages = {129--150} 28017} 28018 28019@Article{ fletcher:generalized, 28020 author = {R. Fletcher}, 28021 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 28022 Equations}, 28023 journal = {The Computer Journal}, 28024 year = {1968}, 28025 volume = {10}, 28026 pages = {392--399} 28027} 28028 28029@InProceedings{ fletcher:penalty, 28030 crossref = {bachem.grotschel.ea:mathematical}, 28031 author = {R. Fletcher}, 28032 title = {Penalty Functions}, 28033 pages = {87--114} 28034} 28035 28036@Book{ fletcher:practical, 28037 author = {R. Fletcher}, 28038 title = {Practical Methods of Optimization}, 28039 year = {1981}, 28040 publisher = {John Wiley \& Sons}, 28041 address = {Chichester}, 28042 volume = {1} 28043} 28044 28045@Book{ fletcher:practical*1, 28046 author = {R. Fletcher}, 28047 title = {Practical Methods of Optimization}, 28048 year = {1981}, 28049 publisher = {John Wiley \& Sons}, 28050 address = {Chichester}, 28051 volume = {2} 28052} 28053 28054@Book{ fletcher:practical*2, 28055 author = {R. Fletcher}, 28056 title = {Practical Methods of Optimization}, 28057 year = {1987}, 28058 publisher = {John Wiley \& Sons}, 28059 address = {New York}, 28060 edition = {second} 28061} 28062 28063@Unpublished{ fletcher:recent, 28064 author = {R. Fletcher}, 28065 title = {Recent Developments in Nonlinear Programming}, 28066 note = {Presentation at SOR 96, Braunchweig, Germany}, 28067 year = {1996} 28068} 28069 28070@InCollection{ fletcher:second, 28071 author = {R. Fletcher}, 28072 title = {Second Order Correction for Nondifferentiable Optimization}, 28073 booktitle = {Numerical Analysis}, 28074 year = {1982}, 28075 editor = {G. A. Watson}, 28076 publisher = {Springer-Verlag}, 28077 address = {Berlin}, 28078 pages = {85--114} 28079} 28080 28081@InCollection{ florian:mathematical, 28082 author = {M. Florian}, 28083 title = {Mathematical programming applications in national, regional, and urban planning}, 28084 editors = {M. Iri and K. Tanabe}, 28085 booktitle = {Mathematical Programming: Recent Developments and Applications}, 28086 publisher = {Kluwer Academic Publishers}, 28087 address = {Tokyo}, 28088 year = {1989} 28089} 28090 28091@Article{ florian:nonlinear, 28092 author = {M. Florian}, 28093 title = {Nonlinear Cost Network Models in Transportation Analysis}, 28094 journal = {Mathematical Programming Study}, 28095 year = {1986}, 28096 volume = {26}, 28097 pages = {167--196} 28098} 28099 28100@Article{ flynn:computer, 28101 author = {M.~J. Flynn}, 28102 title = {Some Computer Organizations and their Effectiveness}, 28103 journal = {IEEE Transactions on Computers}, 28104 year = {1972}, 28105 volume = {C-21}, 28106 pages = {948--960} 28107} 28108 28109@InProceedings{ fogarty:varying, 28110 crossref = {schaeffer:third}, 28111 author = {T. C. Fogarty}, 28112 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 28113 pages = {422--427} 28114} 28115 28116@Article{ forrest.goldfarb:steepest-edge, 28117 author = {J. J. Forrest and D. Goldfarb}, 28118 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 28119 journal = {Mathematical Programming}, 28120 year = {1992}, 28121 volume = {57}, 28122 pages = {341--374} 28123} 28124 28125@Article{ forrest.tomlin:updating, 28126 author = {J. J. H. Forrest and J. A. Tomlin}, 28127 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 28128 Simplex Method}, 28129 journal = {Mathematical Programming}, 28130 year = {1972}, 28131 volume = {2}, 28132 pages = {263--278} 28133} 28134 28135@TechReport{ forsgren.gill.ea:computing, 28136 author = {A. Forsgren and P. E. Gill and W. Murray}, 28137 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 28138 institution = {Department of Mathematics, Royal Institute of Technology}, 28139 year = {1993}, 28140 number = {TRITA-MAT-1993-9}, 28141 address = {Stockholm, Sweden} 28142} 28143 28144@TechReport{ forsgren.gill:primal-dual, 28145 author = {A. Forsgren and P. E. Gill}, 28146 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 28147 institution = {Department of Mathematics, University of California}, 28148 year = {1996}, 28149 type = {Report NA}, 28150 number = {96-3}, 28151 address = {San Diego} 28152} 28153 28154@InCollection{ fortin.glowinski:decomposition-coordination, 28155 author = {M. Fortin and R. Glowinski}, 28156 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 28157 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 28158 Problems}, 28159 publisher = {North-Holland}, 28160 year = {1983}, 28161 editor = {M. Fortin and R. Glowinski}, 28162 address = {Amsterdam} 28163} 28164 28165@Misc{ foster.kesselman:globus, 28166 author = {I. Foster and C. Kesselman}, 28167 title = {The Globus Project}, 28168 howpublished = {www.globus.org} 28169} 28170 28171@Article{ foster.kesselman:globus*1, 28172 author = {I. Foster and C. Kesselman}, 28173 title = {Globus: A Metacomputing Infrastructure Toolkit}, 28174 journal = {International Journal of Supercomputer Applications}, 28175 volume = {11}, 28176 pages = {115--128}, 28177 year = {1997} 28178} 28179 28180@Book{ foster.kesselman:grid, 28181 editor = {I. Foster and C. Kesselman}, 28182 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 28183 publisher = {Morgan Kaufmann Publishers}, 28184 year = {1999} 28185} 28186 28187@Book{ fourer.gay.ea:ampl, 28188 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 28189 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 28190 year = {1993}, 28191 publisher = {Duxbury Press} 28192} 28193 28194@Article{ fourer.gay.ea:modeling, 28195 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 28196 title = {A Modeling Language for Mathematical Programming}, 28197 journal = {Management Science}, 28198 year = {1990}, 28199 volume = {36}, 28200 pages = {519--554} 28201} 28202 28203@Article{ fraass:development, 28204 author = {A. Fraass}, 28205 title = {The development of conformal radiation therapy}, 28206 journal = {Medical Physics}, 28207 year = {1995}, 28208 volume = {22}, 28209 number = {11}, 28210 pages = {1911--1921} 28211} 28212 28213@TechReport{ fraley:algorithms, 28214 author = {C. Fraley}, 28215 title = {Algorithms for Nonlinear Least Squares}, 28216 institution = {Stanford University}, 28217 year = {1988}, 28218 number = {{SOL} 88.16}, 28219 type = {Technical Report} 28220} 28221 28222@InCollection{ francois.mcdonald.ea:uruguay, 28223 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 28224 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 28225 booktitle = {The {U}ruguay Round and the Developing Economies}, 28226 address = {New York}, 28227 editors = {W. Martin and L. A. Winters}, 28228 publisher = {Cambridge University Press} 28229} 28230 28231@InCollection{ francois.mcdonald.ea:uruguay*1, 28232 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 28233 title = {The {U}ruguay Round: {A} Global Analysis}, 28234 booktitle = {Challenges and Opportunities for East Asian Trade}, 28235 address = {Cambridge}, 28236 editors = {D. Robertson}, 28237 publisher = {Cambridge University Press} 28238} 28239 28240@Article{ frank.wolfe:algorithm, 28241 author = {M. Frank and P. Wolfe}, 28242 title = {An Algorithm for Quadratic Programming}, 28243 journal = {Naval Research Logistics Quarterly}, 28244 year = {1956}, 28245 volume = {3}, 28246 pages = {95--110} 28247} 28248 28249@Article{ freund.nachtigal:qmrpack, 28250 author = {R. W. Freund and N. M. Nachtigal}, 28251 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 28252 journal = {{ACM} Transactions on Mathematical Software}, 28253 year = {1996}, 28254 volume = {22}, 28255 pages = {46--77} 28256} 28257 28258@InProceedings{ freund.schapire:experiments, 28259 author = {Y. Freund and R. E. Schapire}, 28260 title = {Experiments with a New Boosting Algorithm}, 28261 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 28262 pages = {148--156}, 28263 year = {1996}, 28264 editor = {L. Saitta}, 28265 publisher = {Morgan Kaufmann} 28266} 28267 28268@Unpublished{ freund.todd:barrier, 28269 author = {Robert M. Freund and Michael J. Todd}, 28270 title = {Barrier functions and interior-point algorithms for linear programming with 28271 zero-, one-, or two-sided bounds on the variables}, 28272 year = {1992}, 28273 month = jul 28274} 28275 28276@Article{ friedman.chernina:iterative, 28277 author = {V. M. Friedman and V. S. Chernina}, 28278 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 28279 note = {In Russian}, 28280 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 28281 volume = {1}, 28282 pages = {116--120}, 28283 year = {1967} 28284} 28285 28286@Article{ friesz.bernstein.ea:day-to-day, 28287 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 28288 Ganjalizadeh}, 28289 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 28290 Systems}, 28291 journal = {Operations Research}, 28292 year = {1994}, 28293 volume = {42}, 28294 pages = {1120--1136} 28295} 28296 28297@Article{ friesz.tobin.ea:nonlinear, 28298 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 28299 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 28300 Derived Demand Network Equilibrium Problem}, 28301 journal = {Journal of Regional Science}, 28302 year = {1983}, 28303 volume = {23}, 28304 pages = {337--359} 28305} 28306 28307@Article{ friesz:network, 28308 author = {T. L. Friesz}, 28309 title = {Network Equilibrium, Design and Aggregation}, 28310 journal = {Transportation Research}, 28311 volume = {19A}, 28312 year = {1985}, 28313 pages = {413--427} 28314} 28315 28316@Unpublished{ frisch:logarithmic, 28317 author = {K. R. Frisch}, 28318 title = {The Logarithmic Potential Method of Convex Programming}, 28319 year = {1955}, 28320 note = {Unpublished manuscript, University Institute of Economics, Oslo} 28321} 28322 28323@Book{ fukunaga:statistical, 28324 author = {K. Fukunaga}, 28325 title = {Statistical Pattern Recognition}, 28326 year = {1990}, 28327 publisher = {Academic Press}, 28328 address = {New York} 28329} 28330 28331@Article{ fukushima.luo.ea:globally, 28332 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 28333 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 28334 Programs with Linear Complementarity Constraints}, 28335 journal = {Computational Optimization and Applications}, 28336 year = {1998}, 28337 volume = {10}, 28338 pages = {5--34} 28339} 28340 28341@Article{ fukushima:equivalent, 28342 author = {M. Fukushima}, 28343 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 28344 Asymmetric Variational Inequality Problems}, 28345 journal = {Mathematical Programming}, 28346 year = {1992}, 28347 volume = {53}, 28348 pages = {99--110} 28349} 28350 28351@Article{ fukushima:primal, 28352 author = {M. Fukushima}, 28353 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 28354 Mappings with Application to the Traffic Equilibrium Problem}, 28355 journal = {Mathematical Programming}, 28356 year = {1996}, 28357 volume = {72}, 28358 pages = {1--15} 28359} 28360 28361@Article{ gabay.mercier:dual, 28362 author = {D. Gabay and B. Mercier}, 28363 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 28364 Finite Element Approximations}, 28365 journal = {Computational Mathematics and Applications}, 28366 year = {1976}, 28367 volume = {2}, 28368 pages = {17--48} 28369} 28370 28371@InCollection{ gabay:applications, 28372 author = {D. Gabay}, 28373 title = {Applications of the Method of Multipliers to Variational Inequalities}, 28374 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 28375 Problems}, 28376 publisher = {North-Holland}, 28377 year = {1983}, 28378 editor = {M. Fortin and R. Glowinski}, 28379 address = {Amsterdam} 28380} 28381 28382@Unpublished{ gabriel.bernstein:path, 28383 author = {S. A. Gabriel and D. Berstein}, 28384 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 28385 Equilibrium Problem}, 28386 note = {Draft, 1995} 28387} 28388 28389@TechReport{ gabriel.kydes:nonlinear, 28390 author = {S. A. Gabriel and A. S. Kydes}, 28391 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 28392 System}, 28393 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 28394 year = {1995}, 28395 type = {Preprint}, 28396 number = {MCS-P504-0395}, 28397 address = {Argonne, Illinois}, 28398 month = mar 28399} 28400 28401@InProceedings{ gabriel.more:smoothing, 28402 crossref = {ferris.pang:complementarity}, 28403 author = {S. A. Gabriel and J. J. Mor\'{e}}, 28404 title = {Smoothing of Mixed Complementarity Problems} 28405} 28406 28407@Article{ gabriel.pang:inexact, 28408 author = {S. A. Gabriel and J. S. Pang}, 28409 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 28410 journal = {Computational Optimization and Applications}, 28411 year = {1992}, 28412 volume = {1}, 28413 pages = {67--91} 28414} 28415 28416@InCollection{ gabriel.pang:trust, 28417 author = {S. A. Gabriel and J. S. Pang}, 28418 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 28419 booktitle = {Large--Scale Optimization: State of the Art}, 28420 publisher = {Kluwer Academic Publishers}, 28421 year = {1994}, 28422 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 28423 pages = {159--186} 28424} 28425 28426@PhDThesis{ gabriel:algorithms, 28427 author = {S. A. Gabriel}, 28428 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 28429 Extensions}, 28430 school = {The Johns Hopkins University}, 28431 year = {1992}, 28432 address = {Baltimore, Maryland} 28433} 28434 28435@Article{ gafni.bertsekas:two-metric, 28436 author = {E. M. Gafni and D. P. Bertsekas}, 28437 title = {Two-Metric Projection Methods for Constrained Optimization}, 28438 journal = {SIAM Journal on Control and Optimization}, 28439 year = {1984}, 28440 volume = {22}, 28441 pages = {936--964} 28442} 28443 28444@InProceedings{ gaivoronski:convergence, 28445 author = {A. A. Gaivoronski}, 28446 title = {Convergence of Parallel Backpropagation for Neural Networks}, 28447 booktitle = {SIAM Journal on Optimization}, 28448 year = {1994}, 28449 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 28450 submitted} 28451} 28452 28453@Misc{ gaivoronski:private, 28454 author = {A. A. Gaivoronski}, 28455 title = {Private Communication}, 28456 year = {1992}, 28457 month = nov, 28458 address = {ITALTEL, Milan} 28459} 28460 28461@Book{ gale:theory, 28462 author = {D. Gale}, 28463 title = {The Theory of Linear Economic Models}, 28464 year = {1960}, 28465 publisher = {McGraw-Hill Book Company}, 28466 address = {New York} 28467} 28468 28469@Book{ gallant:neural, 28470 author = {S. I. Gallant}, 28471 title = {Neural Network Learning and Expert Systems}, 28472 year = {1993}, 28473 publisher = {MIT Press}, 28474 address = {Cambridge, Massachusetts} 28475} 28476 28477@InProceedings{ ganti.gehrke.ea:framework, 28478 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 28479 title = {A Framework for Measuring Changes in Data Characteristics}, 28480 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 28481 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 28482 publisher = {ACM Press}, 28483 year = {1999}, 28484 isbn = {1-58113-062-7}, 28485 pages = {126--137} 28486} 28487 28488@Book{ ganz:gamma, 28489 author = {J. C. Ganz}, 28490 title = {Gamma Knife Surgery}, 28491 publisher = {Springer-Verlag Wien}, 28492 year = {1997}, 28493 address = {Austria} 28494} 28495 28496@TechReport{ gao:nonlinear, 28497 author = {Y. Gao}, 28498 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 28499 Conditions}, 28500 type = {Manuscript}, 28501 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 28502 month = oct, 28503 year = {1994} 28504} 28505 28506@Article{ garcia-palomares.mangasarian:superlinearly, 28507 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 28508 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 28509 Optimization Problems}, 28510 journal = {Mathematical Programming}, 28511 year = {1976}, 28512 volume = {11}, 28513 pages = {1--13} 28514} 28515 28516@Article{ garcia-palomares.restuccia:global, 28517 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 28518 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 28519 journal = {Mathematical Programming}, 28520 year = {1981}, 28521 volume = {21}, 28522 pages = {290--300} 28523} 28524 28525@InProceedings{ garcia-palomares:superlinearly, 28526 author = {U. M. {Garcia--Palomares}}, 28527 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 28528 crossref = {mangasarian.meyer.ea:nonlinear*2}, 28529 pages = {101--119} 28530} 28531 28532@Article{ garcia.gould:theorem, 28533 author = {C. B. Garcia and F. J. Gould}, 28534 title = {A Theorem on Homotopy Paths}, 28535 journal = {Mathematics of Operations Research}, 28536 year = {1978}, 28537 volume = {3}, 28538 pages = {282--289} 28539} 28540 28541@Book{ garcia.zangwill:pathways, 28542 author = {C. B. Garcia and W. I. Zangwill}, 28543 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 28544 year = {1981}, 28545 publisher = {Prentice-Hall, Inc}, 28546 address = {Englewood Cliffs, New Jersey} 28547} 28548 28549@Book{ garey.johnson:computers, 28550 author = {M. R. Garey and D. S. Johnson}, 28551 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 28552 year = {1979}, 28553 publisher = {W.H. Freeman and Company}, 28554 address = {San Francisco} 28555} 28556 28557@Article{ garey.tarjan.ea:one-processor, 28558 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 28559 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 28560 journal = {Mathematics of Operations Research}, 28561 year = {1988}, 28562 volume = {13}, 28563 pages = {330--348} 28564} 28565 28566@Book{ garfinkel.nemhauser:integer, 28567 author = {R. S. Garfinkel and G. L. Nemhauser}, 28568 title = {Integer Programming}, 28569 year = {1972}, 28570 publisher = {John Wiley \& Sons}, 28571 address = {New York} 28572} 28573 28574@Book{ gass:linear, 28575 author = {S. Gass}, 28576 title = {Linear Programming Methods and Applications}, 28577 edition = {Fifth}, 28578 publisher = {Boyd and Fraser Publishing Company}, 28579 address = {Danvers, Massachusetts}, 28580 year = {1985} 28581} 28582 28583@InProceedings{ gay:combining, 28584 author = {D. M. Gay}, 28585 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 28586 booktitle = {Sparse Matrix Proceedings 1978}, 28587 editor = {I. S. Duff and G. W. Stewart}, 28588 year = {1978}, 28589 organization = {SIAM}, 28590 address = {Philadelphia, Pennsylvania}, 28591 pages = {313--334} 28592} 28593 28594@Article{ gay:electronic, 28595 author = {D. M. Gay}, 28596 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 28597 journal = {{COAL} Newsletter}, 28598 year = {1985}, 28599 volume = {13}, 28600 pages = {10--12} 28601} 28602 28603@TechReport{ gay:hooking, 28604 author = {D. M. Gay}, 28605 title = {Hooking Your Solver to {AMPL}}, 28606 year = {1997}, 28607 institution = {Bell Laboratories}, 28608 address = {Murray Hill, New Jersey}, 28609 note = {Revised 1994, 1997} 28610} 28611 28612@Article{ gay:variant, 28613 author = {D. Gay}, 28614 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 28615 Form}, 28616 journal = {Mathematical Programming}, 28617 year = {1987}, 28618 volume = {37}, 28619 pages = {81--90} 28620} 28621 28622@Article{ geiger.kanzow:resolution, 28623 author = {C. Geiger and C. Kanzow}, 28624 title = {On the Resolution of Monotone Complementarity Problems}, 28625 journal = {Computational Optimization and Applications}, 28626 volume = {5}, 28627 year = {1996}, 28628 pages = {155--173} 28629} 28630 28631@Book{ geist.beguelin.ea:pvm, 28632 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 28633 V. S. Sunderam}, 28634 title = {{PVM}: Parallel Virtual Machine}, 28635 publisher = {MIT Press}, 28636 address = {Cambridge, Massachusetts}, 28637 year = {1994} 28638} 28639 28640@Article{ gendron.crainic:parallel, 28641 author = {B. Gendron and T. G. Crainic}, 28642 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 28643 journal = {Operations Research}, 28644 year = {1994}, 28645 volume = {42}, 28646 pages = {1042--1060} 28647} 28648 28649@Article{ george:automatic, 28650 author = {A. George}, 28651 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 28652 journal = {SIAM Journal on Numerical Analysis}, 28653 vol = {17}, 28654 pages = {740--751}, 28655 year = {1980} 28656} 28657 28658@InProceedings{ georges-schleuter:asparagos, 28659 crossref = {schaeffer:third}, 28660 author = {M. Georges--Schleuter}, 28661 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 28662 pages = {416--421} 28663} 28664 28665@Article{ georgiou:comments, 28666 author = {G. M. Georgiou}, 28667 title = {Comments On Hidden Nodes in Neural Nets}, 28668 journal = {IEEE Transactions on Circuits and Systems}, 28669 year = {1991}, 28670 volume = {38}, 28671 pages = {1410} 28672} 28673 28674@TechReport{ gertz.linderoth.ea:object-oriented, 28675 author = {M. Gertz and J. Linderoth and S. Wright}, 28676 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 28677 institution = {MCS Division, Argonne National Laboratory}, 28678 year = {in preparation} 28679} 28680 28681@Article{ ghellinck.vial:polynomial, 28682 author = {G. de Ghellinck and J.--Ph. Vial}, 28683 title = {A Polynomial {N}ewton Method for Linear Programming}, 28684 journal = {Algorithmica}, 28685 year = {1986}, 28686 volume = {1}, 28687 pages = {425--453} 28688} 28689 28690@InCollection{ gilbert.ng:predicting, 28691 author = {J. R. Gilbert and E. Ng}, 28692 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 28693 year = {1993}, 28694 booktitle = {Graph Theory and Sparse Matrix Computation}, 28695 editor = {A. George and J. Gilbert and J. Liu}, 28696 publisher = {Springer-Verlag} 28697} 28698 28699@Article{ gilbert-lemarechal, 28700 author = {J. C. Gilbert and C. Lemarechal}, 28701 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 28702 journal = {Mathematical Programming}, 28703 year = {1989}, 28704 volume = {45}, 28705 pages = {407--434} 28706} 28707 28708@Article{ gill.murray.ea:computing, 28709 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 28710 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 28711 journal = {SIAM Journal on Scientific and Statistical Computing}, 28712 year = {1983}, 28713 volume = {4}, 28714 pages = {310--321} 28715} 28716 28717@Article{ gill.murray.ea:maintaining, 28718 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 28719 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 28720 year = {1987}, 28721 journal = {Linear Algebra and Its Applications}, 28722 volume = {88/89}, 28723 pages = {239--270} 28724} 28725 28726@Book{ gill.murray.ea:practical, 28727 author = {P. E. Gill and W. Murray and M. H. Wright}, 28728 title = {Practical Optimization}, 28729 year = {1981}, 28730 publisher = {Academic Press}, 28731 address = {London} 28732} 28733 28734@Article{ gill.murray.ea:practical*1, 28735 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 28736 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 28737 journal = {Mathematical Programming}, 28738 year = {1989}, 28739 volume = {45}, 28740 pages = {437--474} 28741} 28742 28743@Article{ gill.murray.ea:projected, 28744 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 28745 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 28746 to {K}armarkar's Projective Method}, 28747 journal = {Mathematical Programming}, 28748 year = {1986}, 28749 volume = {36}, 28750 pages = {183--209} 28751} 28752 28753@Article{ gill.murray:newton-type, 28754 author = {P. E. Gill and W. Murray}, 28755 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 28756 journal = {Mathematical Programming}, 28757 year = {1974}, 28758 volume = {7}, 28759 pages = {311--350} 28760} 28761 28762@InProceedings{ gill.murray:nonlinear, 28763 author = {P. E. Gill and W. Murray}, 28764 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 28765 booktitle = {Numerical Analysis, Dundee 1975}, 28766 year = {1976}, 28767 editor = {G. A. Watson}, 28768 publisher = {Springer-Verlag}, 28769 address = {Berlin}, 28770 note = {Lecture Notes in Mathematics 506} 28771} 28772 28773@Book{ ginsburgh.waelbroeck:activity, 28774 author = {V. Ginsburgh and J. Waelbroeck}, 28775 title = {Activity Analysis and General Equilibrium Modelling}, 28776 publisher = {North--Holland}, 28777 year = {1981}, 28778 address = {Amsterdam} 28779} 28780 28781@Article{ glad.goldstein:errors, 28782 author = {T. Glad and A. Goldstein}, 28783 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 28784 journal = {BIT}, 28785 year = {1977}, 28786 volume = {17}, 28787 pages = {160--169} 28788} 28789 28790@Article{ glad.polak:multiplier, 28791 author = {T. Glad and E. Polak}, 28792 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 28793 journal = {Mathematical Programming}, 28794 year = {1979}, 28795 volume = {17}, 28796 pages = {140--155} 28797} 28798 28799@Book{ glashoff.gustafson:linear, 28800 author = {K. Glashoff and S.--\AA. Gustafson}, 28801 title = {Linear Optimization and Approximation}, 28802 year = {1983}, 28803 publisher = {Springer-Verlag}, 28804 address = {New York} 28805} 28806 28807@Article{ glover:improved, 28808 author = {F. Glover}, 28809 title = {Improved Linear Programming Models for Discriminant Analysis}, 28810 journal = {Decision Sciences}, 28811 year = {1990}, 28812 volume = {21}, 28813 pages = {771--785} 28814} 28815 28816@Book{ glasserman:gradient, 28817 author = {P. Glasserman}, 28818 title = {Gradient Estimation via Perturbation Analysis}, 28819 publisher = {Kluwer}, 28820 year = {1991}, 28821 address = {Norwell, MA} 28822} 28823 28824@Article{ glover:tabu, 28825 author = {F. Glover}, 28826 title = {Tabu Search -- Part 1}, 28827 journal = {ORSA Journal on Computing}, 28828 year = {1989}, 28829 volume = {1}, 28830 pages = {190--206} 28831} 28832 28833@Article{ glowinski.marroco:sur, 28834 author = {R. Glowinski and A. Marroco}, 28835 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 28836 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 28837 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 28838 year = {1975}, 28839 volume = {9(R-2)}, 28840 pages = {41--76} 28841} 28842 28843@TechReport{ goeleven.nguyen:convergence, 28844 author = {D. Goeleven and V. H. Nguyen}, 28845 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 28846 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 28847 year = {1992}, 28848 address = {B-5000 Namur, Belgium} 28849} 28850 28851@Book{ goldberg:genetic, 28852 author = {D. E. Goldberg}, 28853 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 28854 year = {1989}, 28855 publisher = {Addison-Wesley}, 28856 address = {Reading MA} 28857} 28858 28859@Article{ golden.skiscim:simulated, 28860 author = {B. L. Golden and C. C. Skiscim}, 28861 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 28862 journal = {Naval Research Logistics Quarterly}, 28863 year = {1989}, 28864 volume = {33}, 28865 pages = {261--279} 28866} 28867 28868@Article{ goldfarb.reid:practical, 28869 author = {D. Goldfarb and J. K. Reid}, 28870 title = {A Practical Steepest--Edge Simplex Algorithm}, 28871 journal = {Mathematical Programming}, 28872 year = {1977}, 28873 volume = {12}, 28874 pages = {361--371} 28875} 28876 28877@InProceedings{ goldman.tucker:theory, 28878 author = {A. J. Goldman and A. W. Tucker}, 28879 title = {Theory of Linear Programming}, 28880 booktitle = {Linear Inequalities and Related Systems}, 28881 year = {1956}, 28882 editor = {H. W. Kuhn and A. W. Tucker}, 28883 publisher = {Princeton University Press}, 28884 address = {Princeton, New Jersey}, 28885 pages = {53--97} 28886} 28887 28888@Book{ goldstein:constructive, 28889 author = {A. A. Goldstein}, 28890 title = {Constructive Real Analysis}, 28891 year = {1967}, 28892 publisher = {Harper and Row}, 28893 address = {New York} 28894} 28895 28896@Article{ golshtein:block, 28897 author = {Ye. G. Golshtein}, 28898 title = {The Block Method of Convex Programming}, 28899 journal = {Soviet Mathematics Doklady}, 28900 year = {1986}, 28901 volume = {33}, 28902 pages = {584--587} 28903} 28904 28905@Article{ golshtein:general, 28906 author = {Ye. G. Golshtein}, 28907 title = {A General Approach to Decomposition of Optimization Systems}, 28908 journal = {Soviet Journal of Computer and Systems Sciences}, 28909 year = {1987}, 28910 volume = {3}, 28911 pages = {105--114} 28912} 28913 28914@Article{ golub.kahan:calculating, 28915 author = {G. H. Golub and W. Kahan}, 28916 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 28917 journal = {SIAM Journal on Numerical Analysis}, 28918 year = {1965}, 28919 volume = {2}, 28920 pages = {205--224} 28921} 28922 28923@Book{ golub.vanloan:matrix, 28924 author = {G. H. Golub and C. F. {Van Loan}}, 28925 title = {Matrix Computations}, 28926 year = {1996}, 28927 publisher = {The John Hopkins University Press}, 28928 address = {Baltimore, Maryland}, 28929 edition = {Third} 28930} 28931 28932@TechReport{ gomez.barron:exponential, 28933 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 28934 title = {The Exponential Tunneling Method}, 28935 institution = {Universidad Nacional Autonoma de Mexico}, 28936 year = {1991}, 28937 type = {Serie Reportes de Investigacion}, 28938 number = {3}, 28939 address = {Mexico} 28940} 28941 28942@Article{ gondzio:multiple, 28943 author = {J. Gondzio}, 28944 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 28945 journal = {Computational Optimization and Applications}, 28946 year = {1996}, 28947 volume = {6}, 28948 pages = {137--156} 28949} 28950 28951@TechReport{ gonzaga:algorithm, 28952 author = {C. C. Gonzaga}, 28953 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 28954 operations}, 28955 institution = {Electronics Research Laboratory, University of California}, 28956 year = {1987}, 28957 address = {Berkeley, California}, 28958 number = {UCB/ERL M87/10}, 28959 type = {Memorandum} 28960} 28961 28962@Article{ gould.tolle:necessary, 28963 author = {F. J. Gould and J. W. Tolle}, 28964 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 28965 journal = {SIAM Journal on Applied Mathematics}, 28966 year = {1971}, 28967 volume = {20}, 28968 pages = {164--172} 28969} 28970 28971@InProceedings{ goux.kulkarni.ea:enabling, 28972 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 28973 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 28974 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 28975 Distributed Computing}, 28976 year = {2000} 28977} 28978 28979@Article{ gowda.pang:basic, 28980 author = {M. S. Gowda and J. S. Pang}, 28981 title = {The Basic Theorem of Complementarity Revisited}, 28982 journal = {Mathematical Programming}, 28983 year = {1993}, 28984 volume = {58}, 28985 pages = {161--178} 28986} 28987 28988@Article{ gowda.pang:boundedness, 28989 author = {M. S. Gowda and J. S. Pang}, 28990 title = {On the Boundedness and Stability of Solutions to the Affine Variational 28991 Inequality Problem}, 28992 journal = {SIAM Journal on Control and Optimization}, 28993 year = {1994}, 28994 volume = {32}, 28995 pages = {421--441} 28996} 28997 28998@Article{ gowda.pang:stability, 28999 author = {M. S. Gowda and J. S. Pang}, 29000 title = {Stability analysis of variational inequalities and nonlinear complementarity 29001 problems, via the mixed linear complementarity problem and degree theory}, 29002 journal = {Mathematics of Operations Research}, 29003 year = {1994}, 29004 volume = {19}, 29005 pages = {831--879} 29006} 29007 29008@Article{ gowda.sznajder:generalizations, 29009 author = {M. S. Gowda and R. Sznajder}, 29010 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 29011 Horizontal {LCP}s}, 29012 journal = {Linear Algebra and Its Applications}, 29013 year = {1995}, 29014 volume = {223/224}, 29015 pages = {695--715} 29016} 29017 29018@Article{ gowda.sznajder:generalized, 29019 author = {M. S. Gowda and R. Sznajder}, 29020 title = {The Generalized Order Linear Complementarity Problem}, 29021 journal = {SIAM Journal on Matrix Analysis and Applications}, 29022 year = {1994} 29023} 29024 29025@Article{ gowda:analysis, 29026 author = {M. S. Gowda}, 29027 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 29028 Function via its Recession Function}, 29029 journal = {SIAM Journal on Matrix Analysis and Applications}, 29030 year = {1996}, 29031 volume = {17}, 29032 pages = {594--609} 29033} 29034 29035@Article{ gowda:applications, 29036 author = {M. S. Gowda}, 29037 title = {Applications of Degree Theory to Linear Complementarity Problems}, 29038 journal = {Mathematics of Operations Research}, 29039 year = {1993}, 29040 volume = {18}, 29041 pages = {868--879} 29042} 29043 29044@Article{ grant.woo:clinical, 29045 author = {W. I. Grant and S. Y. Woo}, 29046 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 29047 Delivery}, 29048 journal = {Seminars in Radiation Oncology}, 29049 year = {1999}, 29050 volume = {9}, 29051 pages = {99--107} 29052} 29053 29054@Article{ greenberg.hegerich:branch, 29055 author = {H. Greenberg and R. L. Hegerich}, 29056 title = {A Branch Search Algorithm for the Knapsack Problem}, 29057 journal = {Management Science}, 29058 year = {1970}, 29059 volume = {16}, 29060 pages = {327--332} 29061} 29062 29063@InCollection{ grefenstette:incorporating, 29064 crossref = {davis:genetic}, 29065 author = {J. J. Grefenstette}, 29066 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 29067} 29068 29069@Book{ griewank.corliss:automatic, 29070 editor = {A. Griewank and G. F. Corliss}, 29071 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 29072 publisher = {SIAM}, 29073 year = {1991}, 29074 address = {Philadelphia, Pennsylvania} 29075} 29076 29077@Article{ griewank.juedes.ea:adol-c, 29078 author = {A. Griewank and D. Juedes and J. Utke}, 29079 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 29080 in {C}/{C}++}, 29081 journal = {{ACM} Transactions on Mathematical Software}, 29082 year = {1996}, 29083 volume = {22}, 29084 pages = {131--167} 29085} 29086 29087@Article{ griffith.stewart:nonlinear, 29088 author = {R. E. Griffith and R. A. Stewart}, 29089 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 29090 Systems}, 29091 journal = {Management Science}, 29092 year = {1961}, 29093 volume = {7}, 29094 pages = {379--392} 29095} 29096 29097@Article{ grinold:mathematical, 29098 author = {R. C. Grinold}, 29099 title = {Mathematical Methods for {PA}ttern Classification}, 29100 journal = {Management Science}, 29101 year = {1972}, 29102 volume = {19}, 29103 pages = {272--289} 29104} 29105 29106@Article{ grippo.lampariello.ea:class, 29107 author = {L. Grippo and F. Lampariello and S. Lucidi}, 29108 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 29109 journal = {Numerische Mathematik}, 29110 year = {1991}, 29111 volume = {59}, 29112 pages = {779--805} 29113} 29114 29115@Article{ grippo.lampariello.ea:global, 29116 author = {L. Grippo and F. Lampariello and S. Lucidi}, 29117 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 29118 Without Derivatives}, 29119 journal = {Journal of Optimization Theory and Applications}, 29120 year = {1988}, 29121 volume = {56}, 29122 pages = {385--406} 29123} 29124 29125@Article{ grippo.lampariello.ea:nonmonotone, 29126 author = {L. Grippo and F. Lampariello and S. Lucidi}, 29127 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 29128 journal = {SIAM Journal on Numerical Analysis}, 29129 year = {1986}, 29130 volume = {23}, 29131 pages = {707--716} 29132} 29133 29134@Misc{ grippo:private, 29135 author = {L. Grippo}, 29136 title = {Private Communication}, 29137 year = {1992}, 29138 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 29139} 29140 29141@Article{ grotschel.lovasz.ea:ellipsoid, 29142 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 29143 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 29144 journal = {Combinatorica}, 29145 year = {1981}, 29146 volume = {1}, 29147 pages = {169--197} 29148} 29149 29150@Article{ guignard:generalized, 29151 author = {M. Guignard}, 29152 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 29153 {B}anach Space}, 29154 journal = {SIAM Journal on Control and Optimization}, 29155 year = {1969}, 29156 volume = {7}, 29157 pages = {232--241} 29158} 29159 29160@Article{ guler.ye:convergence, 29161 author = {O. G{\"{u}}ler and Y. Ye}, 29162 title = {Convergence Behavior of Interior--Point Algorithms}, 29163 journal = {Mathematical Programming}, 29164 year = {1993}, 29165 volume = {60}, 29166 pages = {215--228} 29167} 29168 29169@Article{ guler:existence, 29170 author = {O. G{\"{u}}ler}, 29171 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 29172 Complementarity Problems}, 29173 journal = {Mathematics of Operations Research}, 29174 year = {1993}, 29175 volume = {18}, 29176 pages = {128--147} 29177} 29178 29179@Article{ guler:generalized, 29180 author = {O. G{\"{u}}ler}, 29181 title = {Generalized Linear Complementarity Problems}, 29182 journal = {Mathematics of Operations Research}, 29183 year = {1995}, 29184 volume = {20}, 29185 pages = {441--448} 29186} 29187 29188@Article{ gupta.sen:minimizing, 29189 author = {S. Gupta and T. Sen}, 29190 title = {Minimizing the Range of Lateness on a Single Machine}, 29191 journal = {Journal of the Operational Research Society}, 29192 year = {1984}, 29193 volume = {35}, 29194 pages = {853--857} 29195} 29196 29197@InCollection{ gustafson:numerical, 29198 author = {S.-\AA. Gustafson}, 29199 title = {On Numerical Analysis in Semi-Infinite Programming}, 29200 booktitle = {Semi-Infinite Programming}, 29201 year = {1979}, 29202 editor = {R. Hettich}, 29203 publisher = {Springer-Verlag}, 29204 address = {Berlin} 29205} 29206 29207@Article{ gustafsson.lind.ea:simultaneous, 29208 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 29209 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 29210 or compensation filters using a generalized pencil beam algorithm}, 29211 journal = {Medical Physics}, 29212 year = {1995}, 29213 volume = {22}, 29214 number = {7}, 29215 pages = {1141--1156} 29216} 29217 29218@PhDThesis{ ha:decomposition, 29219 author = {C. D. Ha}, 29220 title = {Decomposition Methods for Structured Convex Programming}, 29221 year = {1980}, 29222 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 29223} 29224 29225@TechReport{ haakonsen.mathiesen:toward, 29226 author = {L. Haakonsen and L. Mathiesen}, 29227 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 29228 institution = {NHH, Bergen}, 29229 year = {1995}, 29230 type = {Discussion Paper}, 29231 number = {3/95} 29232} 29233 29234@Article{ haaland.norman.ea:vemod, 29235 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 29236 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 29237 journal = {Scandinavian Journal of Economics}, 29238 year = {1987} 29239} 29240 29241@Article{ haarhoff.buys:method, 29242 author = {P. C. Haarhoff and J. D. Buys}, 29243 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 29244 Constraints}, 29245 journal = {Computer Journal}, 29246 year = {1970}, 29247 volume = {12}, 29248 pages = {178--184} 29249} 29250 29251@Article{ habetler.kostreva:direct, 29252 author = {G. J. Habetler and M. M. Kostreva}, 29253 title = {On a direct algorithm for nonlinear complementarity problems}, 29254 journal = {SIAM Journal on Control and Optimization}, 29255 volume = {16}, 29256 year = {1978}, 29257 pages = {504--511} 29258} 29259 29260@Book{ hadamard:cauchys, 29261 author = {J. Hadamard}, 29262 title = {Cauchy's Problem in Linear Partial Differential Equations}, 29263 year = {1923}, 29264 publisher = {Yale University Press} 29265} 29266 29267@Article{ haddock.mittenthal:simulation, 29268 author = {J. Haddock and J. Mittenthal}, 29269 title = {Simulation optimization using simulated annealing}, 29270 journal = {Comput. Ind. Eng.}, 29271 year = {1992}, 29272 volume = {22}, 29273 pages = {387--395} 29274} 29275 29276@TechReport{ hamala:general, 29277 author = {M. Hamala}, 29278 title = {A General Approach to Interior Point Methods with Linear Parameter for 29279 Mathematical Programming}, 29280 institution = {Royal Institute of Technology}, 29281 year = {1978}, 29282 number = {1978--20}, 29283 type = {Department of Mathematics Paper TRITA--MAT} 29284} 29285 29286@Article{ han.mangasarian:dual, 29287 author = {S.--P. Han and O. L. Mangasarian}, 29288 title = {A Dual Differentiable Exact Penalty Function}, 29289 journal = {Mathematical Programming}, 29290 year = {1983}, 29291 volume = {25}, 29292 pages = {293--301} 29293} 29294 29295@Article{ han.mangasarian:exact, 29296 author = {S.--P. Han and O. L. Mangasarian}, 29297 title = {Exact Penalty Functions in Nonlinear Programming}, 29298 journal = {Mathematical Programming}, 29299 year = {1979}, 29300 volume = {17}, 29301 pages = {251--269} 29302} 29303 29304@Article{ han.pang.ea:globally, 29305 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 29306 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 29307 journal = {Mathematics of Operations Research}, 29308 year = {1992}, 29309 volume = {17}, 29310 pages = {586--607} 29311} 29312 29313@Article{ han:decomposition, 29314 author = {S.--P. Han}, 29315 title = {A Decomposition Method and its Application to Convex Programming}, 29316 journal = {Mathematics of Operations Research}, 29317 year = {1989}, 29318 volume = {14}, 29319 pages = {237--248} 29320} 29321 29322@Article{ han:globally, 29323 author = {S.--P. Han}, 29324 title = {A Globally Convergent Method for Nonlinear Programming}, 29325 journal = {Journal of Optimization Theory and Applications}, 29326 year = {1977}, 29327 volume = {22}, 29328 pages = {297--309} 29329} 29330 29331@Article{ han:superlinearly, 29332 author = {S.--P. Han}, 29333 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 29334 Programming Problems}, 29335 journal = {Mathematical Programming}, 29336 year = {1976}, 29337 volume = {11}, 29338 pages = {263--282} 29339} 29340 29341@Article{ hansen.koopmans:definition, 29342 author = {T. Hansen and T. C. Koopmans}, 29343 title = {On the Definition and Computation of a Capital Stock Invariant Under 29344 Optimization}, 29345 journal = {Journal of Economic Theory}, 29346 year = {1972}, 29347 volume = {5}, 29348 pages = {487--523} 29349} 29350 29351@InCollection{ harker.pang:damped, 29352 author = {P. T. Harker and J. S. Pang}, 29353 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 29354 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 29355 publisher = {AMS}, 29356 year = {1990}, 29357 editor = {E. L. Allgower and K. Georg}, 29358 number = {26}, 29359 series = {Lectures on Applied Mathematics}, 29360 address = {Providence, Rhode Island}, 29361 pages = {265--284} 29362} 29363 29364@Article{ harker.pang:existence, 29365 author = {P. T. Harker and J. S. Pang}, 29366 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 29367 Constraints}, 29368 journal = {Operations Research Letters}, 29369 year = {1988}, 29370 volume = {7}, 29371 pages = {61--64} 29372} 29373 29374@Article{ harker.pang:finite-dimensional, 29375 author = {P. T. Harker and J. S. Pang}, 29376 title = {Finite--dimensional variational inequality and nonlinear complementarity 29377 problems: {A} survey of theory, algorithms and applications}, 29378 journal = {Mathematical Programming}, 29379 year = {1990}, 29380 volume = {48}, 29381 pages = {161--220} 29382} 29383 29384@Article{ harker.xiao:newtons, 29385 author = {P. T. Harker and B. Xiao}, 29386 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 29387 {B}--Differentiable Equation Approach}, 29388 journal = {Mathematical Programming}, 29389 year = {1990}, 29390 volume = {48}, 29391 pages = {339--358} 29392} 29393 29394@Article{ harker:accelerating, 29395 author = {P. T. Harker}, 29396 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 29397 Finite--Dimensional Variational Inequalities}, 29398 journal = {Mathematical Programming}, 29399 year = {1988}, 29400 volume = {41}, 29401 pages = {29--50} 29402} 29403 29404@Article{ harker:generalized, 29405 author = {P. T. Harker}, 29406 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 29407 journal = {European Journal of Operations Research}, 29408 volume = {54}, 29409 pages = {81--94}, 29410 year = {1987} 29411} 29412 29413@Book{ harker:lectures, 29414 author = {P. T. Harker}, 29415 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 29416 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 29417 year = {1993}, 29418 series = {CORE Lecture Series} 29419} 29420 29421@Article{ harris:pivot, 29422 author = {P. M. J. Harris}, 29423 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 29424 journal = {Mathematical Programming}, 29425 year = {1973}, 29426 volume = {5}, 29427 pages = {1--28} 29428} 29429 29430@InCollection{ harrison.kristrom:carbon, 29431 author = {G. W. Harrison and B. Kristrom}, 29432 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 29433 booktitle = {Environment and Transport in Economic Modelling}, 29434 publisher = {Kluwer Academic Publishers}, 29435 year = {1997}, 29436 editor = {R. Roson and K. A. Small}, 29437 address = {Amsterdam} 29438} 29439 29440@Article{ harrison.rutherford.ea:increased, 29441 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 29442 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 29443 journal = {Journal of Economic Integration}, 29444 year = {1996}, 29445 volume = {11}, 29446 pages = {332--365} 29447} 29448 29449@Article{ harrison.rutherford.ea:liberalizing, 29450 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 29451 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 29452 journal = {Journal of Policy Modeling}, 29453 year = {1995}, 29454 volume = {17} 29455} 29456 29457@Article{ harrison.rutherford.ea:quantifying, 29458 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 29459 title = {Quantifying the {U}ruguay Round}, 29460 journal = {Finance and Development}, 29461 year = {1995}, 29462 volume = {32}, 29463 pages = {38--41} 29464} 29465 29466@InProceedings{ harrison.rutherford.ea:quantifying*1, 29467 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 29468 title = {Quantifying the {U}ruguay Round}, 29469 year = {1996}, 29470 booktitle = {The {U}ruguay Round and the Developing Economies}, 29471 address = {New York}, 29472 editors = {W. Martin and L. A. Winters}, 29473 publisher = {Cambridge University Press} 29474} 29475 29476@Article{ harrison.rutherford.ea:quantifying*2, 29477 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 29478 title = {Quantifying the {U}ruguay Round}, 29479 journal = {The Economic Journal}, 29480 year = {1997}, 29481 volume = {107}, 29482 pages = {1405--1430} 29483} 29484 29485@Article{ harrison.rutherford.ea:trade, 29486 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 29487 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 29488 journal = {The World Bank Economic Review}, 29489 year = {1993}, 29490 volume = {7}, 29491 pages = {191--217} 29492} 29493 29494@Article{ hartman.stampacchia:nonlinear, 29495 author = {P. Hartman and G. Stampacchia}, 29496 title = {On some nonlinear differential-functional equations}, 29497 journal = {Acta Mathematica}, 29498 year = {1966}, 29499 volume = {115}, 29500 pages = {271--310} 29501} 29502 29503@Book{ harvey:forecasting, 29504 author = {Andrew C. Harvey}, 29505 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 29506 publisher = {Cambridge University Press}, 29507 address = {New York, NY}, 29508 year = {1989} 29509} 29510 29511@Article{ haurie.marcotte:relationship, 29512 author = {A. Haurie and P. Marcotte}, 29513 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 29514 journal = {Networks}, 29515 year = {1985}, 29516 volume = {15}, 29517 pages = {295--308} 29518} 29519 29520@Article{ hearn.lawphongpanich.ea:restricted, 29521 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 29522 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 29523 journal = {Mathematical Programming Study}, 29524 year = {1987}, 29525 volume = {31}, 29526 pages = {99--118} 29527} 29528 29529@Article{ hearn:gap, 29530 author = {D. W. Hearn}, 29531 title = {The Gap Function of a Convex Program}, 29532 journal = {Operations Research Letters}, 29533 year = {1982}, 29534 volume = {1}, 29535 pages = {67--71} 29536} 29537 29538@Article{ hedlund.gustavsson:design, 29539 author = {P. Hedlund and A. Gustavsson}, 29540 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 29541 Ability}, 29542 journal = {Analytica Chimica Acta}, 29543 year = {1992}, 29544 volume = {259}, 29545 pages = {243--256} 29546} 29547 29548@Article{ helgason.kennington.ea:parallelization, 29549 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 29550 title = {A Parallelization of the Simplex Method}, 29551 journal = {Annals of Operations Research}, 29552 year = {1988}, 29553 volume = {14}, 29554 pages = {17--40} 29555} 29556 29557@Article{ helgason.kennington.ea:polynomially, 29558 author = {Richard Helgason and James Kennington and H. Lall}, 29559 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 29560 journal = {Mathematical Programming}, 29561 year = {1980}, 29562 volume = {18}, 29563 pages = {338--343} 29564} 29565 29566@Book{ henderson.quandt:microeconomic, 29567 author = {J. M. Henderson and R. E. Quandt}, 29568 title = {Microeconomic Theory}, 29569 publisher = {McGraw--Hill}, 29570 address = {New York}, 29571 year = {1980}, 29572 edition = {Third} 29573} 29574 29575@TechReport{ hendrickson.leland:chaco, 29576 author = {B. Hendrickson and R. Leland}, 29577 title = {The {C}haco User's Guide: Version 2}, 29578 institution = {Sandia National Laboratories}, 29579 type = {Technical Report}, 29580 number = {SAND94-2692}, 29581 address = {Albuquerque, New Mexico}, 29582 year = {1994} 29583} 29584 29585@InProceedings{ hendrickson.leland:multilevel, 29586 author = {B. Hendrickson and R. Leland}, 29587 title = {A Multilevel Algorithm for Partitioning Graphs}, 29588 booktitle = {Proceedings of Supercomputing '95}, 29589 year = {1995} 29590} 29591 29592@Book{ hertz.krogh.ea:introduction, 29593 author = {J. Hertz and A. Krogh and R. G. Palmer}, 29594 title = {Introduction to the Theory of Neural Computation}, 29595 year = {1991}, 29596 publisher = {Addison-Wesley}, 29597 address = {Redwood City, California} 29598} 29599 29600@Article{ hertz.werra:tabu, 29601 author = {A. Hertz and D. de Werra}, 29602 title = {Using {T}abu Search techniques for Graph Coloring}, 29603 journal = {Computing}, 29604 year = {1987}, 29605 volume = {29}, 29606 pages = {345--351} 29607} 29608 29609@InCollection{ hettich:review, 29610 author = {R. Hettich}, 29611 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 29612 booktitle = {Semi-Infinite Programming and Applications}, 29613 year = {1983}, 29614 editor = {A. V. Fiacco and K. O. Kortanek}, 29615 publisher = {Springer-Verlag}, 29616 address = {Berlin} 29617} 29618 29619@Article{ highleyman:note, 29620 author = {W. H. Highleyman}, 29621 title = {A Note on Linear Separation}, 29622 journal = {IRE Transactions on Electronic Computers}, 29623 year = {1961}, 29624 volume = {10}, 29625 pages = {777--778} 29626} 29627 29628@Article{ hildreth:quadratic, 29629 author = {C. Hildreth}, 29630 title = {A Quadratic Programming Procedure}, 29631 journal = {Naval Research Logistics Quarterly}, 29632 year = {1957}, 29633 volume = {4}, 29634 pages = {79--85}, 29635 note = {Erratum, p. 361} 29636} 29637 29638@Book{ himmelblau:applied, 29639 author = {D. M. Himmelblau}, 29640 title = {Applied Nonlinear Programming}, 29641 year = {1972}, 29642 publisher = {McGraw--Hill}, 29643 address = {New York} 29644} 29645 29646@Book{ hiriart-urruty.lemarechal:convex, 29647 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 29648 title = {Convex Analysis and Minimization Algorithms {I}}, 29649 year = {1993}, 29650 publisher = {Springer Verlag}, 29651 address = {Berlin}, 29652 volume = {305}, 29653 series = {Grundlehren der mathematischen Wissenschaften} 29654} 29655 29656@TechReport{ hironaka:introduction, 29657 author = {H. Hironaka}, 29658 title = {Introduction to real-analytic sets and real-analytic maps}, 29659 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 29660 year = {1973}, 29661 type = {Technical Report}, 29662 address = {Pisa, Italy} 29663} 29664 29665@Article{ ho.lee.ea:decomposition, 29666 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 29667 title = {Decomposition of Linear Programs Using Parallel Computation}, 29668 journal = {Mathematical Programming}, 29669 year = {1988}, 29670 volume = {42}, 29671 pages = {391--405} 29672} 29673 29674@Article{ ho.loute:computational, 29675 author = {J. K. Ho and E. Loute}, 29676 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 29677 for Linear Programming}, 29678 journal = {Mathematical Programming}, 29679 year = {1983}, 29680 volume = {27}, 29681 pages = {283--290} 29682} 29683 29684@Book{ hock.schittkowski:test, 29685 author = {W. Hock and K. Schittkowski}, 29686 title = {Test Examples for Nonlinear Programming Codes}, 29687 volume = {187}, 29688 series = {Lecture Notes in Economics and Mathematical Systems}, 29689 year = {1981}, 29690 publisher = {Springer Verlag}, 29691 address = {Berlin, Germany} 29692} 29693 29694@Book{ hockney.jesshope:parallel, 29695 author = {R. W. Hockney and C. R. Jesshope}, 29696 title = {Parallel Computers 2}, 29697 publisher = {Adam Hilger}, 29698 year = {1988}, 29699 address = {Bristol} 29700} 29701 29702@Article{ hoffman:approximate, 29703 author = {A. J. Hoffman}, 29704 title = {On Approximate Solutions of Systems of Linear Inequalities}, 29705 journal = {Journal of Research of the National Bureau of Standards}, 29706 year = {1952}, 29707 volume = {49}, 29708 pages = {263--265} 29709} 29710 29711@Article{ hogan:comments, 29712 author = {W. W. Hogan}, 29713 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 29714 for the {USA}}, 29715 journal = {The Energy Journal}, 29716 year = {1990}, 29717 volume = {11}, 29718 pages = {75--84} 29719} 29720 29721@Article{ hogan:energy, 29722 author = {W. W. Hogan}, 29723 title = {Energy Policy Models for {P}roject {I}ndependence}, 29724 journal = {Computers \& Operations Research}, 29725 year = {1975}, 29726 volume = {2}, 29727 pages = {251--271} 29728} 29729 29730@Book{ holland:adaptation, 29731 author = {J. Holland}, 29732 title = {Adaptation in Natural and Artificial Systems}, 29733 year = {1975}, 29734 publisher = {The University of Michigan Press}, 29735 address = {Ann Arbor, Michigan} 29736} 29737 29738@Article{ holmes.mackie:comparison, 29739 author = {T. Holmes and T. R. Mackie}, 29740 title = {A comparison of three inverse treatment planning algorithms}, 29741 journal = {Physics in Medicine and Biology}, 29742 year = {1994}, 29743 volume = {39}, 29744 number = {1}, 29745 pages = {91--106} 29746} 29747 29748@Article{ holmes.mackie:filtered, 29749 author = {T. Holmes and T. R. Mackie}, 29750 title = {A filtered backprojection dose calculation method for inverse treatment 29751 planning}, 29752 journal = {Medical Physics}, 29753 year = {1994}, 29754 volume = {21}, 29755 number = {2}, 29756 pages = {303--313} 29757} 29758 29759@Article{ hooke.jeeves:direct, 29760 author = {R. Hooke and T. A. Jeeves}, 29761 title = {Direct Search Solution of Numerical and Statistical Problems}, 29762 journal = {Journal of Associated Computing Machinery}, 29763 year = {1961}, 29764 volume = {8}, 29765 pages = {212--229} 29766} 29767 29768@Article{ hoppe.mittelmann:multi-grid, 29769 author = {R. H. W. Hoppe and H. D. Mittelmann}, 29770 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 29771 Inequalities}, 29772 journal = {Journal of Computational and Applied Mathematics}, 29773 year = {1989}, 29774 volume = {26}, 29775 pages = {35--46} 29776} 29777 29778@Book{ horn.johnson:matrix, 29779 author = {R. A. Horn and C. R. Johnson}, 29780 title = {Matrix Anaysis}, 29781 publisher = {Cambridge University Press}, 29782 year = {1985}, 29783 address = {Cambridge, England} 29784} 29785 29786@Article{ hornik.stinchcombe.ea:multilayer, 29787 author = {K. Hornik and M. Stinchcombe and H. White}, 29788 title = {Multilayer Feedforward Networks are Universal Approximators}, 29789 journal = {Neural Networks}, 29790 year = {1989}, 29791 volume = {2}, 29792 pages = {359--366} 29793} 29794 29795@Article{ horowitz.sahni:computing, 29796 author = {E. Horowitz and S. Sahni}, 29797 title = {Computing Partitions with Applications to the Knapsack Problem}, 29798 journal = {jacm}, 29799 year = {1974}, 29800 volume = {21}, 29801 pages = {277--292} 29802} 29803 29804@Article{ hristov.fallone:continuous, 29805 author = {D. H. Hristov and B. G. Fallone}, 29806 title = {A continuous penalty function method for inverse treatment planning}, 29807 journal = {Medical Physics}, 29808 year = {1998}, 29809 volume = {25}, 29810 number = {2}, 29811 pages = {208--223} 29812} 29813 29814@Article{ hu.cheng.ea:numerical, 29815 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 29816 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 29817 analysis}, 29818 journal = {Transactions of the {ASME}}, 29819 volume = {116}, 29820 year = {1994}, 29821 pages = {470--478} 29822} 29823 29824@InProceedings{ hua.sheu:skyscraper, 29825 author = {K. A. Hua and S. Sheu}, 29826 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 29827 Video-On-Demand Systems}, 29828 year = {1997}, 29829 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 29830 address = {Cannes, France}, 29831 pages = {89--100} 29832} 29833 29834@Article{ huang.pang:option, 29835 author = {J. Huang and J. S. Pang}, 29836 title = {Option Pricing and Linear Complementarity}, 29837 journal = {Journal of Computational Finance}, 29838 volume = {2}, 29839 year = {1998}, 29840 pages = {31--60} 29841} 29842 29843@InCollection{ huard:resolution, 29844 author = {P. Huard}, 29845 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 29846 of Centers}, 29847 booktitle = {Nonlinear Programming}, 29848 year = {1967}, 29849 editor = {J. Abadie}, 29850 publisher = {North--Holland}, 29851 address = {Amsterdam}, 29852 pages = {207--219} 29853} 29854 29855@Book{ huber:robust, 29856 author = {P. J. Huber}, 29857 title = {Robust Statistics}, 29858 year = {1981}, 29859 publisher = {John Wiley}, 29860 address = {New York} 29861} 29862 29863@Book{ hudson:piecewise, 29864 author = {J. F. P. Hudson}, 29865 title = {Piecewise Linear Topology}, 29866 publisher = {Benjamin}, 29867 address = {New York}, 29868 year = {1969} 29869} 29870 29871@InCollection{ hunter.markusen.ea:north, 29872 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 29873 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 29874 booktitle = {Modeling North American Economic Integration}, 29875 publisher = {Kluwer Academic Publishers}, 29876 year = {1995}, 29877 editor = {T. Kehoe and P. Kehoe}, 29878 pages = {117--130} 29879} 29880 29881@Article{ ibarra.kim:fast, 29882 author = {O. H. Ibarra and C. E. Kim}, 29883 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 29884 journal = {jacm}, 29885 year = {1975}, 29886 volume = {22}, 29887 pages = {463--468} 29888} 29889 29890@Article{ ijiri:fundamental, 29891 author = {Y. Ijiri}, 29892 title = {Fundamental Queries in Aggregation Theory}, 29893 journal = {Journal of the American Statistical Association}, 29894 year = {1971}, 29895 volume = {66}, 29896 pages = {766--782} 29897} 29898 29899@Article{ ingargiola.korsh:reduction, 29900 author = {G. P. Ingargiola and J. F. Korsh}, 29901 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 29902 journal = {Management Science}, 29903 year = {1973}, 29904 volume = {20}, 29905 pages = {460--463} 29906} 29907 29908@Article{ ioffe:variational, 29909 author = {A. D. Ioffe}, 29910 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 29911 Second--Order Directional Derivative}, 29912 journal = {Journal of Mathematical Analysis and its Applications}, 29913 year = {1993} 29914} 29915 29916@Article{ iri.imai:multiplicative, 29917 author = {M. Iri and H. Imai}, 29918 title = {A Multiplicative Barrier Function Method for Linear Programming}, 29919 journal = {Algorithmica}, 29920 year = {1986}, 29921 volume = {1}, 29922 pages = {455--482} 29923} 29924 29925@Article{ isac.goeleven:implicit, 29926 author = {G. Isac and D. Goeleven}, 29927 title = {The Implicit General Order Complementarity Problem, Models and Iterative 29928 Methods}, 29929 journal = {Annals of Operations Research}, 29930 year = {1993} 29931} 29932 29933@Article{ isac.kostreva:generalized, 29934 author = {G. Isac and M. M. Kostreva}, 29935 title = {The Generalized Order Complementarity Problem}, 29936 journal = {Journal of Optimization Theory and Applications}, 29937 volume = {19}, 29938 pages = {227--232}, 29939 year = {1991} 29940} 29941 29942@Book{ isac:complementarity, 29943 author = {G. Isac}, 29944 title = {Complementarity Problems}, 29945 publisher = {Springer-Verlag}, 29946 year = {1992}, 29947 series = {Lecture Notes in Mathematics}, 29948 address = {New York} 29949} 29950 29951@Article{ iusem.svaiter:variant, 29952 author = {A. N. Iusem and B. F. Svaiter}, 29953 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 29954 Search Strategy}, 29955 journal = {Optimization}, 29956 year = {1997}, 29957 volume = {42}, 29958 pages = {309--321} 29959} 29960 29961@Article{ iusem:convergence, 29962 author = {A. N. Iusem}, 29963 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 29964 Problems}, 29965 journal = {Mathematical Programming}, 29966 year = {1993}, 29967 volume = {59}, 29968 pages = {33--48} 29969} 29970 29971@Article{ jackson.kutcher.ea:probability, 29972 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 29973 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 29974 Architecture subject to Non-Uniform Irradiation}, 29975 journal = {Medical Physics}, 29976 year = {1993}, 29977 volume = {20}, 29978 pages = {613--625} 29979} 29980 29981@Article{ jackson:optimization, 29982 author = {A. Jackson and X. H. Wang and R. Mohan}, 29983 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 29984 (abstract)}, 29985 journal = {Medical Physics}, 29986 year = {1994}, 29987 volume = {21}, 29988 pages = {1006} 29989} 29990 29991@TechReport{ jackson:scheduling, 29992 author = {J. R. Jackson}, 29993 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 29994 institution = {University of California}, 29995 year = {1955}, 29996 address = {Los Angeles}, 29997 number = {43}, 29998 type = {Research Report} 29999} 30000 30001@Article{ jansen.roos.ea:polynomiality, 30002 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 30003 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 30004 Complementarity Problems}, 30005 journal = {Mathematical Programming}, 30006 volume = {78}, 30007 pages = {315--346}, 30008 year = {1997} 30009} 30010 30011@Article{ jiang.fukushima.ea:trust, 30012 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 30013 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 30014 journal = {SIAM Journal on Optimization}, 30015 volume = {8}, 30016 pages = {140--157}, 30017 year = {1998} 30018} 30019 30020@Article{ jiang.qi:nonsmooth, 30021 author = {H. Jiang and L. Qi}, 30022 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 30023 journal = {SIAM Journal on Control and Optimization}, 30024 volume = {35}, 30025 pages = {178--193}, 30026 year = {1997} 30027} 30028 30029@TechReport{ jiang.ralph:qpecgen, 30030 author = {H. Jiang and D. Ralph}, 30031 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 30032 Objectives and Affine Variational Inequality Constraints}, 30033 year = {1997}, 30034 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 30035 address = {Australia} 30036} 30037 30038@TechReport{ jiang.ralph:smooth, 30039 author = {H. Jiang and D. Ralph}, 30040 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 30041 Constraints}, 30042 year = {1997}, 30043 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 30044 address = {Australia} 30045} 30046 30047@Article{ jiang:unconstrained, 30048 author = {H. Jiang}, 30049 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 30050 journal = {Journal of Global Optimization, forthcoming}, 30051 year = {1997} 30052} 30053 30054@Article{ jittorntrum.osborne:strong, 30055 author = {K. Jittorntrum and M. R. Osborne}, 30056 title = {Strong uniqueness and second order convergence in nonlinear discrete 30057 approximation}, 30058 journal = {Numerische Mathematik}, 30059 year = {1980}, 30060 volume = {34}, 30061 pages = {439--455} 30062} 30063 30064@InProceedings{ jog.suh.ea:effects, 30065 crossref = {schaeffer:third}, 30066 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 30067 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 30068 Genetic Algorithm for the Travelling Salesman Problem}, 30069 pages = {110--115} 30070} 30071 30072@Article{ jog.suh.ea:parallel, 30073 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 30074 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 30075 journal = {SIAM Journal on Optimization}, 30076 year = {1991}, 30077 volume = {1} 30078} 30079 30080@Article{ johansson.klarbring:rigid, 30081 author = {L. Johansson and A. Klarbring}, 30082 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 30083 Complementarity}, 30084 journal = {Mechanics of Structures \& Machines}, 30085 volume = {20}, 30086 pages = {293--319}, 30087 year = {1992} 30088} 30089 30090@Article{ johnson.aragon.ea:optimization, 30091 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 30092 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 30093 Partitioning}, 30094 journal = {Operations Research}, 30095 year = {1989}, 30096 volume = {37}, 30097 pages = {865--892} 30098} 30099 30100@Article{ johnson:optimally, 30101 author = {R. Johnson}, 30102 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 30103 journal = {Management Science}, 30104 year = {1988}, 30105 volume = {34}, 30106 pages = {240--253} 30107} 30108 30109@Article{ johnsson:solving, 30110 author = {S. L. Johnsson}, 30111 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 30112 journal = {SIAM Journal on Scientific and Statistical Computing}, 30113 year = {1987}, 30114 volume = {8}, 30115 pages = {475--489} 30116} 30117 30118@Article{ jorgenson.wilcoxen:reducing, 30119 author = {D. W. Jorgenson and P. J. Wilcoxen}, 30120 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 30121 journal = {Resource and Energy Economics}, 30122 year = {1993}, 30123 volume = {15}, 30124 pages = {7--25} 30125} 30126 30127@TechReport{ josephy:hogans, 30128 author = {N. H. Josephy}, 30129 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 30130 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 30131 year = {1979}, 30132 address = {Madison, Wisconsin}, 30133 number = {1972}, 30134 type = {Technical Summary Report} 30135} 30136 30137@TechReport{ josephy:newton, 30138 author = {N. H. Josephy}, 30139 title = {A {N}ewton Method for the {PIES} Energy Model}, 30140 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 30141 year = {1979}, 30142 address = {Madison, Wisconsin}, 30143 number = {1971}, 30144 type = {Technical Summary Report} 30145} 30146 30147@PhDThesis{ josephy:newtons, 30148 author = {N. H. Josephy}, 30149 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 30150 year = {1979}, 30151 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30152} 30153 30154@TechReport{ josephy:newtons*1, 30155 author = {N. H. Josephy}, 30156 title = {{N}ewton's Method for Generalized Equations}, 30157 institution = {Mathematics Research Center, University of Wisconsin}, 30158 year = {1979}, 30159 address = {Madison, Wisconsin}, 30160 number = {1965}, 30161 type = {Technical Summary Report} 30162} 30163 30164@TechReport{ josephy:quasi-newton, 30165 author = {N. H. Josephy}, 30166 title = {Quasi--{N}ewton Methods for Generalized Equations}, 30167 institution = {Mathematics Research Center, University of Wisconsin}, 30168 year = {1979}, 30169 address = {Madison, Wisconsin}, 30170 number = {1966}, 30171 type = {Technical Summary Report} 30172} 30173 30174@PhDThesis{ kabbadj:methodes, 30175 author = {S. Kabbadj}, 30176 title = {Methodes Proximales Entropiques}, 30177 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 30178 year = {1994}, 30179 type = {Doctoral Thesis} 30180} 30181 30182@Book{ kall.wallace:stochastic, 30183 author = {P. Kall and S. W. Wallace}, 30184 title = {Stochastic Programming}, 30185 publisher = {John Wiley \& Sons}, 30186 year = {1994}, 30187 address = {Chichester} 30188} 30189 30190@Article{ kallman.agren.ea:tumor, 30191 author = {P. Kallman and A. Agren and A. Brahme}, 30192 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 30193 journal = {International Journal of Radiation Biology}, 30194 year = {1992}, 30195 volume = {62}, 30196 pages = {249--262} 30197} 30198 30199@Misc{ kalvelagen:gams, 30200 author = {Erwin Kalvelagen}, 30201 title = {The {GAMS} {I/O} Library}, 30202 howpublished = {mimeo, GAMS Development Corporation}, 30203 year = {1992}, 30204 note = {Preliminary Version} 30205} 30206 30207@Article{ kaneko:complete, 30208 author = {I. Kaneko}, 30209 title = {Complete solution of a class of elastic-plastic structures}, 30210 journal = {Computer Methods in Applied Mechanics and Engineering}, 30211 volume = {21}, 30212 year = {1980}, 30213 pages = {193--209} 30214} 30215 30216@Article{ kaneko:mathematical, 30217 author = {I. Kaneko}, 30218 title = {A mathematical programming method for the inelastic analysis of reinforced 30219 concrete frames}, 30220 journal = {International Journal for Numerical Methods in Engineering}, 30221 volume = {11}, 30222 year = {1977}, 30223 pages = {1137--1154} 30224} 30225 30226@Article{ kaneko:piecewise, 30227 author = {I. Kaneko}, 30228 title = {Piecewise linear elastic-plastic analysis}, 30229 journal = {International Journal for Numerical Methods in Engineering}, 30230 volume = {14}, 30231 year = {1979}, 30232 pages = {757--767} 30233} 30234 30235@Article{ kanet:minimizing, 30236 author = {J. J. Kanet}, 30237 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 30238 Date}, 30239 journal = {Naval Research Logistics Quarterly}, 30240 year = {1981}, 30241 volume = {28}, 30242 pages = {643--651} 30243} 30244 30245@Article{ kantorovich:mathematical, 30246 author = {L. V. Kantorovich}, 30247 title = {Mathematical Methods in the Organization and Planning of Production}, 30248 journal = {Management Science}, 30249 year = {1960}, 30250 volume = {6}, 30251 pages = {366--422}, 30252 note = {English translation, Russian version 1939} 30253} 30254 30255@Article{ kanzow.fukushima:equivalence, 30256 author = {C. Kanzow and M. Fukushima}, 30257 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 30258 Unconstrained Minimization}, 30259 journal = {Journal of Optimization Theory and Applications}, 30260 year = {1996}, 30261 volume = {90}, 30262 pages = {581--603} 30263} 30264 30265@Article{ kanzow.fukushima:theoretical, 30266 author = {C. Kanzow and M. Fukushima}, 30267 title = {Theoretical and Numerical Investigation of the {D}-gap function for 30268 Box-Constrained Variational Inequalities}, 30269 journal = {Mathematical Programming}, 30270 year = {1998}, 30271 volume = {83}, 30272 pages = {55--88} 30273} 30274 30275@Article{ kanzow.jiang:continuation, 30276 author = {C. Kanzow and H. Jiang}, 30277 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 30278 journal = {Mathematical Programming}, 30279 year = {1998}, 30280 volume = {81}, 30281 pages = {103--125} 30282} 30283 30284@Article{ kanzow.kleinmichel:class, 30285 author = {C. Kanzow and H. Kleinmichel}, 30286 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 30287 Optimization}, 30288 journal = {Optimization Methods and Software}, 30289 year = {1995}, 30290 volume = {5}, 30291 pages = {173--198} 30292} 30293 30294@Article{ kanzow.kleinmichel:new, 30295 author = {C. Kanzow and H. Kleinmichel}, 30296 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 30297 Problems}, 30298 journal = {Computational Optimization and Applications}, 30299 volume = {11}, 30300 pages = {227--251}, 30301 year = {1998} 30302} 30303 30304@Article{ kanzow.pieper:jacobian, 30305 author = {C. Kanzow and H. Pieper}, 30306 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 30307 journal = {SIAM Journal on Optimization}, 30308 year = {1999}, 30309 volume = {9}, 30310 pages = {342--373} 30311} 30312 30313@Article{ kanzow.qi:qp-free, 30314 author = {C. Kanzow and H. -D. Qi}, 30315 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 30316 problems}, 30317 journal = {Mathematical Programming}, 30318 year = {1999}, 30319 volume = {85}, 30320 pages = {81--106} 30321} 30322 30323@Article{ kanzow.yamashita.ea:ncp-functions, 30324 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 30325 title = {New {NCP}-functions and their properties}, 30326 journal = {Journal of Optimization Theory and Applications}, 30327 year = {1997}, 30328 volume = {94}, 30329 pages = {115--135} 30330} 30331 30332@TechReport{ kanzow.zupke:inexact, 30333 author = {C. Kanzow and M. Zupke}, 30334 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 30335 year = {1997}, 30336 institution = {Institute of Applied Mathematics, University of Hamburg}, 30337 type = {Preprint}, 30338 number = {127}, 30339 address = {Hamburg, Germany} 30340} 30341 30342@Article{ kanzow:approach, 30343 author = {C. Kanzow}, 30344 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 30345 {P}-Functions}, 30346 journal = {Operations Research Letters}, 30347 volume = {20}, 30348 year = {1997}, 30349 pages = {85--92} 30350} 30351 30352@Article{ kanzow:equation-based, 30353 author = {C. Kanzow}, 30354 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 30355 journal = {Optimization Methods and Software}, 30356 year = {1994}, 30357 volume = {3}, 30358 pages = {327--340} 30359} 30360 30361@Article{ kanzow:global, 30362 author = {C. Kanzow}, 30363 title = {Global Convergence Properties of Some Iterative Methods for Linear 30364 Complementarity Problems}, 30365 journal = {SIAM Journal on Optimization}, 30366 year = {1996}, 30367 volume = {6}, 30368 pages = {326--341} 30369} 30370 30371@Article{ kanzow:inexact, 30372 author = {C. Kanzow}, 30373 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 30374 journal = {Numerische Mathematik, forthcoming}, 30375 year = {1999} 30376} 30377 30378@Article{ kanzow:noninterior, 30379 author = {C. Kanzow}, 30380 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 30381 journal = {SIAM Journal on Matrix Analysis and Applications}, 30382 volume = {17}, 30383 pages = {851--868}, 30384 year = {1996} 30385} 30386 30387@Article{ kanzow:nonlinear, 30388 author = {C. Kanzow}, 30389 title = {Nonlinear Complementarity as Unconstrained Optimization}, 30390 journal = {Journal of Optimization Theory and Applications}, 30391 year = {1996}, 30392 volume = {88}, 30393 pages = {139--155} 30394} 30395 30396@TechReport{ kanzow:semismooth, 30397 author = {C. Kanzow}, 30398 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 30399 Problems}, 30400 institution = {Institute of Applied Mathematics, University of Hamburg}, 30401 year = {1997}, 30402 type = {Preprint}, 30403 address = {Hamburg, Germany} 30404} 30405 30406@TechReport{ kanzow:tools, 30407 annote = {This should be replaced by kanzow:noninterior}, 30408 author = {C. Kanzow}, 30409 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 30410 institution = {Institute of Applied Mathematics, University of Hamburg}, 30411 year = {1994}, 30412 address = {Germany} 30413} 30414 30415@Article{ kaplan.meier:nonparametric, 30416 author = {E. L. Kaplan and P. Meier}, 30417 title = {Nonparametric Estimation from Incomplete Observations}, 30418 journal = {J. Am. Stat. Assoc.}, 30419 year = {1958}, 30420 volume = {53}, 30421 pages = {457--481} 30422} 30423 30424@Article{ karamardian:complementarity, 30425 author = {S. Karamardian}, 30426 title = {The Complementarity Problem}, 30427 journal = {Mathematical Programming}, 30428 year = {1972}, 30429 volume = {2}, 30430 pages = {107--129} 30431} 30432 30433@Article{ karamardian:complementarity*1, 30434 author = {S. Karamardian}, 30435 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 30436 journal = {Journal of Optimization Theory and Applications}, 30437 year = {1976}, 30438 volume = {18}, 30439 pages = {445--454} 30440} 30441 30442@Article{ karamardian:generalized, 30443 author = {S. Karamardian}, 30444 title = {Generalized Complementarity Problem}, 30445 journal = {Journal of Optimization Theory and Applications}, 30446 year = {1971}, 30447 volume = {8}, 30448 pages = {161--167} 30449} 30450 30451@Article{ karmarkar.karp.ea:probabilistic, 30452 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 30453 title = {Probabilistic Analysis of Optimum Partitioning}, 30454 journal = {Journal of Applied Probability}, 30455 year = {1986}, 30456 volume = {23}, 30457 pages = {626--645} 30458} 30459 30460@Article{ karmarkar:polynomial, 30461 author = {N. Karmarkar}, 30462 title = {A New Polynomial Time Algorithm for Linear Programming}, 30463 journal = {Combinatorica}, 30464 year = {1984}, 30465 volume = {4}, 30466 pages = {373--395} 30467} 30468 30469@Unpublished{ karp:probabilistic, 30470 author = {R. M. Karp}, 30471 title = {Probabilistic Analysis of Algorithms}, 30472 note = {(Lecture Notes)} 30473} 30474 30475@InCollection{ karp:reducibility, 30476 author = {R. M. Karp}, 30477 title = {Reducibility among Combinatorial Problems}, 30478 booktitle = {Complexity of Computer Computations}, 30479 year = {1972}, 30480 editor = {R. E. Miller and J. W. Thatcher}, 30481 publisher = {Plenum Press}, 30482 address = {New York}, 30483 pages = {85--103} 30484} 30485 30486@MastersThesis{ karush:minima, 30487 author = {W. Karush}, 30488 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 30489 year = {1939}, 30490 school = {Department of Mathematics, University of Chicago} 30491} 30492 30493@TechReport{ karypis.kumar:metis, 30494 author = {G. Karypis and V. Kumar}, 30495 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 30496 Version 2.0}, 30497 institution = {University of Minnesota, Department of Computer Science}, 30498 type = {Technical Report}, 30499 address = {Minnesota}, 30500 year = {1995} 30501} 30502 30503@TechReport{ karypis.kumar:multilevel, 30504 author = {G. Karypis and V. Kumar}, 30505 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 30506 institution = {University of Minnesota, Department of Computer Science}, 30507 type = {Technical Report}, 30508 number = {95-064}, 30509 address = {Minnesota}, 30510 year = {1995} 30511} 30512 30513@Article{ katukani:generalization, 30514 author = {S. Katukani}, 30515 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 30516 journal = {Duke Mathematical Journal}, 30517 year = {1941}, 30518 volume = {8}, 30519 pages = {457--459} 30520} 30521 30522@Article{ keifer.wolfowitz:stochastic, 30523 author = {J. Keifer and J. Wolfowitz}, 30524 title = {Stochastic Estimation of the Maximum of a Regression Function}, 30525 journal = {Annals of Mathematical Statistics}, 30526 year = {1952}, 30527 volume = {23}, 30528 pages = {462--466} 30529} 30530 30531@InCollection{ kellog.li.ea:method, 30532 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 30533 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 30534 booktitle = {Computing Fixed Points with Applications}, 30535 year = {1977}, 30536 editor = {S. Karamardian}, 30537 publisher = {Academic Press}, 30538 pages = {133--147} 30539} 30540 30541@Book{ kennington.helgason:algorithms, 30542 author = {J. L. Kennington and R. V. Helgason}, 30543 title = {Algorithms for Network Programming}, 30544 year = {1980}, 30545 publisher = {John Wiley \& Sons}, 30546 address = {New York} 30547} 30548 30549@Article{ kernighan.lin:efficient, 30550 author = {B. W. Kernighan and S. Lin}, 30551 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 30552 journal = {The Bell System Technical Journal}, 30553 pages = {291--307}, 30554 volume = {29}, 30555 year = {1970} 30556} 30557 30558@Article{ khachian:polynomial, 30559 author = {L. G. Khachian}, 30560 title = {A Polynomial Algorithm for Linear Programming}, 30561 journal = {Soviet Mathematics Doklady}, 30562 year = {1979}, 30563 volume = {20}, 30564 pages = {191--194} 30565} 30566 30567@Article{ khobotov:modification, 30568 author = {E. N. Khobotov}, 30569 title = {A Modification of the Extragradient Method for the Solution of Variational 30570 Inequalities and some Optimization Problems}, 30571 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 30572 year = {1987}, 30573 volume = {27}, 30574 pages = {1462--1473} 30575} 30576 30577@Book{ khuri.cornell:response, 30578 author = {A. I. Khuri and J. A. Cornell}, 30579 title = {Response Surfaces: Designs and Analyses}, 30580 publisher = {Marcel Dekker}, 30581 year = {1987}, 30582 address = {New York} 30583} 30584 30585@Article{ kibardin:decomposition, 30586 author = {V. M. Kibardin}, 30587 title = {Decomposition into Functions in the Minimization Problems}, 30588 journal = {Automation and Remote Control}, 30589 year = {1980}, 30590 volume = {40}, 30591 pages = {1311--1323} 30592} 30593 30594@TechReport{ king:sposl, 30595 author = {A. J. King}, 30596 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 30597 institution = {IBM T.J. Watson Research Center}, 30598 year = {1994}, 30599 number = {RC 19757}, 30600 address = {Yorktown Heights, New York} 30601} 30602 30603@Article{ kirkpatrick.gelatt.ea:optimization, 30604 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 30605 title = {Optimization by Simulated Annealing}, 30606 journal = {Science}, 30607 year = {1983}, 30608 volume = {220}, 30609 pages = {671--680} 30610} 30611 30612@Book{ kiwiel:methods, 30613 author = {K. C. Kiwiel}, 30614 title = {Methods of Descent for Nondifferentiable Optimization}, 30615 year = {1985}, 30616 publisher = {Springer-Verlag}, 30617 address = {Berlin}, 30618 series = {Lecture Notes in Mathematics}, 30619 number = {1133} 30620} 30621 30622@Article{ kiwiel:twice, 30623 author = {K. C. Kiwiel}, 30624 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 30625 journal = {Journal of Optimization Theory and Applications}, 30626 year = {1996}, 30627 volume = {88}, 30628 pages = {233--236} 30629} 30630 30631@Article{ klarbring.bjorkman:mathematical, 30632 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 30633 title = {A mathematical programming approach to contact problems with friction and varying 30634 contact surface}, 30635 journal = {Computers \& Structures}, 30636 volume = {30}, 30637 year = {1988}, 30638 pages = {1185--1198} 30639} 30640 30641@Article{ klarbring.bjorkman:solution, 30642 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 30643 title = {Solution of large displacement contact problems with friction using {N}ewton's 30644 method for generalized equations}, 30645 journal = {International Journal for Numerical Methods in Engineering}, 30646 volume = {34}, 30647 year = {1992}, 30648 pages = {249--269} 30649} 30650 30651@Article{ klarbring.pang:existence, 30652 author = {A. Klarbring and J. S. Pang}, 30653 title = {Existence of solution to discrete semicoercive frictional contact problems}, 30654 journal = {{SIAM} Journal on Optimization, under review}, 30655 year = {1996} 30656} 30657 30658@Article{ klarbring:discrete, 30659 author = {A. Klarbring}, 30660 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 30661 (Stability, Uniqueness and Variational Principles)}, 30662 journal = {International Journal on Solids and Structures}, 30663 volume = {24}, 30664 pages = {459--479}, 30665 year = {1988} 30666} 30667 30668@TechReport{ klarbring:large, 30669 author = {A. Klarbring}, 30670 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 30671 Discretization}, 30672 number = {LiTH-IKP-R-798}, 30673 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 30674 address = {Link{\"o}ping}, 30675 year = {1994} 30676} 30677 30678@Article{ klarbring:mathematical, 30679 author = {A. Klarbring}, 30680 title = {A mathematical programming approach to three dimensional contact problems with 30681 friction}, 30682 journal = {Computer Methods in Applied Mechanics and Engineering}, 30683 volume = {58}, 30684 year = {1986}, 30685 pages = {175--200} 30686} 30687 30688@InCollection{ klarbring:mathematical*1, 30689 author = {A. Klarbring}, 30690 title = {Mathematical programming and augmented {L}agrangian methods for frictional 30691 contact problems}, 30692 editor = {A. Curnier}, 30693 booktitle = {Proceedings Contact Mechanics International Symposium}, 30694 publisher = {Presse Polytechniques et Universitaires Romandes}, 30695 address = {Lausanne}, 30696 year = {1992}, 30697 pages = {409--422} 30698} 30699 30700@InCollection{ klarbring:mathematical*2, 30701 author = {A. Klarbring}, 30702 title = {Mathematical programming in contact problems}, 30703 editors = {M. H. Aliabadi and C. A. Brebbia}, 30704 booktitle = {Computational Methods for Contact Problems}, 30705 publisher = {Computational Mechanics Publications}, 30706 address = {Southampton}, 30707 year = {1993}, 30708 pages = {233--264} 30709} 30710 30711@Article{ klarbring:quadratic, 30712 author = {A. Klarbring}, 30713 title = {A quadratic program in frictionless contact problems}, 30714 journal = {International Journal of Engineering Science}, 30715 volume = {24}, 30716 pages = {1207--1217}, 30717 year = {1986} 30718} 30719 30720@InCollection{ klee.minty:how, 30721 author = {V. Klee and G. J. Minty}, 30722 title = {How Good is the Simplex Algorithm?}, 30723 booktitle = {Inequalities--III}, 30724 year = {1972}, 30725 publisher = {Academic Press}, 30726 pages = {159--175} 30727} 30728 30729@Article{ kleywegt.shapiro:sample, 30730 author = {A. Kleywegt and A. Shapiro}, 30731 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 30732 journal = {Stochastic Programming E-Print Series}, 30733 year = {1999}, 30734 note = {Available from dochost.rz.hu-berlin.de/speps} 30735} 30736 30737@Book{ knuth:art, 30738 author = {D. E. Knuth}, 30739 title = {The Art of Computer Programming}, 30740 publisher = {Addison-Wesley Longman Inc.}, 30741 address = {Reading, Massachusetts}, 30742 year = {1998}, 30743 edition = {Third}, 30744 volume = {2} 30745} 30746 30747@InProceedings{ kocvara.outrata:nonsmooth, 30748 author = {M. Ko\v{c}vara and J. V. Outrata}, 30749 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 30750 crossref = {ferris.pang:complementarity}, 30751 pages = {148--164} 30752} 30753 30754@Article{ kocvara.outrata:optimization, 30755 author = {M. Ko\v{c}vara and J. V. Outrata}, 30756 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 30757 volume = {15}, 30758 journal = {Numerical Fucntional Analysis and Optimization}, 30759 year = {1994}, 30760 pages = {869--887} 30761} 30762 30763@InCollection{ kocvara.outrata:solution, 30764 author = {M. Ko\v{c}vara and J. V. Outrata}, 30765 title = {On the solution of optimum design problems with variational inequalities}, 30766 editors = {D. Z. Du and L. Qi and R. Womersley}, 30767 booktitle = {Recent Advances in Nonsmooth Optimization}, 30768 publisher = {World Scientific Publishers}, 30769 address = {Singapore}, 30770 year = {1995}, 30771 pages = {172--192} 30772} 30773 30774@Article{ kojima.hirabayashi:homotopy, 30775 author = {M. Kojima and R. Hirabayashi}, 30776 title = {Continuous deformation of nonlinear programs}, 30777 journal = {Mathematical Programming Study}, 30778 editor = {A.~V. Fiacco}, 30779 publisher = {North--Holland}, 30780 address = {Amsterdam}, 30781 year = {1984}, 30782 volume = {21}, 30783 pages = {150--198} 30784} 30785 30786@Article{ kojima.megiddo.ea:homotopy, 30787 author = {M. Kojima and N. Megiddo and T. Noma}, 30788 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 30789 journal = {Mathematics of Operations Research}, 30790 year = {1991}, 30791 volume = {16}, 30792 pages = {754--774} 30793} 30794 30795@TechReport{ kojima.megiddo.ea:primal-dual, 30796 author = {M. Kojima and N. Megiddo and S. Mizuno}, 30797 title = {A primal-dual exterior point algorithm for linear programming}, 30798 institution = {IBM Alamaden Research Center}, 30799 year = {1991}, 30800 number = {RJ 8500}, 30801 address = {San Jose, California} 30802} 30803 30804@Book{ kojima.megiddo.ea:unified, 30805 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 30806 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 30807 Problems}, 30808 year = {1991}, 30809 publisher = {Springer-Verlag}, 30810 address = {Berlin}, 30811 volume = {538}, 30812 series = {Lecture Notes in Computer Science} 30813} 30814 30815@Article{ kojima.mizuno.ea:continuation, 30816 author = {M. Kojima and S. Mizuno and T. Noma}, 30817 title = {A New Continuation Method for Complementarity Problems with Uniform 30818 {P}-function}, 30819 journal = {Mathematical Programming}, 30820 year = {1989}, 30821 volume = {43}, 30822 pages = {107--113} 30823} 30824 30825@TechReport{ kojima.mizuno.ea:infeasible, 30826 author = {M. Kojima and S. Mizuno and M. Todd}, 30827 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 30828 programming}, 30829 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 30830 year = {1992}, 30831 number = {1023}, 30832 address = {Ithaca, New York}, 30833 month = aug 30834} 30835 30836@Article{ kojima.mizuno.ea:onl, 30837 author = {M. Kojima and S. Mizuno and A. Yoshise}, 30838 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 30839 complementarity problems}, 30840 journal = {Mathematical Programming}, 30841 year = {1991}, 30842 volume = {50}, 30843 pages = {331--342} 30844} 30845 30846@Article{ kojima.mizuno.ea:polynomial-time, 30847 author = {M. Kojima and S. Mizuno and A. Yoshise}, 30848 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 30849 journal = {Mathematical Programming}, 30850 year = {1989}, 30851 volume = {44}, 30852 pages = {1--20} 30853} 30854 30855@Article{ kojima.noma.ea:global, 30856 author = {M. Kojima and T. Noma and A. Yoshise}, 30857 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 30858 journal = {Mathematical Programming}, 30859 volume = {65}, 30860 pages = {43--72}, 30861 year = {1994} 30862} 30863 30864@Article{ kojima.shindo.ea:interior-point, 30865 author = {M. Kojima and S. Shindo and S. Hara}, 30866 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 30867 Problem in Symmetric Matrices}, 30868 journal = {SIAM Journal on Optimization}, 30869 volume = {7}, 30870 pages = {86--125} 30871} 30872 30873@Article{ kojima.shindo:extensions, 30874 author = {M. Kojima and S. Shindo}, 30875 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 30876 Equations}, 30877 journal = {Journal of Operations Research Society of Japan}, 30878 year = {1986}, 30879 volume = {29}, 30880 pages = {352--374} 30881} 30882 30883@Article{ kojima:computational, 30884 author = {M. Kojima}, 30885 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 30886 journal = {Keio Engineering Reports}, 30887 year = {1974}, 30888 volume = {27}, 30889 pages = {1--41} 30890} 30891 30892@Article{ kojima:recent, 30893 author = {M. Kojima}, 30894 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 30895 continuation methods}, 30896 journal = {Systems and Control}, 30897 year = {1981}, 30898 volume = {25}, 30899 pages = {421--430} 30900} 30901 30902@Article{ kolesar:branch, 30903 author = {P. J. Kolesar}, 30904 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 30905 journal = {Management Science}, 30906 year = {1967}, 30907 volume = {13}, 30908 pages = {723--735} 30909} 30910 30911@Book{ kolman.beck:elementary, 30912 author = {B. Kolman and R. E. Beck}, 30913 title = {Elementary Linear Programming with Applications}, 30914 year = {1980}, 30915 publisher = {Academic Press} 30916} 30917 30918@Book{ koopmans:activity, 30919 editor = {T. C. Koopmans}, 30920 title = {Activity Analysis of Production and Allocation}, 30921 publisher = {John Wiley}, 30922 address = {New York}, 30923 year = {1951} 30924} 30925 30926@Article{ korpelevich:extragradient, 30927 author = {G. M. Korpelevich}, 30928 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 30929 journal = {Matecon}, 30930 year = {1976}, 30931 volume = {12}, 30932 pages = {747--756} 30933} 30934 30935@Article{ kortanek.shi:convergence, 30936 author = {K. O. Kortanek and M. Shi}, 30937 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 30938 Algorithm}, 30939 journal = {European Journal of Operational Research}, 30940 year = {1987}, 30941 volume = {32}, 30942 pages = {47--61} 30943} 30944 30945@TechReport{ kortanek.shi:remarks, 30946 author = {K. O. Kortanek and M. Shi}, 30947 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 30948 Hybrid Algorithm 1985-6'}, 30949 institution = {College of Business Administration, University of Iowa}, 30950 year = {1987}, 30951 address = {Iowa City}, 30952 number = {87--1}, 30953 type = {Working Paper} 30954} 30955 30956@TechReport{ kortanek:vector-supercomputer, 30957 author = {K. O. Kortanek}, 30958 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 30959 institution = {College of Business Administration, University of Iowa}, 30960 year = {1987}, 30961 address = {Iowa City}, 30962 number = {87--2}, 30963 type = {Working Paper} 30964} 30965 30966@Article{ kostreva:block, 30967 author = {M. M. Kostreva}, 30968 title = {Block Pivot Methods for Solving the Complementarity Problem}, 30969 journal = {Linear Algebra and Its Applications}, 30970 volume = {21}, 30971 pages = {207--215}, 30972 year = {1978} 30973} 30974 30975@Article{ kostreva:elasto-hydrodynamic, 30976 author = {M. M. Kostreva}, 30977 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 30978 journal = {International Journal for Numerical Methods in Fluids}, 30979 year = {1984}, 30980 volume = {4}, 30981 pages = {377--397} 30982} 30983 30984@Article{ kostreva:recent, 30985 author = {M. M. Kostreva}, 30986 title = {Recent Results on Complementarity Models for Engineering and Economics}, 30987 journal = {Infor, Journal of the Canadian {OR} Society}, 30988 year = {1990}, 30989 volume = {28}, 30990 pages = {324--334} 30991} 30992 30993@Article{ kotiah.steinberg:occurrences, 30994 author = {T. C. T. Kotiah and D. I. Steinberg}, 30995 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 30996 Programming Models}, 30997 journal = {Communications of the ACM}, 30998 volume = {20}, 30999 year = {1977}, 31000 pages = {107--112} 31001} 31002 31003@Article{ kotiah.steinberg:possibility, 31004 author = {T. C. T. Kotiah and D. I. Steinberg}, 31005 title = {On the Possibility of Cycling with the Simplex Method}, 31006 journal = {Operations Research}, 31007 volume = {26}, 31008 year = {1978}, 31009 pages = {374--376} 31010} 31011 31012@InCollection{ kuhn.tucker:nonlinear, 31013 author = {H. W. Kuhn and A. W. Tucker}, 31014 title = {Nonlinear Programming}, 31015 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 31016 Probability}, 31017 year = {1951}, 31018 editor = {J. Neyman}, 31019 publisher = {University of California Press}, 31020 address = {Berkeley and Los Angeles}, 31021 pages = {481--492} 31022} 31023 31024@Article{ kummer:metric, 31025 author = {B. Kummer}, 31026 title = {Metric regularity: characterizations, nonsmooth variations, and successive 31027 approximation}, 31028 journal = {Journal of Mathematical Analysis and its Applications}, 31029 year = {}, 31030 optkey = {}, 31031 optvolume = {}, 31032 optnumber = {}, 31033 optpages = {}, 31034 optmonth = {}, 31035 optnote = {}, 31036 optannote = {} 31037} 31038 31039@InCollection{ kummer:newtons, 31040 author = {B. Kummer}, 31041 title = {{N}ewton's Method for Non--Differentiable Functions}, 31042 booktitle = {Advances in Mathematical Optimization}, 31043 publisher = {Akademie--Verlag}, 31044 year = {1988}, 31045 editors = {J. Guddat et al.}, 31046 pages = {114--125}, 31047 address = {Berlin} 31048} 31049 31050@Unpublished{ kuntsevich.kappel:solvopt, 31051 author = {A. Kuntsevich and F. Kappel}, 31052 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 31053 year = {1997}, 31054 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 31055 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 31056} 31057 31058@Book{ kushner.clark:stochastic, 31059 author = {H. J. Kushner and D. S. Clark}, 31060 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 31061 publisher = {Springer-Verlag}, 31062 year = {1978}, 31063 address = {New York} 31064} 31065 31066@Article{ kutcher.burman.ea:histogram, 31067 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 31068 title = {Histogram reduction method for calculating complication probabilities for 31069 three-dimensional treatment planning evaluation}, 31070 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31071 year = {1991}, 31072 optvolume = {21}, 31073 optpages = {137-146} 31074} 31075 31076@Article{ kutcher.burman:calculation, 31077 author = {G. J. Kutcher and C. Burman}, 31078 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 31079 Irradiation: The Effective Volume Method}, 31080 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31081 year = {1989}, 31082 volume = {16}, 31083 pages = {1623--1630} 31084} 31085 31086@Article{ kwak.lee:complementarity, 31087 author = {B. M. Kwak and B. C. Lee.}, 31088 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 31089 Problem}, 31090 journal = {Computers and Structures}, 31091 volume = {18}, 31092 pages = {469--480}, 31093 year = {1988} 31094} 31095 31096@Article{ kwak:complementarity, 31097 author = {B. M. Kwak}, 31098 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 31099 journal = {Journal of Applied Mechanics}, 31100 volume = {58}, 31101 pages = {134--140}, 31102 year = {1991} 31103} 31104 31105@Article{ lagarias.reeds.ea:convergence, 31106 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 31107 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 31108 journal = {SIAM Journal on Optimization}, 31109 year = {1998}, 31110 volume = {9}, 31111 pages = {112--147} 31112} 31113 31114@Article{ lahaye:methode, 31115 author = {E. Lahaye}, 31116 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 31117 transcendantes}, 31118 journal = {C. R. Acad. Sci. Paris}, 31119 year = {1934}, 31120 volume = {198}, 31121 pages = {1840--1842} 31122} 31123 31124@Article{ lahaye:solution, 31125 author = {E. Lahaye}, 31126 title = {Solution of Systems of Transcendental Equations}, 31127 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 31128 year = {1948}, 31129 volume = {5}, 31130 pages = {805--822} 31131} 31132 31133@Article{ lahenbruch.mickey:estimation, 31134 author = {P. A. Lahenbruch and R. M. Mickey}, 31135 title = {Estimation of Error Rates in Discriminant Analysis}, 31136 journal = {Technometrics}, 31137 year = {1968}, 31138 volume = {10}, 31139 pages = {1--11} 31140} 31141 31142@Article{ lakshminarayan.lakshmanan.ea:optimal, 31143 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 31144 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 31145 journal = {Operations Research}, 31146 year = {1978}, 31147 volume = {26}, 31148 pages = {1079--1082} 31149} 31150 31151@Article{ land.doig:automatic, 31152 author = {A. H. Land and A. G. Doig}, 31153 title = {An Automatic Method for Solving Discrete Programming Problems}, 31154 journal = {Econometrica}, 31155 volume = {28}, 31156 year = {1960}, 31157 pages = {497-520} 31158} 31159 31160@Article{ langer.morrill:comparison, 31161 author = {M. Langer and S. Morrill}, 31162 title = {A comparison of mixed integer programming and fast simulated annealing for 31163 optimized beam weights in radiation therapy}, 31164 journal = {Medical Physics}, 31165 year = {1996}, 31166 volume = {23}, 31167 number = {6}, 31168 pages = {957--964} 31169} 31170 31171@Article{ larsson.patriksson:class, 31172 author = {T. Larsson and M. Patriksson}, 31173 title = {A Class of Gap Functions for Variational Inequalities}, 31174 journal = {Mathematical Programming}, 31175 year = {1994}, 31176 volume = {64}, 31177 pages = {53--79} 31178} 31179 31180@Article{ lasdon.waren.ea:solving, 31181 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 31182 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 31183 Linear Programming Algorithms}, 31184 journal = {ACM SIGMAP Bulletin}, 31185 year = {1979}, 31186 volume = {27}, 31187 pages = {9--15} 31188} 31189 31190@TechReport{ lawler.lenstra.ea:sequencing, 31191 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 31192 title = {Sequencing and Scheduling: Algorithms and Complexity}, 31193 institution = {Centre for Mathematics and Computer Science}, 31194 year = {1989}, 31195 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 31196 number = {BS--R89xx} 31197} 31198 31199@Article{ lawler:fast, 31200 author = {E. L. Lawler}, 31201 title = {Fast Approximations Algorithms for Knapsack Problems}, 31202 journal = {Mathematics of Operations Research}, 31203 year = {1979}, 31204 volume = {4}, 31205 pages = {339--356} 31206} 31207 31208@Book{ lawless:statistical, 31209 author = {J. F. Lawless}, 31210 title = {Statistical Models and Methods for Lifetime Data}, 31211 year = {1982}, 31212 publisher = {John Wiley and Sons}, 31213 address = {New York, NY} 31214} 31215 31216@Article{ lawrence.spingarn:fixed, 31217 author = {J. Lawrence and J. E. Spingarn}, 31218 title = {On fixed points of non-expansive piecewise isometric mappings}, 31219 journal = {Proceedings of the London Mathematical Society}, 31220 year = {1987}, 31221 volume = {55}, 31222 number = {3}, 31223 pages = {605--624} 31224} 31225 31226@Article{ leavitt.martin.ea:dynamic, 31227 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 31228 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 31229 dose delivery}, 31230 journal = {Medical Physics}, 31231 year = {1990}, 31232 volume = {17}, 31233 number = {1}, 31234 pages = {87--92} 31235} 31236 31237@Article{ leblanc.morlok.ea:efficient, 31238 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 31239 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 31240 Problem}, 31241 journal = {Transportation Research}, 31242 volume = {9}, 31243 year = {1975}, 31244 pages = {309--318} 31245} 31246 31247@Article{ lee:computational, 31248 author = {S. S. Lee}, 31249 title = {A computational method for frictional contact problem using finite element 31250 method}, 31251 journal = {International Journal for Numerical Methods in Engineering}, 31252 volume = {37}, 31253 year = {1994}, 31254 pages = {217--228} 31255} 31256 31257@PhDThesis{ lee:military, 31258 author = {D. K. Lee}, 31259 title = {Military Force Planning Problems Under Uncertainty}, 31260 school = {University of Wisconsin -- Madison}, 31261 year = {1996}, 31262 address = {Madison, Wisconsin} 31263} 31264 31265@Article{ leibel.kutcher.ea:improved, 31266 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 31267 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 31268 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 31269 the Nasopharynx}, 31270 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31271 year = {1991}, 31272 volume = {20}, 31273 pages = {823--833} 31274} 31275 31276@Article{ lee.gallagher.ea:treatment, 31277 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 31278 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 31279 Computational Approaches and Experiments with Permanent Prostate Implant 31280 Planning}, 31281 journal = {Physics in Medicine and Biology}, 31282 year = {1999}, 31283 volume = {44}, 31284 pages = {145--165} 31285} 31286 31287@Article{ lemarechal.nemirovskii.ea:variants, 31288 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 31289 title = {New Variants of Bundle Methods}, 31290 year = {1995}, 31291 journal = {Mathematical Programming}, 31292 volume = {69}, 31293 pages = {111--147} 31294} 31295 31296@InCollection{ lemarechal.strodiot.ea:bundle, 31297 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 31298 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 31299 booktitle = {Nonlinear Programming}, 31300 year = {1981}, 31301 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 31302 publisher = {Academic Press}, 31303 pages = {245--282}, 31304 volume = {4} 31305} 31306 31307@Article{ lemke.howson:equilibrium, 31308 author = {C. E. Lemke and J. T. Howson}, 31309 title = {Equilibrium Points of Bimatrix Games}, 31310 journal = {SIAM Journal on Applied Mathematics}, 31311 year = {1964}, 31312 volume = {12}, 31313 pages = {413--423} 31314} 31315 31316@Article{ lemke:bimatrix, 31317 author = {C. E. Lemke}, 31318 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 31319 journal = {Management Science}, 31320 year = {1965}, 31321 volume = {11}, 31322 pages = {681--689} 31323} 31324 31325@InCollection{ lemke:complementary, 31326 author = {C. E. Lemke}, 31327 title = {On Complementary Pivot Theory}, 31328 booktitle = {Mathematics of the Decision Sciences: Part 1}, 31329 publisher = {American Mathematical Society}, 31330 year = {1968}, 31331 editor = {G. B. Dantzig and A. F. Veinott}, 31332 volume = {11}, 31333 series = {Lectures in Applied Mathematics}, 31334 address = {Providence}, 31335 pages = {95--114} 31336} 31337 31338@Article{ levenberg:method, 31339 author = {K. Levenberg}, 31340 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 31341 journal = {Quarterly Applied Mathematics}, 31342 year = {1944}, 31343 volume = {2}, 31344 pages = {164--168} 31345} 31346 31347@Article{ levitin.polyak:constrained, 31348 author = {E. S. Levitin and B. T. Polyak}, 31349 title = {Constrained minimization methods}, 31350 journal = {Computational Mathematics and Mathematical Physics}, 31351 year = {1968}, 31352 volume = {6}, 31353 pages = {1--50}, 31354 note = {Translated from Russian} 31355} 31356 31357@Article{ li.swetis:linear, 31358 author = {W. Li and J. J. Swetits}, 31359 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 31360 journal = {SIAM Journal on Optimization}, 31361 volume = {8}, 31362 pages = {457-475}, 31363 year = {1998} 31364} 31365 31366@TechReport{ li:error, 31367 author = {W. Li}, 31368 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 31369 institution = {Department of Mathematics and Statistics, Old Dominion University}, 31370 year = {1993}, 31371 address = {Norfolk, VA 23529}, 31372 number = {TR93-1}, 31373 note = {SIAM Journal on Control and Optimization, to appear} 31374} 31375 31376@TechReport{ li:linearly, 31377 author = {W. Li}, 31378 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 31379 Quadratic Splines}, 31380 institution = {Department of Mathematics and Statistics, Old Dominion University}, 31381 year = {1993}, 31382 address = {Norfolk, VA 23529}, 31383 number = {TR93-3}, 31384 note = {Journal of Optimization Theory and Applications, to appear} 31385} 31386 31387@InProceedings{ li:merit, 31388 author = {W. Li}, 31389 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 31390 Problems}, 31391 crossref = {ferris.pang:complementarity} 31392} 31393 31394@Article{ li:remarks, 31395 author = {W. Li}, 31396 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 31397 Complementarity Problem}, 31398 journal = {SIAM Journal on Optimization}, 31399 year = {1993}, 31400 volume = {3}, 31401 pages = {155--163} 31402} 31403 31404@TechReport{ li:sharp, 31405 author = {W. Li}, 31406 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 31407 institution = {Department of Mathematics and Statistics, Old Dominion University}, 31408 year = {1991}, 31409 address = {Norfolk, VA 23529}, 31410 number = {TR91-13}, 31411 note = {SIAM Journal on Control and Optimization, to appear} 31412} 31413 31414@Article{ lin.kernighan:efficient, 31415 author = {S. Lin and B. W. Kernighan}, 31416 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 31417 journal = {Operations Research}, 31418 year = {1973}, 31419 volume = {21}, 31420 pages = {498--516} 31421} 31422 31423@Article{ lin.pang:iterative, 31424 author = {Y. Y. Lin and J. S. Pang}, 31425 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 31426 journal = {SIAM Journal on Control and Optimization}, 31427 year = {1987}, 31428 volume = {25}, 31429 pages = {383--411} 31430} 31431 31432@Unpublished{ linderoth:branch, 31433 author = {J. Linderoth}, 31434 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 31435 institution = {Argonne National Laboratories}, 31436 year = {2000}, 31437 note = {Working Paper} 31438} 31439 31440@Article{ lions.stampacchia:variational, 31441 author = {J. L. Lions and G. Stampacchia}, 31442 title = {Variational Inequalities}, 31443 journal = {Communications on Pure and Applied Math}, 31444 year = {1967}, 31445 volume = {20}, 31446 pages = {493--19} 31447} 31448 31449@Article{ lions.mercier:splitting, 31450 author = {P.--L. Lions and B. Mercier}, 31451 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 31452 journal = {SIAM Journal on Numerical Analysis}, 31453 year = {1979}, 31454 volume = {16}, 31455 pages = {964--979} 31456} 31457 31458@Article{ lions:methode, 31459 author = {P.--L. Lions}, 31460 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 31461 journal = {Israel Journal of Mathematics}, 31462 year = {1978}, 31463 volume = {31}, 31464 number = {2}, 31465 pages = {204--208} 31466} 31467 31468@InProceedings{ litzkow.livny.ea:condor, 31469 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 31470 title = {Condor: {A} Hunter of Idle Workstations}, 31471 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 31472 Systems}, 31473 year = {1988}, 31474 pages = {104--111}, 31475 month = jun 31476} 31477 31478@Article{ liu.nocedal:limited, 31479 author = {D. C. Liu and J. Nocedal}, 31480 title = {On the Limited Memory Method for Large Scale Optimization}, 31481 journal = {Mathematical Programming}, 31482 year = {1989}, 31483 volume = {45}, 31484 pages = {503--528} 31485} 31486 31487@InBook{ livny.raman:high, 31488 author = {M. Livny and R. Raman}, 31489 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 31490 chapter = {High Throughput Resource Management}, 31491 publisher = {Morgan Kaufmann Publishers}, 31492 year = {1999}, 31493 pages = {311--337} 31494} 31495 31496@Article{ llacer:inverse, 31497 author = {J. Llacer}, 31498 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 31499 Method}, 31500 journal = {Medical Physics}, 31501 year = {1997}, 31502 volume = {24}, 31503 number = {11}, 31504 pages = {1751--1764} 31505} 31506 31507@Book{ lojasiewicz:ensembles, 31508 author = {M. S. Lojasiewicz}, 31509 title = {Ensembles semi-analytiques}, 31510 publisher = {Institut des Hautes Etudes Scientifiques}, 31511 year = {1964}, 31512 address = {Bures-sur-Yvette} 31513} 31514 31515@Article{ lootsma:logarithmic, 31516 author = {F. A. Lootsma}, 31517 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 31518 journal = {Phillips Research Reports}, 31519 year = {1967}, 31520 volume = {22}, 31521 pages = {329--344} 31522} 31523 31524@InCollection{ lootsma:survey, 31525 author = {F. A. Lootsma}, 31526 title = {A Survey of Methods for Solving Constrained Minimization Problems via 31527 Unconstrained Minimization}, 31528 booktitle = {Numerical Methods for Nonlinear Optimization}, 31529 year = {1972}, 31530 editor = {F. A. Lootsma}, 31531 publisher = {Academic Press}, 31532 address = {London} 31533} 31534 31535@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 31536 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31537 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 31538 Regional Trade Blocks}, 31539 institution = {National Bureau of Economic Research, Inc.}, 31540 year = {1993}, 31541 number = {4512}, 31542 address = {Cambridge, Massechusetts} 31543} 31544 31545@InCollection{ lopezdesilanes.markusen.ea:auto, 31546 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31547 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 31548 year = {1994}, 31549 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 31550 publisher = {Cambridge University Press}, 31551 editor = {C. Shields and J. Francois} 31552} 31553 31554@Article{ lopezdesilanes.markusen.ea:complementarity, 31555 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31556 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 31557 journal = {Journal of Development Economics}, 31558 year = {1994}, 31559 volume = {45}, 31560 pages = {133--151} 31561} 31562 31563@Article{ lopezdesilanes.markusen.ea:trade, 31564 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 31565 title = {Trade Policy Subtleties with Multinational Firms}, 31566 journal = {European Economic Review}, 31567 year = {1996} 31568} 31569 31570@Article{ lotstedt:coulomb, 31571 author = {P. L{\"{o}}tstedt}, 31572 title = {Coulomb friction in two-dimensional rigid body systems}, 31573 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 31574 volume = {61}, 31575 year = {1981}, 31576 pages = {605--615} 31577} 31578 31579@Article{ lotstedt:mechanical, 31580 author = {P. L{\"{o}}tstedt}, 31581 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 31582 journal = {SIAM Journal on Applied Mathematics}, 31583 volume = {42}, 31584 year = {1982}, 31585 pages = {281--296} 31586} 31587 31588@Book{ luenberger:linear, 31589 author = {D. G. Luenberger}, 31590 title = {Linear and Nonlinear Programming}, 31591 year = {1984}, 31592 publisher = {Addison-Wesley}, 31593 edition = {Second} 31594} 31595 31596@Book{ luenberger:optimization, 31597 author = {D. G. Luenberger}, 31598 title = {Optimization by Vector Space Methods}, 31599 year = {1969}, 31600 publisher = {John Wiley \& Sons}, 31601 address = {New York} 31602} 31603 31604@Article{ lundy.mees:convergence, 31605 author = {M. Lundy and A. Mees}, 31606 title = {Convergence of an Annealing Algorithm}, 31607 journal = {Mathematical Programming}, 31608 year = {1986}, 31609 volume = {34}, 31610 pages = {111--124} 31611} 31612 31613@Article{ luo.luo:extension, 31614 author = {X.-D. Luo and Z.-Q. Luo}, 31615 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 31616 journal = {SIAM Journal on Optimization}, 31617 year = {1994}, 31618 volume = {4}, 31619 pages = {383--392} 31620} 31621 31622@Article{ luo.mangasarian.ea:error, 31623 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 31624 title = {New Error Bounds for the Linear Complementarity Problem}, 31625 journal = {Mathematics of Operations Research}, 31626 year = {1994}, 31627 pages = {880--892}, 31628 volume = {19} 31629} 31630 31631@Article{ luo.pang.ea:exact, 31632 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 31633 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 31634 Equilibrium Constraints}, 31635 journal = {Mathematical Programming}, 31636 volume = {75}, 31637 pages = {19--76}, 31638 year = {1996} 31639} 31640 31641@Book{ luo.pang.ea:mathematical, 31642 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 31643 title = {Mathematical Programs with Equilibrium Constraints}, 31644 publisher = {Cambridge University Press}, 31645 year = {1996} 31646} 31647 31648@Article{ luo.pang:error, 31649 author = {Z.-Q. Luo and J. S. Pang}, 31650 title = {Error Bounds for Analytic Systems and their Applications}, 31651 journal = {Mathematical Programming}, 31652 year = {1994}, 31653 volume = {67}, 31654 pages = {1--28} 31655} 31656 31657@Article{ luo.shu.ea:optimizing, 31658 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 31659 title = {Optimizing computerized treatment planning for the Gamma Knife by source 31660 culling}, 31661 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31662 year = {1999}, 31663 volume = {45}, 31664 number = {5}, 31665 pages = {1339--1346} 31666} 31667 31668@InProceedings{ luo.tseng:class, 31669 author = {Z.-Q. Luo and P. Tseng}, 31670 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 31671 crossref = {ferris.pang:complementarity}, 31672 pages = {204--225} 31673} 31674 31675@Article{ luo.tseng:convergence, 31676 author = {Z.-Q. Luo and P. Tseng}, 31677 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 31678 Minimization}, 31679 journal = {Journal of Optimization Theory and Applications}, 31680 year = {1992}, 31681 volume = {72}, 31682 pages = {7--35} 31683} 31684 31685@Article{ luo.tseng:convergence*1, 31686 author = {Z.-Q. Luo and P. Tseng}, 31687 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 31688 Linear Complementarity Problem}, 31689 journal = {SIAM Journal on Control and Optimization}, 31690 year = {1991}, 31691 volume = {29}, 31692 pages = {1037--1060} 31693} 31694 31695@Article{ luo.tseng:convergence*2, 31696 author = {Z.-Q. Luo and P. Tseng}, 31697 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 31698 journal = {Mathematics of Operations Research}, 31699 year = {1993}, 31700 volume = {18}, 31701 pages = {846--867} 31702} 31703 31704@Article{ luo.tseng:error, 31705 author = {Z.--Q. Luo and P. Tseng}, 31706 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 31707 Affine Variational Inequality Problem}, 31708 journal = {SIAM Journal on Optimization}, 31709 year = {1992}, 31710 volume = {2}, 31711 pages = {43--54} 31712} 31713 31714@Article{ luo.tseng:error*1, 31715 author = {Z.-Q. Luo and P. Tseng}, 31716 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 31717 Over a Polyhedral Set}, 31718 journal = {SIAM Journal on Optimization}, 31719 year = {1993}, 31720 volume = {3}, 31721 pages = {43--59} 31722} 31723 31724@Article{ luo.tseng:error*2, 31725 author = {Z.-Q. Luo and P. Tseng}, 31726 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 31727 Approach}, 31728 journal = {Annals of Operations Research}, 31729 year = {1993}, 31730 volume = {46}, 31731 pages = {157--178} 31732} 31733 31734@Article{ luo.tseng:global, 31735 author = {Z.-Q. Luo and P. Tseng}, 31736 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 31737 Problems}, 31738 journal = {Operations Research Letters}, 31739 year = {1992}, 31740 volume = {11}, 31741 pages = {159--165} 31742} 31743 31744@Article{ luo.tseng:linear, 31745 author = {Z.-Q. Luo and P. Tseng}, 31746 title = {On the linear convergence of descent methods for convex essentially smooth 31747 minimization}, 31748 journal = {SIAM Journal on Control and Optimization}, 31749 year = {1992}, 31750 volume = {30}, 31751 pages = {408--425} 31752} 31753 31754@TechReport{ luo:convergence, 31755 author = {Z.-Q. Luo}, 31756 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 31757 Quadratic Programs}, 31758 institution = {Communications Research Laboratory, McMaster University}, 31759 year = {1992}, 31760 address = {Hamilton, Ontario} 31761} 31762 31763@Article{ lustig.marsten.ea:computational, 31764 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 31765 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 31766 Programming}, 31767 journal = {Linear Algebra and Its Applications}, 31768 year = {1991}, 31769 volume = {152}, 31770 pages = {191--222} 31771} 31772 31773@Article{ lustig.marsten.ea:implementing, 31774 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 31775 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 31776 programming}, 31777 journal = {SIAM Journal on Optimization}, 31778 year = {1992}, 31779 volume = {2}, 31780 pages = {435--449} 31781} 31782 31783@Article{ lustig.marsten.ea:interior-point, 31784 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 31785 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 31786 journal = {ORSA Journal on Computing}, 31787 year = {1994}, 31788 volume = {6}, 31789 number = {1}, 31790 pages = {1--38} 31791} 31792 31793@Article{ lyman.wolbarst:optimization, 31794 author = {J. T. Lyman and A. B. Wolbarst}, 31795 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 31796 Algorithm}, 31797 journal = {International Journal of Radiation Oncology, Biology and Physics}, 31798 year = {1989}, 31799 volume = {17}, 31800 pages = {433--436} 31801} 31802 31803@Article{ mackie.holmes.ea:tomotherapy*1, 31804 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 31805 J. Yang and B. Paliwal and T. Kinsella}, 31806 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 31807 journal = {Medical Physics}, 31808 year = {1993}, 31809 volume = {20}, 31810 number = {6}, 31811 pages = {1709--1719} 31812} 31813 31814@Article{ mackie.holmes.ea:tomotherapy*2, 31815 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 31816 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 31817 journal = {Int. J. of Imaging Systems and Technology}, 31818 year = {1995}, 31819 volume = {6}, 31820 pages = {43--55} 31821} 31822 31823@Article{ mackie.scrimger.ea:convolution, 31824 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 31825 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 31826 journal = {Medical Physics}, 31827 year = {1985}, 31828 volume = {12}, 31829 pages = {188--196} 31830} 31831 31832@Article{ mackinnon:technique, 31833 author = {James G. Mac{K}innon}, 31834 title = {A Technique for the Solution of Spatial Equilibrium Models}, 31835 journal = {Journal of Regional Science}, 31836 year = {1976}, 31837 volume = {16}, 31838 pages = {293--307} 31839} 31840 31841@PhDThesis{ madsen:minimization, 31842 author = {K. Madsen}, 31843 title = {Minimization of Nonlinear Approximation Functions}, 31844 year = {1985}, 31845 address = {Lyngby, Denmark}, 31846 school = {Institute of Numerical Analysis, Technical University of Denmark}, 31847 annote = {Dissertation} 31848} 31849 31850@Book{ magill.quinzii:theory, 31851 author = {M. Magill and M. Quinzii}, 31852 title = {Theory of Incomplete Markets}, 31853 publisher = {MIT Press}, 31854 year = {1996} 31855} 31856 31857@InCollection{ magnanti:models, 31858 author = {T. L. Magnanti}, 31859 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 31860 booktitle = {Transportation Planning Models}, 31861 year = {1984}, 31862 editor = {M. Florian}, 31863 publisher = {North Holland}, 31864 pages = {153--186} 31865} 31866 31867@InCollection{ maguregui:modified, 31868 author = {J. Maguregui}, 31869 title = {A modified {N}ewton algorithm for functions over convex sets}, 31870 crossref = {mangasarian.meyer.ea:nonlinear*3}, 31871 pages = {461--473} 31872} 31873 31874@PhDThesis{ maguregui:regular, 31875 author = {J. Maguregui}, 31876 title = {Regular Multivalued Functions and Algorithmic Applications}, 31877 year = {1977}, 31878 address = {Madison, Wisconsin}, 31879 school = {Computer Sciences Department, University of Wisconsin} 31880} 31881 31882@Article{ mahey.oualibouch.ea:proximal, 31883 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 31884 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 31885 journal = {SIAM Journal on Optimization}, 31886 year = {1995}, 31887 volume = {5}, 31888 pages = {454--466} 31889} 31890 31891@Article{ mahey.pham:partial, 31892 author = {P. Mahey and D. T. Pham}, 31893 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 31894 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 31895 year = {1993}, 31896 volume = {27}, 31897 pages = {375--392} 31898} 31899 31900@InCollection{ maier.novati:shakedown, 31901 author = {G. Maier and G. Novati}, 31902 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 31903 geometric effects with reference to discrete structural models}, 31904 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 31905 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 31906 publisher = {Pineridge Press}, 31907 address = {Swansea}, 31908 year = {1990}, 31909 pages = {451--471} 31910} 31911 31912@Article{ maier:incremental, 31913 author = {G. Maier}, 31914 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 31915 Instabilizing Effects}, 31916 journal = {International Journal of Solids and Structures}, 31917 volume = {7}, 31918 year = {1971}, 31919 pages = {345--372} 31920} 31921 31922@InCollection{ maier:inverse, 31923 author = {G. Maier}, 31924 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 31925 booktitle = {Serie VIII}, 31926 publisher = {Academia Nazionale dei Lincei}, 31927 year = {1981}, 31928 volume = {LXX}, 31929 pages = {203--209} 31930} 31931 31932@Article{ maier:matrix, 31933 author = {G. Maier}, 31934 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 31935 yield planes}, 31936 journal = {Meccanica}, 31937 volume = {5}, 31938 year = {1970}, 31939 pages = {54--66} 31940} 31941 31942@Article{ maier:quadratic, 31943 author = {G. Maier}, 31944 title = {A quadratic programming approach for certain classes of nonlinear structural 31945 problems}, 31946 journal = {Meccanica}, 31947 volume = {3}, 31948 year = {1968}, 31949 pages = {121--130} 31950} 31951 31952@Book{ manber:introduction, 31953 author = {U. Manber}, 31954 title = {Introduction to Algorithms: {A} Creative Approach}, 31955 year = {1989}, 31956 publisher = {Addison-Wesley} 31957} 31958 31959@Article{ mangasarian.deleone:error, 31960 author = {O. L. Mangasarian and R. {De~Leone}}, 31961 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 31962 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 31963 journal = {Applied Mathematics and Optimization}, 31964 year = {1988}, 31965 volume = {17}, 31966 pages = {1--14} 31967} 31968 31969@Article{ mangasarian.deleone:parallel, 31970 author = {O. L. Mangasarian and R. {De~Leone}}, 31971 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 31972 Problems and Linear Programs}, 31973 journal = {Journal of Optimization Theory and Applications}, 31974 year = {1987}, 31975 volume = {54}, 31976 pages = {437--446} 31977} 31978 31979@Article{ mangasarian.fromovitz:fritz, 31980 author = {O. L. Mangasarian and S. Fromovitz}, 31981 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 31982 and inequality constraints}, 31983 journal = {Journal of Mathematical Analysis and its Applications}, 31984 year = {1967}, 31985 volume = {17}, 31986 pages = {37--47} 31987} 31988 31989@Article{ mangasarian.mclinden:simple, 31990 author = {O. L. Mangasarian and L. McLinden}, 31991 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 31992 Programs}, 31993 journal = {Mathematical Programming}, 31994 year = {1985}, 31995 volume = {32}, 31996 pages = {32--40} 31997} 31998 31999@Article{ mangasarian.meyer:nonlinear, 32000 author = {O. L. Mangasarian and R. R. Meyer}, 32001 title = {Nonlinear Perturbation of Linear Programs}, 32002 journal = {SIAM Journal on Control and Optimization}, 32003 year = {1979}, 32004 volume = {17}, 32005 pages = {745--752} 32006} 32007 32008@TechReport{ mangasarian.musicant:active, 32009 author = {O. L. Mangasarian and David R. Musicant}, 32010 title = {Active Set Support Vector Machine Classification}, 32011 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32012 year = {2000}, 32013 number = {00-04}, 32014 address = {Madison, Wisconsin} 32015} 32016 32017@TechReport{ mangasarian.musicant:lagrangian, 32018 author = {O. L. Mangasarian and D. R. Musicant}, 32019 title = {Lagrangian Support Vector Machines}, 32020 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32021 year = {2000}, 32022 number = {00-06}, 32023 address = {Madison, Wisconsin} 32024} 32025 32026@TechReport{ mangasarian.musicant:robust, 32027 author = {O. L. Mangasarian and David R. Musicant}, 32028 title = {Robust Linear and Support Vector Regression}, 32029 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32030 year = {1999}, 32031 number = {99-09}, 32032 address = {Madison, Wisconsin} 32033} 32034 32035@Article{ mangasarian.musicant:successive, 32036 author = {O. L. Mangasarian and David R. Musicant}, 32037 title = {Successive Overrelaxation for Support Vector Machines}, 32038 journal = {IEEE Transactions on Neural Networks}, 32039 volume = {10}, 32040 year = {1999}, 32041 pages = {1032-1037} 32042} 32043 32044@Article{ mangasarian.pang:exact, 32045 author = {O. L. Mangasarian and J. S. Pang}, 32046 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 32047 Constraints}, 32048 journal = {Optimization}, 32049 year = {1997}, 32050 volume = {42}, 32051 pages = {1--8} 32052} 32053 32054@Article{ mangasarian.pang:extended, 32055 author = {O. L. Mangasarian and J. S. Pang}, 32056 title = {The Extended Linear Complementarity Problem}, 32057 journal = {SIAM Journal on Matrix Analysis and Applications}, 32058 year = {1994}, 32059 volume = {16} 32060} 32061 32062@Article{ mangasarian.ren:error, 32063 author = {O. L. Mangasarian and J. Ren}, 32064 title = {New error bounds for the nonlinear complementarity problem}, 32065 year = {1994}, 32066 volume = {1}, 32067 pages = {49--56}, 32068 journal = {Communications on Applied Nonlinear Analysis} 32069} 32070 32071@Article{ mangasarian.ren:improved, 32072 author = {O. L. Mangasarian and J. Ren}, 32073 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 32074 year = {1994}, 32075 volume = {66}, 32076 journal = {Mathematical Programming}, 32077 pages = {241--255} 32078} 32079 32080@InProceedings{ mangasarian.setiono.ea:pattern, 32081 crossref = {coleman.li:large-scale}, 32082 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 32083 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 32084 Diagnosis}, 32085 pages = {22--31} 32086} 32087 32088@Article{ mangasarian.shiau:error, 32089 author = {O. L. Mangasarian and T.--H. Shiau}, 32090 title = {Error Bounds for Monotone Linear Complementarity Problems}, 32091 journal = {Mathematical Programming}, 32092 year = {1986}, 32093 volume = {36}, 32094 pages = {81--89} 32095} 32096 32097@Article{ mangasarian.shiau:lipschitz, 32098 author = {O. L. Mangasarian and T.--H. Shiau}, 32099 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 32100 Complementarity Problems}, 32101 journal = {SIAM Journal on Control and Optimization}, 32102 year = {1987}, 32103 volume = {25}, 32104 pages = {583--595} 32105} 32106 32107@Article{ mangasarian.solodov:nonlinear, 32108 author = {O. L. Mangasarian and M. V. Solodov}, 32109 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 32110 journal = {Mathematical Programming}, 32111 year = {1993}, 32112 volume = {62}, 32113 pages = {277--298} 32114} 32115 32116@Article{ mangasarian.solodov:serial, 32117 author = {O. L. Mangasarian and M. V. Solodov}, 32118 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 32119 Minimization}, 32120 year = {1994}, 32121 journal = {Optimization Methods and Software}, 32122 volume = {4}, 32123 pages = {103--116} 32124} 32125 32126@Article{ mangasarian.street.ea:breast, 32127 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 32128 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 32129 journal = {Operations Research}, 32130 year = {1995}, 32131 volume = {43}, 32132 pages = {570--577} 32133} 32134 32135@Article{ mangasarian.wolberg:cancer, 32136 author = {O. L. Mangasarian and W. H. Wolberg}, 32137 title = {Cancer Diagnosis via Linear Programming}, 32138 journal = {SIAM News}, 32139 year = {1990}, 32140 volume = {23}, 32141 pages = {1 \& 18} 32142} 32143 32144@InCollection{ mangasarian:applications, 32145 author = {O. L. Mangasarian}, 32146 title = {Some Applications of Penalty Functions in Mathematical Programming}, 32147 booktitle = {Optimization and Related Fields}, 32148 year = {1986}, 32149 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 32150 publisher = {Springer-Verlag}, 32151 address = {Heidelberg}, 32152 pages = {307--329}, 32153 note = {Lecture Notes in Mathematics 1190} 32154} 32155 32156@Article{ mangasarian:characterization, 32157 author = {O. L. Mangasarian}, 32158 title = {Characterization of linear complementarity problems as linear programs}, 32159 journal = {Mathematical Programming Study}, 32160 year = {1978}, 32161 volume = {7}, 32162 pages = {74--87} 32163} 32164 32165@InProceedings{ mangasarian:condition, 32166 author = {O. L. Mangasarian}, 32167 title = {A condition number for linear inequalities and linear programs}, 32168 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 32169 1981}, 32170 year = {1981}, 32171 editor = {G. Bamberg and O. Opitz}, 32172 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 32173 address = {Konigstein}, 32174 pages = {3--15} 32175} 32176 32177@Article{ mangasarian:convergence, 32178 author = {O. L. Mangasarian}, 32179 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 32180 Symmetric Monotone Linear Complementarity Problem}, 32181 journal = {SIAM Journal on Optimization}, 32182 volume = {1}, 32183 pages = {114--122}, 32184 year = {1991} 32185} 32186 32187@Article{ mangasarian:equivalence, 32188 author = {O. L. Mangasarian}, 32189 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 32190 journal = {SIAM Journal on Applied Mathematics}, 32191 year = {1976}, 32192 volume = {31}, 32193 pages = {89--92} 32194} 32195 32196@Article{ mangasarian:error, 32197 author = {O. L. Mangasarian}, 32198 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 32199 journal = {ORSA Journal on Computing}, 32200 volume = {15}, 32201 pages = {187--192}, 32202 year = {1994} 32203} 32204 32205@Article{ mangasarian:error*1, 32206 author = {O. L. Mangasarian}, 32207 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 32208 journal = {Mathematical Programming}, 32209 year = {1990}, 32210 volume = {48}, 32211 pages = {437--445} 32212} 32213 32214@Article{ mangasarian:generalized, 32215 author = {O. L. Mangasarian}, 32216 title = {Generalized Linear Complementarity Problems as Linear Programs}, 32217 journal = {Methods of Operations Research}, 32218 year = {1979}, 32219 editor = {W. Oettli and F. Steffens}, 32220 volume = {31}, 32221 pages = {393--402} 32222} 32223 32224@InCollection{ mangasarian:generalized*1, 32225 author = {O. L. Mangasarian}, 32226 title = {Generalized Support Vector Machines}, 32227 year = {2000}, 32228 pages = {135-146}, 32229 booktitle = {Advances in Large Margin Classifiers}, 32230 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 32231 publisher = {MIT Press}, 32232 address = {Cambridge, MA} 32233} 32234 32235@Article{ mangasarian:global, 32236 author = {O. L. Mangasarian}, 32237 title = {Global error bounds for monotone affine variational inequality problems}, 32238 journal = {Linear Algebra and Its Applications}, 32239 year = {1992}, 32240 pages = {153--164} 32241} 32242 32243@InCollection{ mangasarian:least, 32244 author = {O. L. Mangasarian}, 32245 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 32246 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 32247 year = {1990}, 32248 publisher = {Oxford University Press}, 32249 address = {New York}, 32250 pages = {217--221} 32251} 32252 32253@Article{ mangasarian:least-norm, 32254 author = {O. L. Mangasarian}, 32255 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 32256 Problem}, 32257 journal = {Journal of Mathematical Analysis and Applications}, 32258 year = {1983}, 32259 volume = {92}, 32260 pages = {240--251} 32261} 32262 32263@Article{ mangasarian:linear, 32264 author = {O. L. Mangasarian}, 32265 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 32266 journal = {Mathematical Programming}, 32267 year = {1976}, 32268 volume = {10}, 32269 pages = {263--270} 32270} 32271 32272@Article{ mangasarian:linear*1, 32273 author = {O. L. Mangasarian}, 32274 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 32275 journal = {Operations Research}, 32276 year = {1965}, 32277 volume = {13}, 32278 pages = {444--452} 32279} 32280 32281@Article{ mangasarian:locally, 32282 author = {O. L. Mangasarian}, 32283 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 32284 Complementarity Problems}, 32285 journal = {Mathematical Programming}, 32286 year = {1980}, 32287 volume = {19}, 32288 pages = {200--212} 32289} 32290 32291@InCollection{ mangasarian:machine, 32292 author = {O. L. Mangasarian}, 32293 title = {Machine Learning via Polyhedral Concave Minimization}, 32294 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 32295 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 32296 pages = {175-188}, 32297 year = {1996}, 32298 address = {Heidelberg}, 32299 publisher = {Physica-Verlag A Springer-Verlag Company} 32300} 32301 32302@Article{ mangasarian:mathematical, 32303 author = {O. L. Mangasarian}, 32304 title = {Mathematical Programming in Neural Networks}, 32305 journal = {ORSA Journal on Computing}, 32306 volume = {5}, 32307 pages = {349--360}, 32308 year = {1993} 32309} 32310 32311@InProceedings{ mangasarian:mathematical*1, 32312 author = {O. L. Mangasarian}, 32313 title = {Mathematical Programming in Machine Learning}, 32314 booktitle = {Nonlinear Optimization and Applications}, 32315 editor = {G. Di Pillo and F. Giannessi}, 32316 publisher = {Plenum Publishing}, 32317 address = {New York}, 32318 pages = {283--295}, 32319 year = {1996} 32320} 32321 32322@Article{ mangasarian:mathematical*2, 32323 author = {O. L. Mangasarian}, 32324 title = {Mathematical Programming in Data Mining}, 32325 journal = {Data Mining and Knowledge Discovery}, 32326 volume = {1}, 32327 year = {1997}, 32328 pages = {183-201} 32329} 32330 32331@Article{ mangasarian:multi-surface, 32332 author = {O. L. Mangasarian}, 32333 title = {Multi-surface Method of Pattern Separation}, 32334 journal = {IEEE Transactions on Information Theory}, 32335 year = {1968}, 32336 volume = {IT-14}, 32337 pages = {801--807} 32338} 32339 32340@Book{ mangasarian:nonlinear, 32341 author = {O. L. Mangasarian}, 32342 title = {Nonlinear Programming}, 32343 year = {1969}, 32344 publisher = {McGraw--Hill}, 32345 address = {New York}, 32346 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 32347} 32348 32349@Article{ mangasarian:normal, 32350 author = {O. L. Mangasarian}, 32351 title = {Normal Solutions of Linear Programs}, 32352 journal = {Mathematical Programming Study}, 32353 year = {1984}, 32354 volume = {22}, 32355 pages = {206--216} 32356} 32357 32358@Article{ mangasarian:optimal, 32359 author = {O. L. Mangasarian}, 32360 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 32361 Linear Programs}, 32362 journal = {Journal of Optimization Theory and Applications}, 32363 year = {1981}, 32364 volume = {35}, 32365 pages = {123--128} 32366} 32367 32368@Article{ mangasarian:parallel, 32369 author = {O. L. Mangasarian}, 32370 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 32371 journal = {SIAM Journal on Control and Optimization}, 32372 volume = {33}, 32373 pages = {1916--1925}, 32374 year = {1995} 32375} 32376 32377@TechReport{ mangasarian:regularized, 32378 author = {O. L. Mangasarian}, 32379 title = {Regularized Linear Programs with Equilibrium Constraints}, 32380 institution = {Computer Sciences Department, University of Wisconsin}, 32381 year = {1997}, 32382 address = {Madison, Wisconsin}, 32383 type = {Mathematical Programming Technical Report}, 32384 number = {97--13}, 32385 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 32386} 32387 32388@Article{ mangasarian:simple, 32389 author = {O. L. Mangasarian}, 32390 title = {A Simple Characterization of Solution Sets of Convex Programs}, 32391 journal = {Operations Research Letters}, 32392 year = {1988}, 32393 volume = {7}, 32394 pages = {21--26} 32395} 32396 32397@Article{ mangasarian:solution, 32398 author = {O. L. Mangasarian}, 32399 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 32400 journal = {Journal of Optimization Theory and Applications}, 32401 year = {1977}, 32402 month = aug, 32403 volume = {22}, 32404 pages = {465--485} 32405} 32406 32407@Article{ mangasarian:stable, 32408 author = {O. L. Mangasarian}, 32409 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 32410 journal = {Linear Algebra and Its Applications}, 32411 year = {1981}, 32412 volume = {41}, 32413 pages = {209--223} 32414} 32415 32416@Article{ mangasarian:sufficiency, 32417 author = {O. L. Mangasarian}, 32418 title = {Sufficiency of Exact Penalty Minimization}, 32419 journal = {SIAM Journal on Control and Optimization}, 32420 year = {1985}, 32421 month = jan, 32422 volume = {23}, 32423 pages = {30--37} 32424} 32425 32426@Article{ mangasarian:unconstrained, 32427 author = {O. L. Mangasarian}, 32428 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 32429 journal = {SIAM Journal on Control and Optimization}, 32430 year = {1975}, 32431 volume = {13}, 32432 pages = {772--791} 32433} 32434 32435@Book{ manne.richels:buying, 32436 author = {A. S. Manne and R. G. Richels}, 32437 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 32438 publisher = {MIT Press}, 32439 year = {1992}, 32440 address = {Cambridge MA} 32441} 32442 32443@Article{ manne.richels:global, 32444 author = {A. S. Manne and R. G. Richels}, 32445 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 32446 journal = {The Energy Journal}, 32447 year = {1991}, 32448 volume = {12}, 32449 pages = {87--107} 32450} 32451 32452@Article{ manne.richels:international, 32453 author = {A. S. Manne and R. G. Richels}, 32454 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 32455 journal = {Economic Review}, 32456 year = {1991}, 32457 volume = {81}, 32458 pages = {135--139} 32459} 32460 32461@Article{ manne.rutherford:international, 32462 author = {A. S. Manne and T. F. Rutherford}, 32463 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 32464 General Equilibrium Model}, 32465 journal = {The Energy Journal}, 32466 year = {1993}, 32467 volume = {14}, 32468 pages = {1--20} 32469} 32470 32471@InCollection{ manne:eta-macro, 32472 author = {A. S. Manne}, 32473 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 32474 booktitle = {Modeling Energy-Economy Interactions}, 32475 year = {1977}, 32476 editor = {C. J. Hitch}, 32477 publisher = {Resources for the Future}, 32478 address = {Washington DC} 32479} 32480 32481@PhDThesis{ maratos:exact, 32482 author = {N. Maratos}, 32483 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 32484 Problems}, 32485 year = {1978}, 32486 school = {Imperial College, University of London} 32487} 32488 32489@Article{ marcotte.dussault:note, 32490 author = {P. Marcotte and J.--P. Dussault}, 32491 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 32492 Inequalities}, 32493 journal = {Operations Research Letters}, 32494 year = {1987}, 32495 volume = {6}, 32496 pages = {35--42} 32497} 32498 32499@Article{ marcotte.zhu:exact, 32500 author = {P. Marcotte and D. L. Zhu}, 32501 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 32502 Problem}, 32503 journal = {Mathematical Programming}, 32504 year = {1996}, 32505 volume = {74}, 32506 pages = {141--158} 32507} 32508 32509@Article{ marcotte:algorithm, 32510 author = {P. Marcotte}, 32511 title = {A New Algorithm for Solving Variational Inequalities with Application to the 32512 Traffic Assignment Problem}, 32513 journal = {Mathematical Programming}, 32514 year = {1985}, 32515 volume = {33}, 32516 pages = {339--351} 32517} 32518 32519@Article{ marcotte:application, 32520 author = {P. Marcotte}, 32521 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 32522 Equilibrium Problems}, 32523 journal = {Information Systems and Operational Research}, 32524 year = {1991}, 32525 volume = {29}, 32526 pages = {258--270} 32527} 32528 32529@Article{ marcotte:network, 32530 author = {P. Marcotte}, 32531 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 32532 journal = {Mathematical Programming}, 32533 year = {1986}, 32534 volume = {34}, 32535 pages = {142--162} 32536} 32537 32538@Article{ markusen.rutherford.ea:el, 32539 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 32540 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 32541 journal = {Cuadernos Economicos de Ice}, 32542 year = {1995}, 32543 volume = {59}, 32544 pages = {57--68} 32545} 32546 32547@Article{ markusen.rutherford.ea:trade, 32548 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 32549 title = {Trade liberalization in a multinational-dominated industry}, 32550 journal = {Journal of International Economics}, 32551 year = {1995}, 32552 volume = {38}, 32553 pages = {95--118} 32554} 32555 32556@Article{ markusen.rutherford:discrete, 32557 author = {J. R. Markusen and T. F. Rutherford}, 32558 title = {Discrete plant-location decisions in an applied general equilibrium model of 32559 trade liberalization}, 32560 journal = {Weltwirtshchaftliches Archiv}, 32561 year = {1994} 32562} 32563 32564@Article{ markusen.wigle:nash, 32565 author = {J. Markusen and R. Wigle}, 32566 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 32567 Country Size, Scale Economies and Capital Mobility}, 32568 journal = {Journal of Political Mobility}, 32569 year = {1989}, 32570 volume = {97}, 32571 pages = {368--386} 32572} 32573 32574@Article{ marquardt:algorithm, 32575 author = {D. W. Marquardt}, 32576 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 32577 journal = {SIAM Journal on Applied Mathematics}, 32578 year = {1963}, 32579 volume = {11}, 32580 pages = {431--441} 32581} 32582 32583@Article{ martello.toth:algorithm, 32584 author = {S. Martello and P. Toth}, 32585 title = {A New Algorithm for the 0--1 Knapsack Problem}, 32586 journal = {Management Science}, 32587 year = {1988}, 32588 volume = {34}, 32589 pages = {633--644} 32590} 32591 32592@InCollection{ martello.toth:algorithms, 32593 author = {S. Martello and P. Toth}, 32594 title = {Algorithms for Knapsack Problems}, 32595 booktitle = {Surveys in Combinatorial Optimization}, 32596 year = {1987}, 32597 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 32598 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 32599 address = {Amsterdam} 32600} 32601 32602@Article{ martello.toth:mixture, 32603 author = {S. Martello and P. Toth}, 32604 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 32605 Problem}, 32606 journal = {Management Science}, 32607 year = {1984}, 32608 volume = {30}, 32609 pages = {765--771} 32610} 32611 32612@Article{ martello.toth:worst-case, 32613 author = {S. Martello and P. Toth}, 32614 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 32615 journal = {Mathematical Programming}, 32616 year = {1984}, 32617 volume = {28}, 32618 pages = {198--205} 32619} 32620 32621@Article{ martinet:regularisation, 32622 author = {Bernard Martinet}, 32623 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 32624 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 32625 year = {1970}, 32626 volume = {4}, 32627 pages = {154--159} 32628} 32629 32630@Article{ maskin.tirole:theory, 32631 author = {E. Maskin and J. Tirole}, 32632 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 32633 fixed costs}, 32634 journal = {Econometrica}, 32635 volume = {56}, 32636 year = {1988}, 32637 pages = {549--569} 32638} 32639 32640@Article{ maskin.tirole:theory*1, 32641 author = {E. Maskin and J. Tirole}, 32642 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 32643 Edgeworth cycles}, 32644 journal = {Econometrica}, 32645 volume = {56}, 32646 year = {1988}, 32647 pages = {571--579} 32648} 32649 32650@Article{ maskus.rutherford.ea:economic, 32651 author = {K. Maskus and T. F. Rutherford and S. Selby}, 32652 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 32653 {M}exico}, 32654 journal = {North American Journal of Economics and Finance}, 32655 year = {1996} 32656} 32657 32658@Article{ mastor:experimental, 32659 author = {A. A. Mastor}, 32660 title = {An Experimental Investigation and Comparative Evaluation of Production Line 32661 Balancing Techniques}, 32662 journal = {Management Science}, 32663 year = {1970}, 32664 volume = {16}, 32665 pages = {728--746} 32666} 32667 32668@Article{ mathias.pang:error, 32669 author = {R. Mathias and J. S. Pang}, 32670 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 32671 journal = {Linear Algebra and Its Applications}, 32672 year = {1990}, 32673 volume = {132}, 32674 pages = {123--136} 32675} 32676 32677@Article{ mathiesen:algorithm, 32678 author = {L. Mathiesen}, 32679 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 32680 {W}alrasian Equilibrium Model: An Example}, 32681 journal = {Mathematical Programming}, 32682 year = {1987}, 32683 volume = {37}, 32684 pages = {1--18} 32685} 32686 32687@Article{ mathiesen:computation, 32688 author = {L. Mathiesen}, 32689 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 32690 Problems}, 32691 journal = {Mathematical Programming Study}, 32692 year = {1985}, 32693 volume = {23}, 32694 pages = {144--162} 32695} 32696 32697@Article{ mathiesen:computational, 32698 author = {L. Mathiesen}, 32699 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 32700 Complementarity Problems}, 32701 journal = {Operations Research}, 32702 year = {1985}, 32703 volume = {33}, 32704 pages = {1225--1250} 32705} 32706 32707@Book{ matlab:users, 32708 author = {{MATLAB}}, 32709 title = {User's Guide}, 32710 year = {1992}, 32711 publisher = {The MathWorks, Inc.} 32712} 32713 32714@Book{ mcclelland.rummelhart:explorations, 32715 author = {J. L. McClelland and D. E. Rummelhart}, 32716 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 32717 Programs, and Exercises}, 32718 year = {1987}, 32719 publisher = {MIT Press}, 32720 address = {Cambridge, Massachusetts} 32721} 32722 32723@Article{ mccormick:modification, 32724 author = {G. P. McCormick}, 32725 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 32726 journal = {Mathematical Programming}, 32727 year = {1977}, 32728 volume = {13}, 32729 pages = {111--115} 32730} 32731 32732@Book{ mccormick:nonlinear, 32733 author = {G. P. McCormick}, 32734 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 32735 year = {1983}, 32736 publisher = {John Wiley \& Sons}, 32737 address = {New York} 32738} 32739 32740@Article{ mcculloch.pitts:logical, 32741 author = {W. McCulloch and W. Pitts}, 32742 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 32743 journal = {Bulletin of Mathematical Biophysics}, 32744 year = {1943}, 32745 volume = {7}, 32746 pages = {115--133} 32747} 32748 32749@TechReport{ mckenna.zenios:optimal, 32750 author = {M. McKenna and S. A. Zenios}, 32751 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 32752 institution = {Thinking Machines Corporation}, 32753 year = {1990}, 32754 type = {Working Paper}, 32755 address = {Cambridge, MA} 32756} 32757 32758@Article{ mckinnon:convergence, 32759 author = {K. I. M. McKinnon}, 32760 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 32761 journal = {SIAM Journal on Optimization}, 32762 year = {1998}, 32763 volume = {9}, 32764 pages = {148--158} 32765} 32766 32767@Article{ mcshane.monma.ea:implementation, 32768 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 32769 title = {An implementation of a primal-dual interior point method for linear programming}, 32770 journal = {ORSA Journal of Computing}, 32771 year = {1989}, 32772 volume = {1}, 32773 pages = {70--83} 32774} 32775 32776@PhDThesis{ medhi:decomposition, 32777 author = {D. Medhi}, 32778 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 32779 Optimization}, 32780 school = {Computer Sciences Department, University of Wisconsin}, 32781 year = {1987}, 32782 address = {Madison, Wisconsin}, 32783 note = {Technical Report 718} 32784} 32785 32786@Article{ medhi:parallel, 32787 author = {D. Medhi}, 32788 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 32789 Programming Problems}, 32790 journal = {Annals of Operations Research}, 32791 year = {1990}, 32792 volume = {22}, 32793 pages = {101--127} 32794} 32795 32796@Article{ megiddo:complexity, 32797 author = {N. Megiddo}, 32798 title = {On the complexity of polyhedral separability}, 32799 journal = {Discrete and Computational Geometry}, 32800 year = {1988}, 32801 volume = {3}, 32802 pages = {325--337} 32803} 32804 32805@Article{ megiddo:finding, 32806 author = {N. Megiddo}, 32807 title = {On Finding Primal-- and Dual--Optimal Bases}, 32808 journal = {ORSA Journal on Computing}, 32809 year = {1991}, 32810 volume = {3}, 32811 pages = {63--65} 32812} 32813 32814@Article{ mehrotra:implementation, 32815 author = {S. Mehrotra}, 32816 title = {On the implementation of a primal-dual interior point method}, 32817 journal = {SIAM Journal on Optimization}, 32818 year = {1992}, 32819 volume = {2}, 32820 pages = {575--601} 32821} 32822 32823@PhDThesis{ merrill:applications, 32824 author = {O. H. Merrill}, 32825 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 32826 Semicontinuous Point to Set Mappings}, 32827 year = {1972}, 32828 school = {University of Michigan} 32829} 32830 32831@Article{ merten.muller:variance, 32832 author = {A. G. Merten and M. E. Muller}, 32833 title = {Variance Minimization in Single Machine Sequencing Problems}, 32834 journal = {Management Science}, 32835 year = {1972}, 32836 volume = {18}, 32837 pages = {518--528} 32838} 32839 32840@TechReport{ meyer:continuity, 32841 author = {R. R. Meyer}, 32842 title = {Continuity Properties of Linear Programs}, 32843 institution = {Computer Sciences Department, University of Wisconsin}, 32844 year = {1979}, 32845 address = {Madison, Wisconsin}, 32846 number = {373} 32847} 32848 32849@Article{ miersemann.mittelmann:continuation, 32850 author = {E. Miersemann and H. D. Mittelmann}, 32851 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 32852 journal = {Journal of Computational and Applied Mathematics}, 32853 year = {1989}, 32854 volume = {26}, 32855 pages = {23--34} 32856} 32857 32858@Article{ mifflin:semismooth, 32859 author = {R. Mifflin}, 32860 title = {Semismooth and semiconvex functions in constrained optimization}, 32861 journal = {SIAM Journal on Control and Optimization}, 32862 year = {1977}, 32863 volume = {15}, 32864 pages = {957--972} 32865} 32866 32867@Article{ mifflin:stable, 32868 author = {R. Mifflin}, 32869 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 32870 journal = {Mathematical Programming}, 32871 vol = {16}, 32872 pages = {141--158}, 32873 year = {1979} 32874} 32875 32876@Book{ miller:survival, 32877 author = {Jr. R. G. Miller}, 32878 title = {Survival Analysis}, 32879 year = {1981}, 32880 publisher = {John Wiley \& Sons}, 32881 address = {New York} 32882} 32883 32884@Book{ minsky.papert:perceptrons, 32885 author = {M. Minsky and S. Papert}, 32886 title = {Perceptrons: An Introduction to Computational Geometry}, 32887 year = {1969}, 32888 publisher = {MIT Press}, 32889 address = {Cambridge, Massachusetts} 32890} 32891 32892@Article{ minty:monotone, 32893 author = {G. J. Minty}, 32894 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 32895 journal = {Duke Mathematics Journal}, 32896 year = {1962}, 32897 volume = {29}, 32898 pages = {341--346} 32899} 32900 32901@Article{ minty:monotonicity, 32902 author = {G. J. Minty}, 32903 title = {On the Monotonicity of the Gradient of a Convex Function}, 32904 journal = {Pacific Journal of Mathematics}, 32905 year = {1964}, 32906 volume = {14}, 32907 pages = {243--247} 32908} 32909 32910@TechReport{ mizuno.jarre.ea:unified, 32911 author = {S. Mizuno and F. Jarre and J. Stoer}, 32912 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 32913 linear complementarity problems}, 32914 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 32915 address = {W{\"{u}}rzburg, Germany}, 32916 year = {1994}, 32917 number = {Nr. 213}, 32918 type = {Preprint} 32919} 32920 32921@TechReport{ mizuno:polynomiality, 32922 author = {S. Mizuno}, 32923 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 32924 for linear programming}, 32925 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 32926 year = {1993}, 32927 number = {1006}, 32928 address = {Ithaca, New York}, 32929 month = jan 32930} 32931 32932@Article{ mohan.mageras.ea:clinically, 32933 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 32934 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 32935 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 32936 journal = {Medical Physics}, 32937 year = {1992}, 32938 volume = {19}, 32939 number = {4}, 32940 pages = {933--944} 32941} 32942 32943@Article{ mohan:field, 32944 author = {R. Mohan}, 32945 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 32946 Collimation}, 32947 journal = {Seminars in Radiation Oncology}, 32948 year = {1995}, 32949 volume = {5}, 32950 number = {2}, 32951 pages = {86--99} 32952} 32953 32954@Article{ monteiro.pang.ea:positive, 32955 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 32956 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 32957 journal = {SIAM Journal on Optimization}, 32958 year = {1995}, 32959 volume = {5}, 32960 pages = {129--148} 32961} 32962 32963@Article{ monteiro.tsuchiya:limiting, 32964 author = {R. D. C. Monteiro and T. Tsuchiya}, 32965 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 32966 Monotone Horizontal Linear Complementarity Problem}, 32967 year = {1996}, 32968 journal = {Mathematics of Operations Research}, 32969 pages = {793--814}, 32970 volume = {21} 32971} 32972 32973@Article{ monteiro.wright:local, 32974 author = {R. D. C. Monteiro and S. J. Wright}, 32975 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 32976 journal = {Computational Optimization and Applications}, 32977 year = {1994}, 32978 volume = {3}, 32979 pages = {131--155} 32980} 32981 32982@Article{ monteiro.wright:superlinear, 32983 author = {R. D. C. Monteiro and S. J. Wright}, 32984 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 32985 year = {1996}, 32986 journal = {SIAM Journal on Optimization}, 32987 volume = {6}, 32988 pages = {1--18} 32989} 32990 32991@Article{ monteiro.wright:superlinear*1, 32992 author = {R. D. C. Monteiro and S. J. Wright}, 32993 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 32994 journal = {Mathematical Programming}, 32995 year = {1995}, 32996 volume = {69}, 32997 pages = {311--333} 32998} 32999 33000@Article{ more.garbow.ea:testing, 33001 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 33002 title = {Testing Unconstrained Optimization Software}, 33003 journal = {ACM Transactions on Mathematical Software}, 33004 year = {1981}, 33005 volume = {7}, 33006 pages = {17--41} 33007} 33008 33009@Article{ more.rheinboldt:p, 33010 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 33011 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 33012 Mappings}, 33013 journal = {Linear Algebra and Its Applications}, 33014 year = {1973}, 33015 volume = {6}, 33016 pages = {45--68} 33017} 33018 33019@Article{ more.sorensen:use, 33020 author = {J. J. Mor\'{e} and D. C. Sorensen}, 33021 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 33022 journal = {Mathematical Programming}, 33023 year = {1979}, 33024 volume = {16}, 33025 pages = {1--20} 33026} 33027 33028@Article{ more.sorensen:computing, 33029 author = {J. J. Mor\'{e} and D. C. Sorensen}, 33030 title = {Computing a Trust Region Step}, 33031 journal = {SIAM Journal on Scientific and Statistical Computing}, 33032 year = {1983}, 33033 volume = {4}, 33034 pages = {553--572} 33035} 33036 33037@Article{ more.toraldo:solution, 33038 author = {J. J. Mor\'e and G. Toraldo}, 33039 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 33040 journal = {SIAM Journal on Optimization}, 33041 year = {1991}, 33042 volume = {1}, 33043 pages = {93--113} 33044} 33045 33046@TechReport{ more.vavasis:solution, 33047 author = {J. J. Mor\'{e} and S. A. Vavasis}, 33048 title = {On the Solution of Concave Knapsack Problems}, 33049 institution = {Argonne National Laboratory}, 33050 year = {1988}, 33051 address = {Argonne, Illinois}, 33052 number = {ANL/MCS--P40--1288}, 33053 type = {Mathematics and Computer Science Division Report} 33054} 33055 33056@Book{ more.wright:optimization, 33057 author = {J. J. Mor\'{e} and S. J. Wright}, 33058 title = {Optimization Software Guide}, 33059 publisher = {SIAM}, 33060 address = {Philadelphia, Pennsylvania}, 33061 series = {Frontiers in Applied Mathematics}, 33062 number = {14}, 33063 year = {1993} 33064} 33065 33066@TechReport{ more.wu:global, 33067 author = {J. J. Mor\'{e} and Z. Wu}, 33068 title = {Global Continuation for Distance Geometry Problems}, 33069 institution = {Argonne National Laboratory}, 33070 year = {1995}, 33071 type = {Preprint}, 33072 number = {MCS-P505-0395}, 33073 address = {Argonne, Illinois} 33074} 33075 33076@TechReport{ more.wu:issues, 33077 author = {J. J. Mor\'{e} and Z. Wu}, 33078 title = {Issues in Large-Scale Global Molecular Optimization}, 33079 institution = {Argonne National Laboratory}, 33080 year = {1995}, 33081 type = {Preprint}, 33082 number = {MCS-P539-1095}, 33083 address = {Argonne, Illinois} 33084} 33085 33086@TechReport{ more:collection, 33087 author = {J. J. Mor\'e}, 33088 title = {A Collection of Nonlinear Model Problems}, 33089 institution = {Argonne National Laboratory}, 33090 year = {1989}, 33091 type = {Preprint}, 33092 address = {Argonne, Illinois}, 33093 number = {MCS-P60-0289} 33094} 33095 33096@Article{ more:global, 33097 author = {J. J. Mor\'e}, 33098 title = {Global Methods for Nonlinear Complementarity Problems}, 33099 year = {1996}, 33100 journal = {Mathematics of Operations Research}, 33101 pages = {589--614}, 33102 volume = {21} 33103} 33104 33105@Article{ moreau:proximite, 33106 author = {J.--J. Moreau}, 33107 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 33108 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 33109 year = {1965}, 33110 volume = {93}, 33111 pages = {273--299} 33112} 33113 33114@Article{ morrill.lane.ea:dose-volume, 33115 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 33116 title = {Dose-volume considerations with linear programming}, 33117 journal = {Medical Physics}, 33118 year = {1991}, 33119 volume = {18}, 33120 number = {6}, 33121 pages = {1201--1210} 33122} 33123 33124@Article{ morrill:very, 33125 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 33126 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 33127 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33128 year = {1995}, 33129 volume = {31}, 33130 pages = {179--188} 33131} 33132 33133@TechReport{ morshedi.tapia:karmarkar, 33134 author = {A. M. Morshedi and R. A. Tapia}, 33135 title = {Karmarkar as a Classical Method}, 33136 institution = {Department of Mathematical Sciences, Rice University}, 33137 year = {1987}, 33138 number = {87--7}, 33139 type = {Technical Report} 33140} 33141 33142@Article{ mosco:dual, 33143 author = {U. Mosco}, 33144 title = {Dual Variational Inequalities}, 33145 journal = {Journal of Mathematical Analysis and its Applications}, 33146 year = {1972}, 33147 volume = {40}, 33148 pages = {202--206} 33149} 33150 33151@Article{ motzkin.schoenberg:relaxation, 33152 author = {T. S. Motzkin and I. J. Schoenberg}, 33153 title = {The relaxation method for linear inequalities}, 33154 journal = {Canadian Journal of Mathematics}, 33155 year = {1954}, 33156 volume = {6}, 33157 pages = {393--404} 33158} 33159 33160@InProceedings{ muhlenbein:parallel, 33161 crossref = {schaeffer:third}, 33162 author = {H. M{\"{}u}hlenbein}, 33163 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 33164 pages = {416--421} 33165} 33166 33167@Article{ mukhopadhyay.roy.ea:polynomial, 33168 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 33169 title = {A polynomial time algorithm for generating neural networks for pattern 33170 classification: Its stability properties and some test results}, 33171 journal = {Neural Computation}, 33172 year = {1993}, 33173 volume = {5}, 33174 pages = {317--330} 33175} 33176 33177@Article{ mulvey.ruszczynski:diagonal, 33178 author = {J. M. Mulvey and A. Ruszczynski}, 33179 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 33180 journal = {Operations Research Letters}, 33181 year = {1992}, 33182 volume = {12}, 33183 pages = {205--215} 33184} 33185 33186@TechReport{ mulvey.ruszczynski:scenario, 33187 author = {J. M. Mulvey and A. Ruszczynski}, 33188 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 33189 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 33190 year = {1991}, 33191 address = {Princeton, New Jersey}, 33192 number = {SOR 91-19}, 33193 type = {Technical Report} 33194} 33195 33196@PhDThesis{ munson:algorithms, 33197 author = {T. S. Munson}, 33198 title = {Algorithms and Environments for Complementarity}, 33199 school = {University of Wisconsin--Madison}, 33200 year = {2000}, 33201 address = {Madison, Wisconsin}, 33202 month = aug, 33203 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 33204} 33205 33206@Article{ munson.facchinei.ea:semismooth, 33207 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 33208 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 33209 journal = {INFORMS Journal on Computing}, 33210 year = {2001}, 33211 volume = {forthcoming} 33212} 33213 33214@Article{ murchland:braess, 33215 author = {J. D. Murchland}, 33216 title = {Braess' Paradox of Traffic Flow}, 33217 journal = {Transportation Research}, 33218 year = {1970}, 33219 volume = {4}, 33220 pages = {391--394} 33221} 33222 33223@Unpublished{ murphy.aha:uci, 33224 author = {P. M. Murphy and D. W. Aha}, 33225 title = {{UCI} Repository of Machine Learning Databases}, 33226 year = {1992}, 33227 note = {Department of Information and Computer Science, University of California, Irvine, 33228 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 33229} 33230 33231@Book{ murphy.lawrence.ea:american, 33232 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 33233 title = {American Cancer Society Textbook of Clinical Oncology}, 33234 publisher = {The American Cancer Society, Inc.}, 33235 address = {Atlanta, Georgia}, 33236 year = {1995} 33237} 33238 33239@Article{ murphy.sherali.ea:mathematical, 33240 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 33241 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 33242 Equilibrium}, 33243 journal = {Mathematical Programming}, 33244 year = {1982}, 33245 volume = {24}, 33246 pages = {92--106} 33247} 33248 33249@TechReport{ murtagh.saunders:minos, 33250 author = {B. A. Murtagh and M. A. Saunders}, 33251 title = {{MINOS} 5.0 User's Guide}, 33252 institution = {Stanford University}, 33253 address = {Stanford, California}, 33254 year = {1983}, 33255 number = {{SOL} 83.20}, 33256 type = {Technical Report} 33257} 33258 33259@InProceedings{ murthy.kasif.ea:oc1, 33260 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 33261 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 33262 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 33263 year = {1993}, 33264 publisher = {The AAAI Press/The MIT Press}, 33265 address = {Cambridge, MA 02142}, 33266 pages = {322--327} 33267} 33268 33269@Book{ murty:linear, 33270 author = {K. G. Murty}, 33271 title = {Linear Complementarity, Linear and Nonlinear Programming}, 33272 year = {1988}, 33273 publisher = {Helderman-Verlag}, 33274 address = {Berlin} 33275} 33276 33277@Book{ murty:linear*1, 33278 author = {K. G. Murty}, 33279 title = {Linear Programming}, 33280 year = {1983}, 33281 publisher = {John Wiley \& Sons}, 33282 address = {New York} 33283} 33284 33285@Article{ murty:number, 33286 author = {K. G. Murty}, 33287 title = {On the number of solutions of the complementarity problem and spanning properties 33288 of cones}, 33289 journal = {Linear Algebra and Its Applications}, 33290 year = {1972}, 33291 volume = {5}, 33292 pages = {65--108} 33293} 33294 33295@Book{ murty:linear*2, 33296 author = {K. G. Murty}, 33297 title = {Linear and Combinatorial Programming}, 33298 year = {1976}, 33299 publisher = {John Wiley \& Sons}, 33300 address = {New York} 33301} 33302 33303@Book{ nagurney:network, 33304 author = {A. Nagurney}, 33305 title = {Network Economics -- {A} Variational Inequality Approach}, 33306 publisher = {Kluwer Academic Publishers}, 33307 year = {1993}, 33308 address = {Dordrecht, The Netherlands} 33309} 33310 33311@Article{ nash.nocedal:numerical, 33312 author = {S. G. Nash and J. Nocedal}, 33313 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 33314 Method for Large Scale Optimization}, 33315 journal = {SIAM Journal on Optimization}, 33316 year = {1991}, 33317 volume = {3}, 33318 pages = {358--372} 33319} 33320 33321@Article{ nash:equilibrium, 33322 author = {J. F. Nash}, 33323 title = {Equilibrium Points in {N}--Person Games}, 33324 journal = {Proceedings of the National Academy of Sciences}, 33325 year = {1950}, 33326 volume = {36}, 33327 pages = {48--49} 33328} 33329 33330@Article{ nash:non-cooperative, 33331 author = {J. F. Nash}, 33332 title = {Non-cooperative games}, 33333 journal = {Annals of Mathematics}, 33334 year = {1951}, 33335 volume = {54}, 33336 pages = {286--295} 33337} 33338 33339@Article{ nash:newton-type, 33340 author = {S. G. Nash}, 33341 title = {{N}ewton--Type Minimization via {L}anczos Method}, 33342 journal = {SIAM Journal on Numerical Analysis}, 33343 year = {1984}, 33344 volume = {21}, 33345 pages = {770--788} 33346} 33347 33348@Article{ nauss:efficient, 33349 author = {R. M. Nauss}, 33350 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 33351 journal = {Management Science}, 33352 year = {1976}, 33353 volume = {23}, 33354 pages = {27--31} 33355} 33356 33357@Book{ nazareth:computer, 33358 author = {J. L. Nazareth}, 33359 title = {Computer Solution of Linear Programs}, 33360 year = {1987}, 33361 publisher = {Oxford University Press}, 33362 address = {Oxford} 33363} 33364 33365@Article{ nelder.mead:simplex, 33366 title = {A Simplex Method for Function Minimization}, 33367 author = {J. A. Nelder and R. Mead}, 33368 journal = {Computer Journal}, 33369 volume = {7}, 33370 pages = {308--313}, 33371 year = {1965} 33372} 33373 33374@Article{ nemhauser.savelsbergh.ea:minto, 33375 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 33376 title = {{MINTO}, {A} Mixed Integer Optimizer}, 33377 journal = {Operations Research Letters}, 33378 year = {1994}, 33379 optkey = {}, 33380 optvolume = {15}, 33381 optnumber = {}, 33382 optpages = {47--58}, 33383 optmonth = {}, 33384 optnote = {}, 33385 optannote = {} 33386} 33387 33388@Book{ nemhauser.wolsey:integer, 33389 author = {G. L. Nemhauser and L. A. Wolsey}, 33390 title = {Integer and Combinatorial Optimization}, 33391 publisher = {John Wiley \& Sons}, 33392 year = {1988}, 33393 address = {New York, NY} 33394} 33395 33396@Article{ nestor.pasurka:alternative, 33397 author = {D. Vaughn Nestor and C. Pasurka}, 33398 title = {Alternative Specifications for Environmental Control Costs in a General 33399 Equilibrium Framework}, 33400 journal = {Economics Letters}, 33401 year = {1995}, 33402 volume = {48}, 33403 pages = {273--280} 33404} 33405 33406@Article{ nestor.pasurka:cge, 33407 author = {D. Vaughn Nestor and C. Pasurka}, 33408 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 33409 of Environmental Policy}, 33410 journal = {Economic Modelling}, 33411 year = {1995}, 33412 volume = {12}, 33413 pages = {53--59} 33414} 33415 33416@Article{ newman.shapiro:theorems, 33417 author = {D. J. Newman and H. S. Shapiro}, 33418 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 33419 journal = {Duke Mathematical Journal}, 33420 year = {1963}, 33421 volume = {30}, 33422 pages = {673--682} 33423} 33424 33425@Article{ ng.peyton:block, 33426 author = {E. Ng and B. Peyton}, 33427 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 33428 journal = {SIAM Journal on Scientific and Statistical Computing}, 33429 year = {1993}, 33430 volume = {14}, 33431 pages = {1034--1056} 33432} 33433 33434@TechReport{ nielsen.zenios:solving, 33435 author = {S. S. Nielsen and S. A. Zenios}, 33436 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 33437 Algorithms}, 33438 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 33439 year = {1992}, 33440 address = {Philadelphia}, 33441 number = {92-01-05} 33442} 33443 33444@Article{ niemierko:optimization, 33445 author = {A. Niemierko}, 33446 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 33447 Points and Constraints}, 33448 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33449 year = {1992}, 33450 volume = {23}, 33451 pages = {99--108} 33452} 33453 33454@InCollection{ niemierko:treatment, 33455 author = {A. Niemierko}, 33456 title = {Treatment Plan Optimization}, 33457 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 33458 editor = {J. A. Purdy and B. Emami}, 33459 publisher = {Medical Physics Publishing}, 33460 year = {1993}, 33461 pages = {49--55}, 33462 address = {St. Louis, Missouri} 33463} 33464 33465@Article{ niemireko:optimization, 33466 author = {A. Niemierko}, 33467 title = {Optimization of intensity modulated beams: Local or global optimum?}, 33468 journal = {Medical Physics}, 33469 year = {1996}, 33470 optvolume = {23}, 33471 optpages = {1072} 33472} 33473 33474@Manual{ nih:radiation, 33475 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 33476 author = {N. C. I. National Institutes of Health}, 33477 organization = {NIH Publication}, 33478 address = {Bethesda, Maryland}, 33479 edition = {97-2227}, 33480 year = {1997} 33481} 33482 33483@Book{ nilsson:learning, 33484 author = {N. J. Nilsson}, 33485 title = {Learning Machines}, 33486 year = {1966}, 33487 publisher = {MIT Press}, 33488 address = {Cambridge, Massachusetts} 33489} 33490 33491@Article{ nocedal:theory, 33492 author = {J. Nocedal}, 33493 title = {Theory of Algorithms for Unconstrained Optimization}, 33494 journal = {Acta Numerica}, 33495 year = {1992}, 33496 pages = {199--242} 33497} 33498 33499@InProceedings{ noyes:neural, 33500 author = {J. L. Noyes}, 33501 title = {Neural Network Optimization Methods}, 33502 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 33503 Processing}, 33504 year = {1991}, 33505 publisher = {Indiana-Purdue University}, 33506 address = {Fort Wayne, Indiana}, 33507 pages = {1--12} 33508} 33509 33510@Article{ nygard.juell.ea:neural, 33511 author = {K. E. Nygard and P. Juell and N. Kadaba}, 33512 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 33513 journal = {ORSA Journal on Computing}, 33514 year = {1990}, 33515 volume = {4}, 33516 pages = {353--364} 33517} 33518 33519@Article{ oh.goenka:elastohydrodynamic, 33520 author = {K. P. Oh and P. K. Goenka}, 33521 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 33522 journal = {Transactions of the {ASME}, Journal of Tribology}, 33523 volume = {107}, 33524 year = {1985}, 33525 pages = {389--395} 33526} 33527 33528@Article{ oh.li.ea:elastohydrodynamic, 33529 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 33530 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 33531 journal = {Transactions of the {ASME}, Journal of Tribology}, 33532 volume = {109}, 33533 pages = {356--362}, 33534 year = {1987} 33535} 33536 33537@Article{ oh:analysis, 33538 author = {K. P. Oh}, 33539 title = {Analysis of a Needle Bearing}, 33540 journal = {Transactions of the {ASME}, Journal of Tribology}, 33541 volume = {106}, 33542 pages = {78--87}, 33543 year = {1984} 33544} 33545 33546@Article{ oh:formulation, 33547 author = {K. P. Oh}, 33548 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 33549 Complementarity Problem}, 33550 journal = {Transactions of the {ASME}, Journal of Tribology}, 33551 volume = {108}, 33552 year = {1986}, 33553 pages = {598--604} 33554} 33555 33556@Article{ oh:numerical, 33557 author = {K. P. Oh}, 33558 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 33559 Nonlinear Complementarity Problem}, 33560 journal = {Transactions of the {ASME}, Journal of Tribology}, 33561 volume = {106}, 33562 year = {1984}, 33563 pages = {88--95} 33564} 33565 33566@Article{ olivera.shepard.ea:maximum, 33567 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 33568 and E. E. Fitchard and T. R. Mackie}, 33569 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 33570 journal = {Physics in Medicine and Biology}, 33571 year = {1998}, 33572 pages = {3277--3294} 33573} 33574 33575@Article{ opial:weak, 33576 author = {Z. Opial}, 33577 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 33578 Mappings}, 33579 journal = {Bulletin of the American Mathematical Society}, 33580 year = {1967}, 33581 volume = {73}, 33582 pages = {591--597} 33583} 33584 33585@Book{ orchard-hays:advanced, 33586 author = {W. Orchard--Hays}, 33587 title = {Advanced Linear Programming Computing Techniques}, 33588 year = {1968}, 33589 publisher = {McGraw--Hill}, 33590 address = {New York} 33591} 33592 33593@Article{ orourke.taylor.ea:factor, 33594 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 33595 title = {Factor price convergence in the late nineteenth century}, 33596 journal = {International Economic Review}, 33597 year = {1996} 33598} 33599 33600@Article{ orourke.williamson:open, 33601 author = {K. O'Rourke and J. G. Williamson}, 33602 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 33603 accounting}, 33604 journal = {Scandinavian Economic and Social History}, 33605 year = {1995}, 33606 volume = {XLIII}, 33607 pages = {171--203} 33608} 33609 33610@Article{ orourke:costs, 33611 author = {K. O'Rourke}, 33612 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 33613 journal = {Research in Economic History}, 33614 year = {1995}, 33615 volume = {15}, 33616 pages = {215--259} 33617} 33618 33619@Article{ orourke:industrial, 33620 author = {K. O'Rourke}, 33621 title = {Industrial policy, employment policy and the non-traded sector}, 33622 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 33623 year = {1996} 33624} 33625 33626@Article{ orourke:measuring, 33627 author = {K. O'Rourke}, 33628 title = {Measuring protection: a cautionary tale}, 33629 journal = {Journal of Development Economics}, 33630 year = {1996} 33631} 33632 33633@Book{ ortega.rheinboldt:iterative, 33634 author = {J. M. Ortega and W. C. Rheinboldt}, 33635 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 33636 year = {1970}, 33637 publisher = {Academic Press}, 33638 address = {San Diego, California} 33639} 33640 33641@Book{ ortega:introduction, 33642 author = {J. M. Ortega}, 33643 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 33644 year = {1988}, 33645 publisher = {Plenum Press}, 33646 address = {New York} 33647} 33648 33649@Book{ ortega:numerical, 33650 author = {J. M. Ortega}, 33651 title = {Numerical Analysis, {A} Second Course}, 33652 year = {1972}, 33653 publisher = {Academic Press} 33654} 33655 33656@Article{ osborne.womersley:strong, 33657 author = {M. R. Osborne and R. S. Womersley}, 33658 title = {Strong uniqueness in sequential linear programming}, 33659 journal = {Journal of the Australian Mathematical Society, Series B}, 33660 year = {1990}, 33661 volume = {31}, 33662 pages = {379--384} 33663} 33664 33665@InCollection{ osborne:strong, 33666 author = {M. R. Osborne}, 33667 title = {Strong uniqueness in nonlinear approximation}, 33668 booktitle = {The numerical solution of nonlinear problems}, 33669 year = {1981}, 33670 editor = {C. T. H. Baker and C. Phillips}, 33671 publisher = {Clarendon Press}, 33672 address = {Oxford} 33673} 33674 33675@Book{ outrata.kocvara.ea:nonsmooth, 33676 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 33677 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 33678 publisher = {Kluwer Academic Publishers}, 33679 year = {1998}, 33680 address = {Dordrecht, The Netherlands} 33681} 33682 33683@Article{ outrata.zowe:numerical, 33684 author = {J. V. Outrata and J. Zowe}, 33685 title = {A Numerical Approach to Optimization Problems with Variational Inequality 33686 Constraints}, 33687 journal = {Mathematical Programming}, 33688 year = {1995}, 33689 volume = {68}, 33690 pages = {105--130} 33691} 33692 33693@Article{ outrata:necessary, 33694 author = {J. V. Outrata}, 33695 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 33696 journal = {Journal of Optimization Theory and Applications}, 33697 volume = {76}, 33698 year = {1993}, 33699 pages = {305--320} 33700} 33701 33702@Article{ outrata:numerical, 33703 author = {J. V. Outrata}, 33704 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 33705 journal = {Zeitschrift f{\"{u}}r Operations Research}, 33706 volume = {4}, 33707 year = {1990}, 33708 pages = {255--278} 33709} 33710 33711@Article{ outrata:optimization, 33712 author = {J. V. Outrata}, 33713 title = {On Optimization Problems with Variational Inequality Constraints}, 33714 journal = {SIAM Journal on Optimization}, 33715 volume = {4}, 33716 year = {1994}, 33717 pages = {340--357} 33718} 33719 33720@Article{ paige.saunders:lsqr, 33721 author = {C. C. Paige and M. A. Saunders}, 33722 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 33723 journal = {{ACM} Transactions on Mathematical Software}, 33724 year = {1982}, 33725 volume = {8}, 33726 pages = {43--71} 33727} 33728 33729@Article{ paige.saunders:solution, 33730 author = {C. C. Paige and M. A. Saunders}, 33731 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 33732 journal = {SIAM Journal on Numerical Analysis}, 33733 year = {1975}, 33734 volume = {12}, 33735 pages = {617--629} 33736} 33737 33738@Article{ palacios-gomez.lasdon.ea:nonlinear, 33739 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 33740 title = {Nonlinear Optimization by Successive Linear Programming}, 33741 journal = {Management Science}, 33742 year = {1982}, 33743 volume = {28}, 33744 pages = {1106--1120} 33745} 33746 33747@Article{ palomares.mangasarian:superlinearly, 33748 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 33749 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 33750 Optimization Problems}, 33751 journal = {Mathematical Programming}, 33752 year = {1976}, 33753 volume = {11}, 33754 pages = {1--13} 33755} 33756 33757@Article{ panagiotopoulos.al-fahed:robot, 33758 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 33759 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 33760 journal = {The International Journal of Robotics Research}, 33761 year = {1994}, 33762 volume = {13}, 33763 pages = {127--136} 33764} 33765 33766@Book{ panagiotopoulos:hemivariational, 33767 author = {P. D. Panagiotopoulos}, 33768 title = {Hemivariational Inequalities}, 33769 publisher = {Springer-Verlag}, 33770 address = {Berlin}, 33771 year = {1993} 33772} 33773 33774@Book{ panagiotopoulos:inequality, 33775 author = {P. D. Panagiotopoulos}, 33776 title = {Inequality Problems in Mechanics and Applications}, 33777 publisher = {Birkh{\"{a}}user}, 33778 address = {Boston}, 33779 year = {1985} 33780} 33781 33782@Article{ pang.chan:iterative, 33783 author = {J. S. Pang and D. Chan}, 33784 title = {Iterative Methods for Variational and Complementarity Problems}, 33785 journal = {Mathematical Programming}, 33786 year = {1982}, 33787 volume = {24}, 33788 pages = {284--313} 33789} 33790 33791@Article{ pang.gabriel:nesqp, 33792 author = {J. S. Pang and S. A. Gabriel}, 33793 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 33794 journal = {Mathematical Programming}, 33795 year = {1993}, 33796 volume = {60}, 33797 pages = {295--338} 33798} 33799 33800@Article{ pang.han.ea:minimization, 33801 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 33802 title = {Minimization of Locally {L}ipschitzian Functions}, 33803 journal = {SIAM Journal on Optimization}, 33804 year = {1991}, 33805 volume = {1}, 33806 pages = {57--82} 33807} 33808 33809@Article{ pang.qi:nonsmooth, 33810 author = {J. S. Pang and L. Qi}, 33811 title = {Nonsmooth Equations: Motivation and Algorithms}, 33812 journal = {SIAM Journal on Optimization}, 33813 year = {1993}, 33814 volume = {3}, 33815 pages = {443--465} 33816} 33817 33818@Article{ pang.trinkle.ea:complementarity, 33819 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 33820 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 33821 journal = {Computational Optimization and Applications}, 33822 volume = {5}, 33823 pages = {97--138}, 33824 year = {1996} 33825} 33826 33827@Article{ pang.trinkle:complementarity, 33828 author = {J. S. Pang and J. C. Trinkle}, 33829 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 33830 Contact Problems with {C}oulomb Friction}, 33831 year = {1996}, 33832 journal = {Mathematical Programming}, 33833 volume = {73}, 33834 pages = {199--226} 33835} 33836 33837@TechReport{ pang.wang:embedding, 33838 author = {J. S. Pang and Z. P. Wang}, 33839 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 33840 Problems}, 33841 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 33842 year = {1990}, 33843 address = {Baltimore, Maryland} 33844} 33845 33846@TechReport{ pang.yang:parallel, 33847 author = {J. S. Pang and J. M. Yang}, 33848 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 33849 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 33850 year = {1987}, 33851 address = {Baltimore, Maryland}, 33852 type = {Manuscript} 33853} 33854 33855@Article{ pang.yu:linearized, 33856 author = {J. S. Pang and C. S. Yu}, 33857 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 33858 Networks}, 33859 journal = {Networks}, 33860 volume = {14}, 33861 pages = {427--438}, 33862 year = {1984} 33863} 33864 33865@Article{ pang:b-differentiable, 33866 author = {J. S. Pang}, 33867 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 33868 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 33869 Inequality Problems}, 33870 journal = {Mathematical Programming}, 33871 year = {1991}, 33872 volume = {51}, 33873 pages = {101--132} 33874} 33875 33876@InCollection{ pang:complementarity, 33877 author = {J. S. Pang}, 33878 title = {Complementarity Problems}, 33879 booktitle = {Handbook in Global Optimization}, 33880 publisher = {Kluwer Academic Publishers}, 33881 year = {1994}, 33882 editor = {R. Horst and P. Pardalos}, 33883 address = {Boston} 33884} 33885 33886@Article{ pang:convergence, 33887 author = {J. S. Pang}, 33888 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 33889 Problem}, 33890 journal = {Journal of Optimization Theory and Applications}, 33891 year = {1982}, 33892 volume = {37}, 33893 pages = {149--162} 33894} 33895 33896@Article{ pang:convergence*1, 33897 author = {J. S. Pang}, 33898 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 33899 Application of some Sensitivity Results}, 33900 journal = {Mathematical Programming}, 33901 year = {1993}, 33902 volume = {58}, 33903 pages = {149--160} 33904} 33905 33906@Article{ pang:inexact, 33907 author = {J. S. Pang}, 33908 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 33909 journal = {Mathematical Programming}, 33910 year = {1986}, 33911 volume = {36}, 33912 pages = {54--71} 33913} 33914 33915@Article{ pang:more, 33916 author = {J. S. Pang}, 33917 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 33918 Complementarity Problem}, 33919 journal = {Journal of Optimization Theory and Applications}, 33920 year = {1986}, 33921 volume = {49}, 33922 pages = {107--134} 33923} 33924 33925@Article{ pang:more*1, 33926 author = {J. S. Pang}, 33927 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 33928 Complementarity Problems}, 33929 journal = {Journal of Optimization Theory and Applications}, 33930 year = {1986}, 33931 volume = {49}, 33932 pages = {107--134} 33933} 33934 33935@Article{ pang:necessary, 33936 author = {J. S. Pang}, 33937 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 33938 the Linear Complementarity Problem}, 33939 journal = {Journal of Optimization Theory and Applications}, 33940 year = {1984}, 33941 volume = {42}, 33942 pages = {1--17} 33943} 33944 33945@Article{ pang:newtons, 33946 author = {J. S. Pang}, 33947 title = {{N}ewton's Method for {B}--Differentiable Equations}, 33948 journal = {Mathematics of Operations Research}, 33949 year = {1990}, 33950 volume = {15}, 33951 pages = {311--341} 33952} 33953 33954@Article{ pang:posteriori, 33955 author = {J. S. Pang}, 33956 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 33957 Problem}, 33958 journal = {Mathematics of Operations Research}, 33959 year = {1987}, 33960 volume = {12}, 33961 pages = {474--484} 33962} 33963 33964@Article{ pantoja.mayne:sequential, 33965 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 33966 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 33967 with Control Inequality Constraints}, 33968 journal = {International Journal on Control}, 33969 year = {1991}, 33970 volume = {53}, 33971 pages = {823--836} 33972} 33973 33974@Book{ papadimitriou.steiglitz:combinatorial, 33975 author = {C. H. Papadimitriou and K. Steiglitz}, 33976 title = {Combinatorial Optimization: Algorithms and Complexity}, 33977 year = {1982}, 33978 publisher = {Prentice-Hall, Inc}, 33979 address = {Englewood Cliffs, New Jersey} 33980} 33981 33982@Article{ papanikolau.mackie.ea:investigation, 33983 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 33984 Reckwerdt}, 33985 title = {Investigation of the convolution method for polyenergetic spectra}, 33986 journal = {Medical Physics}, 33987 year = {1993}, 33988 volume = {20}, 33989 number = {5}, 33990 pages = {1327--1336} 33991} 33992 33993@Article{ parisot:resolution, 33994 author = {G. R. Parisot}, 33995 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 33996 Lin\'{e}aire par Application de la Programmation Logarithmique}, 33997 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 33998 year = {1961}, 33999 volume = {20}, 34000 pages = {227--259} 34001} 34002 34003@Article{ parker.cave.ea:comparison, 34004 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 34005 title = {Comparison of Simplex Algorithms}, 34006 journal = {Analytica Chimica Acta}, 34007 year = {1985}, 34008 volume = {175}, 34009 pages = {231--237} 34010} 34011 34012@InProceedings{ parker:optimal, 34013 author = {D. Parker}, 34014 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 34015 Second Order Hebbian Learning}, 34016 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 34017 II}, 34018 year = {1987}, 34019 address = {San Diego:IEEE}, 34020 pages = {593--600} 34021} 34022 34023@Book{ pascali.sburlan:nonlinear, 34024 author = {D. Pascali and S. Sburlan}, 34025 title = {Nonlinear Mappings of Monotone Type}, 34026 publisher = {Editura Academeie}, 34027 year = {1978} 34028} 34029 34030@Article{ passty:ergodic, 34031 author = {G. B. Passty}, 34032 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 34033 space}, 34034 journal = {Journal of Mathematical Analysis and Applications}, 34035 year = {1979}, 34036 volume = {72}, 34037 pages = {383--390} 34038} 34039 34040@Article{ peaceman.rachford:numerical, 34041 author = {D. W. Peaceman and H. H. Rachford}, 34042 title = {The numerical solution of parabolic and elliptic differential equations}, 34043 journal = {SIAM Journal}, 34044 year = {1955}, 34045 volume = {3}, 34046 pages = {28--41} 34047} 34048 34049@Book{ peck.tiesberg:global, 34050 author = {S. Peck and T. Tiesberg}, 34051 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 34052 {CETA}}, 34053 publisher = {The Electric Power Institute}, 34054 year = {1992}, 34055 address = {Paolo Alto CA} 34056} 34057 34058@TechReport{ peng:convexity, 34059 author = {J. -M. Peng}, 34060 title = {The Convexity of the Implicit {L}agrangian}, 34061 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 34062 year = {1995}, 34063 type = {Technical Report}, 34064 address = {Beijing} 34065} 34066 34067@Article{ peng:equivalence, 34068 author = {J. -M. Peng}, 34069 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 34070 journal = {Mathematical Programming}, 34071 year = {1997}, 34072 volume = {78}, 34073 pages = {347--356} 34074} 34075 34076@Article{ pennisi:taking, 34077 author = {E. Pennisi}, 34078 title = {Taking a structured approach to understanding proteins}, 34079 journal = {Science}, 34080 year = {1998}, 34081 volume = {279}, 34082 pages = {978--979} 34083} 34084 34085@Article{ penot:regularity, 34086 author = {J. P. Penot}, 34087 title = {On regularity conditions in mathematical programming}, 34088 journal = {Mathematical Programming Study}, 34089 year = {1982}, 34090 volume = {17}, 34091 pages = {28--66} 34092} 34093 34094@Book{ perez:principles, 34095 author = {C. A. Perez and L. W. Brady}, 34096 title = {Principles and practice of radiotherapy}, 34097 publisher = {Lippincott-Raven}, 34098 year = {1998}, 34099 address = {Philadelphia}, 34100 edition = {3rd} 34101} 34102 34103@Article{ perroni.rutherford:international, 34104 author = {C. Perroni and T. Rutherford}, 34105 title = {International Trade in Carbon Emission Rights and Basic Materials: General 34106 Equilibrium Calculations for 2020}, 34107 journal = {Scandinavian Journal of Economics}, 34108 year = {1993} 34109} 34110 34111@Article{ perroni.rutherford:regular, 34112 author = {C. Perroni and T. Rutherford}, 34113 title = {Regular Flexibility of Nested {CES} Functions}, 34114 journal = {European Economic Review}, 34115 year = {1995}, 34116 volume = {39}, 34117 pages = {335--343} 34118} 34119 34120@InCollection{ perroni.wigle:environmental, 34121 author = {C. Perroni and R. M. Wigle}, 34122 title = {Environmental Policy Modeling}, 34123 booktitle = {Global Trade Analysis: Modeling and Applications}, 34124 publisher = {Cambridge University Press}, 34125 year = {1996}, 34126 editor = {T. Hertel} 34127} 34128 34129@Article{ peterson:review, 34130 author = {D. W. Peterson}, 34131 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 34132 journal = {SIAM Review}, 34133 year = {1973}, 34134 volume = {15}, 34135 pages = {639--654} 34136} 34137 34138@PhDThesis{ petersson:optimization, 34139 author = {J. Petersson}, 34140 title = {Optimization of Structures in Unilateral Contact}, 34141 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 34142 number = {397}, 34143 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 34144 University}, 34145 address = {Link{\"o}ping, Sweden}, 34146 year = {1995} 34147} 34148 34149@Book{ petri:modelling, 34150 author = {P. Petri}, 34151 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 34152 publisher = {Harvard University Press}, 34153 year = {1984} 34154} 34155 34156@InProceedings{ petrzykowski:application, 34157 author = {T. Petrzykowski}, 34158 title = {Application of the Steepest Ascent Method to Concave Programming}, 34159 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 34160 year = {1962}, 34161 publisher = {North--Holland}, 34162 address = {Amsterdam}, 34163 pages = {185--189} 34164} 34165 34166@InProceedings{ pettey.leuze.ea:parallel, 34167 crossref = {grefenstette:genetic}, 34168 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 34169 title = {A Parallel Genetic Algorithm}, 34170 pages = {155--161} 34171} 34172 34173@InProceedings{ pettey.leuze:theoretical, 34174 crossref = {schaeffer:third}, 34175 author = {C. C. Pettey and M. R. Leuze}, 34176 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 34177 pages = {398--405} 34178} 34179 34180@Book{ pfeiffer.glocker:multibody, 34181 author = {F. Pfeiffer and C. Glocker}, 34182 title = {Multibody Dynamics with Unilateral Contact}, 34183 year = {1996}, 34184 publisher = {John Wiley \& Sons} 34185} 34186 34187@TechReport{ pierro.iusem:convergence, 34188 author = {A. R. de Pierro and A. N. Iusem}, 34189 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 34190 Linear Complementarity Problems}, 34191 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 34192 year = {1990}, 34193 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 34194} 34195 34196@InCollection{ pillo.grippo.ea:class, 34197 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 34198 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 34199 booktitle = {System Modelling and Optimization}, 34200 year = {1981}, 34201 editor = {R. F. Drenick and F. Kozin}, 34202 publisher = {Springer-Verlag}, 34203 address = {Berlin} 34204} 34205 34206@Article{ pillo.grippo:augmented, 34207 author = {G. Di Pillo and L. Grippo}, 34208 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 34209 Problems}, 34210 journal = {Journal of Optimization Theory and Applications}, 34211 year = {1982}, 34212 volume = {36}, 34213 pages = {495--519} 34214} 34215 34216@Article{ pillo.grippo:class, 34217 author = {G. Di Pillo and L. Grippo}, 34218 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 34219 journal = {SIAM Journal on Control and Optimization}, 34220 year = {1979}, 34221 volume = {17}, 34222 pages = {618--628} 34223} 34224 34225@Article{ pillo.grippo:continuously, 34226 author = {G. Di Pillo and L. Grippo}, 34227 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 34228 Problems with Inequality Constraints}, 34229 journal = {SIAM Journal on Control and Optimization}, 34230 year = {1985}, 34231 volume = {23}, 34232 pages = {72--84} 34233} 34234 34235@Article{ pillo.grippo:exact, 34236 author = {G. Di Pillo and L. Grippo}, 34237 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 34238 Programming Problems}, 34239 journal = {Mathematical Programming}, 34240 year = {1986}, 34241 volume = {36}, 34242 pages = {1--18} 34243} 34244 34245@InProceedings{ plambeck.fu.ea:throughput, 34246 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 34247 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 34248 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 34249 editor = {J. Schoen}, 34250 year = {1993}, 34251 publisher = {Society for Computer Simulation}, 34252 address = {San Diego, CA}, 34253 pages = {70--75} 34254} 34255 34256@Article{ plambeck.fu.ea:sample-path, 34257 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 34258 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 34259 journal = {Mathematical Programming}, 34260 year = {1996}, 34261 volume = {75}, 34262 pages = {137--176} 34263} 34264 34265@InProceedings{ platt:sequential, 34266 author = {J. Platt}, 34267 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 34268 Machines}, 34269 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 34270 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 34271 publisher = {MIT Press}, 34272 pages = {185-208}, 34273 year = {1999} 34274} 34275 34276@Book{ poincare:sur, 34277 author = {H. Poincar\'{e}}, 34278 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 34279 year = {1881}, 34280 publisher = {Oeuvres I}, 34281 address = {Gauthier--Villars, Paris} 34282} 34283 34284@Article{ polak.ribiere:note, 34285 author = {E. Polak and G. Ribi\`{e}re}, 34286 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 34287 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 34288 year = {1969}, 34289 volume = {16-R1}, 34290 pages = {35--43} 34291} 34292 34293@Book{ polak:computational, 34294 author = {E. Polak}, 34295 title = {Computational Methods in Optimization; {A} Unified Approach}, 34296 year = {1971}, 34297 publisher = {Academic Press}, 34298 address = {New York} 34299} 34300 34301@Article{ polak:global, 34302 author = {E. Polak}, 34303 title = {On the Global Stabilization of Locally Convergent Algorithms}, 34304 journal = {Automatica}, 34305 year = {1976}, 34306 volume = {12}, 34307 pages = {337--349} 34308} 34309 34310@Article{ polyak.tretiyakov:concerning, 34311 author = {B. T. Polyak and N. V. Tretiyakov}, 34312 title = {Concerning an Iterative Method for Linear Programming and its Economic 34313 Interpretation}, 34314 journal = {Economics and Mathematical Methods}, 34315 year = {1972}, 34316 volume = {8}, 34317 pages = {740--751}, 34318 note = {(Russian)} 34319} 34320 34321@Article{ polyak.tretiyakov:method, 34322 author = {B. T. Polyak and N. V. Tretiyakov}, 34323 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 34324 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 34325 year = {1973}, 34326 volume = {13}, 34327 pages = {42--58} 34328} 34329 34330@Article{ polyak:conjugate, 34331 author = {B. T. Polyak}, 34332 title = {The conjugate gradient method in extremal problems}, 34333 journal = {USSR Computational Mathematics and Mathematical Physics}, 34334 year = {1969}, 34335 volume = {9}, 34336 pages = {94--112}, 34337 note = {Translated from Russian} 34338} 34339 34340@Book{ polyak:introduction, 34341 author = {B. T. Polyak}, 34342 title = {Introduction to Optimization}, 34343 year = {1987}, 34344 publisher = {Optimization Software, Inc.}, 34345 address = {Publications Division, New York} 34346} 34347 34348@Unpublished{ polyak:methods, 34349 author = {R. A. Polyak}, 34350 title = {On the Methods of Centers}, 34351 year = {1988}, 34352 note = {Unpublished manuscript} 34353} 34354 34355@Unpublished{ polyak:sharp, 34356 author = {B. T. Polyak}, 34357 title = {Sharp Minima}, 34358 year = {1979}, 34359 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 34360 Applications, {IIASA}, Laxenburg, Austria} 34361} 34362 34363@InProceedings{ polyak:smooth, 34364 author = {R. A. Polyak}, 34365 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 34366 Problems with Constraints}, 34367 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 34368 Programming}, 34369 year = {1982}, 34370 address = {Bonn} 34371} 34372 34373@Article{ polychronopoulos.tsitsiklis:analysis, 34374 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 34375 title = {Stochastic Shortest Path Problems with Recourse}, 34376 journal = {Networks}, 34377 year = {1996}, 34378 volume = {27}, 34379 pages = {133--143} 34380} 34381 34382@TechReport{ potra.bonnans:infeasible, 34383 author = {F. A. Potra and J. F. Bonnans}, 34384 title = {Infeasible path following algorithms for linear complementarity problems}, 34385 institution = {INRIA}, 34386 year = {1994}, 34387 month = dec, 34388 number = {RR--2445}, 34389 type = {Research Report} 34390} 34391 34392@Article{ potra.sheng:large-step, 34393 author = {F. A. Potra and R. Sheng}, 34394 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 34395 year = {1997}, 34396 journal = {SIAM Journal on Optimization}, 34397 volume = {7}, 34398 pages = {318--335} 34399} 34400 34401@Article{ potra:infeasible, 34402 author = {F. A. Potra}, 34403 title = {An infeasible interior-point predictor-corrector algorithm for linear 34404 programming}, 34405 journal = {SIAM Journal on Optimization}, 34406 year = {1996}, 34407 volume = {6}, 34408 pages = {19--32} 34409} 34410 34411@TechReport{ potra:onl, 34412 author = {F. A. Potra}, 34413 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 34414 convergence.}, 34415 institution = {Department of Mathematics, The University of Iowa}, 34416 address = {Iowa City, Iowa}, 34417 year = {1994}, 34418 number = {50}, 34419 type = {Reports on Computational Mathematics} 34420} 34421 34422@TechReport{ potra:predictor-corrector, 34423 author = {F. A. Potra}, 34424 title = {On a predictor-corrector method for solving linear programs from infeasible 34425 starting points}, 34426 institution = {Department of Mathematics, University of Iowa}, 34427 address = {Iowa City, Iowa}, 34428 year = {1992}, 34429 number = {34}, 34430 type = {Reports on Computational Mathematics} 34431} 34432 34433@TechReport{ potra:quadratically, 34434 author = {F. A. Potra}, 34435 title = {A quadratically convergent infeasible interior-point algorithm for linear 34436 programming}, 34437 institution = {Department of Mathematics, University of Iowa}, 34438 year = {1992}, 34439 number = {28}, 34440 address = {Iowa City, Iowa}, 34441 month = jul 34442} 34443 34444@InCollection{ powell:convergence, 34445 author = {M. J. D. Powell}, 34446 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 34447 Optimization Calculations}, 34448 crossref = {mangasarian.meyer.ea:nonlinear*3}, 34449 pages = {27--63} 34450} 34451 34452@InProceedings{ powell:direct, 34453 author = {M. J. D. Powell}, 34454 title = {A Direct Search Optimization Method that Models the Objective and Constraint 34455 Functions by Linear Interpolation}, 34456 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 34457 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 34458 volume = {275}, 34459 year = {1994}, 34460 publisher = {Kluwer Academic Publishers}, 34461 pages = {51--67}, 34462 address = {Dordrecht, The Netherlands} 34463} 34464 34465@Article{ powell:efficient, 34466 author = {M. J. D. Powell}, 34467 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 34468 without Calculating Derivatives}, 34469 journal = {Computer Journal}, 34470 year = {1964}, 34471 volume = {17}, 34472 pages = {155--162} 34473} 34474 34475@InCollection{ powell:general, 34476 author = {M. J. D. Powell}, 34477 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 34478 booktitle = {Approximation Theory IV}, 34479 year = {1983}, 34480 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 34481 publisher = {Academic Press}, 34482 address = {New York}, 34483 pages = {187--218} 34484} 34485 34486@InCollection{ powell:hybrid, 34487 author = {M. J. D. Powell}, 34488 title = {A hybrid method for nonlinear equations}, 34489 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 34490 publisher = {Gordon and Breach}, 34491 year = {1970}, 34492 editor = {P. Rabinowitz} 34493} 34494 34495@TechReport{ powell:karmarkars, 34496 author = {M. J. D. Powell}, 34497 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 34498 institution = {Department of Applied Mathematics and Theoretical Physics, University of 34499 Cambridge}, 34500 year = {1989}, 34501 month = nov, 34502 address = {Cambridge, CB3 9EW, England} 34503} 34504 34505@InCollection{ powell:method, 34506 author = {M. J. D. Powell}, 34507 title = {A Method for Nonlinear Constraints in Minimization Problems}, 34508 booktitle = {Optimization}, 34509 year = {1969}, 34510 editor = {R. Fletcher}, 34511 publisher = {Academic Press}, 34512 address = {London}, 34513 pages = {283--298} 34514} 34515 34516@Book{ prekopa:stochastic, 34517 author = {A. Pr{\'{e}}kopa}, 34518 title = {Stochastic Programming}, 34519 publisher = {Kluwer Academic Publishers}, 34520 year = {1995}, 34521 address = {Dordrecht, The Netherlands} 34522} 34523 34524@Book{ press.flannery.ea:numerical, 34525 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 34526 Vetterling}, 34527 title = {Numerical Recipes : the Art of Scientific Computing}, 34528 publisher = {Cambridge University Press}, 34529 year = {1988} 34530} 34531 34532@Article{ pruyne.livny:interfacing, 34533 author = {J. Pruyne and M. Livny}, 34534 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 34535 journal = {Journal on Future Generations of Computer Systems}, 34536 volume = {12}, 34537 year = {1996}, 34538 pages = {67--85} 34539} 34540 34541@InCollection{ pruyne.livny:parallel, 34542 author = {J. Pruyne and M. Livny}, 34543 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 34544 booktitle = {Job Scheduling Strategies for Parallel Processing}, 34545 publisher = {Springer-Verlag}, 34546 year = {1995}, 34547 editor = {D. G. Feitelson and L. Rudolph}, 34548 volume = {949}, 34549 series = {Lecture Notes in Computer Science} 34550} 34551 34552@PhDThesis{ pruyne:resource, 34553 author = {J. C. Pruyne}, 34554 title = {Resource Management Services for Parallel Applications}, 34555 school = {University of Wisconsin--Madison}, 34556 year = {1996}, 34557 address = {Madison, Wisconsin} 34558} 34559 34560@Book{ pshenichny.danilin:numerical, 34561 author = {B. N. Pshenichny and Yu. M. Danilin}, 34562 title = {Numerical Methods in Extremal Problems}, 34563 year = {1978}, 34564 publisher = {MIR Publishers}, 34565 address = {Moscow} 34566} 34567 34568@TechReport{ qi.chen:globally, 34569 author = {L. Qi and X. Chen}, 34570 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 34571 institution = {School of Mathematics, University of New South Wales}, 34572 year = {1993}, 34573 annote = {revised}, 34574 address = {Sydney} 34575} 34576 34577@Article{ qi.jiang:semismooth, 34578 author = {L. Qi and H. Jiang}, 34579 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 34580 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 34581 journal = {Mathematics of Operations Research}, 34582 volume = {22}, 34583 pages = {301--325}, 34584 year = {1997} 34585} 34586 34587@TechReport{ qi.peng:unconstrained, 34588 author = {H. -D. Qi and J. -M. Peng}, 34589 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 34590 Problems}, 34591 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 34592 year = {1996}, 34593 type = {Technical Report}, 34594 address = {Beijing} 34595} 34596 34597@InCollection{ qi.sun:survey, 34598 author = {L. Qi and D. Sun}, 34599 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 34600 year = {1999}, 34601 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 34602 booktitle = {Progress in Optimization}, 34603 pages = {121--146}, 34604 series = {Applied Optimization}, 34605 volume = {30}, 34606 publisher = {Kluwer Academic Publishers}, 34607 address = {Dordrecht} 34608} 34609 34610@Article{ qi.sun:nonsmooth, 34611 author = {L. Qi and J. Sun}, 34612 title = {A Nonsmooth Version of {N}ewton's Method}, 34613 journal = {Mathematical Programming}, 34614 year = {1993}, 34615 volume = {58}, 34616 pages = {353--368} 34617} 34618 34619@Article{ qi:convergence, 34620 author = {L. Qi}, 34621 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 34622 journal = {Mathematics of Operations Research}, 34623 year = {1993}, 34624 volume = {18}, 34625 pages = {227--244} 34626} 34627 34628@TechReport{ qi:regular, 34629 author = {L. Qi}, 34630 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 34631 convergent generalized {N}ewton methods for complementarity and variational 34632 inequality problems}, 34633 institution = {School of Mathematics, University of New South Wales}, 34634 year = {1997}, 34635 type = {Applied Mathematics Report}, 34636 number = {AMR 97/14}, 34637 address = {Sydney, Australia} 34638} 34639 34640@Article{ radner:competitive, 34641 author = {R. Radner}, 34642 title = {Competitive Equilibrium under Uncertainty}, 34643 journal = {Econometrica}, 34644 year = {1968}, 34645 volume = {36}, 34646 pages = {31--58} 34647} 34648 34649@Article{ radstrom:embedding, 34650 author = {H. R{\aa}dstr{\"{o}}m}, 34651 title = {An embedding theorem for spaces of convex sets}, 34652 journal = {Proc. Amer. Math. Soc.}, 34653 year = {1952}, 34654 volume = {3}, 34655 pages = {165--169} 34656} 34657 34658@Article{ raghavachari:connections, 34659 author = {M. Raghavachari}, 34660 title = {On Connections between Zero--One Integer Programming and Concave Programming 34661 Under Linear Constraints}, 34662 journal = {Operations Research}, 34663 year = {1969}, 34664 volume = {17}, 34665 pages = {680--684} 34666} 34667 34668@Article{ rajan.burridge.ea:dynamics, 34669 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 34670 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 34671 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 34672 month = mar, 34673 year = {1987}, 34674 pages = {671--677} 34675} 34676 34677@Article{ ralph:branching, 34678 author = {D. Ralph}, 34679 title = {On Branching Numbers of Normal Manifolds}, 34680 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 34681 volume = {22}, 34682 pages = {1041--1050}, 34683 year = {1994} 34684} 34685 34686@Article{ ralph:global, 34687 author = {D. Ralph}, 34688 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 34689 Path Search}, 34690 journal = {Mathematics of Operations Research}, 34691 year = {1994}, 34692 volume = {19}, 34693 pages = {352--389} 34694} 34695 34696@InProceedings{ ralph:piecewise, 34697 author = {D. Ralph}, 34698 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 34699 with Linear Complementarity Constraints}, 34700 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 34701 Applications (CTAC95)}, 34702 year = {1996} 34703} 34704 34705@PhDThesis{ raman:integration, 34706 author = {R. Raman}, 34707 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 34708 for process systems.}, 34709 address = {Pittsburgh, Pennsylvania}, 34710 year = {1993}, 34711 school = {Department of Chemical Engineering, Carnegie Mellon University} 34712} 34713 34714@PhDThesis{ rangaraj:nonsmooth, 34715 author = {Narayan Rangaraj}, 34716 title = {Nonsmooth Optimization: Algorithms and Applications}, 34717 year = {1990}, 34718 address = {Baltimore, MD}, 34719 school = {Department of Mathematical Sciences, The Johns Hopkins University} 34720} 34721 34722@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 34723 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 34724 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 34725 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 34726 Radiation Therapy, Salt Lake City}, 34727 year = {1997}, 34728 editor = {D. D. Leavitt and G. Starkshall}, 34729 publisher = {Medical Physics Publishing}, 34730 address = {St. Louis, Missouri}, 34731 pages = {420--422} 34732} 34733 34734@Article{ reid:sparsity-exploiting, 34735 author = {J. K. Reid}, 34736 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear 34737 Programming Bases}, 34738 journal = {Mathematical Programming}, 34739 year = {1982}, 34740 volume = {24}, 34741 pages = {55--69} 34742} 34743 34744@Book{ reingold.nievergelt.ea:combinatorial, 34745 author = {E. Reingold and J. Nievergelt and N. Deo}, 34746 title = {Combinatorial Algorithms: Theory and Practice}, 34747 publisher = {Prentice-Hall, Inc}, 34748 address = {Englewood Cliffs, New Jersey} 34749} 34750 34751@PhDThesis{ reinoza:degree, 34752 author = {J. A. Reinoza}, 34753 title = {A Degree for Generalized Equations}, 34754 year = {1979}, 34755 address = {Madison, Wisconsin}, 34756 school = {University of Wisconsin} 34757} 34758 34759@Article{ reinoza:solving, 34760 author = {A. Reinoza}, 34761 title = {Solving Generalized Equations via Homotopies}, 34762 journal = {Mathematical Programming}, 34763 year = {1985}, 34764 volume = {31}, 34765 pages = {307--320} 34766} 34767 34768@PhDThesis{ ren:computable, 34769 author = {J. Ren}, 34770 title = {Computable Error Bounds in Mathematical Programming}, 34771 school = {Computer Sciences Department, University of Wisconsin}, 34772 year = {1993}, 34773 address = {Madison, Wisconsin}, 34774 note = {Technical Report 1173} 34775} 34776 34777@Article{ renegar:polynomial-time, 34778 author = {J. Renegar}, 34779 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 34780 Programming}, 34781 journal = {Mathematical Programming}, 34782 year = {1988}, 34783 volume = {40}, 34784 pages = {59--94} 34785} 34786 34787@Article{ robbins.monro:stochastic, 34788 author = {H. Robbins and S. Monro}, 34789 title = {A Stochastic Approximation Method}, 34790 journal = {Annals of Mathematical Statistics}, 34791 year = {1951}, 34792 volume = {22}, 34793 pages = {400--407} 34794} 34795 34796@Article{ robinson:analysis, 34797 author = {S. M. Robinson}, 34798 title = {Analysis of Sample-Path Optimization}, 34799 journal = {Mathematics of Operations Research}, 34800 year = {1996}, 34801 volume = {21}, 34802 pages = {513--528} 34803} 34804 34805@InCollection{ robinson:bundle-based, 34806 author = {S. M. Robinson}, 34807 title = {Bundle-Based Decomposition: Conditions for Convergence}, 34808 booktitle = {Analyse Non Lin\'{e}aire}, 34809 year = {1989}, 34810 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 34811 publisher = {Gauthier-Villaars}, 34812 address = {Paris}, 34813 pages = {435--447} 34814} 34815 34816@InCollection{ robinson:bundle-based*1, 34817 author = {S. M. Robinson}, 34818 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 34819 booktitle = {System Modeling and Optimization}, 34820 year = {1986}, 34821 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 34822 publisher = {Springer-Verlag}, 34823 address = {Berlin}, 34824 pages = {751--756}, 34825 volume = {84}, 34826 series = {Lecture Notes in Control and Information Sciences} 34827} 34828 34829@Article{ robinson:continuity, 34830 author = {S. M. Robinson}, 34831 title = {Some Continuity Properties of Polyhedral Multifunctions}, 34832 journal = {Mathematical Programming Study}, 34833 year = {1981}, 34834 volume = {14}, 34835 pages = {206--214} 34836} 34837 34838@Article{ robinson:extension, 34839 author = {S. M. Robinson}, 34840 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 34841 journal = {Numerische Mathematik}, 34842 year = {1972}, 34843 volume = {19}, 34844 pages = {341--347} 34845} 34846 34847@InCollection{ robinson:generalized, 34848 crossref = {bachem.grotschel.ea:mathematical}, 34849 author = {S. M. Robinson}, 34850 title = {Generalized Equations}, 34851 pages = {346--367} 34852} 34853 34854@Article{ robinson:generalized*1, 34855 author = {S. M. Robinson}, 34856 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 34857 journal = {Mathematical Programming Study}, 34858 year = {1979}, 34859 volume = {10}, 34860 pages = {128--141} 34861} 34862 34863@InCollection{ robinson:homeomorphism, 34864 author = {S. M. Robinson}, 34865 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 34866 booktitle = {Optimization and Nonlinear Analysis}, 34867 year = {1992}, 34868 editor = {A. Ioffe and M. Marcus and S. Reich}, 34869 publisher = {Longman}, 34870 address = {Harlow, Essex, England}, 34871 pages = {240--248}, 34872 series = {Pitman Research Notes in Mathematics Series No. 244} 34873} 34874 34875@Article{ robinson:implicit-function, 34876 author = {S. M. Robinson}, 34877 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 34878 journal = {Mathematics of Operations Research}, 34879 year = {1991}, 34880 volume = {16}, 34881 pages = {292--309} 34882} 34883 34884@Article{ robinson:local*1, 34885 author = {S. M. Robinson}, 34886 title = {Local Epi--Continuity and Local Optimization}, 34887 journal = {Mathematical Programming}, 34888 year = {1987}, 34889 volume = {37}, 34890 pages = {208--222} 34891} 34892 34893@Article{ robinson:local*2, 34894 author = {S. M. Robinson}, 34895 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 34896 Nondegeneracy}, 34897 journal = {Mathematical Programming Study}, 34898 year = {1984}, 34899 volume = {22}, 34900 pages = {217--230} 34901} 34902 34903@Article{ robinson:local*3, 34904 author = {S. M. Robinson}, 34905 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 34906 Stability and Sensitivity}, 34907 journal = {Mathematical Programming Study}, 34908 year = {1987}, 34909 volume = {30}, 34910 pages = {45--66} 34911} 34912 34913@Article{ robinson:mathematical, 34914 author = {S. M. Robinson}, 34915 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 34916 journal = {Mathematical Programming}, 34917 year = {1990}, 34918 volume = {48}, 34919 pages = {221--229} 34920} 34921 34922@Article{ robinson:newtons, 34923 author = {S. M. Robinson}, 34924 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 34925 journal = {Set Valued Analysis}, 34926 year = {1994}, 34927 volume = {2}, 34928 pages = {291--305} 34929} 34930 34931@Article{ robinson:nonsingularity, 34932 author = {S. M. Robinson}, 34933 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 34934 journal = {Mathematical Programming}, 34935 year = {1993}, 34936 volume = {62}, 34937 pages = {415--425} 34938} 34939 34940@InCollection{ robinson:nonsmooth, 34941 author = {S. M. Robinson}, 34942 title = {Nonsmooth Continuation for Generalized Equations}, 34943 year = {1997}, 34944 pages = {282--291}, 34945 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 34946 booktitle = {Recent Advances in Optimization}, 34947 series = {Lecture Notes in Economics and Mathematical Systems}, 34948 volume = {452}, 34949 publisher = {Springer-Verlag}, 34950 address = {Heidelberg} 34951} 34952 34953@Article{ robinson:normal, 34954 author = {S. M. Robinson}, 34955 title = {Normal Maps Induced by Linear Transformations}, 34956 journal = {Mathematics of Operations Research}, 34957 year = {1992}, 34958 volume = {17}, 34959 pages = {691--714} 34960} 34961 34962@Article{ robinson:normed, 34963 author = {S. M. Robinson}, 34964 title = {Normed Convex Processes}, 34965 journal = {Transactions of the American Mathematical Society}, 34966 year = {1972}, 34967 volume = {174}, 34968 pages = {127--140} 34969} 34970 34971@Article{ robinson:reduction, 34972 author = {S. M. Robinson}, 34973 title = {A reduction method for variational inequalities}, 34974 journal = {Mathematical Programming}, 34975 year = {1998}, 34976 volume = {80}, 34977 pages = {161--169} 34978} 34979 34980@Article{ robinson:regularity, 34981 author = {S. M. Robinson}, 34982 title = {Regularity and stability for convex multivalued functions}, 34983 journal = {Mathematics of Operations Research}, 34984 year = {1976}, 34985 volume = {1}, 34986 pages = {130--143} 34987} 34988 34989@Unpublished{ robinson:shadow, 34990 author = {S. M. Robinson}, 34991 title = {Shadow {JUNK} for biblio file}, 34992 year = {1800} 34993} 34994 34995@Article{ robinson:shadow*1, 34996 author = {S. M. Robinson}, 34997 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 34998 journal = {Operations Research}, 34999 year = {1993}, 35000 volume = {41}, 35001 pages = {518--535} 35002} 35003 35004@Article{ robinson:shadow*2, 35005 author = {S. M. Robinson}, 35006 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 35007 journal = {Operations Research}, 35008 year = {1993}, 35009 volume = {41}, 35010 pages = {536--548} 35011} 35012 35013@Unpublished{ robinson:stability, 35014 author = {S. M. Robinson}, 35015 title = {Stability {JUNK} for biblio file}, 35016 year = {1800} 35017} 35018 35019@Article{ robinson:stability*1, 35020 author = {S. M. Robinson}, 35021 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 35022 journal = {SIAM Journal on Numerical Analysis}, 35023 year = {1975}, 35024 volume = {12}, 35025 pages = {754--769} 35026} 35027 35028@Article{ robinson:stability*2, 35029 author = {S. M. Robinson}, 35030 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 35031 Nonlinear Systems}, 35032 journal = {SIAM Journal on Numerical Analysis}, 35033 year = {1976}, 35034 volume = {13}, 35035 pages = {497--513} 35036} 35037 35038@Article{ robinson:strongly, 35039 author = {S. M. Robinson}, 35040 title = {Strongly Regular Generalized Equations}, 35041 journal = {Mathematics of Operations Research}, 35042 year = {1980}, 35043 volume = {5}, 35044 pages = {43--62} 35045} 35046 35047@Article{ rockafellar.wets:generalized, 35048 author = {R. T. Rockafellar and R. J.--B. Wets}, 35049 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 35050 Control in Discrete Time}, 35051 journal = {SIAM Journal on Control and Optimization}, 35052 year = {1990}, 35053 volume = {28}, 35054 pages = {810--822} 35055} 35056 35057@Article{ rockafellar.wets:lagrangian, 35058 author = {R. T. Rockafellar and R. J.--B. Wets}, 35059 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 35060 in Stochastic Programming}, 35061 journal = {Mathematical Programming Study}, 35062 year = {1986}, 35063 volume = {28}, 35064 pages = {63--93} 35065} 35066 35067@InCollection{ rockafellar.wets:linear-quadratic, 35068 author = {R. T. Rockafellar and R. J.--B. Wets}, 35069 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 35070 Generation Algorithm}, 35071 booktitle = {Stochastic Optimization}, 35072 publisher = {Springer-Verlag}, 35073 year = {1987}, 35074 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 35075 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 35076 pages = {545--560}, 35077 address = {New York, Berlin} 35078} 35079 35080@Article{ rockafellar.wets:scenarios, 35081 author = {R. T. Rockafellar and R. J.--B. Wets}, 35082 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 35083 journal = {Mathematics of Operations Research}, 35084 year = {1991}, 35085 volume = {10}, 35086 pages = {119--147} 35087} 35088 35089@InProceedings{ rockafellar:applications, 35090 author = {R. T. Rockafellar}, 35091 title = {New Applications of Duality in Convex Programming}, 35092 booktitle = {Proceedings of the Fourth Conference on Probability}, 35093 year = {1971}, 35094 address = {Brasov, Romania} 35095} 35096 35097@Article{ rockafellar:augmented, 35098 author = {R. T. Rockafellar}, 35099 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 35100 journal = {SIAM Journal on Control and Optimization}, 35101 year = {1974}, 35102 volume = {12}, 35103 pages = {268--285} 35104} 35105 35106@Article{ rockafellar:augmented*1, 35107 author = {R. T. Rockafellar}, 35108 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 35109 Convex Programming}, 35110 journal = {Mathematics of Operations Research}, 35111 year = {1976}, 35112 volume = {1}, 35113 pages = {97--116} 35114} 35115 35116@Article{ rockafellar:characterization, 35117 author = {R. T. Rockafellar}, 35118 title = {Characterization of the subdifferentials of convex functions}, 35119 journal = {Pacific Journal of Mathematics}, 35120 year = {1966}, 35121 volume = {17}, 35122 number = {3}, 35123 pages = {497--510} 35124} 35125 35126@Article{ rockafellar:computational, 35127 author = {R. T. Rockafellar}, 35128 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 35129 Programming}, 35130 journal = {Mathematical Programming}, 35131 year = {1990}, 35132 volume = {48}, 35133 pages = {447--474} 35134} 35135 35136@Book{ rockafellar:conjugate, 35137 author = {R. T. Rockafellar}, 35138 title = {Conjugate Duality and Optimization}, 35139 year = {1974}, 35140 publisher = {SIAM}, 35141 address = {Philadelphia, Pennsylvania}, 35142 volume = {16}, 35143 series = {Conference Board of the Mathematical Sciences} 35144} 35145 35146@Book{ rockafellar:convex, 35147 author = {R. T. Rockafellar}, 35148 title = {Convex Analysis}, 35149 year = {1970}, 35150 publisher = {Princeton University Press}, 35151 address = {Princeton, New Jersey} 35152} 35153 35154@Article{ rockafellar:first-, 35155 author = {R. T. Rockafellar}, 35156 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 35157 journal = {Transactions of the American Mathematical Society}, 35158 year = {1988}, 35159 volume = {307}, 35160 pages = {75--108} 35161} 35162 35163@InProceedings{ rockafellar:generalized, 35164 author = {R. T. Rockafellar}, 35165 title = {A Generalized Approach to Linear-Quadratic Programming}, 35166 booktitle = {Proceedings of the International Conference on Numerical Optimization and 35167 Applications}, 35168 year = {1986}, 35169 pages = {58--66}, 35170 note = {(Xi'an, China)} 35171} 35172 35173@InProceedings{ rockafellar:generalized*1, 35174 crossref = {bachem.grotschel.ea:mathematical}, 35175 author = {R. T. Rockafellar}, 35176 title = {Generalized Subgradients in Mathematical Programming}, 35177 pages = {368--390} 35178} 35179 35180@InCollection{ rockafellar:large-scale, 35181 author = {R. T. Rockafellar}, 35182 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 35183 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 35184 chapter = {15}, 35185 year = {1991}, 35186 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 35187 publisher = {SIAM Publications}, 35188 pages = {247--261} 35189} 35190 35191@Article{ rockafellar:linear-quadratic, 35192 author = {R. T. Rockafellar}, 35193 title = {Linear-Quadratic Programming and Optimal Control}, 35194 journal = {SIAM Journal on Control and Optimization}, 35195 year = {1987}, 35196 volume = {25}, 35197 pages = {781--814} 35198} 35199 35200@Article{ rockafellar:maximality, 35201 author = {R. T. Rockafellar}, 35202 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 35203 journal = {Transactions of the American Mathematical Society}, 35204 year = {1970}, 35205 volume = {149}, 35206 pages = {75--88} 35207} 35208 35209@InCollection{ rockafellar:monotone, 35210 author = {R. T. Rockafellar}, 35211 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 35212 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35213 pages = {1--26} 35214} 35215 35216@Article{ rockafellar:monotone*1, 35217 author = {R. T. Rockafellar}, 35218 title = {Monotone Operators and the Proximal Point Algorithm}, 35219 journal = {SIAM Journal on Control and Optimization}, 35220 year = {1976}, 35221 volume = {14}, 35222 pages = {877--898} 35223} 35224 35225@Article{ rockafellar:multiplier, 35226 author = {R. T. Rockafellar}, 35227 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 35228 journal = {Journal of Optimization Theory and Applications}, 35229 year = {1973}, 35230 volume = {12}, 35231 pages = {555--562} 35232} 35233 35234@Article{ rockafellar:multistage, 35235 author = {R. T. Rockafellar}, 35236 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 35237 journal = {Control and Cybernetics}, 35238 year = {1988}, 35239 volume = {17}, 35240 number = {2-3}, 35241 pages = {225--245} 35242} 35243 35244@Book{ rockafellar:network, 35245 author = {R. T. Rockafellar}, 35246 title = {Network Flows and Monotropic Optimization}, 35247 publisher = {John Wiley}, 35248 year = {1984}, 35249 address = {New York} 35250} 35251 35252@Article{ rodrigues:mixed, 35253 author = {H. C. Rodrigues}, 35254 title = {A mixed variational formulation for shape optimization of solids with contact 35255 conditions}, 35256 journal = {Structural Optimization}, 35257 volume = {6}, 35258 year = {1993}, 35259 pages = {19--28} 35260} 35261 35262@Book{ rodrigues:obstacle, 35263 author = {J. F. Rodrigues}, 35264 title = {Obstacle Problems in Mathematical Physics}, 35265 publisher = {Elsevier Publishing Company}, 35266 address = {Amsterdam}, 35267 year = {1987} 35268} 35269 35270@Book{ roos.terlaky.ea:theory, 35271 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 35272 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 35273 publisher = {John Wiley \& Sons}, 35274 year = {1997}, 35275 address = {Chichester} 35276} 35277 35278@TechReport{ rosa:decomposition, 35279 author = {C. H. Rosa}, 35280 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 35281 institution = {IIASA}, 35282 year = {1996}, 35283 number = {WP-96-013}, 35284 address = {A-2361 Laxenburg, Austria} 35285} 35286 35287@Article{ rosen.lane.ea:treatment, 35288 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 35289 title = {Treatment Plan Optimization Using Linear Programming}, 35290 journal = {Medical Physics}, 35291 year = {1990}, 35292 volume = {18}, 35293 number = {2}, 35294 pages = {141--152} 35295} 35296 35297@TechReport{ rosenblatt:perceptron-a, 35298 author = {F. Rosenblatt}, 35299 title = {The perceptron--a perceiving and recognizing automaton}, 35300 institution = {Cornell Aeronautical Laboratory}, 35301 year = {1957}, 35302 month = jan, 35303 address = {Ithaca, New York}, 35304 number = {85-460-1} 35305} 35306 35307@Book{ rosenblatt:principles, 35308 author = {F. Rosenblatt}, 35309 title = {Principles of Neurodynamics}, 35310 year = {1962}, 35311 publisher = {Spartan Books}, 35312 address = {New York} 35313} 35314 35315@InProceedings{ rosenblatt:two, 35316 author = {F. Rosenblatt}, 35317 title = {Two theorems of statistical separability in the perceptron}, 35318 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 35319 year = {1959}, 35320 publisher = {{HMS} Stationery Office}, 35321 address = {London}, 35322 volume = {1} 35323} 35324 35325@Article{ rosenbrock:automatic, 35326 author = {H. H. Rosenbrock}, 35327 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 35328 journal = {Computer Journal}, 35329 year = {1960}, 35330 volume = {3}, 35331 pages = {175--184} 35332} 35333 35334@Article{ roy.mukhopadhyay:pattern, 35335 author = {A. Roy and S. Mukhopadhyay}, 35336 title = {Pattern Classification Using Linear Programming}, 35337 journal = {ORSA Journal on Computing}, 35338 year = {1990}, 35339 volume = {3}, 35340 pages = {66--80} 35341} 35342 35343@Book{ rubinstein:monte, 35344 author = {R. Rubinstein}, 35345 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 35346 Networks}, 35347 publisher = {Wiley}, 35348 address = {New York, NY}, 35349 year = {1986} 35350} 35351 35352@Article{ ruchala.olivera.ea:comparison, 35353 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 35354 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 35355 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 35356 journal = {Physics in Medicine and Biology, forthcoming}, 35357 year = {1999} 35358} 35359 35360@Book{ rudin:principles, 35361 author = {W. Rudin}, 35362 title = {Principles of Mathematical Analysis}, 35363 year = {1976}, 35364 publisher = {McGraw--Hill}, 35365 address = {Tokyo, Japan}, 35366 edition = {Third} 35367} 35368 35369@Book{ rudin:real, 35370 author = {W. Rudin}, 35371 title = {Real and Complex Analysis}, 35372 year = {1974}, 35373 publisher = {McGraw--Hill}, 35374 address = {Tokyo, Japan}, 35375 edition = {Second} 35376} 35377 35378@InProceedings{ rumelhart.hinton.ea:learning, 35379 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 35380 title = {Learning Internal Representations by Error Propagation}, 35381 booktitle = {Parallel Distributed Processing}, 35382 year = {1986}, 35383 editor = {D. E. Rumelhart and J. L. McClelland}, 35384 publisher = {MIT Press}, 35385 address = {Cambridge, Massachusetts}, 35386 pages = {318--362} 35387} 35388 35389@Book{ rumelhart.mcclelland:parallel, 35390 author = {D. E. Rumelhart and J. L. McClelland}, 35391 title = {Parallel Distributed Processing}, 35392 year = {1986}, 35393 publisher = {MIT Press}, 35394 address = {Cambridge, Massachusetts} 35395} 35396 35397@InCollection{ ruszczynski:regularized, 35398 author = {A. Ruszczynski}, 35399 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 35400 year = {1995}, 35401 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 35402 editor = {K. Marti and P. Kall}, 35403 publisher = {Springer-Verlag}, 35404 address = {Berlin}, 35405 volume = {425}, 35406 series = {Lecture Notes in Control and Information Sciences}, 35407 pages = {93--108} 35408} 35409 35410@Article{ rutherford.rutstrom.ea:lacord, 35411 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 35412 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 35413 quantitative}, 35414 journal = {Revue d' Economie du developpement}, 35415 year = {1994} 35416} 35417 35418@InCollection{ rutherford.tarr:blueprints, 35419 author = {T. Rutherford and D. Tarr}, 35420 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 35421 Open Economy}, 35422 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 35423 publisher = {Cambridge University Press}, 35424 year = {1997}, 35425 editor = {R. Baldwin and J. Francois}, 35426 address = {New York} 35427} 35428 35429@Article{ rutherford:applied, 35430 author = {T. F. Rutherford}, 35431 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 35432 Overview of the Modeling Framework and Syntax}, 35433 year = {1999}, 35434 volume = {14}, 35435 pages = {1--46}, 35436 journal = {Computational Economics} 35437} 35438 35439@PhDThesis{ rutherford:applied*1, 35440 author = {T. F. Rutherford}, 35441 title = {Applied General Equilibrium Modeling}, 35442 school = {Stanford University}, 35443 year = {1987} 35444} 35445 35446@Article{ rutherford:extensions, 35447 author = {T. F. Rutherford}, 35448 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 35449 Analysis}, 35450 journal = {Journal of Economic Dynamics and Control}, 35451 volume = {19}, 35452 pages = {1299--1324}, 35453 year = {1995} 35454} 35455 35456@Misc{ rutherford:gnuplot, 35457 author = {T. F. Rutherford}, 35458 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 35459 organization = {Department of Economics, University of Colorado}, 35460 address = {Boulder, Colorado}, 35461 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 35462} 35463 35464@Unpublished{ rutherford:miles, 35465 author = {T. F. Rutherford}, 35466 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 35467 year = {1993}, 35468 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 35469} 35470 35471@TechReport{ rutherford:modeling, 35472 author = {T. F. Rutherford}, 35473 title = {A Modeling System for Applied General Equilibrium Analysis}, 35474 type = {Cowles Foundation Discussion Paper}, 35475 number = {836}, 35476 institution = {Yale University}, 35477 year = {1987} 35478} 35479 35480@TechReport{ rutherford:mpsge, 35481 author = {T. F. Rutherford}, 35482 title = {{MPSGE}}, 35483 institution = {University of Western Ontario}, 35484 year = {1988}, 35485 address = {London, Ontario} 35486} 35487 35488@Article{ rykov:simplex, 35489 author = {A. S. Rykov}, 35490 title = {Simplex Direct Search Algorithms}, 35491 journal = {Automation and Remote Control}, 35492 year = {1980}, 35493 volume = {41}, 35494 pages = {784--793} 35495} 35496 35497@Article{ saad.schultz:gmres, 35498 author = {Y. Saad and M. Schultz}, 35499 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 35500 Linear Systems}, 35501 journal = {SIAM Journal on Scientific and Statistical Computing}, 35502 year = {1986}, 35503 volume = {44}, 35504 pages = {856--869} 35505} 35506 35507@Book{ saad:iterative, 35508 author = {Y. Saad}, 35509 title = {Iterative Methods for Sparse Linear Systems}, 35510 year = {1996}, 35511 publisher = {PWS Publishing Company}, 35512 address = {Boston, Massachusetts} 35513} 35514 35515@Article{ sahni:approximate, 35516 author = {S. Sahni}, 35517 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 35518 journal = {jacm}, 35519 year = {1975}, 35520 volume = {22}, 35521 pages = {115--124} 35522} 35523 35524@InProceedings{ sauer.shepard.ea:comparison, 35525 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 35526 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 35527 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35528 Radiation Therapy, Salt Lake City}, 35529 year = {1997}, 35530 editor = {D. D. Leavitt and G. Starkshall}, 35531 publisher = {Medical Physics Publishing}, 35532 address = {St. Louis, Missouri} 35533} 35534 35535@Article{ sauer.xu:multivariate, 35536 author = {Th. Sauer and Y. Xu}, 35537 title = {On Multivariate {L}agrange Interpolation}, 35538 journal = {Mathematics of Computation}, 35539 year = {1995}, 35540 volume = {64}, 35541 pages = {1147--1170} 35542} 35543 35544@Article{ savelsbergh:preprocessing, 35545 author = {M. W. P. Savelsbergh}, 35546 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 35547 journal = {ORSA Journal on Computing}, 35548 year = {1994}, 35549 volume = {6}, 35550 pages = {445--454} 35551} 35552 35553@Article{ scarf:approximation, 35554 author = {H. E. Scarf}, 35555 title = {The Approximation of Fixed Points of a Continuous Mapping}, 35556 journal = {SIAM Journal on Applied Mathematics}, 35557 year = {1967}, 35558 volume = {15}, 35559 pages = {1328--1343} 35560} 35561 35562@Book{ scarf:computation, 35563 author = {H. E. Scarf}, 35564 title = {The Computation of Economic Equilibria}, 35565 year = {1973}, 35566 publisher = {Yale University Press}, 35567 address = {New Haven, Connecticut} 35568} 35569 35570@TechReport{ scheel.scholtes:mathematical, 35571 author = {H. Scheel and S. Scholtes}, 35572 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 35573 and Sensitivity}, 35574 institution = {Judge Institute of Management Studies, University of Cambridge}, 35575 year = {1998}, 35576 type = {Technical Report}, 35577 address = {Cambridge, England} 35578} 35579 35580@Article{ schlick:modified, 35581 author = {T. Schlick}, 35582 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 35583 journal = {SIAM Journal on Scientific Computing}, 35584 year = {1993}, 35585 volume = {14}, 35586 pages = {424--445} 35587} 35588 35589@Article{ schnabel.eskow:modified, 35590 author = {R. B. Schnabel and E. Eskow}, 35591 title = {A New Modified {C}holesky Factorization}, 35592 journal = {SIAM Journal on Scientific and Statistical Computing}, 35593 year = {1991}, 35594 volume = {11}, 35595 pages = {1136--1158} 35596} 35597 35598@Article{ schneider.zenios:comparative, 35599 author = {M. H. Schneider and S. A. Zenios}, 35600 title = {A Comparative Study of Algorithms for Matrix Balancing}, 35601 journal = {Operations Research}, 35602 year = {1990}, 35603 volume = {38}, 35604 pages = {439--455} 35605} 35606 35607@Book{ scholkopf.burges.ea:advances, 35608 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 35609 title = {Advances in Kernel Methods: Support Vector Machines}, 35610 publisher = {MIT Press}, 35611 address = {Cambridge, MA }, 35612 year = {1998}, 35613 isbn = {0-262-19416-3} 35614} 35615 35616@Article{ scholtes.stohr:exact, 35617 author = {S. Scholtes and M. St{\"{o}}hr}, 35618 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 35619 journal = {SIAM Journal on Control and Optimization}, 35620 volume = {37}, 35621 pages = {617--652}, 35622 year = {1999} 35623} 35624 35625@TechReport{ scholtes:introduction, 35626 author = {S. Scholtes}, 35627 title = {Introduction to piecewise differentiable equations}, 35628 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 35629 Universit{\"{a}}t Karlsruhe}, 35630 year = {1994}, 35631 type = {Preprint}, 35632 number = {No. 53/1994}, 35633 address = {Karlsruhe, Germany} 35634} 35635 35636@Article{ schramm.zowe:version, 35637 author = {H. Schramm and J. Zowe}, 35638 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 35639 Idea, Convergence Analysis, Numerical Results}, 35640 journal = {SIAM Journal on Optimization}, 35641 year = {1992}, 35642 volume = {2}, 35643 pages = {121--152} 35644} 35645 35646@Article{ schultz.meyer:interior, 35647 author = {G. L. Schultz and R. R. Meyer}, 35648 title = {An Interior Point Method for Block Angular Optimization}, 35649 journal = {SIAM Journal on Optimization}, 35650 year = {1991}, 35651 volume = {1}, 35652 pages = {583--602} 35653} 35654 35655@InProceedings{ sekiguchi.sato.ea:ninf, 35656 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 35657 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 35658 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 35659 year = {1996}, 35660 address = {Santa Fe} 35661} 35662 35663@InCollection{ sellami.robinson:homotopies, 35664 author = {H. Sellami and S. M. Robinson}, 35665 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 35666 Inequalities}, 35667 booktitle = {Nonlinear Optimization and Applications}, 35668 editor = {G. Di Pillo and F. Giannessi}, 35669 year = {1996}, 35670 pages = {327--343}, 35671 publisher = {Plenum Press}, 35672 address = {New York} 35673} 35674 35675@Article{ sellami.robinson:implementation, 35676 author = {H. Sellami and S. M. Robinson}, 35677 title = {Implementation of a Continuation Method for Normal Maps}, 35678 journal = {Mathematical Programming}, 35679 year = {1997}, 35680 volume = {76}, 35681 pages = {563--578} 35682} 35683 35684@PhDThesis{ sellami:continuation, 35685 author = {H. Sellami}, 35686 title = {A Continuation Method for Normal Maps}, 35687 school = {University of Wisconsin -- Madison}, 35688 year = {1994}, 35689 address = {Madison, Wisconsin} 35690} 35691 35692@Article{ sellami:homotopy, 35693 author = {H. Sellami}, 35694 title = {A Homotopy Continuation Method for Normal Maps}, 35695 journal = {Mathematical Programming}, 35696 vol = {82}, 35697 year = {1998}, 35698 pages = {317--337} 35699} 35700 35701@Book{ seuss:one, 35702 author = {{Dr.} A. Seuss}, 35703 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 35704 year = {1960}, 35705 publisher = {Beginner Books}, 35706 address = {New York}, 35707 series = {Beginner Books, B13}, 35708 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 35709 Yink, Yop, Gack, and the Zeds} 35710} 35711 35712@Article{ seyfferth.pfeiffer:dynamics, 35713 author = {W. Seyfferth and F. Pfeiffer}, 35714 title = {Dynamics of Assembly Processes With a Manipulator}, 35715 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 35716 and Systems}, 35717 year = {1992}, 35718 pages = {1303--1310} 35719} 35720 35721@Article{ shanno.simantiraki:infeasible, 35722 author = {D. Shanno and E. Simantiraki}, 35723 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 35724 year = {1997}, 35725 journal = {SIAM Journal on Optimization}, 35726 volume = {7}, 35727 pages = {620--640} 35728} 35729 35730@InProceedings{ shanno.simantiraki:interior, 35731 author = {D. Shanno and E. Simantiraki}, 35732 title = {Interior Point Methods for Linear and Nonlinear Programming}, 35733 booktitle = {State of the Art in Numerical Analysis}, 35734 year = {1997}, 35735 editor = {I. S. Duff and G. A. Watson}, 35736 publisher = {Oxford University Press}, 35737 address = {Oxford} 35738} 35739 35740@Article{ shannon:introduction, 35741 author = {R. E. Shannon}, 35742 title = {Introduction to the Art and Science of simulation}, 35743 journal = {WSC98 1998 Winter simulation conference proceedings}, 35744 year = {1998}, 35745 volume = {1}, 35746 pages = {7--14} 35747} 35748 35749@TechReport{ shapiro:concepts, 35750 author = {A. Shapiro}, 35751 title = {On Concepts of Directional Differentiability}, 35752 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 35753 year = {1988}, 35754 address = {Pretoria, South Africa}, 35755 number = {73/88(18)}, 35756 type = {Research Report} 35757} 35758 35759@Book{ shavlik.editors:readings, 35760 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 35761 title = {Readings in Machine Learning}, 35762 year = {1990}, 35763 publisher = {Morgan Kaufman}, 35764 address = {San Mateo, California} 35765} 35766 35767@Article{ shavlik.mooney.ea:symbolic, 35768 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 35769 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 35770 journal = {Machine Learning}, 35771 year = {1991}, 35772 volume = {6}, 35773 pages = {111--143} 35774} 35775 35776@Book{ sheffi:urban, 35777 author = {Y. Sheffi}, 35778 title = {Urban Transportation Networks}, 35779 publisher = {Prentice-Hall, Inc}, 35780 year = {1985}, 35781 address = {Englewood Cliffs, New Jersey} 35782} 35783 35784@Article{ sheng.potra:quadratically, 35785 author = {R. Sheng and F. A. Potra}, 35786 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 35787 Polynomial {CO}mplexity}, 35788 journal = {SIAM Journal on Optimization}, 35789 year = {1997}, 35790 volume = {7}, 35791 pages = {304--317} 35792} 35793 35794@InProceedings{ shepard.angelos.ea:simple, 35795 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 35796 title = {A Simple Model for Examining Radiotherapy Optimization}, 35797 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35798 Radiation Therapy, Salt Lake City}, 35799 year = {1997}, 35800 editor = {D. D. Leavitt and G. Starkshall}, 35801 publisher = {Medical Physics Publishing}, 35802 address = {St. Louis, Missouri} 35803} 35804 35805@Article{ shepard.ferris.ea:inverse, 35806 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 35807 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 35808 journal = {Medical Physics}, 35809 volume = {27}, 35810 pages = {12}, 35811 year = {2000}, 35812 key = {93} 35813} 35814 35815@Article{ shepard.ferris.ea:optimizing, 35816 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 35817 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 35818 journal = {SIAM Review}, 35819 volume = {41}, 35820 pages = {721--744}, 35821 year = {1999}, 35822 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 35823 key = {68}, 35824 institution = {Computer Sciences Department, University of Wisconsin}, 35825 address = {Madison, Wisconsin}, 35826 number = {98-07}, 35827 type = {Mathematical Programming Technical Report} 35828} 35829 35830@Article{ sherali.shetty:finitely, 35831 author = {H. D. Sherali and C. M. Shetty}, 35832 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 35833 Cuts and Disjunctive Face Cuts}, 35834 journal = {Mathematical Programming}, 35835 year = {1980}, 35836 volume = {19}, 35837 pages = {14--31} 35838} 35839 35840@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 35841 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 35842 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 35843 journal = {Operations Research}, 35844 year = {1983}, 35845 volume = {31}, 35846 pages = {253--276} 35847} 35848 35849@Article{ shi.olafsson.ea:hybrid, 35850 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 35851 title = {A New Hybrid Optimization Algorithm}, 35852 journal = {Computers and Industrial Engineering}, 35853 year = {1999}, 35854 volume = {36}, 35855 pages = {409--426} 35856} 35857 35858@PhDThesis{ shiau:iterative, 35859 author = {T.--H. Shiau}, 35860 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 35861 school = {Computer Sciences Department, University of Wisconsin}, 35862 year = {1983}, 35863 address = {Madison, Wisconsin}, 35864 note = {Technical Report 507} 35865} 35866 35867@InProceedings{ shor:generalized, 35868 crossref = {bachem.grotschel.ea:mathematical}, 35869 author = {N. Z. Shor}, 35870 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 35871 Dilation Operations}, 35872 pages = {501--529} 35873} 35874 35875@Book{ shor:minimization, 35876 author = {N. Z. Shor}, 35877 title = {Minimization Methods for Nondifferentiable Functions}, 35878 year = {1985}, 35879 publisher = {Springer-Verlag}, 35880 address = {Berlin} 35881} 35882 35883@Article{ shoven.whalley:applied, 35884 author = {J. Shoven and J. Whalley}, 35885 title = {Applied General Equilibrium Models of Taxation and International Trade: 35886 Introduction and Survey}, 35887 journal = {Journal of Economic Literature}, 35888 year = {1984}, 35889 volume = {22}, 35890 pages = {1007--1051} 35891} 35892 35893@Article{ shultz.meyer:interior, 35894 author = {G. L. Shultz and R. R. Meyer}, 35895 title = {An Interior Point Method for Block Angular Optimization}, 35896 journal = {SIAM Journal on Optimization}, 35897 year = {1991}, 35898 volume = {1}, 35899 pages = {583--602} 35900} 35901 35902@Article{ shultz.schnabel.ea:family, 35903 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 35904 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 35905 journal = {SIAM Journal on Numerical Analysis}, 35906 year = {1985}, 35907 volume = {22}, 35908 pages = {44--67} 35909} 35910 35911@Article{ sibony:methodes, 35912 author = {M. Sibony}, 35913 title = {Methodes iteratives pur les equations et inequations aux derives partielles 35914 nonlineaires de type monotone}, 35915 journal = {Calcolo}, 35916 year = {1970}, 35917 volume = {7}, 35918 pages = {65--183} 35919} 35920 35921@Article{ sidney:optimal, 35922 author = {J. B. Sidney}, 35923 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 35924 journal = {Operations Research}, 35925 year = {1977}, 35926 volume = {25}, 35927 pages = {62--69} 35928} 35929 35930@Book{ siegel:corba, 35931 author = {J. Siegel}, 35932 title = {{CORBA} - Fundamentals and Programming}, 35933 publisher = {John Wiley \& Sons}, 35934 year = {1996}, 35935 address = {New York, New York} 35936} 35937 35938@TechReport{ simantiraki.shanno:infeasible-interior-point, 35939 author = {E. Simantiraki and D. F. Shanno}, 35940 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 35941 type = {Research Report}, 35942 number = {7-95}, 35943 institution = {Rutgers Center for Operations Research, Rutgers University}, 35944 address = {New Brunswick, New Jersey}, 35945 year = {1995} 35946} 35947 35948@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 35949 author = {E. Simantiraki and D. F. Shanno}, 35950 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 35951 Problems}, 35952 crossref = {ferris.pang:complementarity}, 35953 pages = {386--404} 35954} 35955 35956@Book{ simpson:artificial, 35957 author = {P. K. Simpson}, 35958 title = {Artificial Neural Systems}, 35959 year = {1990}, 35960 publisher = {Pergamon Press}, 35961 address = {New York} 35962} 35963 35964@Article{ smeers:computable, 35965 author = {Y. Smeers}, 35966 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 35967 and Gas Markets}, 35968 journal = {The Energy Journal}, 35969 year = {1997}, 35970 optkey = {}, 35971 optvolume = {18}, 35972 optnumber = {}, 35973 optmonth = {}, 35974 optpages = {1--32}, 35975 optnote = {}, 35976 optannote = {} 35977} 35978 35979@Article{ smith:design, 35980 author = {F. W. Smith}, 35981 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 35982 Procedures}, 35983 journal = {IEEE Transactions on Computers}, 35984 year = {1969}, 35985 volume = {18}, 35986 pages = {367--372} 35987} 35988 35989@Article{ smith:existence, 35990 author = {M. J. Smith}, 35991 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 35992 journal = {Transportation Research}, 35993 year = {1979}, 35994 volume = {13B}, 35995 pages = {295--304} 35996} 35997 35998@Article{ smith:existence*1, 35999 author = {M. J. Smith}, 36000 title = {The existence and calculation of traffic equilibria}, 36001 journal = {Transportation Research}, 36002 volume = {17B}, 36003 year = {1983}, 36004 pages = {291--303} 36005} 36006 36007@Article{ smith:pattern, 36008 author = {F. W. Smith}, 36009 title = {Pattern Classifier Design by Linear Programming}, 36010 journal = {IEEE Transactions on Computers}, 36011 year = {1968}, 36012 volume = {C-17}, 36013 pages = {367--372} 36014} 36015 36016@Article{ solodov.svaiter:projection, 36017 author = {M. V. Solodov and B. F. Svaiter}, 36018 title = {A New Projection Method for Variational Inequality Problems}, 36019 journal = {SIAM Journal on Control and Optimization}, 36020 volume = {37}, 36021 pages = {765--776}, 36022 year = {1999} 36023} 36024 36025@Article{ solodov.tseng:modified, 36026 author = {M. V. Solodov and P. Tseng}, 36027 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 36028 year = {1996}, 36029 journal = {SIAM Journal on Control and Optimization}, 36030 pages = {1814--1830}, 36031 volume = {34} 36032} 36033 36034@Article{ solodov:stationary, 36035 author = {M. V. Solodov}, 36036 title = {Stationary Points of Bound Constrained Minimization Reformulations of 36037 Complementarity Problems}, 36038 journal = {Journal of Optimization Theory and Applications, forthcoming}, 36039 year = {1997} 36040} 36041 36042@Article{ spendley.hext.ea:sequential, 36043 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 36044 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 36045 Operation}, 36046 journal = {Technometrics}, 36047 year = {1962}, 36048 pages = {441--461}, 36049 volume = {4} 36050} 36051 36052@Article{ spingarn:applications, 36053 author = {J. E. Spingarn}, 36054 title = {Applications of the Method of Partial Inverses to Convex Programming}, 36055 journal = {Mathematical Programming}, 36056 year = {1985}, 36057 volume = {32}, 36058 pages = {199--223} 36059} 36060 36061@Book{ srinivasan.whalley:general, 36062 author = {T. Srinivasan and J. Whalley}, 36063 title = {General Equilibrium Trade Policy Modelling}, 36064 publisher = {MIT Press}, 36065 year = {1986}, 36066 address = {Boston} 36067} 36068 36069@Book{ stackelberg:theory, 36070 author = {H. Van Stackelberg}, 36071 title = {The Theory of Market Economy}, 36072 publisher = {Oxford University Press}, 36073 year = {1952} 36074} 36075 36076@Article{ stavroulakis.panagiotopoulos.ea:rigid, 36077 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 36078 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 36079 Applications}, 36080 journal = {Computers \& Structures}, 36081 volume = {40}, 36082 year = {1991}, 36083 pages = {599--614} 36084} 36085 36086@Article{ stavroulakis:optimal, 36087 author = {G. E. Stavroulakis}, 36088 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 36089 optimal control problem for variational inequalities}, 36090 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 36091 year = {1996} 36092} 36093 36094@Article{ stavroulakis:optimal*1, 36095 author = {G. E. Stavroulakis}, 36096 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 36097 journal = {Archives of Applied Mechanics, forthcoming}, 36098 year = {1996} 36099} 36100 36101@Book{ steenbrink:optimization, 36102 author = {P. A. Steenbrink}, 36103 title = {Optimization of Transport Networks}, 36104 publisher = {John Wiley \& Sons}, 36105 address = {London, England}, 36106 year = {1974} 36107} 36108 36109@Article{ stephens:asymptotic, 36110 author = {M. A. Stephens}, 36111 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 36112 journal = {Annals of Statistics}, 36113 year = {1976}, 36114 volume = {4}, 36115 pages = {357--369} 36116} 36117 36118@Article{ stephens:edf, 36119 author = {M. A. Stephens}, 36120 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 36121 journal = {Journal of the American Statistical Association}, 36122 year = {1974}, 36123 volume = {69}, 36124 pages = {730--737} 36125} 36126 36127@Article{ stevens:location, 36128 author = {B. H. Stevens}, 36129 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 36130 journal = {Papers of the Regional Science Association}, 36131 year = {1968}, 36132 volume = {21}, 36133 pages = {19--34} 36134} 36135 36136@Article{ stewart.trinkle:implicit, 36137 author = {D. E. Stewart and J. C. Trinkle}, 36138 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 36139 Collisions and {C}oulomb Friction}, 36140 journal = {International Journal for Numerical Methods in Engineering}, 36141 year = {1996}, 36142 volume = {39}, 36143 pages = {2673--2691} 36144} 36145 36146@Book{ stoer.bulirsch:introduction, 36147 author = {J. Stoer and R. Bulirsch}, 36148 title = {Introduction to Numerical Analysis}, 36149 year = {1980}, 36150 publisher = {Springer-Verlag}, 36151 address = {New York} 36152} 36153 36154@Article{ stoer:complexity, 36155 author = {J. Stoer}, 36156 title = {The complexity of an infeasible interior--point path--following method for the 36157 solution of linear programs}, 36158 journal = {Optimization Methods and Software}, 36159 year = {1994}, 36160 volume = {3}, 36161 pages = {1--12} 36162} 36163 36164@Article{ stone:cross-validatory, 36165 author = {M. Stone}, 36166 title = {Cross-validatory choice and assessment of statistical predictions}, 36167 journal = {Journal of the Royal Statistical Society}, 36168 year = {1974}, 36169 volume = {36}, 36170 pages = {111--147} 36171} 36172 36173@Article{ stone.smith.ea:inverse, 36174 author = {R. A. Stone and V. Smith and L. Verhey}, 36175 title = {Inverse Planning for the {G}amma {K}nife}, 36176 journal = {Medical Physics}, 36177 year = {1993}, 36178 volume = {20}, 36179 pages = {865} 36180} 36181 36182@Book{ strang:linear, 36183 author = {G. Strang}, 36184 title = {Linear Algebra and its Applications}, 36185 year = {1980}, 36186 publisher = {Academic Press}, 36187 address = {New York}, 36188 edition = {Second} 36189} 36190 36191@InProceedings{ street.wolberg.ea:nuclear, 36192 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 36193 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 36194 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 36195 year = {1993}, 36196 publisher = {SPIE--The International Society for Optical Engineering}, 36197 address = {San Jose, California}, 36198 pages = {861--870}, 36199 volume = {1905} 36200} 36201 36202@Article{ subramanian:gauss-newton, 36203 author = {P. K. Subramanian}, 36204 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 36205 journal = {Journal of Optimization Theory and Applications}, 36206 year = {1993}, 36207 volume = {77}, 36208 pages = {467--482} 36209} 36210 36211@PhDThesis{ subramanian:iterative, 36212 author = {P. K. Subramanian}, 36213 title = {Iterative Methods of Solution for Complementarity Problems}, 36214 year = {1985}, 36215 address = {Madison, Wisconsin}, 36216 school = {Computer Sciences Department, University of Wisconsin} 36217} 36218 36219@TechReport{ subramanian:note, 36220 author = {P. K. Subramanian}, 36221 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 36222 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 36223 year = {1985}, 36224 address = {Madison, Wisconsin}, 36225 number = {2844}, 36226 type = {Technical Summary Report} 36227} 36228 36229@TechReport{ suh.gucht:distributed, 36230 author = {J. Y. Suh and D. Van Gucht}, 36231 title = {Distributed Genetic Algorithms}, 36232 institution = {Computer Science Department, Indiana University}, 36233 year = {1987}, 36234 address = {Bloomington}, 36235 number = {225} 36236} 36237 36238@Article{ sun.natori.ea:computational, 36239 author = {S. M. Sun and M. C. Natori and K. C. Park}, 36240 title = {A Computational Procedure for Flexible Beams with Frictional Contact 36241 Constraints}, 36242 journal = {International Journal for Numerical Methods in Engineering}, 36243 volume = {36}, 36244 pages = {3781--3800}, 36245 year = {1993} 36246} 36247 36248@Article{ sun.qi:ncp-functions, 36249 author = {D. Sun and L. Qi}, 36250 title = {On {NCP}-Functions}, 36251 journal = {Computational Optimization and Applications, forthcoming}, 36252 year = {1998} 36253} 36254 36255@Article{ sun.womersley:unconstrained, 36256 author = {D. Sun and R. S. Womersley}, 36257 title = {A new unconstrained differentiable merit function for box constrained variational 36258 inequality problems and a damped {G}auss-{N}ewton method}, 36259 journal = {SIAM Journal on Optimization}, 36260 year = {1999}, 36261 volume = {9}, 36262 pages = {388--413} 36263} 36264 36265@Article{ sun:class, 36266 author = {D. Sun}, 36267 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 36268 journal = {Journal of Optimization Theory and Applications}, 36269 year = {1996}, 36270 volume = {91}, 36271 pages = {123--140} 36272} 36273 36274@PhDThesis{ sun:monotropic, 36275 author = {J. Sun}, 36276 title = {On Monotropic Piecewise Quadratic Programming}, 36277 school = {University of Washington}, 36278 year = {1986}, 36279 address = {Seattle, Washington} 36280} 36281 36282@Article{ sun:thermal, 36283 author = {D. C. Sun}, 36284 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 36285 journal = {Journal of Applied Mechanics}, 36286 volume = {58}, 36287 pages = {141--153}, 36288 year = {1991} 36289} 36290 36291@Article{ sundararaghavan.ahmed:minimizing, 36292 author = {P. S. Sundararaghavan and M. U. Ahmed}, 36293 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 36294 Scheduling}, 36295 journal = {Naval Research Logistics Quarterly}, 36296 year = {1984}, 36297 volume = {31}, 36298 pages = {325--333} 36299} 36300 36301@TechReport{ sznajder.gowda:generalizations, 36302 author = {R. Sznajder and M. S. Gowda}, 36303 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 36304 horizontal {LCP}s}, 36305 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 36306 year = {1992}, 36307 address = {Catonsville, Maryland}, 36308 number = {92--16}, 36309 type = {Research Report} 36310} 36311 36312@Article{ sznajder.gowda:nondegeneracy, 36313 author = {R. Sznajder and M. S. Gowda}, 36314 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 36315 journal = {Mathematics of Operations Research}, 36316 year = {1998}, 36317 volume = {23}, 36318 pages = {221--238} 36319} 36320 36321@Article{ taji.fukushima.ea:globally, 36322 author = {K. Taji and M. Fukushima and T. Ibaraki}, 36323 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 36324 Inequalities}, 36325 journal = {Mathematical Programming}, 36326 year = {1993}, 36327 volume = {58}, 36328 pages = {369--383} 36329} 36330 36331@Article{ taji.fukushima:optimization, 36332 author = {K. Taji and M. Fukushima}, 36333 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 36334 Problem}, 36335 journal = {Journal of the Operations Research Society of Japan}, 36336 year = {1994}, 36337 volume = {37}, 36338 pages = {310--331} 36339} 36340 36341@Article{ talbot.patterson.ea:comparative, 36342 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 36343 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 36344 journal = {Management Science}, 36345 year = {1986}, 36346 volume = {32}, 36347 pages = {430--454} 36348} 36349 36350@Article{ talman.yamamoto:simplicial, 36351 author = {A. J. J. Talman and Y. Yamamoto}, 36352 title = {A {S}implicial Algorithm for Stationary Point Problems}, 36353 journal = {Mathematics of Operations Research}, 36354 year = {1989}, 36355 volume = {14}, 36356 pages = {383--399} 36357} 36358 36359@InProceedings{ tanese:distributed, 36360 crossref = {schaeffer:third}, 36361 author = {R. Tanese}, 36362 title = {Distributed Genetic Algorithms}, 36363 pages = {434--439} 36364} 36365 36366@InProceedings{ tanese:parallel, 36367 crossref = {grefenstette:genetic}, 36368 author = {R. Tanese}, 36369 title = {Parallel Genetic Algorithms for a Hypercube}, 36370 pages = {177--183} 36371} 36372 36373@Article{ teboulle:entropic, 36374 author = {M. Teboulle}, 36375 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 36376 year = {1992}, 36377 journal = {Mathematics of Operations Research}, 36378 volume = {17}, 36379 pages = {670--690} 36380} 36381 36382@Article{ thuente:duality, 36383 author = {D. J. Thuente}, 36384 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 36385 journal = {Operations Research}, 36386 year = {1980}, 36387 volume = {28}, 36388 pages = {1005--1011} 36389} 36390 36391@Book{ tikhonov.arsenin:solutions, 36392 author = {A. N. Tikhonov and V. Y. Arsenin}, 36393 title = {Solutions of Ill--Posed Problems}, 36394 year = {1977}, 36395 publisher = {John Wiley \& Sons}, 36396 address = {New York} 36397} 36398 36399@InProceedings{ tin-loi.ferris:complementarity, 36400 author = {F. Tin-Loi and M. C. Ferris}, 36401 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 36402 booktitle = {Computational Mechanics for the Next Millenium}, 36403 key = {79}, 36404 pages = {1029--1036}, 36405 year = {1999}, 36406 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 36407 volume = {2}, 36408 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 36409 Mechanics}, 36410 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 36411 publisher = {Elsevier Science Ltd}, 36412 type = {Mathematical Programming Technical Report}, 36413 institution = {Computer Sciences Department, University of Wisconsin}, 36414 address = {Madison, Wisconsin}, 36415 number = {99-02} 36416} 36417 36418@InProceedings{ tin-loi.ferris:holonomic, 36419 author = {F. Tin-Loi and M. C. Ferris}, 36420 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 36421 booktitle = {Advances in Fracture Research}, 36422 year = {1997}, 36423 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 36424 volume = {2}, 36425 publisher = {Pergamon Press}, 36426 pages = {2183--2190}, 36427 key = {53} 36428} 36429 36430@InProceedings{ tin-loi.ferris:simple, 36431 author = {F. Tin-Loi and M. C. Ferris}, 36432 title = {A Simple Mathematical Programming Method for a Structural Identification 36433 Problem}, 36434 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 36435 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 36436 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 36437 publisher = {Techno-Press}, 36438 address = {Korea}, 36439 year = {1997}, 36440 pages = {511--518}, 36441 key = {59} 36442} 36443 36444@Article{ tin-loi.misa:large, 36445 author = {F. Tin-Loi and J. S. Misa}, 36446 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 36447 journal = {International Journal for Numerical Methods in Engineering}, 36448 volume = {39}, 36449 pages = {741--762}, 36450 year = {1996} 36451} 36452 36453@Article{ tin-loi.pang:elastoplastic, 36454 author = {F. Tin-Loi and J. S. Pang}, 36455 title = {Elastoplastic analysis of structures with nonlinear hardening}, 36456 journal = {Computer Methods in Applied Mechanics and Engineering}, 36457 volume = {107}, 36458 year = {1993}, 36459 pages = {299--312} 36460} 36461 36462@Article{ tin-loi.vimonsatit:nonlinear, 36463 author = {F. Tin-Loi and V. Vimonsatit}, 36464 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 36465 journal = {Engineering Structures}, 36466 volume = {18}, 36467 year = {1996}, 36468 pages = {115--124} 36469} 36470 36471@Article{ tobin:uniqueness, 36472 author = {R. L. Tobin}, 36473 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 36474 journal = {Annals of Operations Research}, 36475 volume = {34}, 36476 year = {1992}, 36477 pages = {21--36} 36478} 36479 36480@Article{ tobin:variable, 36481 author = {R. L. Tobin}, 36482 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 36483 Problem}, 36484 journal = {Mathematical Programming}, 36485 year = {1988}, 36486 volume = {40}, 36487 pages = {33--51} 36488} 36489 36490@Article{ todd.burrell:extension, 36491 author = {M. J. Todd and B. P. Burrell}, 36492 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 36493 Variables}, 36494 journal = {Algorithmica}, 36495 year = {1986}, 36496 volume = {1}, 36497 pages = {409--424} 36498} 36499 36500@Book{ todd:computation, 36501 author = {M. J. Todd}, 36502 title = {Computation of Fixed Points and Applications}, 36503 publisher = {Springer-Verlag}, 36504 year = {1976}, 36505 volume = {124}, 36506 series = {Lecture Notes in Economics and Mathematical Systems}, 36507 address = {Heidelberg} 36508} 36509 36510@Article{ todd:note, 36511 author = {M. J. Todd}, 36512 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 36513 Production}, 36514 journal = {Journal of Mathematical Economics}, 36515 year = {1976}, 36516 volume = {6}, 36517 pages = {135--144} 36518} 36519 36520@Article{ toint:assesment, 36521 author = {Ph. L. Toint}, 36522 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 36523 Optimization}, 36524 year = {1996}, 36525 journal = {SIAM Journal on Scientific Computing}, 36526 volume = {17}, 36527 pages = {725=-739} 36528} 36529 36530@TechReport{ toint:assesment*1, 36531 author = {Ph. L. Toint}, 36532 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 36533 Optimization: The Complete Numerical Results}, 36534 institution = {Department of Mathematics, FUNDP}, 36535 year = {1994}, 36536 number = {94/15}, 36537 address = {Namur, Belgium} 36538} 36539 36540@Article{ toint:global, 36541 author = {Ph. L. Toint}, 36542 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 36543 in a {H}ilbert Space}, 36544 journal = {IMA Journal of Numerical Analysis}, 36545 year = {1988}, 36546 volume = {8}, 36547 pages = {231--252} 36548} 36549 36550@Article{ toint:non-monotone, 36551 author = {Ph. L. Toint}, 36552 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 36553 Convex Constraints}, 36554 year = {1997}, 36555 journal = {Mathematical Programming}, 36556 volume = {77}, 36557 pages = {69--94} 36558} 36559 36560@InCollection{ toint:transportation, 36561 author = {Ph. L. Toint}, 36562 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 36563 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 36564 Management}, 36565 publisher = {Springer-Verlag}, 36566 series = {NATO ASI Series F}, 36567 year = {1997}, 36568 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 36569} 36570 36571@Article{ tomlin.welch:finding, 36572 author = {J. Tomlin and J. Welch}, 36573 title = {Finding Duplicate Rows in a Linear Programming Model}, 36574 journal = {Operations Research Letters}, 36575 year = {1986}, 36576 volume = {5}, 36577 number = {1}, 36578 pages = {7--11} 36579} 36580 36581@Article{ torczon:convergence, 36582 author = {V. Torczon}, 36583 title = {On the Convergence of the Multidirectional Search Algorithm}, 36584 journal = {SIAM Journal on Optimization}, 36585 year = {1991}, 36586 volume = {1}, 36587 pages = {123--145} 36588} 36589 36590@Article{ torczon:convergence*1, 36591 author = {V. Torczon}, 36592 title = {On the Convergence of Pattern Search Algorithms}, 36593 journal = {SIAM Journal on Optimization}, 36594 year = {1997}, 36595 volume = {7}, 36596 pages = {1--25} 36597} 36598 36599@Misc{ torma.rutherford:general, 36600 author = {H. Torma and T. Rutherford}, 36601 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 36602 year = {1992}, 36603 howpublished = {Working Paper 15/1992}, 36604 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 36605} 36606 36607@Article{ trinkle.pang.ea:dynamic, 36608 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 36609 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 36610 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 36611 year = {1997}, 36612 pages = {267--279}, 36613 volume = {77} 36614} 36615 36616@InProceedings{ trinkle.pang:dynamic, 36617 author = {J. C. Trinkle and J. S. Pang}, 36618 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 36619 book = {{IEEE} International Conference on Robotics and Automation}, 36620 pages = {2276--2281}, 36621 year = {1997} 36622} 36623 36624@TechReport{ tseng.bertsekas:convergence, 36625 author = {P. Tseng and D. P. Bertsekas}, 36626 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 36627 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 36628 Technology}, 36629 year = {1990}, 36630 type = {technical report}, 36631 number = {LIDS-P-1995}, 36632 address = {Cambridge, MA} 36633} 36634 36635@Article{ tseng.yamashita.ea:equivalence, 36636 author = {P. Tseng and N. Yamashita and M. Fukushima}, 36637 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 36638 Approach}, 36639 year = {1996}, 36640 journal = {SIAM Journal on Optimization}, 36641 volume = {6}, 36642 pages = {446--460} 36643} 36644 36645@Article{ tseng:applications, 36646 author = {P. Tseng}, 36647 title = {Applications of a splitting algorithm to decomposition in convex programming and 36648 variational inequalities}, 36649 journal = {SIAM Journal on Control and Optimization}, 36650 year = {1991}, 36651 volume = {29}, 36652 pages = {119--138} 36653} 36654 36655@Article{ tseng:dual, 36656 author = {P. Tseng}, 36657 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 36658 Constraints: a Unified Approach}, 36659 journal = {SIAM Journal on Control and Optimization}, 36660 year = {1990}, 36661 volume = {28}, 36662 pages = {214--242} 36663} 36664 36665@Article{ tseng:dual*1, 36666 author = {P. Tseng}, 36667 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 36668 Unified Approach}, 36669 journal = {SIAM Journal on Control and Optimization}, 36670 year = {1990}, 36671 volume = {28}, 36672 pages = {214--242} 36673} 36674 36675@Article{ tseng:dual*2, 36676 author = {P. Tseng}, 36677 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 36678 journal = {Mathematical Programming}, 36679 year = {1993}, 36680 volume = {59}, 36681 pages = {231--248} 36682} 36683 36684@Article{ tseng:fortified-descent, 36685 author = {P. Tseng}, 36686 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 36687 journal = {SIAM Journal on Optimization}, 36688 volume = {10}, 36689 pages = {269--288}, 36690 year = {2000} 36691} 36692 36693@Article{ tseng:growth, 36694 author = {P. Tseng}, 36695 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 36696 Problem}, 36697 journal = {Journal of Optimization Theory and Applications}, 36698 volume = {89}, 36699 year = {1996}, 36700 pages = {17--37} 36701} 36702 36703@Unpublished{ tseng:matlab, 36704 author = {P. Tseng}, 36705 title = {Matlab Implementations of Complementarity Codes}, 36706 year = {1995}, 36707 note = {Private Communication} 36708} 36709 36710@Article{ ursescu:multifunctions, 36711 author = {C. Ursescu}, 36712 title = {Multifunctions with closed convex graph}, 36713 journal = {Czech. Math. J.}, 36714 year = {1975}, 36715 volume = {35}, 36716 pages = {438--441} 36717} 36718 36719@TechReport{ vaidya:algorithm, 36720 author = {P. M. Vaidya}, 36721 title = {An Algorithm for Linear Programming which Requires 36722 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 36723 institution = {AT\&T Bell Laboratories}, 36724 year = {1987}, 36725 address = {Murray Hill, New Jersey} 36726} 36727 36728@Article{ val:unloading, 36729 author = {P. Du Val}, 36730 title = {The Unloading Problem for Plane Curves}, 36731 journal = {American Journal of Mathematics}, 36732 year = {1940}, 36733 volume = {62}, 36734 pages = {307--311} 36735} 36736 36737@InCollection{ valentine:problem, 36738 author = {F. A. Valentine}, 36739 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 36740 Conditions}, 36741 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 36742 year = {1937}, 36743 publisher = {University of Chicago Press}, 36744 address = {Chicago}, 36745 pages = {407--448} 36746} 36747 36748@Article{ valle.poch.ea:comparison, 36749 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 36750 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 36751 Flow-Injection Systems}, 36752 journal = {Analytica Chimica Acta}, 36753 year = {1990}, 36754 volume = {241}, 36755 pages = {31--42} 36756} 36757 36758@Article{ vandenberghe.demoor.ea:generalized, 36759 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 36760 title = {The generalized linear complementarity problem applied to the complete analysis 36761 of resistive piecewise-linear circuits}, 36762 journal = {IEEE Transactions on Circuits and Systems}, 36763 volume = {36}, 36764 year = {1989}, 36765 pages = {1382--1391} 36766} 36767 36768@Article{ vanderbei.meketon.ea:modification, 36769 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 36770 title = {A Modification of {K}armarkar's Algorithm}, 36771 journal = {Algorithmica}, 36772 year = {1986}, 36773 volume = {1}, 36774 pages = {395--407} 36775} 36776 36777@Article{ vanderbei:affine-scaling, 36778 author = {R. J. Vanderbei}, 36779 title = {Affine--Scaling for Linear Programs with Free Variables}, 36780 journal = {Mathematical Programming}, 36781 year = {1989}, 36782 volume = {43}, 36783 pages = {31--44} 36784} 36785 36786@Article{ vanroy.wolsey:solving, 36787 author = {T. J. Van~Roy and L. A. Wolsey}, 36788 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 36789 journal = {Operations Research}, 36790 volume = {35}, 36791 pages = {45--57}, 36792 year = {1987} 36793} 36794 36795@Book{ vapnik:nature, 36796 author = {V. N. Vapnik}, 36797 title = {The Nature of Statistical Learning Theory}, 36798 publisher = {John Wiley \& Sons}, 36799 address = {New York}, 36800 year = {1996} 36801} 36802 36803@Book{ varian:microeconomic, 36804 author = {Hal R. Varian}, 36805 title = {Microeconomic Analysis}, 36806 year = {1978}, 36807 publisher = {W.W. Norton \& Company}, 36808 address = {New York, New York} 36809} 36810 36811@Article{ verhey:immobilizing, 36812 author = {L. J. Verhey}, 36813 title = {Immobilizing and Positioning Patients for Radiotherapy}, 36814 journal = {Seminars in Radiation Oncology}, 36815 year = {1995}, 36816 volume = {5}, 36817 number = {2}, 36818 pages = {100--113} 36819} 36820 36821@Article{ vinante.pintos:differentiable, 36822 author = {C. Vinante and S. Pintos}, 36823 title = {On Differentiable Exact Penalty Functions}, 36824 journal = {Journal of Optimization Theory and Applications}, 36825 year = {1986}, 36826 volume = {50}, 36827 pages = {479--493} 36828} 36829 36830@Article{ vlach:scheduling, 36831 author = {M. Vlach}, 36832 title = {On Scheduling with Earliness and Tardiness Penalties}, 36833 journal = {Methods of Operations Research}, 36834 year = {1983}, 36835 volume = {45}, 36836 pages = {367--375} 36837} 36838 36839@InCollection{ wacker:summary, 36840 author = {H.--J. Wacker}, 36841 title = {A Summary of the Developments on Imbedding Methods}, 36842 booktitle = {Continuation Methods}, 36843 year = {1978}, 36844 editor = {H.--J. Wacker}, 36845 publisher = {Academic Press}, 36846 address = {New York}, 36847 pages = {1--35} 36848} 36849 36850@Article{ wakefield.tin-loi:large, 36851 author = {R. R. Wakefield and F. Tin-Loi}, 36852 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 36853 Formulation}, 36854 journal = {Computer Methods in Applied Mechanics and Engineering}, 36855 volume = {84}, 36856 year = {1990}, 36857 pages = {229--242} 36858} 36859 36860@Article{ wakefield.tin-loi:large*1, 36861 author = {R. R. Wakefield and F. Tin-Loi}, 36862 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 36863 Approach}, 36864 journal = {International Journal Mechanical Science}, 36865 volume = {33}, 36866 year = {1991}, 36867 pages = {379--391} 36868} 36869 36870@Article{ walker:implementation, 36871 author = {H. F. Walker}, 36872 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 36873 journal = {SIAM Journal on Scientific Computing}, 36874 volume = {9}, 36875 year = {1988}, 36876 pages = {152--163} 36877} 36878 36879@Book{ wall.schwartz:programming, 36880 author = {L. Wall and R. L. Schwartz}, 36881 title = {Programming Perl}, 36882 publisher = {O'Reilly and Associates, Inc.}, 36883 address = {Sebastopol, CA}, 36884 year = {1991} 36885} 36886 36887@Book{ walras:elements, 36888 author = {L. Walras}, 36889 title = {Elements of Pure Economics}, 36890 publisher = {Allen and Unwin}, 36891 year = {1954}, 36892 address = {London} 36893} 36894 36895@Article{ wang.monteiro.ea:interior, 36896 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 36897 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 36898 journal = {Mathematical Programming}, 36899 volume = {74}, 36900 pages = {159--196}, 36901 year = {1996} 36902} 36903 36904@Article{ wardi:stochastic, 36905 author = {Y. Wardi}, 36906 title = {A Stochastic Steepest-Descent Algorithm}, 36907 journal = {Journal of Optimization Theory and Applications}, 36908 year = {1988}, 36909 volume = {59}, 36910 pages = {307--323} 36911} 36912 36913@Article{ wardi:stochastic*1, 36914 author = {Y. Wardi}, 36915 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 36916 journal = {Journal of Optimization Theory and Applications}, 36917 year = {1990}, 36918 volume = {64}, 36919 pages = {399--417} 36920} 36921 36922@Article{ wardrop:theoretical, 36923 author = {J. G. Wardrop}, 36924 title = {Some Theoretical Aspects of Road Traffic Research}, 36925 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 36926 year = {1952}, 36927 pages = {325--378} 36928} 36929 36930@Article{ warga:minimizing, 36931 author = {J. Warga}, 36932 title = {Minimizing certain convex functions}, 36933 journal = {Journal of SIAM on Applied Mathematics}, 36934 year = {1963}, 36935 volume = {11}, 36936 pages = {588--593} 36937} 36938 36939@Article{ watson.billups.ea:hompack, 36940 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 36941 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 36942 Algorithms}, 36943 journal = {{ACM} Transactions on Mathematical Software}, 36944 year = {1987}, 36945 volume = {13}, 36946 pages = {281--310} 36947} 36948 36949@Article{ watson.billups.ea:slow, 36950 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 36951 title = {Slow Viscous Flow in a Syringe}, 36952 journal = {Journal of Biomechanical Engineering}, 36953 year = {1986}, 36954 volume = {108}, 36955 pages = {317--323} 36956} 36957 36958@Article{ watson:discrete, 36959 author = {G. A. Watson}, 36960 title = {Discrete $\ell_1$ approximation by rational functions}, 36961 journal = {IMA Journal of Numerical Analysis}, 36962 year = {1984}, 36963 volume = {4}, 36964 pages = {275--288} 36965} 36966 36967@Article{ watson:solving, 36968 author = {L. T. Watson}, 36969 title = {Solving the nonlinear complementarity problem by a homotopy method}, 36970 journal = {SIAM Journal on Control and Optimization}, 36971 year = {1979}, 36972 volume = {17}, 36973 pages = {36--46} 36974} 36975 36976@Article{ webb:optimum, 36977 author = {S. Webb}, 36978 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 36979 Heterogeneity}, 36980 journal = {Physics in Medicine and Biology}, 36981 year = {1994}, 36982 volume = {39}, 36983 pages = {1895--1914} 36984} 36985 36986@Book{ webb:physics, 36987 author = {S. Webb}, 36988 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 36989 publisher = {Institute of Physics Publishing Ltd.}, 36990 year = {1997}, 36991 optaddress = {Philadelphia} 36992} 36993 36994@InBook{ webb:theory, 36995 author = {S. Webb}, 36996 editor = {E. Sternick}, 36997 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 36998 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 36999 publisher = {Advanced Medical Publishing}, 37000 year = {1997} 37001} 37002 37003@Book{ weiss.kulikowski:computer, 37004 author = {S. M. Weiss and C. A. Kulikowski}, 37005 title = {Computer Systems that Learn}, 37006 year = {1991}, 37007 publisher = {Morgan Kaufmann Publishers, Inc}, 37008 address = {San Mateo, California} 37009} 37010 37011@PhDThesis{ werbos:beyond, 37012 author = {P. J. Werbos}, 37013 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 37014 Sciences}, 37015 year = {1974}, 37016 school = {Harvard University} 37017} 37018 37019@InCollection{ wets:convergence, 37020 author = {R. J.-B. Wets}, 37021 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 37022 Problems}, 37023 booktitle = {Variational Inequalites and Complementarity Problems}, 37024 year = {1980}, 37025 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 37026 publisher = {John Wiley \& Sons}, 37027 address = {New York}, 37028 pages = {375--403} 37029} 37030 37031@InCollection{ wets:large, 37032 author = {R. J.-B. Wets}, 37033 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 37034 booktitle = {Numerical Techniques for Stochastic Optimization}, 37035 publisher = {Springer-Verlag}, 37036 year = {1988}, 37037 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 37038 address = {Berlin}, 37039 pages = {65--93} 37040} 37041 37042@Article{ white:asymptotic, 37043 author = {H. White}, 37044 title = {Some asymptotic results for learning in single hidden-layer feedforward network 37045 models}, 37046 journal = {Journal of the American Stattistical Association}, 37047 year = {1989}, 37048 volume = {84}, 37049 number = {408}, 37050 pages = {1003--1013} 37051} 37052 37053@Article{ white:learning, 37054 author = {H. White}, 37055 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 37056 journal = {Neural Computation}, 37057 year = {1989}, 37058 volume = {1}, 37059 pages = {425--461} 37060} 37061 37062@InProceedings{ whitley.starkweather.ea:scheduling, 37063 crossref = {schaeffer:third}, 37064 author = {D. Whitley and T. Starkweather and D. Fuquay}, 37065 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 37066 Operator}, 37067 pages = {133--140} 37068} 37069 37070@Book{ williams:model, 37071 author = {H. P. Williams}, 37072 title = {Model Building in Mathematical Programming}, 37073 publisher = {John Wiley \& Sons}, 37074 year = {1990}, 37075 edition = {Third} 37076} 37077 37078@Book{ wilmott.dewynne.ea:option, 37079 author = {P. Wilmott and J. Dewynne and S. Howison}, 37080 title = {Option Pricing}, 37081 publisher = {Oxford Financial Press}, 37082 year = {1993}, 37083 address = {Oxford, England} 37084} 37085 37086@PhDThesis{ wilson:simplicial, 37087 author = {R. B. Wilson}, 37088 title = {A Simplicial Algorithm for Concave Programming}, 37089 year = {1963}, 37090 address = {Boston, MA}, 37091 school = {Graduate School of Business Administration, Harvard University} 37092} 37093 37094@TechReport{ wolberg.bennett.ea:breast, 37095 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 37096 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 37097 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 37098 Wisconsin}, 37099 year = {1992}, 37100 address = {Madison, WI 53706}, 37101 type = {Manuscript} 37102} 37103 37104@Article{ wolberg.mangasarian:multisurface, 37105 author = {W. H. Wolberg and O. L. Mangasarian}, 37106 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 37107 Cytology}, 37108 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 37109 year = {1990}, 37110 volume = {87}, 37111 pages = {9193--9196} 37112} 37113 37114@Unpublished{ wolberg.mangasarian:wbcd, 37115 author = {W. H. Wolberg and O. L. Mangasarian}, 37116 title = {{WBCD: Wisconsin Breast Cancer Database}}, 37117 year = {1991}, 37118 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 37119 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 37120} 37121 37122@Article{ wolberg.street.ea:breast, 37123 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 37124 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 37125 journal = {Analytical and Quantitative Cytology and Histology}, 37126 year = {1993}, 37127 volume = {15}, 37128 number = {6}, 37129 pages = {396--404} 37130} 37131 37132@Unpublished{ wolberg.street.ea:wdbc, 37133 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 37134 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 37135 year = {1995}, 37136 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 37137 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 37138} 37139 37140@Unpublished{ wolberg.street.ea:wpbc, 37141 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 37142 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 37143 year = {1995}, 37144 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 37145 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 37146} 37147 37148@Book{ wolsey:integer, 37149 author = {L. A. Wolsey}, 37150 title = {Integer Programming}, 37151 publisher = {John Wiley \& Sons}, 37152 year = {1998}, 37153 address = {New York, NY} 37154} 37155 37156@Article{ womersley:local, 37157 author = {R. S. Womersley}, 37158 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 37159 journal = {Mathematical Programming}, 37160 year = {1985}, 37161 volume = {32}, 37162 pages = {69--89} 37163} 37164 37165@Article{ woo.sanders.ea:peacock, 37166 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 37167 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 37168 journal = {International Journal of Radiation Oncology, Biology and Physics}, 37169 year = {1994}, 37170 volume = {29}, 37171 number = {1}, 37172 pages = {213--214} 37173} 37174 37175@Article{ wright.ralph:superlinear, 37176 author = {S. J. Wright and D. Ralph}, 37177 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 37178 Problems}, 37179 year = {1996}, 37180 journal = {Mathematics of Operations Research}, 37181 volume = {21}, 37182 pages = {815--838} 37183} 37184 37185@TechReport{ wright.zhang:superquadratic, 37186 author = {S. J. Wright and Y. Zhang}, 37187 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 37188 problems}, 37189 institution = {Argonne National Laboratory}, 37190 year = {1994}, 37191 annote = {revised}, 37192 number = {MCS--P418--0294}, 37193 address = {Argonne, Illinois}, 37194 type = {Preprint} 37195} 37196 37197@TechReport{ wright:dynfgm, 37198 author = {S. E. Wright}, 37199 title = {{DYNFGM}: Dynamic Finite Generation Method}, 37200 institution = {Department of Mathematics, University of Washington}, 37201 year = {1989}, 37202 address = {Seattle, Washington} 37203} 37204 37205@Article{ wright:infeasible-interior-point, 37206 author = {S. J. Wright}, 37207 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 37208 journal = {Mathematical Programming}, 37209 volume = {67}, 37210 pages = {29--51}, 37211 year = {1994} 37212} 37213 37214@Article{ wright:path-following, 37215 author = {S. J. Wright}, 37216 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 37217 Complementarity Problems}, 37218 journal = {Optimization Methods and Software}, 37219 year = {1993}, 37220 volume = {2}, 37221 pages = {79--106} 37222} 37223 37224@TechReport{ wright:path-following*1, 37225 author = {S. J. Wright}, 37226 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 37227 Problems}, 37228 institution = {Argonne National Laboratory}, 37229 year = {1993}, 37230 number = {MCS--P401--1293}, 37231 address = {Argonne, Illinois} 37232} 37233 37234@Book{ wright:primal-dual, 37235 author = {S. J. Wright}, 37236 title = {Primal--Dual Interior--Point Methods}, 37237 year = {1997}, 37238 publisher = {SIAM}, 37239 address = {Philadelphia, Pennsylvania} 37240} 37241 37242@TechReport{ wright:reduced, 37243 author = {S. J. Wright}, 37244 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 37245 institution = {Argonne National Laboratory}, 37246 year = {2000}, 37247 number = {MCS--P808--0400}, 37248 address = {Argonne, Illinois} 37249} 37250 37251@Article{ wright:solution, 37252 author = {S. J. Wright}, 37253 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 37254 journal = {Parallel Computing}, 37255 year = {1990}, 37256 volume = {16}, 37257 pages = {221--238} 37258} 37259 37260@Article{ wu.bourland:morphology, 37261 author = {Q. J. Wu and J. D. Bourland}, 37262 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 37263 isocenters}, 37264 journal = {Medical Physics}, 37265 year = {1999}, 37266 volume = {26}, 37267 number = {10}, 37268 pages = {2151--2160} 37269} 37270 37271@Misc{ wunderling:soplex, 37272 author = {R. Wunderling}, 37273 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 37274 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 37275} 37276 37277@Article{ xiao.harker:nonsmooth, 37278 author = {B. Xiao and P. T. Harker}, 37279 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 37280 journal = {Mathematical Programming}, 37281 year = {1994}, 37282 volume = {65}, 37283 pages = {151--194} 37284} 37285 37286@Article{ xiao.harker:nonsmooth*1, 37287 author = {B. Xiao and P. T. Harker}, 37288 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 37289 Results}, 37290 journal = {Mathematical Programming}, 37291 year = {1994}, 37292 volume = {65}, 37293 pages = {195--216} 37294} 37295 37296@Article{ xiao.zhou:nonmonotone, 37297 author = {Y. Xiao and F. J. Zhou}, 37298 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 37299 Minimization}, 37300 journal = {Computing}, 37301 year = {1992}, 37302 volume = {48}, 37303 pages = {303--317} 37304} 37305 37306@TechReport{ xiao:global, 37307 author = {B. Xiao}, 37308 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 37309 {B}-differentiable equation approach}, 37310 type = {{Ph.D. Thesis}}, 37311 year = {1990}, 37312 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 37313 address = {Philadelphia, PA} 37314} 37315 37316@Article{ xu.burke:polynomial, 37317 author = {S. Xu and J. V. Burke}, 37318 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 37319 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 37320 year = {1999}, 37321 journal = {Mathematical Programming}, 37322 volume = {86}, 37323 pages = {91--104} 37324} 37325 37326@TechReport{ xu:global, 37327 author = {S. Xu}, 37328 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 37329 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 37330 institution = {Department of Mathematics, University of Washington}, 37331 year = {1996}, 37332 type = {Technical Report}, 37333 address = {Seattle, WA} 37334} 37335 37336@Article{ yajima.konno:efficient, 37337 author = {Y. Yajima and H. Konno}, 37338 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 37339 Problems}, 37340 journal = {Journal of Global Optimization}, 37341 year = {1991}, 37342 volume = {1:1}, 37343 pages = {155--171} 37344} 37345 37346@Article{ yamamoto:path-following, 37347 author = {Y. Yamamoto}, 37348 title = {A Path--Following Algorithm for Stationary Point Problems}, 37349 journal = {Journal of Operations Society of Japan}, 37350 year = {1987}, 37351 volume = {30}, 37352 pages = {181--198} 37353} 37354 37355@Article{ yamashita.fukushima:modified, 37356 author = {N. Yamashita and M. Fukushima}, 37357 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 37358 Complementarity Problems}, 37359 journal = {Mathematical Programming}, 37360 year = {1997}, 37361 volume = {76}, 37362 pages = {469--492} 37363} 37364 37365@Article{ yamashita.fukushima:stationary, 37366 author = {N. Yamashita and M. Fukushima}, 37367 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 37368 Problems}, 37369 journal = {Journal of Optimization Theory and Applications}, 37370 volume = {84}, 37371 pages = {653--663}, 37372 year = {1995} 37373} 37374 37375@Article{ yamashita.taji.ea:unconstrained, 37376 author = {N. Yamashita and K. Taji and M. Fukushima}, 37377 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 37378 journal = {Journal of Optimization Theory and Applications}, 37379 year = {1997}, 37380 volume = {92}, 37381 pages = {439--456} 37382} 37383 37384@TechReport{ yamashita:properties, 37385 author = {N. Yamashita}, 37386 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 37387 Complementarity Problem}, 37388 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 37389 year = {1996}, 37390 type = {Technical Report}, 37391 address = {Kyoto, Japan} 37392} 37393 37394@Article{ yang.mackie.ea:investigation, 37395 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 37396 Thomadsen}, 37397 title = {An investigation of tomotherapy beam delivery}, 37398 journal = {Medical Physics}, 37399 year = {1997}, 37400 volume = {24}, 37401 number = {3}, 37402 pages = {425--436} 37403} 37404 37405@Article{ yan.shu.ea:clinical, 37406 author = {Y. Yan and H. Shu and X. Bao}, 37407 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 37408 Treatmen System}, 37409 journal = {International Journal of Radiation Oncology, Biology and Physics}, 37410 year = {1997}, 37411 volume = {39}, 37412 pages = {247--254} 37413} 37414 37415@Article{ yau.gao:obstacle, 37416 author = {S. T. Yau and Y. Gao}, 37417 title = {Obstacle problem for von {K}arm\'an equations}, 37418 journal = {Advances in Applied Mathematics}, 37419 volume = {13}, 37420 year = {1992}, 37421 pages = {123--141} 37422} 37423 37424@Article{ ye.tse:extension, 37425 author = {Y. Ye and E. Tse}, 37426 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 37427 Programming}, 37428 journal = {Mathematical Programming}, 37429 year = {1989}, 37430 volume = {44} 37431} 37432 37433@Article{ ye:affine, 37434 author = {Y. Ye}, 37435 title = {On affine scaling algorithms for nonconvex quadratic programming}, 37436 journal = {Mathematical Programming}, 37437 year = {1992}, 37438 volume = {56}, 37439 pages = {285--300} 37440} 37441 37442@PhDThesis{ ye:interior, 37443 author = {Y. Ye}, 37444 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 37445 Programming}, 37446 year = {1987}, 37447 address = {Stanford, California}, 37448 school = {Department of Engineering--Economic Systems, Stanford University} 37449} 37450 37451@Book{ ye:interior*1, 37452 author = {Y. Ye}, 37453 title = {Interior-Point Algorithms: Theory and Analysis}, 37454 publisher = {John Wiley \& Sons}, 37455 year = {1997}, 37456 address = {New York, NY} 37457} 37458 37459@Article{ yu:convergence, 37460 author = {W. --C. Yu}, 37461 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 37462 journal = {Scientia Sinica, Special issue of Mathematics}, 37463 year = {1979}, 37464 volume = {1}, 37465 pages = {68--77} 37466} 37467 37468@Article{ yu.schell:genetic, 37469 author = {Y. Yu and M. C. Schell}, 37470 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 37471 journal = {Medical Physics}, 37472 year = {1996}, 37473 volume = {23}, 37474 pages = {2085--2091} 37475} 37476 37477@Article{ yuan:superlinear, 37478 author = {Y. Yuan}, 37479 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 37480 Optimization}, 37481 journal = {Mathematical Programming}, 37482 year = {1985}, 37483 volume = {31}, 37484 pages = {269--285} 37485} 37486 37487@Book{ zangwill:nonlinear, 37488 author = {W. I. Zangwill}, 37489 title = {Nonlinear Programming: {A} Unified Approach}, 37490 year = {1969}, 37491 publisher = {Prentice-Hall, Inc}, 37492 address = {Englewood Cliffs, New Jersey} 37493} 37494 37495@TechReport{ zangwill:nonlinear*1, 37496 author = {W. I. Zangwill}, 37497 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 37498 institution = {Center for Research in Management Science, University of California}, 37499 year = {1965}, 37500 address = {Berkeley}, 37501 number = {131}, 37502 type = {Working Paper} 37503} 37504 37505@Article{ zangwill:nonlinear*2, 37506 author = {W. I. Zangwill}, 37507 title = {Nonlinear Programming via Penalty Functions}, 37508 journal = {Management Science}, 37509 year = {1967}, 37510 volume = {13}, 37511 pages = {344--358} 37512} 37513 37514@TechReport{ zenios.censor:massively, 37515 author = {S. A. Zenios and Y. Censor}, 37516 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 37517 Problems}, 37518 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 37519 year = {1990}, 37520 type = {report}, 37521 number = {89-09-10}, 37522 address = {Philadelphia, PA} 37523} 37524 37525@Article{ zenios.lasken:nonlinear, 37526 author = {S. A. Zenios and R. A. Lasken}, 37527 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 37528 journal = {Annals of Operations Research}, 37529 year = {1988}, 37530 volume = {14}, 37531 pages = {147--163} 37532} 37533 37534@Article{ zenios.mulvey:distributed, 37535 author = {S. A. Zenios and J. M. Mulvey}, 37536 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 37537 journal = {Parallel Computing}, 37538 year = {1988}, 37539 volume = {6}, 37540 pages = {43--56} 37541} 37542 37543@TechReport{ zenios.neilsen:massively, 37544 author = {S. A. Zenios and S. Neilsen}, 37545 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 37546 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 37547 year = {1990}, 37548 type = {report}, 37549 number = {90-03-01}, 37550 address = {Philadelphia, PA} 37551} 37552 37553@TechReport{ zenios.qi.ea:comparative, 37554 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 37555 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 37556 Nonlinear Network Optimization}, 37557 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 37558 year = {1990}, 37559 type = {report}, 37560 number = {89-10-02}, 37561 address = {Philadelphia, PA} 37562} 37563 37564@Article{ zhang.kim.ea:improved, 37565 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 37566 title = {An Improved Successive Linear Programming Algorithm}, 37567 year = {1985}, 37568 journal = {Management Science}, 37569 volume = {31}, 37570 pages = {1312--1331} 37571} 37572 37573@Article{ zhang.tapia.ea:superlinear, 37574 author = {Y. Zhang and R. A. Tapia and F. Potra}, 37575 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 37576 of problems}, 37577 journal = {SIAM Journal on Optimization}, 37578 year = {1993}, 37579 volume = {3}, 37580 number = {?}, 37581 pages = {413--422}, 37582} 37583 37584@Article{ zhang.tapia:superlinearly, 37585 author = {Y. Zhang and R. A. Tapia}, 37586 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 37587 linear programming}, 37588 journal = {SIAM Journal on Optimization}, 37589 year = {1993}, 37590 volume = {3}, 37591 pages = {118--133} 37592} 37593 37594@TechReport{ zhang.zhang:superlinear, 37595 author = {Y. Zhang and D. Zhang}, 37596 title = {Superlinear convergence of infeasible interior-point methods for linear 37597 programming}, 37598 institution = {Department of Mathematics and Statistics, University of Maryland}, 37599 year = {1992}, 37600 number = {92-15}, 37601 address = {Baltimore County, Maryland} 37602} 37603 37604@Article{ zhang:convergence, 37605 author = {Yin Zhang}, 37606 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 37607 Horizontal Linear Complementarity Problem}, 37608 journal = {SIAM Journal on Optimization}, 37609 year = {1994}, 37610 volume = {4}, 37611 pages = {208--227} 37612} 37613 37614@Article{ zhang:convergence*1, 37615 author = {Y. Zhang}, 37616 title = {On the convergence of a class of infeasible interior-point methods for the 37617 horizontal linear complementarity problem}, 37618 journal = {SIAM Journal on Optimization}, 37619 year = {1994}, 37620 volume = {4}, 37621 pages = {208--227} 37622} 37623 37624@Article{ zhu.rockafellar:primal-dual, 37625 author = {C. Y. Zhu and R. T. Rockafellar}, 37626 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 37627 Programming}, 37628 journal = {SIAM Journal on Optimization}, 37629 year = {1993}, 37630 volume = {3}, 37631 pages = {751--783} 37632} 37633 37634@Article{ zhu:modified, 37635 author = {C. Y. Zhu}, 37636 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 37637 journal = {Computational Optimization and Applications}, 37638 year = {1992}, 37639 volume = {2}, 37640 pages = {182--205} 37641} 37642 37643@Article{ zhu:primal-dual, 37644 author = {C. Y. Zhu}, 37645 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 37646 Programming}, 37647 journal = {SIAM Journal on Optimization}, 37648 year = {1995}, 37649 volume = {5}, 37650 pages = {114--128} 37651} 37652 37653@Book{ zoutendijk:methods, 37654 author = {G. Zoutendijk}, 37655 title = {Methods of Feasible Directions}, 37656 year = {1960}, 37657 publisher = {Elsevier Publishing Company}, 37658 address = {Amsterdam} 37659} 37660 37661@Article{ zowe.kurcyusz:regularity, 37662 author = {J. Zowe and S. Kurcyusz}, 37663 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 37664 journal = {Applied Mathematics and Optimization}, 37665 year = {1979}, 37666 volume = {5}, 37667 pages = {49--62} 37668} 37669 37670@InProceedings{ zowe:nondifferentiable, 37671 author = {J. Zowe}, 37672 title = {Nondifferentiable Optimization}, 37673 booktitle = {Computational Mathematical Programming}, 37674 year = {1985}, 37675 editor = {K. Schittkowski}, 37676 publisher = {Springer-Verlag}, 37677 address = {Berlin} 37678} 37679 37680@Proceedings{ bachem.grotschel.ea:mathematical, 37681 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 37682 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 37683 year = {1983}, 37684 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 37685 publisher = {Springer Verlag}, 37686 address = {Berlin} 37687} 37688 37689@Proceedings{ belew.booker:fourth, 37690 year = {1991}, 37691 editor = {R. K. Belew and L. B. Booker}, 37692 publisher = {Morgan Kaufmann Publishers, Inc}, 37693 address = {San Mateo, California}, 37694 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 37695} 37696 37697@Proceedings{ coleman.li:large-scale, 37698 year = {1990}, 37699 editor = {T. F. Coleman and Y. Li}, 37700 publisher = {SIAM}, 37701 address = {Philadelphia, Pennsylvania}, 37702 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 37703 University, Ithaca, New York, October 19-20, 1989}, 37704 booktitle = {Large-Scale Numerical Optimization} 37705} 37706 37707@Book{ davis:genetic, 37708 title = {Genetic Algorithms and Simulated Annealing}, 37709 year = {1987}, 37710 editor = {L. D. Davis}, 37711 publisher = {Pitman}, 37712 address = {London}, 37713 booktitle = {Genetic Algorithms and Simulated Annealing} 37714} 37715 37716@Proceedings{ ferris.pang:complementarity, 37717 title = {Complementarity and Variational Problems: State of the Art}, 37718 booktitle = {Complementarity and Variational Problems: State of the Art}, 37719 year = {1997}, 37720 key = {57}, 37721 editor = {M. C. Ferris and J. S. Pang}, 37722 publisher = {SIAM Publications}, 37723 address = {Philadelphia, Pennsylvania} 37724} 37725 37726@Proceedings{ ferris.mangasarian.ea:complementarity, 37727 title = {Complementarity: Applications, Algorithms and Extensions}, 37728 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 37729 year = {2001}, 37730 key = {95}, 37731 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 37732 publisher = {Kluwer Academic Publishers}, 37733 address = {Dordrecht, The Netherlands} 37734} 37735 37736@Proceedings{ florian:traffic, 37737 title = {Traffic Equilibrium Methods}, 37738 year = {1976}, 37739 editor = {M. Florian}, 37740 publisher = {Springer-Verlag}, 37741 address = {Berlin} 37742} 37743 37744@Proceedings{ grefenstette:genetic, 37745 title = {Genetic Algorithms and their Applications: Proceedings of the Second 37746 International Conference on Genetic Algorithms}, 37747 year = {1987}, 37748 editor = {J. J. Grefenstette}, 37749 publisher = {Lawrence Erlbaum Associates}, 37750 address = {Hillsdale, New Jersey}, 37751 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 37752 International Conference on Genetic Algorithms} 37753} 37754 37755@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 37756 booktitle = {Nonlinear Programming}, 37757 volume = {2}, 37758 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 37759 publisher = {Academic Press}, 37760 address = {New York}, 37761 year = {1975} 37762} 37763 37764@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 37765 booktitle = {Nonlinear Programming}, 37766 volume = {3}, 37767 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 37768 publisher = {Academic Press}, 37769 address = {London}, 37770 year = {1978} 37771} 37772 37773@Proceedings{ robinson:local, 37774 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 37775 Regularity}, 37776 year = {1983}, 37777 editor = {V. Pereyra and A. Reinoza}, 37778 publisher = {Springer-Verlag}, 37779 address = {Berlin}, 37780 author = {S. M. Robinson}, 37781 pages = {240--251}, 37782 series = {Numerical Methods: Proceedings, Caracas 1982} 37783} 37784 37785@Proceedings{ schaeffer:third, 37786 year = {1989}, 37787 editor = {J. D. Schaeffer}, 37788 publisher = {Morgan Kaufmann Publishers, Inc}, 37789 address = {San Mateo, California}, 37790 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 37791} 37792 37793@Book{ vanderbei:linear, 37794 author = {R. J. Vanderbei}, 37795 title = {Linear Programming: Foundations and Extensions}, 37796 year = {1997}, 37797 publisher = {Kluwer Academic Publishers}, 37798 address = {Boston, Massachusetts} 37799} 37800 37801@Book{ dfobook, 37802 title = {Introduction to Derivative-Free Optimization}, 37803 publisher = {Society for Industrial and Applied Mathematics}, 37804 year = {2009}, 37805 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 37806 series = {MPS/SIAM Series on Optimization}, 37807 address = {Philadelphia, PA, USA}, 37808 isbn = {0-89871-460-5} 37809} 37810 37811@Article{ unedf0, 37812 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 37813 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 37814 title = {Nuclear Energy Density Optimization}, 37815 journal = {Physical Review C}, 37816 year = {2010}, 37817 volume = {82}, 37818 number = {2}, 37819 pages = {024313}, 37820 doi = {10.1103/PhysRevC.82.024313} 37821} 37822 37823@Article{ hestenes1969multiplier, 37824 title = {Multiplier and gradient methods}, 37825 author = {Hestenes, Magnus R}, 37826 journal = {Journal of optimization theory and applications}, 37827 volume = {4}, 37828 number = {5}, 37829 pages = {303--320}, 37830 year = {1969}, 37831 publisher = {Springer} 37832} 37833 37834@Article{ powell1969method, 37835 title = {A method for nonlinear constraints in minimization problems}, 37836 author = {Powell, Michael JD}, 37837 journal = {Optimization}, 37838 pages = {283--298}, 37839 year = {1969}, 37840 publisher = {Academic Press} 37841} 37842 37843@Book{ nocedal2006numerical, 37844 title = {Numerical optimization}, 37845 author = {Nocedal, Jorge and Wright, Stephen}, 37846 year = {2006}, 37847 publisher = {Springer Science \& Business Media} 37848} 37849 37850@Article{ rockafellar1974augmented, 37851 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 37852 author = {Rockafellar, R Tyrrell}, 37853 journal = {SIAM Journal on Control}, 37854 volume = {12}, 37855 number = {2}, 37856 pages = {268--285}, 37857 year = {1974}, 37858 publisher = {SIAM} 37859} 37860 37861@Article{ bacuta2006, 37862 title = {A unified approach for Uzawa algorithms}, 37863 author = {Constantin Bacuta}, 37864 journal = {SIAM Journal on Numerical Analysis}, 37865 volume = {44}, 37866 number = {6}, 37867 pages = {2633--2649}, 37868 year = {2006} 37869} 37870 37871@Article{ manteuffelrugesouthworth2018, 37872 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 37873 (AIR)}, 37874 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 37875 journal = {SIAM Journal on Scientific Computing}, 37876 volume = {40}, 37877 number = {6}, 37878 pages = {A4105--A4130}, 37879 year = {2018} 37880} 37881 37882@Article{ manteuffelmunzenmaierrugesouthworth2019, 37883 title = {Nonsymmetric reduction-based algebraic multigrid}, 37884 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 37885 journal = {SIAM Journal on Scientific Computing}, 37886 volume = {41}, 37887 number = {5}, 37888 pages = {S242--S268}, 37889 year = {2019} 37890} 37891 37892@PhDThesis{ sivas2021, 37893 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 37894 author = {Abdullah Ali Sivas}, 37895 department = {Applied Mathematics}, 37896 institution = {University of Waterloo}, 37897 year = {2021} 37898} 37899 37900@Article{ brookshughes1982, 37901 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 37902 with particular emphasis on the incompressible {Navier-Stokes} equations}, 37903 author = {Alexander N Brooks and Thomas JR Hughes}, 37904 journal = {Computer methods in applied mechanics and engineering}, 37905 volume = {32}, 37906 number = {1-3}, 37907 pages = {199--259}, 37908 year = {1982}, 37909 publisher = {Elsevier} 37910} 37911 37912@InProceedings{ suhisaac2020, 37913 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 37914 author = {Hansol Suh and Tobin Isaac}, 37915 booktitle = {SC20: International Conference for High Performance Computing, Networking, 37916 Storage and Analysis}, 37917 pages = {1--12}, 37918 year = {2020}, 37919 organization = {IEEE} 37920} 37921 37922@Misc{ alauzet2010, 37923 title = {Metric-Based Anisotropic Mesh Adaptation}, 37924 author = {Fr\'{e}d\'{e}ric Alauzet}, 37925 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 37926 year = {2010} 37927} 37928 37929@Article{ chan1994qmrcgs, 37930 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 37931 systems}, 37932 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 37933 and Tong, Charles H}, 37934 journal = {SIAM Journal on Scientific Computing}, 37935 volume = {15}, 37936 number = {2}, 37937 pages = {338--347}, 37938 year = {1994}, 37939 publisher = {SIAM} 37940} 37941 37942@Article{ ghai2019comparison, 37943 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 37944 nonsymmetric linear systems}, 37945 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 37946 journal = {Numerical Linear Algebra with Applications}, 37947 volume = {26}, 37948 number = {1}, 37949 pages = {e2215}, 37950 year = {2019}, 37951 publisher = {Wiley Online Library} 37952} 37953 37954@Article{ mishrasalacknepley2022, 37955 title = {On the order of accuracy for finite difference approximations of partial 37956 differential equations using stencil composition}, 37957 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 37958 journal = {International Journal on Numerical Methods in Engineering}, 37959 note = {Submitted}, 37960 year = {2022} 37961} 37962 37963@Article{ nathawaniknepley2022, 37964 title = {Droplet formation simulation using mixed finite elements}, 37965 author = {Darsh K. Nathawani and Matthew G. Knepley}, 37966 journal = {Physics of Fluids}, 37967 volume = {34}, 37968 pages = {064105}, 37969 doi = {10.1063/5.0089752}, 37970 year = {2022} 37971} 37972 37973@InProceedings{ nathawaniknepley2022b, 37974 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 37975 author = {Darsh K. Nathawani and Matthew G. Knepley}, 37976 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 37977 (ICCFD11)}, 37978 editor = {Christoph Brehm and Shishir Pandya}, 37979 number = {4103}, 37980 year = {2022} 37981} 37982 37983@Article{ nathawaniknepley2023, 37984 title = {One-dimensional model to simulate shear-induced droplet formation}, 37985 author = {Darsh K. Nathawani and Matthew G. Knepley}, 37986 journal = {International Journal of Multiphase Flow}, 37987 note = {Submitted}, 37988 year = {2023} 37989} 37990 37991@InProceedings{ georgalisnathawaniknepleypatra2023, 37992 title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, 37993 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 37994 Patra}, 37995 booktitle = {AIAA SciTech 2024}, 37996 note = {Accepted}, 37997 year = {2023} 37998} 37999 38000@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 38001 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 38002 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 38003 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 38004 Thompson and Junchao Zhang}, 38005 doi = {10.48550/ARXIV.2204.01722}, 38006 url = {https://arxiv.org/abs/2204.01722}, 38007 publisher = {arXiv}, 38008 note = {Submitted}, 38009 year = {2022} 38010} 38011 38012@InCollection{ mayknepley2023, 38013 title = {Numerical Modeling of Subduction}, 38014 author = {Dave A. May and Matthew G. Knepley}, 38015 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 38016 editor = {João C. Duarte}, 38017 pages = {539-571}, 38018 isbn = {978-0-323-85733-8}, 38019 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 38020 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 38021 year = {2023} 38022} 38023 38024@Article{ adamsknepley2023, 38025 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 38026 plasmas in {PETSc}}, 38027 author = {Mark F. Adams and Matthew G. Knepley}, 38028 url = {https://arxiv.org/abs/2302.10242}, 38029 note = {In preparation}, 38030 year = {2023}, 38031 petsc_uses = {DMPlex} 38032} 38033 38034@Article{ finnknepleypusztayadams2023, 38035 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 38036 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 38037 url = {https://arxiv.org/abs/2303.12620}, 38038 journal = {Communications in Applied Mathematics and Computational Science}, 38039 note = {Submitted}, 38040 year = {2023} 38041} 38042 38043@Article{ eggersdupont1994, 38044 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 38045 equation}, 38046 author = {Jens Eggers and Todd F. Dupont}, 38047 journal = {Journal of fluid mechanics}, 38048 volume = {262}, 38049 pages = {205--221}, 38050 year = {1994}, 38051 publisher = {Cambridge University Press} 38052} 38053 38054@PhDThesis{ pusztaythesis2023, 38055 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 38056 author = {Joseph V. Pusztay}, 38057 type = {{PhD} thesis}, 38058 school = {University at Buffalo, Department of Computer Science and Engineering}, 38059 address = {Buffalo, NY}, 38060 month = may, 38061 year = {2022} 38062} 38063 38064@PhDThesis{ finnthesis2023, 38065 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 38066 System}, 38067 author = {Daniel S. Finn}, 38068 type = {{PhD} thesis}, 38069 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 38070 Engineering}, 38071 address = {Buffalo, NY}, 38072 month = may, 38073 year = {2023} 38074} 38075 38076@PhDThesis{ nathawanithesis2023, 38077 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 38078 author = {Darsh Kiritbhai Nathawani}, 38079 type = {{PhD} thesis}, 38080 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 38081 Engineering}, 38082 address = {Buffalo, NY}, 38083 month = may, 38084 year = {2023} 38085} 38086 38087@article{MckayEriksonKozdon2019, 38088 title = {A computational method for earthquake cycles within anisotropic media}, 38089 author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, 38090 journal = {Geophysical Journal International}, 38091 volume = {219}, 38092 number = {2}, 38093 pages = {816--833}, 38094 year = {2019}, 38095} 38096 38097article{EricksonOReillyNordstrom2019, 38098 title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, 38099 author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, 38100 journal = {Journal of Scientific Computing}, 38101 volume = {81}, 38102 pages = {2356--2387}, 38103 year = {2019}, 38104} 38105 38106@article{KozdonEricksonWilcox2021, 38107 title = {Hybridized summation-by-parts finite difference methods}, 38108 author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, 38109 journal = {Journal of Scientific Computing}, 38110 volume = {87}, 38111 number = {3}, 38112 pages = {85}, 38113 year = {2021}, 38114} 38115 38116@article{SEAS2022, 38117 title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, 38118 author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, 38119 journal = {Journal of Geophysical Research: Solid Earth}, 38120 volume = {127}, 38121 number = {3}, 38122 pages = {e2021JB023519}, 38123 year = {2022}, 38124} 38125 38126@article{EricksonKozdonHarvey2022, 38127 title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, 38128 author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, 38129 journal = {Journal of Scientific Computing}, 38130 volume = {93}, 38131 number = {1}, 38132 pages = {17}, 38133 year = {2022}, 38134} 38135 38136@article{RuckerEriksonKarlstromLeeGopalakrishnan2022, 38137 title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, 38138 author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, 38139 journal = {Journal of Geophysical Research: Solid Earth}, 38140 volume = {127}, 38141 number = {9}, 38142 pages = {e2022JB024506}, 38143 year = {2022}, 38144} 38145 38146@article{HarveyEriksonKozdon2023, 38147 title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, 38148 author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, 38149 journal = {Journal of Geophysical Research: Solid Earth}, 38150 pages = {e2022JB025357}, 38151 year = {2023}, 38152} 38153 38154@article{SEAS2023, 38155 title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, 38156 author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, 38157 journal = {Bulletin of the Seismological Society of America}, 38158 volume = {113}, 38159 number = {2}, 38160 pages = {499--523}, 38161 year = {2023}, 38162} 38163