1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@article{veldhuizen1984d, 20 title = {{D}-stability and {K}aps-{R}entrop-methods}, 21 author = {Veldhuizen, M van}, 22 journal = {Computing}, 23 volume = {32}, 24 number = {3}, 25 pages = {229--237}, 26 year = {1984}, 27 publisher = {Springer} 28} 29 30@article{shampine1982implementation, 31 title = {Implementation of {R}osenbrock methods}, 32 author = {Shampine, Lawrence F}, 33 journal = {ACM Transactions on Mathematical Software (TOMS)}, 34 volume = {8}, 35 number = {2}, 36 pages = {93--113}, 37 year = {1982}, 38 publisher = {ACM New York, NY, USA} 39} 40 41@book{wanner1996solving, 42 title = {Solving ordinary differential equations {II}}, 43 author = {Wanner, Gerhard and Hairer, Ernst}, 44 volume = {375}, 45 year = {1996}, 46 publisher = {Springer Berlin Heidelberg New York} 47} 48 49@article{kaps1979generalized, 50 title = {Generalized {R}unge--{K}utta methods of order four with stepsize control for stiff ordinary differential equations}, 51 author = {Kaps, Peter and Rentrop, Peter}, 52 journal = {Numerische Mathematik}, 53 volume = {33}, 54 pages = {55--68}, 55 year = {1979}, 56 publisher = {Springer} 57} 58 59@book{butcher2016numerical, 60 title = {Numerical methods for ordinary differential equations}, 61 author = {Butcher, John Charles}, 62 year = {2016}, 63 publisher = {John Wiley \& Sons} 64} 65 66@article{chung1993, 67 author = {Chung, J. and Hulbert, G. M.}, 68 title = {A Time Integration Algorithm for Structural Dynamics With Improved Numerical Dissipation: The Generalized-alpha Method}, 69 journal = {Journal of Applied Mechanics}, 70 volume = {60}, 71 number = {2}, 72 pages = {371-375}, 73 year = {1993}, 74 month = {06}, 75 issn = {0021-8936}, 76 doi = {10.1115/1.2900803}, 77 url = {https://doi.org/10.1115/1.2900803}, 78 eprint = {https://asmedigitalcollection.asme.org/appliedmechanics/article-pdf/60/2/371/5463014/371\_1.pdf}, 79} 80 81@article{hosea1996analysis, 82 title = {Analysis and implementation of {TR-BDF2}}, 83 author = {Hosea, ME and Shampine, LF}, 84 journal = {Applied Numerical Mathematics}, 85 volume = {20}, 86 number = {1-2}, 87 pages = {21--37}, 88 year = {1996}, 89 publisher = {Elsevier} 90} 91 92@article{kennedy2019diagonally, 93 title = {Diagonally implicit {R}unge--{K}utta methods for stiff {ODE}s}, 94 author = {Kennedy, Christopher A and Carpenter, Mark H}, 95 journal = {Applied Numerical Mathematics}, 96 volume = {146}, 97 pages = {221--244}, 98 year = {2019}, 99 publisher = {Elsevier} 100} 101 102@inproceedings{xu2017adaptive, 103 title = {Adaptive relaxed {ADMM}: Convergence theory and practical implementation}, 104 author = {Xu, Zheng and Figueiredo, Mario AT and Yuan, Xiaoming and Studer, Christoph and Goldstein, Tom}, 105 booktitle = {Proceedings of the IEEE conference on computer vision and pattern recognition}, 106 pages = {7389--7398}, 107 year = {2017} 108} 109 110@article{hindmarsh1996time, 111 title = {Time-step limits for stable solutions of the ice-sheet equation}, 112 author = {Hindmarsh, Richard CA and Payne, Antony J}, 113 journal = {Annals of Glaciology}, 114 volume = {23}, 115 pages = {74--85}, 116 year = {1996}, 117 publisher = {Cambridge University Press} 118} 119 120@article{benson2006flexible, 121 title = {Flexible complementarity solvers for large-scale applications}, 122 author = {Benson, Steven J and Munson, Todd S}, 123 journal = {Optimization Methods and Software}, 124 volume = {21}, 125 number = {1}, 126 pages = {155--168}, 127 year = {2006}, 128 publisher ={Taylor \& Francis} 129} 130 131@article{byrd1994representations, 132 title = {Representations of quasi-{N}ewton matrices and their use in limited memory methods}, 133 author = {Byrd, Richard H and Nocedal, Jorge and Schnabel, Robert B}, 134 journal = {Mathematical Programming}, 135 volume = {63}, 136 number = {1-3}, 137 pages = {129--156}, 138 year = {1994}, 139 publisher = {Springer} 140} 141 142@article{gilbert1989some, 143 title = {Some numerical experiments with variable-storage quasi-{N}ewton algorithms}, 144 author = {Gilbert, Jean Charles and Lemar{\'e}chal, Claude}, 145 journal = {Mathematical programming}, 146 volume = {45}, 147 number = {1-3}, 148 pages = {407--435}, 149 year = {1989}, 150 publisher = {Springer} 151} 152 153@inproceedings{dener2019accelerating, 154 title = {Accelerating limited-memory quasi-{N}ewton convergence for large-scale optimization}, 155 author = {Dener, Alp and Munson, Todd}, 156 booktitle = {Computational Science--ICCS 2019: 19th International Conference, Faro, Portugal, June 12--14, 2019, Proceedings, Part III 19}, 157 pages = {495--507}, 158 year = {2019}, 159 organization = {Springer} 160} 161 162@article{park2021linear, 163 title = {Linear and nonlinear solvers for simulating multiphase flow within large-scale engineered subsurface systems}, 164 author = {Park, Heeho D and Hammond, Glenn E and Valocchi, Albert J and LaForce, Tara}, 165 journal = {Advances in Water Resources}, 166 volume = {156}, 167 pages = {104029}, 168 year = {2021}, 169 publisher = {Elsevier} 170} 171 172@inproceedings{va1981design, 173 title = {Design of optimally smoothing multi-stage schemes for the {E}uler equations}, 174 author = {Van Leer, Bram and Tai, Chang-Hsien and Powell, Kenneth}, 175 booktitle = {9th Computational Fluid Dynamics Conference}, 176 pages = {1933}, 177 year = {1981} 178} 179 180@article{pierce1997preconditioned, 181 title = {Preconditioned multigrid methods for compressible flow calculations on stretched meshes}, 182 author = {Pierce, Niles A and Giles, Michael B}, 183 journal = {Journal of Computational Physics}, 184 volume = {136}, 185 number = {2}, 186 pages = {425--445}, 187 year = {1997}, 188 publisher = {Elsevier} 189} 190 191@article{kong2016highly, 192 title = {A highly scalable multilevel {S}chwarz method with boundary geometry preserving coarse spaces for {3D} elasticity problems on domains with complex geometry}, 193 author = {Kong, Fande and Cai, Xiao-Chuan}, 194 journal = {SIAM Journal on Scientific Computing}, 195 volume = {38}, 196 number = {2}, 197 pages = {C73--C95}, 198 year = {2016}, 199 publisher = {SIAM} 200} 201 202@inproceedings{gutierrez2017accommodating, 203 title = {Accommodating thread-level heterogeneity in coupled parallel applications}, 204 author = {Guti{\'e}rrez, Samuel K and Davis, Kei and Arnold, Dorian C and Baker, Randal S and Robey, Robert W and McCormick, Patrick and 205 Holladay, Daniel and Dahl, Jon A and Zerr, R Joe and Weik, Florian and others}, 206 booktitle = {2017 {IEEE} International Parallel and Distributed Processing Symposium ({IPDPS})}, 207 pages = {469--478}, 208 year = {2017}, 209 organization = {IEEE} 210} 211 212@article{heroux2011bi, 213 title = {Bi-modal MPI and MPI+ threads computing on scalable multicore systems}, 214 author = {Heroux, Michael A and Brightwell, R and Wolf, Michael M}, 215 journal = {IJHPCA (Submitted)}, 216 year = {2011} 217} 218 219@inproceedings{bozdaug2005parallel, 220 title = {A parallel distance-2 graph coloring algorithm for distributed memory computers}, 221 author = {Bozda{\u{g}}, Doruk and Catalyurek, Umit and Gebremedhin, Assefaw H and Manne, Fredrik and Boman, Erik G and {\"O}zg{\"u}ner, F{\"u}sun}, 222 booktitle = {International conference on high performance computing and communications}, 223 pages = {796--806}, 224 year = {2005}, 225 organization = {Springer} 226} 227 228@article{dohrmann2009overlapping, 229 title = {An overlapping {S}chwarz algorithm for almost incompressible elasticity}, 230 author = {Dohrmann, Clark R and Widlund, Olof B}, 231 journal = {SIAM journal on numerical analysis}, 232 volume = {47}, 233 number = {4}, 234 pages = {2897--2923}, 235 year = {2009}, 236 publisher = {SIAM} 237} 238 239@article{dohrmann2008domain, 240 title = {Domain decomposition for less regular subdomains: Overlapping {S}chwarz in two dimensions}, 241 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 242 journal = {SIAM journal on numerical analysis}, 243 volume = {46}, 244 number = {4}, 245 pages = {2153--2168}, 246 year = {2008}, 247 publisher = {SIAM} 248} 249 250@incollection{dohrmann2008family, 251 title = {A family of energy minimizing coarse spaces for overlapping {S}chwarz preconditioners}, 252 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 253 booktitle = {Domain decomposition methods in science and engineering XVII}, 254 pages = {247--254}, 255 year = {2008}, 256 publisher = {Springer} 257} 258 259@book{dohrmann2008extending, 260 title = {Extending theory for domain decomposition algorithms to irregular subdomains}, 261 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 262 year = {2008}, 263 publisher = {Springer} 264} 265 266@article{dryja1994schwarz, 267 title = {{S}chwarz analysis of iterative substructuring algorithms for elliptic problems in three dimensions}, 268 author = {Dryja, Maksymilian and Smith, Barry F and Widlund, Olof B}, 269 journal = {SIAM journal on numerical analysis}, 270 volume = {31}, 271 number = {6}, 272 pages = {1662--1694}, 273 year = {1994}, 274 publisher = {SIAM} 275} 276 277@book{smith1990domain, 278 title = {Domain decomposition algorithms for the partial differential equations of linear elasticity}, 279 author = {Smith, Barry F}, 280 year = {1990}, 281 publisher = {New York University} 282} 283 284@article{bramble1989construction, 285 title = {The construction of preconditioners for elliptic problems by substructuring. {IV}}, 286 author = {Bramble, James H and Pasciak, Joseph E and Schatz, Alfred H}, 287 journal = {Mathematics of Computation}, 288 volume = {53}, 289 number = {187}, 290 pages = {1--24}, 291 year = {1989} 292} 293 294@article{kaczmarz1937angenaherte, 295 title = {Angenaherte auflosung von systemen linearer gleichungen}, 296 author = {Kaczmarz, Stefan}, 297 journal = {Bull. Int. Acad. Pol. Sic. Let., Cl. Sci. Math. Nat.}, 298 pages = {355--357}, 299 year = {1937} 300} 301 302@article{nataf2022recent, 303 title = {Recent advances in domain decomposition methods for large-scale saddle point problems}, 304 author = {Nataf, Fr{\'e}d{\'e}ric and Tournier, Pierre-Henri}, 305 journal = {Comptes Rendus. M{\'e}canique}, 306 volume = {350}, 307 number = {S1}, 308 pages = {1--15}, 309 year = {2022} 310} 311 312@article{al2022robustpd, 313 title = {A robust algebraic multilevel domain decomposition preconditioner for sparse symmetric positive definite matrices}, 314 author = {Al Daas, Hussam and Jolivet, Pierre}, 315 journal = {SIAM Journal on Scientific Computing}, 316 volume = {44}, 317 number = {4}, 318 pages = {A2582--A2598}, 319 year = {2022}, 320 publisher = {SIAM} 321} 322 323@article{al2022robust, 324 title = {A robust algebraic domain decomposition preconditioner for sparse normal equations}, 325 author = {Al Daas, Hussam and Jolivet, Pierre and Scott, Jennifer A}, 326 journal = {SIAM Journal on Scientific Computing}, 327 volume = {44}, 328 number = {3}, 329 pages = {A1047--A1068}, 330 year = {2022}, 331 publisher = {SIAM} 332} 333 334@article{al2021multilevel, 335 title = {A multilevel {S}chwarz preconditioner based on a hierarchy of robust coarse spaces}, 336 author = {Al Daas, Hussam and Grigori, Laura and Jolivet, Pierre and Tournier, Pierre-Henri}, 337 journal = {SIAM Journal on Scientific Computing}, 338 volume = {43}, 339 number = {3}, 340 pages = {A1907--A1928}, 341 year = {2021}, 342 publisher = {SIAM} 343} 344 345@book{dolean2015introduction, 346 title = {An introduction to domain decomposition methods: algorithms, theory, and parallel implementation}, 347 author = {Dolean, Victorita and Jolivet, Pierre and Nataf, Fr{\'e}d{\'e}ric}, 348 year = {2015}, 349 publisher = {SIAM} 350} 351 352@article{spillane2011robust, 353 title = {A robust two-level domain decomposition preconditioner for systems of {PDE}s}, 354 author = {Spillane, Nicole and Dolean, Victorita and Hauret, Patrice and Nataf, Fr{\'e}d{\'e}ric and Pechstein, Clemens and Scheichl, Robert}, 355 journal = {Comptes Rendus Mathematique}, 356 volume = {349}, 357 number = {23-24}, 358 pages = {1255--1259}, 359 year = {2011}, 360 publisher = {Elsevier} 361} 362 363@article{kong2020highly, 364 title = {A Highly Parallel Multilevel {N}ewton--{K}rylov--{S}chwarz Method with Subspace-Based Coarsening and 365 Partition-Based Balancing for the Multigroup Neutron Transport Equation on Three-Dimensional Unstructured Meshes}, 366 author = {Kong, Fande and Wang, Yaqi and Gaston, Derek R and Permann, Cody J and Slaughter, Andrew E and Lindsay, 367 Alexander D and DeHart, Mark D and Martineau, Richard C}, 368 journal = {SIAM Journal on Scientific Computing}, 369 volume = {42}, 370 number = {5}, 371 pages = {C193--C220}, 372 year = {2020}, 373 publisher = {SIAM} 374} 375 376@article{ipsen2001note, 377 title = {A note on preconditioning nonsymmetric matrices}, 378 author = {Ipsen, Ilse CF}, 379 journal = {SIAM Journal on Scientific Computing}, 380 volume = {23}, 381 number = {3}, 382 pages = {1050--1051}, 383 year = {2001}, 384 publisher = {SIAM} 385} 386 387@article{murphy2000note, 388 title = {A note on preconditioning for indefinite linear systems}, 389 author = {Murphy, Malcolm F and Golub, Gene H and Wathen, Andrew J}, 390 journal = {SIAM Journal on Scientific Computing}, 391 volume = {21}, 392 number = {6}, 393 pages = {1969--1972}, 394 year = {2000}, 395 publisher = {SIAM} 396} 397 398@article{oliphant1961implicit, 399 title = {An implicit, numerical method for solving two-dimensional time-dependent diffusion problems}, 400 author = {Oliphant, Thomas A}, 401 journal = {Quarterly of Applied mathematics}, 402 volume = {19}, 403 number = {3}, 404 pages = {221--229}, 405 year = {1961} 406} 407 408@article{dupont1968approximate, 409 title = {An approximate factorization procedure for solving self-adjoint elliptic difference equations}, 410 author = {Dupont, Todd and Kendall, Richard P and Rachford, Jr, HH}, 411 journal = {SIAM Journal on Numerical Analysis}, 412 volume = {5}, 413 number = {3}, 414 pages = {559--573}, 415 year = {1968}, 416 publisher = {SIAM} 417} 418 419@inproceedings{manteuffel1979shifted, 420 title = {Shifted incomplete {C}holesky factorization}, 421 author = {Manteuffel, Thomas A}, 422 booktitle = {Sparse Matrix Proceedings 1978}, 423 pages = {41--61}, 424 year = {1979}, 425 organization = {SIAM, Philadelphia, PA} 426} 427 428@incollection{chan1997approximate, 429 title = {Approximate and incomplete factorizations}, 430 author = {Chan, Tony F and Van Der Vorst, Henk A}, 431 booktitle = {Parallel numerical algorithms}, 432 pages = {167--202}, 433 year = {1997}, 434 publisher = {Springer} 435} 436 437@article{mandel2008multispace, 438 title = {Multispace and multilevel {BDDC}}, 439 author = {Mandel, Jan and Soused{\'\i}k, Bed{\v{r}}ich and Dohrmann, Clark R}, 440 journal = {Computing}, 441 volume = {83}, 442 number = {2-3}, 443 pages = {55--85}, 444 year = {2008}, 445 publisher = {Springer} 446} 447 448@article{klawonn2006dual, 449 title = {Dual-primal {FETI} methods for linear elasticity}, 450 author = {Klawonn, Axel and Widlund, Olof B}, 451 journal = {Communications on Pure and Applied Mathematics: A Journal Issued by the Courant Institute of Mathematical Sciences}, 452 volume = {59}, 453 number = {11}, 454 pages = {1523--1572}, 455 year = {2006}, 456 publisher = {Wiley Online Library} 457} 458 459@article{dohrmann2007approximate, 460 title = {An approximate {BDDC} preconditioner}, 461 author = {Dohrmann, Clark R}, 462 journal = {Numerical Linear Algebra with Applications}, 463 volume = {14}, 464 number = {2}, 465 pages = {149--168}, 466 year = {2007}, 467 publisher = {Wiley Online Library} 468} 469 470@book{dryja1987additive, 471 title = {An additive variant of the {S}chwarz alternating method for the case of many subregions}, 472 author = {Dryja, Maksymilian and Widlund, Olof}, 473 year = {1987}, 474 publisher = {Ultracomputer Research Laboratory, Univ., Courant Inst. of Mathematical~…} 475} 476 477@article{couturier2016tsirm, 478 title = {{TSIRM}: A two-stage iteration with least-squares residual minimization algorithm to solve large sparse linear and nonlinear systems}, 479 author = {Couturier, Rapha{\"e}l and Khodja, Lilia Ziane and Guyeux, Christophe}, 480 journal = {Journal of Computational Science}, 481 volume = {17}, 482 pages = {535--546}, 483 year = {2016}, 484 publisher = {Elsevier} 485} 486 487@article{chan1998transpose, 488 title = {Transpose-free formulations of Lanczos-type methods for nonsymmetric linear systems}, 489 author = {Chan, Tony F and De Pillis, Lisette and Van Der Vorst, Henk}, 490 journal = {Numerical Algorithms}, 491 volume = {17}, 492 pages = {51--66}, 493 year = {1998}, 494 publisher = {Springer} 495} 496 497@article{catabriga2006performance, 498 title = {Performance of {LCD} iterative method in the finite element and finite difference solution of convection--diffusion equations}, 499 author = {Catabriga, L and Valli, AMP and Melotti, BZ and Pessoa, LM and Coutinho, ALGA}, 500 journal = {Communications in numerical methods in engineering}, 501 volume = {22}, 502 number = {6}, 503 pages = {643--656}, 504 year = {2006}, 505 publisher = {Wiley Online Library} 506} 507 508@article{catabriga2004evaluating, 509 title = {Evaluating the {LCD} algorithm for solving linear systems of equations arising from implicit {SUPG} formulation of compressible flows}, 510 author = {Catabriga, Lucia and Coutinho, Alvaro LGA and Franca, Leopoldo P}, 511 journal = {International Journal for Numerical Methods in Engineering}, 512 volume = {60}, 513 number = {9}, 514 pages = {1513--1534}, 515 year = {2004}, 516 publisher = {Wiley Online Library} 517} 518 519@article{dai2004study, 520 title = {Study on semi-conjugate direction methods for non-symmetric systems}, 521 author = {Dai, Yu-Hong and Yuan, Jinyun}, 522 journal = {International journal for numerical methods in engineering}, 523 volume = {60}, 524 number = {8}, 525 pages = {1383--1399}, 526 year = {2004}, 527 publisher = {Wiley Online Library} 528} 529 530@article{yuan2004semi, 531 title = {Semi-conjugate direction methods for real positive definite systems}, 532 author = {Yuan, JY and Golub, Gene H and Plemmons, Robert J and Cecilio, WAG}, 533 journal = {BIT Numerical Mathematics}, 534 volume = {44}, 535 pages = {189--207}, 536 year = {2004}, 537 publisher = {Springer} 538} 539 540@article{ji2017breakdown, 541 title = {A breakdown-free block conjugate gradient method}, 542 author = {Ji, Hao and Li, Yaohang}, 543 journal = {BIT Numerical Mathematics}, 544 volume = {57}, 545 pages = {379--403}, 546 year = {2017}, 547 publisher = {Springer} 548} 549 550@inproceedings{jolivet2016block, 551 title = {Block iterative methods and recycling for improved scalability of linear solvers}, 552 author = {Jolivet, Pierre and Tournier, Pierre-Henri}, 553 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 554 pages = {190--203}, 555 year = {2016}, 556 organization = {IEEE} 557} 558 559@article{calandra2013modified, 560 title = {A modified block flexible {GMRES} method with deflation at each iteration for the solution of non-{H}ermitian linear systems with multiple right-hand sides}, 561 author = {Calandra, Henri and Gratton, Serge and Lago, Rafael and Vasseur, Xavier and Carvalho, Luiz Mariano}, 562 journal = {SIAM Journal on Scientific Computing}, 563 volume = {35}, 564 number = {5}, 565 pages = {S345--S367}, 566 year = {2013}, 567 publisher = {SIAM} 568} 569 570@article{o1980block, 571 title = {The block conjugate gradient algorithm and related methods}, 572 author = {O'Leary, Dianne P}, 573 journal = {Linear algebra and its applications}, 574 volume = {29}, 575 pages = {293--322}, 576 year = {1980}, 577 publisher = {Elsevier} 578} 579 580@article{erhel1996restarted, 581 title = {Restarted {GMRES} preconditioned by deflation}, 582 author = {Erhel, Jocelyne and Burrage, Kevin and Pohl, Bert}, 583 journal = {Journal of computational and applied mathematics}, 584 volume = {69}, 585 number = {2}, 586 pages = {303--318}, 587 year = {1996}, 588 publisher = {Elsevier} 589} 590 591@article{bai1994newton, 592 title = {A {N}ewton basis {GMRES} implementation}, 593 author = {Bai, Zhaojun and Hu, Dan and Reichel, Lothar}, 594 journal = {IMA Journal of Numerical Analysis}, 595 volume = {14}, 596 number = {4}, 597 pages = {563--581}, 598 year = {1994}, 599 publisher = {Oxford University Press} 600} 601 602@article{sidje1997alternatives, 603 title = {Alternatives for parallel Krylov subspace basis computation}, 604 author = {Sidje, Roger B}, 605 journal = {Numerical linear algebra with applications}, 606 volume = {4}, 607 number = {4}, 608 pages = {305--331}, 609 year = {1997}, 610 publisher = {Wiley Online Library} 611} 612 613@inproceedings{mohiyuddin2009minimizing, 614 title = {Minimizing communication in sparse matrix solvers}, 615 author = {Mohiyuddin, Marghoob and Hoemmen, Mark and Demmel, James and Yelick, Katherine}, 616 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage and Analysis}, 617 pages = {1--12}, 618 year = {2009} 619} 620 621@article{demmel2012communication, 622 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 623 author = {Demmel, James and Grigori, Laura and Hoemmen, Mark and Langou, Julien}, 624 journal = {SIAM Journal on Scientific Computing}, 625 volume = {34}, 626 number = {1}, 627 pages = {A206--A239}, 628 year = {2012}, 629 publisher = {SIAM} 630} 631 632@article{philippe2012generation, 633 title = {On the generation of {K}rylov subspace bases}, 634 author = {Philippe, Bernard and Reichel, Lothar}, 635 journal = {Applied Numerical Mathematics}, 636 volume = {62}, 637 number = {9}, 638 pages = {1171--1186}, 639 year = {2012}, 640 publisher = {Elsevier} 641} 642 643@article{wakam2013memory, 644 title = {Memory efficient hybrid algebraic solvers for linear systems arising from compressible flows}, 645 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Pacull, Fran{\c{c}}ois}, 646 journal = {Computers \& Fluids}, 647 volume = {80}, 648 pages = {158--167}, 649 year = {2013}, 650 publisher = {Elsevier} 651} 652 653@misc{wakam2011parallelism, 654 title = {Parallelism and robustness in {GMRES} with the {N}ewton basis and the deflated restarting}, 655 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Erhel, Jocelyne}, 656 year = {2011}, 657 url = {https://hal.inria.fr/inria-00638247/en} 658} 659 660@article{tu2015feti, 661 title = {A {FETI-DP} type domain decomposition algorithm for three-dimensional incompressible {S}tokes equations}, 662 author = {Tu, Xuemin and Li, Jing}, 663 journal = {SIAM Journal on Numerical Analysis}, 664 volume = {53}, 665 number = {2}, 666 pages = {720--742}, 667 year = {2015}, 668 publisher = {SIAM} 669} 670 671@article{farhat2001feti, 672 title = {{FETI-DP}: a dual--primal unified {FETI} method—part {I}: A faster alternative to the two-level {FETI} method}, 673 author = {Farhat, Charbel and Lesoinne, Michel and LeTallec, Patrick and Pierson, Kendall and Rixen, Daniel}, 674 journal = {International journal for numerical methods in engineering}, 675 volume = {50}, 676 number = {7}, 677 pages = {1523--1544}, 678 year = {2001}, 679 publisher = {Wiley Online Library} 680} 681 682@article{lottes2023optimal, 683 title = {Optimal polynomial smoothers for multigrid {V}-cycles}, 684 author = {Lottes, James}, 685 journal = {Numerical Linear Algebra with Applications}, 686 volume = {30}, 687 number = {6}, 688 pages = {e2518}, 689 year = {2023}, 690 publisher = {Wiley Online Library} 691} 692 693@article{phillips2022optimal, 694 title = {Optimal {C}hebyshev Smoothers and One-sided {V}-cycles}, 695 author = {Phillips, Malachi and Fischer, Paul}, 696 journal = {arXiv preprint arXiv:2210.03179}, 697 year = {2022} 698} 699 700@incollection{toint1981towards, 701 title = {Towards an efficient sparsity exploiting {N}ewton method for minimization}, 702 author = {Toint, Philippe}, 703 booktitle = {Sparse matrices and their uses}, 704 pages = {57--88}, 705 year = {1981}, 706 publisher = {Academic press} 707} 708 709@article{cools2019numerically, 710 title = {Numerically stable recurrence relations for the communication hiding pipelined conjugate gradient method}, 711 author = {Cools, Siegfried and Cornelis, Jeffrey and Vanroose, Wim}, 712 journal = {IEEE Transactions on Parallel and Distributed Systems}, 713 volume = {30}, 714 number = {11}, 715 pages = {2507--2522}, 716 year = {2019}, 717 publisher = {IEEE} 718} 719 720@article{cornelis2018communication, 721 title = {The communication-hiding conjugate gradient method with deep pipelines}, 722 author = {Cornelis, Jeffrey and Cools, Siegfried and Vanroose, Wim}, 723 journal = {arXiv preprint arXiv:1801.04728}, 724 year = {2018} 725} 726 727@article{d1993conjugate, 728 title = {Conjugate gradient algorithms with reduced synchronization overhead on distributed memory multiprocessors}, 729 author = {D’Azevedo, EF and Eijkhout, VL and Romine, CH}, 730 journal = {Computer Science Technical Report CS-93-185, University of Tennessee, Knoxville}, 731 year = {1993} 732} 733 734@book{malek2014preconditioning, 735 title = {Preconditioning and the conjugate gradient method in the context of solving {PDEs}}, 736 author = {M{\'a}lek, Josef and Strako{\v{s}}, Zden{\v{e}}k}, 737 year = {2014}, 738 publisher = {SIAM} 739} 740 741@book{fokkema1996enhanced, 742 title = {Enhanced implementation of {BiCGstab}(l) for solving linear systems of equations}, 743 author = {Fokkema, Diederik R}, 744 year = {1996}, 745 publisher = {Citeseer} 746} 747 748@article{sleijpen1994bicgstab, 749 title = {{BiCGstab}(l) and other hybrid {Bi-CG} methods}, 750 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A and Fokkema, Diederik R}, 751 journal = {Numerical Algorithms}, 752 volume = {7}, 753 pages = {75--109}, 754 year = {1994}, 755 publisher = {Springer} 756} 757 758@article{sleijpen1995overview, 759 title = {An overview of approaches for the stable computation of hybrid {BiCG} methods}, 760 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A}, 761 journal = {Applied numerical mathematics}, 762 volume = {19}, 763 number = {3}, 764 pages = {235--254}, 765 year = {1995}, 766 publisher = {Elsevier} 767} 768 769@article{fischer1998projection, 770 title = {Projection techniques for iterative solution of Ax= b with successive right-hand sides}, 771 author = {Fischer, Paul F}, 772 journal = {Computer methods in applied mechanics and engineering}, 773 volume = {163}, 774 number = {1-4}, 775 pages = {193--204}, 776 year = {1998}, 777 publisher = {Elsevier} 778} 779 780@article{maskery2018insights, 781 title = {Insights into the mechanical properties of several triply periodic minimal surface lattice structures 782 made by polymer additive manufacturing}, 783 author = {Maskery, Ian and Sturm, Logan and Aremu, Adedeji O and Panesar, Ajit and Williams, 784 Christopher B and Tuck, Christopher J and Wildman, Ricky D and Ashcroft, Ian A and Hague, Richard JM}, 785 journal = {Polymer}, 786 volume = {152}, 787 pages = {62--71}, 788 year = {2018}, 789 publisher = {Elsevier} 790} 791 792@book{karniadakis2005spectral, 793 title = {Spectral/hp element methods for computational fluid dynamics}, 794 author = {Karniadakis, George and Sherwin, Spencer J}, 795 year = {2005}, 796 publisher = {Oxford University Press, USA} 797} 798 799@article{golub1969calculation, 800 title = {Calculation of {G}auss quadrature rules}, 801 author = {Golub, Gene H and Welsch, John H}, 802 journal = {Mathematics of computation}, 803 volume = {23}, 804 number = {106}, 805 pages = {221--230}, 806 year = {1969} 807} 808 809@article{soderlind2006adaptive, 810 title = {Adaptive time-stepping and computational stability}, 811 author = {S{\"o}derlind, Gustaf and Wang, Lina}, 812 journal = {Journal of Computational and Applied Mathematics}, 813 volume = {185}, 814 number = {2}, 815 pages = {225--243}, 816 year = {2006}, 817 publisher = {Elsevier} 818} 819 820@article{soderlind2003digital, 821 title = {Digital filters in adaptive time-stepping}, 822 author = {S{\"o}derlind, Gustaf}, 823 journal = {{ACM} Transactions on Mathematical Software ({TOMS})}, 824 volume = {29}, 825 number = {1}, 826 pages = {1--26}, 827 year = {2003}, 828 publisher = {ACM New York, NY, USA} 829} 830 831@article{volkwein2013proper, 832 title = {Proper orthogonal decomposition: Theory and reduced-order modelling}, 833 author = {Volkwein, Stefan}, 834 journal = {Lecture Notes, University of Konstanz}, 835 volume = {4}, 836 number = {4}, 837 pages = {1--29}, 838 year = {2013}, 839 url = {http://www.math.uni-konstanz.de/numerik/personen/volkwein/teaching/POD-Book.pdf} 840} 841 842@article{frisvad2012building, 843 title = {Building an orthonormal basis from a {3D} unit vector without normalization}, 844 author = {Frisvad, Jeppe Revall}, 845 journal = {Journal of Graphics Tools}, 846 volume = {16}, 847 number = {3}, 848 pages = {151--159}, 849 year = {2012}, 850 publisher = {Taylor \& Francis} 851} 852 853@article{constantinescu2007multirate, 854 title = {Multirate timestepping methods for hyperbolic conservation laws}, 855 author = {Constantinescu, Emil M and Sandu, Adrian}, 856 journal = {Journal of Scientific Computing}, 857 volume = {33}, 858 number = {3}, 859 pages = {239--278}, 860 year = {2007}, 861 publisher = {Springer} 862} 863 864@article{liu2022newton, 865 title = {A {N}ewton-{MR} algorithm with complexity guarantees for nonconvex smooth unconstrained optimization}, 866 author = {Liu, Yang and Roosta, Fred}, 867 journal = {arXiv preprint arXiv:2208.07095}, 868 year = {2022} 869} 870 871@article{choi2011minres, 872 title = {{MINRES-QLP}: A {K}rylov subspace method for indefinite or singular symmetric systems}, 873 author = {Choi, Sou-Cheng T and Paige, Christopher C and Saunders, Michael A}, 874 journal = {SIAM Journal on Scientific Computing}, 875 volume = {33}, 876 number = {4}, 877 pages = {1810--1836}, 878 year = {2011}, 879 publisher = {SIAM} 880} 881 882@article{chen2020predict, 883 title = {Predict-and-recompute conjugate gradient variants}, 884 author = {Chen, Tyler and Carson, Erin}, 885 journal = {SIAM Journal on Scientific Computing}, 886 volume = {42}, 887 number = {5}, 888 pages = {A3084--A3108}, 889 year = {2020}, 890 publisher = {SIAM} 891} 892 893@article{cools2018analyzing, 894 title = {Analyzing the effect of local rounding error propagation on the maximal attainable accuracy of the pipelined conjugate gradient method}, 895 author = {Cools, Siegfried and Yetkin, Emrullah Fatih and Agullo, Emmanuel and Giraud, Luc and Vanroose, Wim}, 896 journal = {SIAM Journal on Matrix Analysis and Applications}, 897 volume = {39}, 898 number = {1}, 899 pages = {426--450}, 900 year = {2018}, 901 publisher = {SIAM} 902} 903 904@inproceedings{tiwari2020pipelined, 905 title = {Pipelined preconditioned conjugate gradient methods for distributed memory systems}, 906 author = {Tiwari, Manasi and Vadhiyar, Sathish}, 907 booktitle = {2020 IEEE 27th International Conference on High Performance Computing, Data, and Analytics (HiPC)}, 908 pages = {151--160}, 909 year = {2020}, 910 organization = {IEEE} 911} 912 913@article{nash1984newton, 914 title = {Newton-type minimization via the {L}anczos method}, 915 author = {Nash, Stephen G}, 916 journal = {SIAM Journal on Numerical Analysis}, 917 volume = {21}, 918 number = {4}, 919 pages = {770--788}, 920 year = {1984}, 921 publisher = {SIAM} 922} 923 924@inproceedings{eller2016scalable, 925 title = {Scalable non-blocking preconditioned conjugate gradient methods}, 926 author = {Eller, Paul R and Gropp, William}, 927 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 928 pages = {204--215}, 929 year = {2016}, 930 organization = {IEEE} 931} 932 933@article{gould1999solving, 934 title = {Solving the trust-region subproblem using the Lanczos method}, 935 author = {Gould, Nicholas IM and Lucidi, Stefano and Roma, Massimo and Toint, Philippe L}, 936 journal = {SIAM Journal on Optimization}, 937 volume = {9}, 938 number = {2}, 939 pages = {504--525}, 940 year = {1999}, 941 publisher = {SIAM} 942} 943 944@article{cools2017communication, 945 title = {The communication-hiding pipelined {BiCGstab} method for the parallel solution of large unsymmetric linear systems}, 946 author = {Cools, Siegfried and Vanroose, Wim}, 947 journal = {Parallel Computing}, 948 volume = {65}, 949 pages = {1--20}, 950 year = {2017}, 951 publisher = {Elsevier} 952} 953 954@Misc{moabwebsite, 955 key = {MOAB}, 956 title = {{MOAB} Website}, 957 howpublished = {\url{https://www.mcs.anl.gov/~fathom/moab-docs/html/contents.html}}, 958 year = {2023} 959} 960 961@book{deuflhard2011, 962 title = {{N}ewton Methods for Nonlinear Problems}, 963 author = {Peter Deuflhard}, 964 volume = {35}, 965 year = {2011}, 966 isbn = {978-3-642-23898-7}, 967 doi = {10.1007/978-3-642-23899-4}, 968 publisher = {Springer-Verlag}, 969 address = {Berlin, Heidelberg} 970} 971 972@article{ketcheson2010runge, 973 title = {{R}unge--{K}utta methods with minimum storage implementations}, 974 author = {Ketcheson, David I}, 975 journal = {Journal of Computational Physics}, 976 volume = {229}, 977 number = {5}, 978 pages = {1763--1773}, 979 year = {2010}, 980 publisher = {Elsevier} 981} 982 983@article{WalkerNi2011, 984 title = {{A}nderson acceleration for fixed-point iterations}, 985 author = {Homer F Walker and Peng Ni}, 986 journal = {SIAM Journal on Numerical Analysis}, 987 volume = {49}, 988 number = {4}, 989 pages = {1715--1735}, 990 year = {2011}, 991 publisher = {SIAM} 992} 993 994@article{Hua2007, 995 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 996 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 997 journal = {AIChE Journal}, 998 volume = {53}, 999 number = {10}, 1000 pages = {2534--2548}, 1001 year = {2007}, 1002 publisher = {Wiley Online Library} 1003} 1004 1005@Article{ openblas, 1006 title = {{OpenBLAS}: A High Performance {BLAS} Library on {L}oongson {3A} {CPU}}, 1007 journal = {Journal of Software}, 1008 volume = {22}, 1009 pages = {208--216}, 1010 year = {2011}, 1011 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 1012 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 1013} 1014 1015@Misc{ openblas-website, 1016 title = {{OpenBLAS}}, 1017 key = {OpenBLAS}, 1018 howpublished = {\url{https://www.openblas.net}} 1019} 1020 1021@Misc{ openacc-website, 1022 title = {{OpenACC}}, 1023 key = {OpenACC}, 1024 howpublished = {\url{https://www.openacc.org}} 1025} 1026 1027@Misc{ bueler2020petsc, 1028 title = {{PETSc} for Partial Differential Equations: Numerical Solutions in {C} and {P}ython}, 1029 author = {Bueler, Ed}, 1030 year = {2020}, 1031 publisher = {SIAM}, 1032 petsc_uses = {KSP} 1033} 1034 1035@TechReport{ petscforgpuexascale, 1036 title = {Toward Performance-Portable {PETSc} for {GPU}-based Exascale Systems}, 1037 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1038 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 1039 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1040 institution = {Argonne National Laboratory}, 1041 number = {ANL/MCS-P9401-1020}, 1042 note = {\url{https://arxiv.org/abs/2011.00715}}, 1043 year = {2020}, 1044 petsc_uses = {KSP} 1045} 1046 1047@Article{ mills2021, 1048 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 1049 journal = {Parallel Computing}, 1050 volume = {108}, 1051 pages = {102831}, 1052 year = {2021}, 1053 issn = {0167-8191}, 1054 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 1055 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 1056 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1057 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 1058 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 1059} 1060 1061@Article{ mills2024, 1062 title = {{PETSc/TAO} Developments for Early Exascale Systems}, 1063 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and 1064 Jacob Faibussowitsch and Tobin Isaac and Matthew G. Knepley and Todd Munson and 1065 Hansul Suh and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1066 journal = {International Journal of High Performance Computing Applications}, 1067 url = {http://arxiv.org/abs/2401.05868}, 1068 note = {Submitted}, 1069 year = {2024} 1070} 1071 1072@Article{ rupp:2016:pis:2988256.2907944, 1073 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 1074 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 1075 journal = {ACM Trans. Math. Softw.}, 1076 issue_date = {September 2016}, 1077 volume = {43}, 1078 number = {2}, 1079 month = aug, 1080 year = {2016}, 1081 issn = {0098-3500}, 1082 pages = {11:1--11:27}, 1083 articleno = {11}, 1084 numpages = {27}, 1085 doi = {10.1145/2907944}, 1086 acmid = {2907944}, 1087 publisher = {ACM}, 1088 address = {New York, NY, USA}, 1089 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 1090 gradient method}, 1091 petsc_uses = {KSP} 1092} 1093 1094@Article{ dalcin2011parallel, 1095 title = {Parallel distributed computing using python}, 1096 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 1097 journal = {Advances in Water Resources}, 1098 volume = {34}, 1099 number = {9}, 1100 pages = {1124--1139}, 1101 year = {2011}, 1102 publisher = {Elsevier}, 1103 petsc_uses = {KSP} 1104} 1105 1106@Article{ mendezpongaortiz2018, 1107 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 1108 author = {JP Mendez and M Ponga and M Ortiz}, 1109 journal = {Journal of the Mechanics and Physics of Solids}, 1110 year = {2018}, 1111 petsc_uses = {KSP} 1112} 1113 1114@TechReport{ morgan2020evaluation, 1115 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 1116 System: Part 1: Vector Node Performance}, 1117 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 1118 year = {2020}, 1119 institution = {Argonne National Laboratory}, 1120 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 1121 petsc_uses = {KSP} 1122} 1123 1124@TechReport{ pdeconstrainedspectraladjoints, 1125 title = {PDE constrained optimization, error estimation and control with spectral elements 1126 using PETSc and TAO}, 1127 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 1128 type = {Preprint}, 1129 number = {ANL/MCS-P9031-1117}, 1130 institution = {ANL}, 1131 month = nov, 1132 year = {2017}, 1133 petsc_uses = {KSP} 1134} 1135 1136@InProceedings{ asc2013, 1137 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 1138 title = {Evaluation of overlapping restricted additive {S}chwarz preconditioning for 1139 parallel solution of very large power flow problems}, 1140 booktitle = {HiPCNA-PG’13}, 1141 year = {2013}, 1142 petsc_uses = {KSP} 1143} 1144 1145@InProceedings{ as2013, 1146 author = {S. Abhyankar and B. F. Smith}, 1147 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 1148 Smart Grid Applications}, 1149 booktitle = {Proceedings of the IEEE PES General Meeting}, 1150 year = {2013}, 1151 petsc_uses = {KSP} 1152} 1153 1154@TechReport{ tspaper, 1155 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 1156 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 1157 Barry F. Smith}, 1158 type = {Preprint}, 1159 number = {ANL/MCS-P5061-0114}, 1160 institution = {ANL}, 1161 month = jan, 1162 year = {2014}, 1163 petsc_uses = {KSP} 1164} 1165 1166@TechReport{ abhyankaretal2018, 1167 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 1168 and Barry F. Smith and Hong Zhang}, 1169 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 1170 journal = {arXiv e-preprints}, 1171 eprint = {1806.01437}, 1172 archiveprefix = {arXiv}, 1173 year = {2018}, 1174 petsc_uses = {KSP} 1175} 1176 1177@Article{ zhang2021cams, 1178 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 1179 author = {Hong Zhang and Emil M. Constantinescu}, 1180 journal = {arXiv e-preprints}, 1181 eprint = {2202.11890}, 1182 archiveprefix = {arXiv}, 1183 year = {2022}, 1184 petsc_uses = {KSP} 1185} 1186 1187@InProceedings{ zhangconstantinescu2021b, 1188 title = {Revolve-based adjoint checkpointing for multistage time integration}, 1189 author = {Hong Zhang and Emil M. Constantinescu}, 1190 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 1191 month = jun, 1192 year = {2021}, 1193 petsc_uses = {KSP} 1194} 1195 1196@Article{ zhang2022tsadjoint, 1197 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 1198 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 1199 Sensitivity Analysis}}, 1200 journal = {SIAM Journal on Scientific Computing}, 1201 volume = {44}, 1202 number = {1}, 1203 pages = {C1-C24}, 1204 year = {2022}, 1205 doi = {10.1137/21M140078X}, 1206 petsc_uses = {KSP} 1207} 1208 1209@TechReport{ bb2008, 1210 author = {Tomasz Blachowicz and Bartlomiej Baron}, 1211 title = {A graphical extension for the Windows version of the Parallel Finite Element 1212 Micromagnetics Package (MagParExt)}, 1213 url = {http://arxiv.org/abs/0807.2655}, 1214 year = {2008}, 1215 petsc_uses = {KSP} 1216} 1217 1218@Article{ jacvgv2008, 1219 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 1220 and J L Vicent}, 1221 title = {Field induced vortex dynamics in magnetic {Ni} nanotriangles}, 1222 journal = {Nanotechnology}, 1223 volume = {19}, 1224 year = {2008}, 1225 doi = {10.1088/0957-4484/19/28/285717}, 1226 petsc_uses = {KSP} 1227} 1228 1229@Article{ yjdwh2008, 1230 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1231 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1232 journal = {Journal of the Magnetics Society of Japan}, 1233 volume = {32}, 1234 year = {2008}, 1235 pages = {50-53}, 1236 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 1237 petsc_uses = {KSP} 1238} 1239 1240@Article{ mtrtrsa2008, 1241 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 1242 Schrefl and M. Albrecht}, 1243 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 1244 journal = {J. Appl. Phys.}, 1245 volume = {103}, 1246 year = {2008}, 1247 doi = {10.1063/1.2894587}, 1248 petsc_uses = {KSP} 1249} 1250 1251@InProceedings{ tmrttsa2008, 1252 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 1253 Schrefl and M. Albrecht}, 1254 title = {Patterning of magnetic films by focused ion beam irradiation}, 1255 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 1256 year = {2008}, 1257 petsc_uses = {KSP} 1258} 1259 1260@Article{ yjdbh2007, 1261 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 1262 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 1263 factor for the single-phase soft magnetic films}, 1264 journal = {J. Magn. Magn. Mater.}, 1265 volume = {320}, 1266 number = {7}, 1267 pages = {1393-1397}, 1268 doi = {10.1016/j.jmmm.2007.11.025}, 1269 petsc_uses = {KSP} 1270} 1271 1272@Article{ lxky2007, 1273 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 1274 title = {Micromagnetic simulation and experimental study on microwave permeability of 1275 nano-magnetic films}, 1276 journal = {Transactions of Nonferrous Metals Society of China}, 1277 year = {2007}, 1278 pages = {756-759}, 1279 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 1280 petsc_uses = {KSP} 1281} 1282 1283@Article{ yjdwh2008a, 1284 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1285 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1286 journal = {Journal of the Magnetics Society of Japan}, 1287 volume = {32}, 1288 year = {2008}, 1289 pages = {50-53}, 1290 doi = {10.3379/msjmag.32.50}, 1291 petsc_uses = {KSP} 1292} 1293 1294@Article{ lylw2007, 1295 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 1296 title = {Micromagnetic study of magnetization reversal in patterned {DyFeCo} thin films}, 1297 journal = {Phys. Stat. Sol.}, 1298 volume = {204}, 1299 number = {12}, 1300 pages = {4049-4052}, 1301 year = {2007}, 1302 doi = {10.1002/pssa.200777359}, 1303 petsc_uses = {KSP} 1304} 1305 1306@InProceedings{ sg2007, 1307 author = {Simon Greaves}, 1308 title = {Micromagnetic Simulations of Magnetic Recording Media}, 1309 booktitle = {High Performance Computing on Vector Systems 2007}, 1310 doi = {10.1007/978-3-540-74384-2_17}, 1311 petsc_uses = {KSP} 1312} 1313 1314@Article{ bsc2007, 1315 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 1316 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm {NiFe} Nanorings}, 1317 journal = {IEEE Trans. Magn.}, 1318 volume = {43}, 1319 year = {2007}, 1320 pages = {2884-2886}, 1321 doi = {10.1109/TMAG.2007.892867}, 1322 petsc_uses = {KSP} 1323} 1324 1325@Article{ ffbf, 1326 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 1327 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 1328 Micromagnetic Simulations: Nmag.}, 1329 journal = {IEEE Trans. Magn. Volume}, 1330 volume = {43}, 1331 pages = {2896-2898}, 1332 doi = {10.1109/TMAG.2007.893843}, 1333 petsc_uses = {KSP} 1334} 1335 1336@InBook{ dfssfs2006, 1337 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 1338 chapter = {Computational Aspects of Micromagnetics}, 1339 title = {The Science of Hysteresis}, 1340 editor = { G. Bertotti and I. Mayergoyz}, 1341 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 1342 petsc_uses = {KSP} 1343} 1344 1345@InBook{ fss, 1346 author = {J. Fidler and T. Schrefl and W. Scholz}, 1347 chapter = {Computational Micromagnetics}, 1348 title = {Handbook of Theoretical and Computational Nanotechnology}, 1349 editor = {M. Rieth and W. Schommers}, 1350 url = {http://www.amazon.com/gp/product/158883042X}, 1351 petsc_uses = {KSP} 1352} 1353 1354@InBook{ shbsef, 1355 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 1356 Josef Fidler}, 1357 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 1358 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 1359 editor = {Helmut Kronmueller and Stuart Parkin}, 1360 doi = {10.1002/9780470022184.hmm203}, 1361 petsc_uses = {KSP} 1362} 1363 1364@InBook{ sfs, 1365 author = {D. Suess and J. Fidler and T. Schrefl}, 1366 chapter = {Micromagnetic Simulation of magnetic materials}, 1367 title = {Handbook of Magnetic Materials}, 1368 editor = {K. H. J. Buschow}, 1369 url = {http://www.amazon.com/gp/product/0444518509}, 1370 petsc_uses = {KSP} 1371} 1372 1373@Article{ fsxzs, 1374 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 1375 Sharma}, 1376 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 1377 Recording.}, 1378 journal = {IEEE Trans. Magn. Volume}, 1379 volume = {43}, 1380 pages = {2175-2177}, 1381 doi = {10.1109/TMAG.2007.893122}, 1382 petsc_uses = {KSP} 1383} 1384 1385@Article{ sb2006, 1386 author = {W. Scholz and S. Batra}, 1387 title = {Effect of write current waveform on magnetization and head field dynamics of 1388 perpendicular recording heads}, 1389 journal = {IEEE Trans. Magn.}, 1390 volume = {42}, 1391 year = {2006}, 1392 pages = {2264--2266}, 1393 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 1394 petsc_uses = {KSP} 1395} 1396 1397@Article{ bsr2006, 1398 author = {S. Batra and W. Scholz and T. Roscamp}, 1399 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 1400 recording system}, 1401 journal = {J. Appl. Phys.}, 1402 volume = {99}, 1403 year = {2006}, 1404 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 1405 petsc_uses = {KSP} 1406} 1407 1408@InProceedings{ japios2006, 1409 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 1410 Subramanian}, 1411 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 1412 in systems with cubic and uniaxial anisotropy.}, 1413 booktitle = {Intermag 2006 Conference}, 1414 petsc_uses = {KSP} 1415} 1416 1417@Article{ kbmb2006, 1418 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 1419 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 1420 Perpendicular Recording Heads}, 1421 journal = {IEEE Trans. Magn.}, 1422 volume = {42}, 1423 year = {2006}, 1424 pages = {2428--2430}, 1425 doi = {10.1109/TMAG.2006.879430}, 1426 petsc_uses = {KSP} 1427} 1428 1429@Article{ cclcw2006, 1430 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 1431 title = {Control of Domain Wall Motion in Permalloy Ring}, 1432 journal = {IEEE Trans. Magn.}, 1433 volume = {42}, 1434 year = {2006}, 1435 pages = {2960--2962}, 1436 doi = {10.1109/TMAG.2006.878414}, 1437 petsc_uses = {KSP} 1438} 1439 1440@Article{ bfmfzczg2007, 1441 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 1442 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 1443 title = {Micromagnetic modelling of ferromagnetic cones}, 1444 journal = {J. Magn. Magn. Mater.}, 1445 volume = {312}, 1446 year = {2007}, 1447 pages = {234-238}, 1448 url = {http://eprints.soton.ac.uk/45900/}, 1449 petsc_uses = {KSP} 1450} 1451 1452@PhDThesis{ rb2005, 1453 author = {Richard Boardman}, 1454 title = {Computer simulation studies of magnetic nanostructures}, 1455 school = {Computational Engineering and Design Group, School of Engineering Sciences, 1456 University of Southampton, United Kingdom}, 1457 year = {2005}, 1458 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 1459 petsc_uses = {KSP} 1460} 1461 1462@InProceedings{ cwwy2006, 1463 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 1464 title = {MPI Performance Analysis Tools on Blue Gene/L}, 1465 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 1466 year = {2006}, 1467 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 1468 petsc_uses = {KSP} 1469} 1470 1471@InProceedings{ ch2006, 1472 author = {I.-H. Chung and J.K. Hollingsworth}, 1473 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 1474 Programs}, 1475 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 1476 pages = {45--56}, 1477 doi = {10.1109/HPDC.2006.1652135}, 1478 petsc_uses = {KSP} 1479} 1480 1481@Article{ lkpl2005, 1482 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1483 title = {Multibit {MRAM} using a pair of memory cells}, 1484 journal = {IEEE Trans. Magn.}, 1485 volume = {41}, 1486 year = {2005}, 1487 pages = {2670-2672}, 1488 doi = {10.1109/TMAG.2005.855288}, 1489 petsc_uses = {KSP} 1490} 1491 1492@Article{ gscn2005, 1493 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 1494 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 1495 journal = {Phys. Rev. B}, 1496 volume = {71}, 1497 year = {2005}, 1498 doi = {10.1103/PhysRevB.71.144407}, 1499 petsc_uses = {KSP} 1500} 1501 1502@PhDThesis{ mda, 1503 author = {Massimiliano d'Aquino}, 1504 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 1505 school = { Universita di Napoli Federico II.}, 1506 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 1507 petsc_uses = {KSP} 1508} 1509 1510@TechReport{ ssdfssf2003, 1511 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 1512 Stehno and J. Fidler}, 1513 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 1514 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 1515 petsc_uses = {KSP} 1516} 1517 1518@InProceedings{ sb2006a, 1519 author = {W. Scholz and S. Batra}, 1520 title = {Effect of write current waveform on magnetization and head field dynamics of 1521 perpendicular recording heads}, 1522 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 1523 petsc_uses = {KSP} 1524} 1525 1526@Article{ scholz-batra1, 1527 author = {W. Scholz and S. Batra}, 1528 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 1529 Recording}, 1530 journal = {IEEE Trans. Magn.}, 1531 note = {submitted}, 1532 year = {2005}, 1533 petsc_uses = {KSP} 1534} 1535 1536@Article{ scholz-batra2, 1537 author = {W. Scholz and S. Batra}, 1538 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 1539 journal = {IEEE Trans. Magn.}, 1540 volume = {41}, 1541 year = {2005}, 1542 pages = {702-706}, 1543 petsc_uses = {KSP} 1544} 1545 1546@Article{ daquino-scholz1, 1547 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1548 title = {Micromagnetic Analysis of Fast Precessional Switching}, 1549 journal = {J. Magn. Magn. Mater.}, 1550 volume = {290-291}, 1551 year = {2005}, 1552 pages = {510-513}, 1553 petsc_uses = {KSP} 1554} 1555 1556@Article{ aq-scholz-fid, 1557 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1558 title = {Numerical and analytical study of fast precessional switching}, 1559 journal = {J. Appl. Phys.}, 1560 volume = {95}, 1561 year = {2004}, 1562 pages = {7055-7057}, 1563 petsc_uses = {KSP} 1564} 1565 1566@InProceedings{ gar-tabik-gar, 1567 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 1568 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 1569 Scatterers}, 1570 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 1571 (PDP'04)}, 1572 year = {2004}, 1573 pages = {80--}, 1574 petsc_uses = {KSP} 1575} 1576 1577@InProceedings{ aq-scholz-mia, 1578 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 1579 title = {Analysis of fast precessional switching in magnetic thin films}, 1580 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 1581 year = {2004}, 1582 pages = {257-260}, 1583 petsc_uses = {KSP} 1584} 1585 1586@Article{ scholz-fid-seus, 1587 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 1588 Dittrich and V. Tsiantos}, 1589 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 1590 Axes}, 1591 journal = {J. Magn. Magn. Mater.}, 1592 year = {2004}, 1593 pages = {1524-1525}, 1594 petsc_uses = {KSP} 1595} 1596 1597@Article{ boardman-zimmerman, 1598 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 1599 Peter de Groot}, 1600 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 1601 journal = {Journal of Applied Physics}, 1602 year = {2005}, 1603 petsc_uses = {KSP} 1604} 1605 1606@Article{ lim-kim-park, 1607 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1608 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 1609 journal = {IEEE Trans. Magn.}, 1610 note = {submitted}, 1611 petsc_uses = {KSP} 1612} 1613 1614@Article{ scholz-suess2, 1615 author = {W. Scholz and D. Suess and T. Schrefl and J. Fidler}, 1616 title = {Micromagnetic simulation of magnetization reversal in small particles with 1617 surface anisotropy}, 1618 journal = {J. Appl. Phys.}, 1619 volume = {95}, 1620 year = {2004}, 1621 pages = {6807-6809}, 1622 petsc_uses = {KSP} 1623} 1624 1625@Article{ scholz-schrefl1, 1626 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 1627 Tsiantos}, 1628 title = {Micromagnetic simulation of the pinning and depinning process in permanent 1629 magnets}, 1630 journal = {IEEE Trans. Magn.}, 1631 volume = {39}, 1632 year = {2003}, 1633 pages = {2920-2922}, 1634 petsc_uses = {KSP} 1635} 1636 1637@Article{ scholz-guslienko, 1638 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 1639 W. Chantrell and J. Fidler}, 1640 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 1641 nanodots}, 1642 journal = {J. Magn. Magn. Mater.}, 1643 volume = {266}, 1644 year = {2003}, 1645 pages = {155-163}, 1646 petsc_uses = {KSP} 1647} 1648 1649@Article{ scholz1, 1650 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 1651 Forster and V. Tsiantos}, 1652 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1653 journal = {Comp. Mat. Sci}, 1654 year = {2003}, 1655 pages = {366--383}, 1656 volume = {28}, 1657 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 1658 petsc_uses = {KSP} 1659} 1660 1661@PhDThesis{ scholz2, 1662 author = {W. Scholz}, 1663 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1664 school = {Vienna University of Technology, Vienna, Austria}, 1665 year = {2003}, 1666 petsc_uses = {KSP} 1667} 1668 1669@Article{ scholz3, 1670 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 1671 Forster and J. Fidler}, 1672 title = {Implementation of a high performance parallel finite element micromagnetics 1673 package}, 1674 journal = {J. Magn. Magn. Mater.}, 1675 year = {2004}, 1676 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 1677 petsc_uses = {KSP} 1678} 1679 1680% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1681@InBook{ zhanggladwell1, 1682 author = {W. Zhang and I. Gladwell}, 1683 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 1684 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 1685 year = {2000}, 1686 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 1687 Physics, vol. 552}, 1688 publisher = {Springer}, 1689 pages = {4190-}, 1690 petsc_uses = {KSP} 1691} 1692 1693@Article{ wolf1, 1694 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 1695 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 1696 thin films}, 1697 journal = {Phil. Mag. A}, 1698 year = {2003}, 1699 lab = {ANL}, 1700 petsc_uses = {KSP} 1701} 1702 1703@Article{ wolf2, 1704 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 1705 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 1706 grain-boundary properties}, 1707 journal = {Computational Materials Science}, 1708 year = {2001}, 1709 volume = {23}, 1710 pages = {15--32}, 1711 lab = {ANL}, 1712 petsc_uses = {KSP} 1713} 1714 1715@Article{ wolf3, 1716 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 1717 title = {Role of grain rotation in grain growth by mesoscale simulation}, 1718 journal = {Phil. Mag. A}, 1719 year = {2002}, 1720 volume = {82}, 1721 pages = {1271--1297}, 1722 lab = {ANL}, 1723 petsc_uses = {KSP} 1724} 1725 1726% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1727@Article{ saut, 1728 author = { Olivier Saut}, 1729 title = {Bidimensional Study of the {M}axwell-{B}loch Model in a Nonlinear Crystal}, 1730 journal = {SIAM Journal on Scientific Computing}, 1731 year = {2004}, 1732 note = {submitted}, 1733 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 1734 petsc_uses = {KSP} 1735} 1736 1737% LiteralHTML: 1738% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 1739% LiteralHTML: 1740@InBook{ khanallorenziayachepennec2016, 1741 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 1742 of Brain Deformation in {Alzheimer's} Disease}, 1743 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 1744 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 1745 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 1746 Miller}, 1747 pages = {167--176}, 1748 isbn = {978-3-319-28329-6}, 1749 doi = {10.1007/978-3-319-28329-6_15}, 1750 publisher = {Springer International Publishing}, 1751 year = {2016}, 1752 petsc_uses = {KSP} 1753} 1754 1755@Article{ ataseven, 1756 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 1757 title = {Parallel implementation of the accelerated {BEM} approach for {EMSI} of the human 1758 brain}, 1759 journal = {Medical and Biological Engineering and Computing}, 1760 month = feb, 1761 year = {2008}, 1762 doi = {10.1007/s11517-008-0316-0}, 1763 petsc_uses = {KSP} 1764} 1765 1766@Article{ dennis-eberhart-03, 1767 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 1768 pages = {832-840}, 1769 volume = {125}, 1770 number = {6}, 1771 title = {Finite-element simulation of cooling of realistic {3-D} human head and neck}, 1772 journal = {J Biomech Eng}, 1773 year = {2003}, 1774 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 1775 petsc_uses = {KSP} 1776} 1777 1778@Conference{ gu7174parallel, 1779 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 1780 frequency-domain small animal optical tomography}}, 1781 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 1782 booktitle = {Proc. of SPIE Vol}, 1783 volume = {7174}, 1784 number = {717406}, 1785 pages = {1}, 1786 petsc_uses = {KSP} 1787} 1788 1789@Article{ barchanski2005using, 1790 title = {{Using domain decomposition techniques for the calculation of low-frequency 1791 electric current densities in high-resolution 3D human anatomy models}}, 1792 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 1793 T.}, 1794 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 1795 and Electronic Engineering}, 1796 volume = {24}, 1797 number = {2}, 1798 pages = {458--467}, 1799 issn = {0332-1649}, 1800 year = {2005}, 1801 publisher = {Emerald Group Publishing Limited}, 1802 petsc_uses = {KSP} 1803} 1804 1805@Article{ motrescurienen05, 1806 author = {V. C. Motrescu and U. van Rienen}, 1807 pages = {227--231}, 1808 volume = {3}, 1809 title = {Computation of currents induced by {ELF} electric fields in anisotropic human 1810 tissues using the Finite Integration Technique}, 1811 journal = {Advances in Radio Science}, 1812 year = {2005}, 1813 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 1814 petsc_uses = {KSP} 1815} 1816 1817@Article{ motrescurienen04, 1818 author = {V. C. Motrescu and U. van Rienen}, 1819 pages = {309--313}, 1820 volume = {2}, 1821 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 1822 Integration Technique (FIT)}, 1823 journal = {Advances in Radio Science}, 1824 year = {2004}, 1825 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 1826 petsc_uses = {KSP} 1827} 1828 1829@InProceedings{ dbl2, 1830 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 1831 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 1832 booktitle = {ECCOMAS2000}, 1833 year = {2000}, 1834 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 1835 petsc_uses = {KSP} 1836} 1837 1838@Unpublished{ cell, 1839 title = {Parallel Simulation Engines for Whole-Cell Models}, 1840 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 1841 Weber}, 1842 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 1843 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 1844 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 1845 year = {2001}, 1846 petsc_uses = {KSP} 1847} 1848 1849@Article{ barker2010two, 1850 title = {Two-level {N}ewton and hybrid {S}chwarz preconditioners for fluid-structure 1851 interaction}, 1852 author = {Barker, A.T. and Cai, X.C.}, 1853 journal = {SIAM Journal on Scientific Computing}, 1854 volume = {32}, 1855 number = {4}, 1856 pages = {2395--2417}, 1857 year = {2010}, 1858 publisher = {Society for Industrial and Applied Mathematics}, 1859 petsc_uses = {KSP} 1860} 1861 1862@Article{ barker2010scalable, 1863 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 1864 with application to blood flow modeling}, 1865 author = {Barker, A.T. and Cai, X.C.}, 1866 journal = {Journal of Computational Physics}, 1867 volume = {229}, 1868 number = {3}, 1869 pages = {642--659}, 1870 year = {2010}, 1871 publisher = {Elsevier}, 1872 petsc_uses = {KSP} 1873} 1874 1875@Article{ barker2009nks, 1876 title = {{NKS} for fully coupled fluid-structure interaction with application}, 1877 author = {Barker, A.T. and Cai, X.C.}, 1878 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 1879 pages = {275--282}, 1880 year = {2009}, 1881 publisher = {Springer}, 1882 petsc_uses = {KSP} 1883} 1884 1885@Article{ mirams2013, 1886 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 1887 and Yi Cui and Gary R Mirams}, 1888 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 1889 to predict {QT} interval changes in the rabbit ventricular wedge}, 1890 journal = {Journal of pharmacological and toxicological methods}, 1891 volume = {68}, 1892 number = {1}, 1893 pages = {88--96}, 1894 year = {2013}, 1895 doi = {10.1016/j.vascn.2013.04.004}, 1896 petsc_uses = {KSP} 1897} 1898 1899% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1900% LiteralHTML: <center><img alt="" 1901% LiteralHTML: src="images/spine0l.jpg"></center></p> 1902% LiteralHTML: <center><img alt="" 1903% LiteralHTML: src="images/vertebra.jpg"></center></p> 1904% LiteralHTML:<font color="#FF0000"> 1905% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 1906% LiteralHTML:Understanding bone mechanical properties and how they may lead to 1907% LiteralHTML:fractures is thus an important medical research activity. PETSc and 1908% LiteralHTML:Prometheus have been used for extremely large scale finite element 1909% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 1910% LiteralHTML:team of doctors and computational scientists. This computation was 1911% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 1912% LiteralHTML:with over 4000 processors.</p> 1913% LiteralHTML: </font> 1914@Article{ arbenz2008scalable, 1915 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 1916 analysis of human bone structures}, 1917 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 1918 journal = {International Journal for Numerical Methods in Engineering}, 1919 volume = {73}, 1920 number = {7}, 1921 pages = {927--947}, 1922 year = {2008}, 1923 publisher = {Wiley Online Library}, 1924 petsc_uses = {KSP} 1925} 1926 1927@InProceedings{ adams-04, 1928 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1929 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 1930 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 1931 half a billion degrees of freedom}, 1932 note = {Gordon Bell Award}, 1933 year = {2004}, 1934 petsc_uses = {KSP} 1935} 1936 1937@InProceedings{ adams-03b, 1938 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1939 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 1940 Whole Bone Micro-Mechanics on the {IBM SP}}, 1941 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 1942 year = {2003}, 1943 petsc_uses = {KSP} 1944} 1945 1946@InProceedings{ oghattas2002, 1947 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 1948 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 1949 booktitle = {Procceedings of SC2002}, 1950 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 1951 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 1952 by time-dependent PDEs, and scalability results for an inverse wave propagation 1953 problem of determining the material field of an acoustic medium. Using the 1954 algorithm, they solved a synthetic inverse wave propagation problem though a 1955 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 1956 processors.}, 1957 year = {2002}, 1958 petsc_uses = {KSP} 1959} 1960 1961% LiteralHTML: <a name="biology:cardiology"> 1962% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1963% LiteralHTML: <center><img alt="" 1964% LiteralHTML: src="images/heart.jpg"> 1965% LiteralHTML: <img alt="" 1966% LiteralHTML: src="images/pump.jpg"></center></p> 1967% LiteralHTML: 1968% LiteralHTML:<font color="#FF0000"> 1969% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 1970% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 1971% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 1972% LiteralHTML: through the heart. PETSc has been used by several research groups to 1973% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 1974% LiteralHTML: fully understand the developments of arrhthmias.</p> 1975% LiteralHTML:</font> 1976@InProceedings{ oghattas2000, 1977 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1978 Walkington}, 1979 title = {A Parallel Dynamic-Mesh {L}agrangian Method for Simulation of Flows with Dynamic 1980 Interfaces}, 1981 booktitle = {Procceedings of SC2000}, 1982 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1983 note = {Blood flow modeling at the microscale including effects on individual blood 1984 cells, for designing heart assist pumps, etc.}, 1985 year = {2000}, 1986 petsc_uses = {KSP} 1987} 1988 1989@InBook{ cfps2006, 1990 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1991 editor = {A. Quarteroni et al.}, 1992 title = {Complex Systems in Biomedicine}, 1993 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1994 publisher = {Springer-Verlag}, 1995 pages = {187--241}, 1996 year = {2006}, 1997 petsc_uses = {KSP} 1998} 1999 2000@InProceedings{ cfpst2007, 2001 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 2002 title = {Determining recovery times from transmembrane action potentials and unipolar 2003 electrograms in normal heart tissue}, 2004 booktitle = {FIMH07}, 2005 publisher = {Springer-Verlag}, 2006 volume = {4466}, 2007 pages = {139--149}, 2008 year = {2007}, 2009 petsc_uses = {KSP} 2010} 2011 2012@Article{ seemann2010framework, 2013 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 2014 Equations Using PETSc}}, 2015 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 2016 D{\\"o}ssel, O.}, 2017 journal = {Progress in Industrial Mathematics at ECMI 2008}, 2018 pages = {363--369}, 2019 year = {2010}, 2020 publisher = {Springer}, 2021 petsc_uses = {KSP} 2022} 2023 2024@InProceedings{ pft2005, 2025 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 2026 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 2027 Intramural Heterogeneity}, 2028 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 2029 pages = {267--277}, 2030 editors = {A. Frangi et al.}, 2031 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 2032 year = {2005}, 2033 petsc_uses = {KSP} 2034} 2035 2036@Article{ bgcp2005, 2037 author = {Boyce E. Griffith and Charles S. Peskin}, 2038 title = {On the order of accuracy of the immersed boundary method: Higher order 2039 convergence rates for sufficiently smooth problems}, 2040 journal = {Journal of Computational Physics}, 2041 year = {2005}, 2042 volume = {208}, 2043 pages = {75--105}, 2044 petsc_uses = {KSP} 2045} 2046 2047@Article{ griffith2007adaptive, 2048 title = {An adaptive, formally second order accurate version of the immersed boundary 2049 method}, 2050 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 2051 journal = {Journal of Computational Physics}, 2052 volume = {223}, 2053 number = {1}, 2054 pages = {10--49}, 2055 year = {2007}, 2056 publisher = {Elsevier}, 2057 petsc_uses = {KSP} 2058} 2059 2060@PhDThesis{ griffith05, 2061 author = {Boyce Griffith}, 2062 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 2063 parallel version of the immersed boundary method}, 2064 school = {New York University}, 2065 year = {2005}, 2066 petsc_uses = {KSP} 2067} 2068 2069@PhDThesis{ murillo, 2070 author = {Maria S. Murillo}, 2071 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 2072 Differential Equations with an Application in Computational Biology}, 2073 school = {University of Colorado at Boulder}, 2074 year = {2002}, 2075 petsc_uses = {KSP} 2076} 2077 2078@Article{ spv2004, 2079 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 2080 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 2081 journal = {IEEE Trans. Biomed. Eng}, 2082 year = {2004}, 2083 volume = {51}, 2084 pages = {1960--1968}, 2085 petsc_uses = {KSP} 2086} 2087 2088@Article{ vphl2003, 2089 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 2090 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 2091 journal = {J. Electrocardiol.}, 2092 year = {2003}, 2093 volume = {36}, 2094 pages = {69--74}, 2095 petsc_uses = {KSP} 2096} 2097 2098@InProceedings{ spbv2003, 2099 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and E.J. Vigmond}, 2100 title = {Preconditioning Techniques for the Bidomain Equations}, 2101 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2102 Methods}, 2103 pages = {571--580}, 2104 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2105 note = {}, 2106 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2107 year = {2003}, 2108 petsc_uses = {KSP} 2109} 2110 2111@Article{ franz-pavir-04, 2112 author = {P. Colli Franzone and L.~F. Pavarino}, 2113 title = {A parallel solver for reaction-diffusion systems in computational 2114 electrocardiology}, 2115 journal = {Mathematical Models and Methods in Applied Sciences}, 2116 year = {2004}, 2117 volume = {14}, 2118 number = {6}, 2119 pages = {883--912}, 2120 petsc_uses = {KSP} 2121} 2122 2123@Article{ franz-pavir-05, 2124 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2125 title = {Simulating patterns of excitation, repolarization and action potential 2126 durationwith cardiac Bidomain and Monodomain models}, 2127 journal = {Mathematical Biosciences}, 2128 year = {2005}, 2129 volume = {197}, 2130 number = {1}, 2131 pages = {35--66}, 2132 petsc_uses = {KSP} 2133} 2134 2135@Article{ franz-pavir-06, 2136 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2137 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 2138 the dispersion of cardiac repolarization and action potential duration: a 2139 simulation study}, 2140 journal = {Mathematical Biosciences}, 2141 year = {2006}, 2142 volume = {204}, 2143 number = {1}, 2144 pages = {132--165}, 2145 petsc_uses = {KSP} 2146} 2147 2148@InProceedings{ colli-franz-sim, 2149 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 2150 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 2151 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 2152 Mediterranean Conference on Medical and Biological Engineering}, 2153 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 2154 year = {2004}, 2155 petsc_uses = {KSP} 2156} 2157 2158@InProceedings{ pf2003, 2159 author = {Luca F. Pavarino and Piero Colli Franzone}, 2160 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 2161 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2162 Methods}, 2163 pages = {669--776}, 2164 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2165 note = {}, 2166 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2167 year = {2003}, 2168 petsc_uses = {KSP} 2169} 2170 2171@Article{ maria-is04, 2172 author = {Maria Murillo and Xiao-Chuan Cai}, 2173 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 2174 activity of the heart}, 2175 journal = {Numerical Linear Algebra with Applications}, 2176 year = {2004}, 2177 volume = {11}, 2178 pages = {261 - 277}, 2179 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 2180 petsc_uses = {KSP} 2181} 2182 2183@Article{ murli2007monitoring, 2184 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 2185 Imaging in a Grid computing PSE}}, 2186 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 2187 and Lapegna, M.}, 2188 journal = {Grid-Based Problem Solving Environments}, 2189 pages = {421--432}, 2190 year = {2007}, 2191 publisher = {Springer}, 2192 petsc_uses = {KSP} 2193} 2194 2195@Article{ carracciuolo:2006:tpc, 2196 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 2197 title = {Towards a parallel component for imaging in {PETSc} programming environment: a case 2198 study in {3-D} echocardiography}, 2199 journal = {Parallel Comput.}, 2200 volume = {32}, 2201 issue = {1}, 2202 month = jan, 2203 year = {2006}, 2204 issn = {0167-8191}, 2205 pages = {67--83}, 2206 numpages = {17}, 2207 doi = {10.1016/j.parco.2005.09.001}, 2208 acmid = {1141218}, 2209 publisher = {Elsevier Science Publishers B. V.}, 2210 address = {Amsterdam, The Netherlands, The Netherlands}, 2211 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 2212 component}, 2213 petsc_uses = {KSP} 2214} 2215 2216@Article{ damore2011integration, 2217 title = {Integration of emerging computer technologies for an efficient image sequences 2218 analysis}, 2219 journal = {Integrated Computer-Aided Engineering }, 2220 volume = {18}, 2221 number = {4}, 2222 pages = {365 - 378}, 2223 year = {2011}, 2224 note = {}, 2225 issn = {1875-8835}, 2226 doi = {10.3233/ICA-2011-0382}, 2227 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 2228 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 2229 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 2230 petsc_uses = {KSP} 2231} 2232 2233@InProceedings{ eth_biwi_00721, 2234 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and G. 2235 Székely}, 2236 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 2237 a {S}chur Complement Preconditioner}, 2238 booktitle = {Euro-Par 2009 Parallel Processing}, 2239 year = {2009}, 2240 month = aug, 2241 pages = {747-759}, 2242 volume = {5704}, 2243 editor = {H. Sips and D. Epema and H.-X. Lin}, 2244 series = {Lecture Notes in Computer Science}, 2245 publisher = {Springer}, 2246 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 2247 parallel Krylov solver}, 2248 petsc_uses = {KSP} 2249} 2250 2251% LiteralHTML: <a name="biology:imagingandsurgery"> 2252% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 2253% LiteralHTML: <center><img alt="" 2254% LiteralHTML: src="images/brain.jpg"></center> 2255@Article{ ganser2004deformable, 2256 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 2257 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 2258 journal = {Medical Image Analysis}, 2259 volume = {8}, 2260 number = {1}, 2261 pages = {3--22}, 2262 year = {2004}, 2263 publisher = {Elsevier}, 2264 petsc_uses = {KSP} 2265} 2266 2267@Unpublished{ taccsurgery, 2268 title = {{TACC} supercomputer performs laser cancer surgery on canine}, 2269 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 2270 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 2271 Austin performed laser surgery on a dog in Houston without the intervention of a 2272 surgeon. The treatment was developed collaboratively by computational experts from 2273 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 2274 leading technologists from the M.D. Anderson Cancer Center in Houston, and 2275 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 2276 state-of-the-art thermal imaging technology, and advanced computational methods, 2277 dynamic, data-driven treatments are being pursued as a minimally invasive 2278 alternative to the standard treatment of cancer.}, 2279 petsc_uses = {KSP} 2280} 2281 2282@Article{ ffhbresso2008, 2283 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 2284 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 2285 Tinsley Oden}, 2286 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 2287 journal = {Engineering with Computers}, 2288 note = {Special issue on Computational Bioengineering}, 2289 year = {2008}, 2290 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 2291 petsc_uses = {KSP} 2292} 2293 2294@TechReport{ dobbhbbbdeffghkkps2008, 2295 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 2296 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 2297 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 2298 and S. Prudhomme and R. J. Stafford}, 2299 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 2300 Cancer}, 2301 year = {2008}, 2302 institution = {University of Texas at Austin}, 2303 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 2304 petsc_uses = {KSP} 2305} 2306 2307@Article{ ogdb2004, 2308 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 2309 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 2310 journal = {Physics in Medicine and Biology}, 2311 year = {2004}, 2312 volume = {49}, 2313 pages = {2955--2947}, 2314 petsc_uses = {KSP} 2315} 2316 2317@InProceedings{ majumdar11, 2318 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 2319 Baldridge and P. Krysl}, 2320 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 2321 booktitle = {ICCS 2005}, 2322 pages = {672--679}, 2323 editor = {V.S. Sunderam et al.}, 2324 year = {2005}, 2325 petsc_uses = {KSP} 2326} 2327 2328@Conference{ sermesant-etal:03, 2329 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 2330 Ayache, H.}, 2331 title = {A parallel implementation of non-rigid registration using a volumetric 2332 biomechanical model}, 2333 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 2334 address = {Philadelphia, PA, USA}, 2335 publisher = {Springer-Verlag}, 2336 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2337 series = {Lecture Notes in Computer Science}, 2338 volume = {2717}, 2339 pages = {398-407}, 2340 date = {june 23-24}, 2341 year = {2003}, 2342 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 2343 petsc_uses = {KSP} 2344} 2345 2346@Conference{ sermesant-etal:04, 2347 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 2348 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 2349 title = {A Novel Nonrigid Registration Algorithm And Applications}, 2350 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 2351 address = {Philadelphia, PA, USA}, 2352 publisher = {Springer-Verlag}, 2353 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2354 series = {Lecture Notes in Computer Science}, 2355 volume = {2208}, 2356 pages = {923}, 2357 year = {2003}, 2358 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 2359 petsc_uses = {KSP} 2360} 2361 2362@Article{ warfield-haker-talos-05, 2363 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 2364 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 2365 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 2366 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 2367 title = {Capturing intraoperative deformations: research experience at {B}righam and {W}omen's 2368 hospital}, 2369 journal = {Medical Image Analysis}, 2370 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 2371 year = {2005}, 2372 petsc_uses = {KSP} 2373} 2374 2375@Article{ brain3, 2376 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 2377 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 2378 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 2379 Deformation during Image Guided Neurosurgery}, 2380 journal = {Computing and Visualization in Science}, 2381 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 2382 year = {2002}, 2383 petsc_uses = {KSP} 2384} 2385 2386@Article{ brain2, 2387 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 2388 Kikinis and Simon K. Warfield}, 2389 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 2390 Element Biomechanical Model}, 2391 journal = {IEEE Transactions on Medical Imaging}, 2392 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 2393 year = {2001}, 2394 petsc_uses = {KSP} 2395} 2396 2397@InProceedings{ brain1, 2398 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 2399 Ferenc A. Jolesz and Ron Kikinis}, 2400 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 2401 Guided Neurosurgery}, 2402 booktitle = {Proceedings of SC2000}, 2403 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 2404 year = {2000}, 2405 petsc_uses = {KSP} 2406} 2407 2408@Article{ vanne06, 2409 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 2410 M. Lassas and M. Kalke}, 2411 title = {Parallelized {B}ayesian inversion for three-dimensional dental {X}-ray imaging}, 2412 journal = {IEEE Transactions on Medical Imaging}, 2413 volume = {25}, 2414 number = {2}, 2415 month = feb, 2416 year = {2006}, 2417 pages = {218--228}, 2418 petsc_uses = {KSP} 2419} 2420 2421@InProceedings{ knepleybardhan2015, 2422 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 2423 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 2424 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 2425 Exposition}, 2426 volume = {9}, 2427 pages = {V009T12A04}, 2428 doi = {10.1115/IMECE2015-53579}, 2429 year = {2015}, 2430 petsc_uses = {KSP} 2431} 2432 2433@InProceedings{ bardhanknepley2015, 2434 title = {Multiscale models and approximation algorithms for protein electrostatics}, 2435 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 2436 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 2437 volume = {61}, 2438 pages = {163--174}, 2439 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 2440 doi = {10.2495/BEM380131}, 2441 publisher = {WIT Press}, 2442 year = {2015}, 2443 petsc_uses = {KSP} 2444} 2445 2446% LiteralHTML: 2447% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 2448% LiteralHTML: 2449@InProceedings{ adamsbrennanknepleywang2022, 2450 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 2451 quench plasmas}, 2452 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 2453 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 2454 (IPDPS '22)}, 2455 doi = {10.1109/IPDPS53621.2022.00020}, 2456 year = {2022}, 2457 petsc_uses = {DMPlex} 2458} 2459 2460@Misc{ adamsknepleybrennan2021, 2461 title = {Runaway Electron Generation with High-Performance, Structure Preserving 2462 Discretization of {F}okker--{P}lank--{L}andau}, 2463 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 2464 year = {2021}, 2465 petsc_uses = {KSP} 2466} 2467 2468@Article{ adamshirvijokiknepleybrownisaacmills2017, 2469 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 2470 Architectures}, 2471 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 2472 Isaac and Richard Mills}, 2473 journal = {SIAM Journal on Scientific Computing}, 2474 volume = {39}, 2475 number = {6}, 2476 pages = {C452--C465}, 2477 doi = {10.1137/17M1118828}, 2478 eprint = {1702.08880}, 2479 year = {2017}, 2480 petsc_uses = {KSP} 2481} 2482 2483@Article{ pusztayknepleyadams2022, 2484 title = {Conservative Projection Between {FEM} and Particle Bases}, 2485 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 2486 journal = {SIAM Journal on Scientific Computing}, 2487 volume = {44}, 2488 number = {4}, 2489 pages = {C310--C319}, 2490 doi = {10.1137/21M145407}, 2491 year = {2022} 2492} 2493 2494@Article{ hirvijoki2017, 2495 author = {Eero Hirvijoki and Mark F. Adams}, 2496 title = {Conservative discretization of the {Landau} collision integral}, 2497 journal = {Physics of Plasmas}, 2498 volume = {24}, 2499 number = {3}, 2500 pages = {032121}, 2501 doi = {10.1063/1.4979122}, 2502 year = {2017}, 2503 petsc_uses = {KSP} 2504} 2505 2506@Article{ mollenadamsknepleyhagerchang2021, 2507 title = {Implementation of higher-order velocity mapping between marker particles and grid 2508 in the particle-in-cell code {XGC}}, 2509 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 2510 S. Chang}, 2511 journal = {Journal of Plasma Physics}, 2512 volume = {87}, 2513 number = {2}, 2514 pages = {905870229}, 2515 eprint = {2012.11764}, 2516 doi = {10.1017/S0022377821000441}, 2517 year = {2021}, 2518 petsc_uses = {KSP} 2519} 2520 2521@Article{ lsmh2014, 2522 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 2523 title = {Comparison of particle trajectories and collision operators for collisional 2524 transport in nonaxisymmetric plasmas}, 2525 journal = { Physics of Plasmas}, 2526 volume = {21}, 2527 year = {2014}, 2528 petsc_uses = {KSP} 2529} 2530 2531@Article{ lpcep2014, 2532 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 2533 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 2534 pedestal}, 2535 journal = {Plasma Physics and Controlled Fusion}, 2536 volume = {56}, 2537 year = {2014}, 2538 petsc_uses = {KSP} 2539} 2540 2541@Article{ facets-scidac08, 2542 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 2543 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 2544 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 2545 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 2546 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 2547 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 2548 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 2549 Stotler and A. Pigarov}, 2550 journal = {J. Phys.: Conf. Ser.}, 2551 volume = {125}, 2552 year = {2008}, 2553 pages = {012040}, 2554 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 2555 petsc_uses = {KSP} 2556} 2557 2558@Article{ facets-scidac09, 2559 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 2560 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 2561 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 2562 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 2563 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 2564 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 2565 and A. Pigarov and H. Zhang}, 2566 journal = {J. Phys.: Conf. Ser.}, 2567 volume = {180}, 2568 year = {2009}, 2569 pages = {012056}, 2570 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 2571 petsc_uses = {KSP} 2572} 2573 2574@InProceedings{ facets-scidac10, 2575 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 2576 {FACETS} Code}, 2577 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 2578 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 2579 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 2580 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 2581 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 2582 Pigarov and H. Zhang}, 2583 booktitle = {Proceedings of SciDAC 2010 Conference}, 2584 year = {2010}, 2585 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 2586 petsc_uses = {KSP} 2587} 2588 2589@InProceedings{ facets-fec2010, 2590 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 2591 the {FACETS} Framework}, 2592 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 2593 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 2594 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 2595 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 2596 Republic of Korea}, 2597 year = {2010}, 2598 petsc_uses = {KSP} 2599} 2600 2601@InProceedings{ facets-epdp2010, 2602 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 2603 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 2604 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 2605 Groebner and S. Balay and L. McInnes and H. Zhang}, 2606 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 2607 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 2608 year = {2010}, 2609 petsc_uses = {KSP} 2610} 2611 2612@Article{ carlssoncary09, 2613 author = {Johan Carlsson, John R. Cary}, 2614 title = {The hypersecant {J}acobian approximation for quasi-{N}ewton solves of sparse 2615 nonlinear systems}, 2616 journal = {arXiv}, 2617 year = {2009}, 2618 note = {http://arxiv.org/abs/0905.1054}, 2619 url = {http://arxiv.org/pdf/0905.1054v1}, 2620 petsc_uses = {KSP} 2621} 2622 2623@InProceedings{ oshahjs2006, 2624 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 2625 S.J. Janhunen and T.P. Kiviniemi}, 2626 title = {Performance enhancements to {ELMFIRE} gyrokinetic code leading to new ranges of 2627 application}, 2628 booktitle = {33rd EPS Conference on Plasma Phys.}, 2629 year = {2006}, 2630 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 2631 note = {European fusion code}, 2632 petsc_uses = {KSP} 2633} 2634 2635@Article{ zhu2006, 2636 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 2637 title = {Intermediate nonlinear evolution of the {P}arker instability: Formation of 2638 convection-induced discontinuities and absence of finite-time singularities}, 2639 journal = {Phys. Rev. Lett.}, 2640 volume = {96}, 2641 number = {065001}, 2642 year = {2006}, 2643 doi = {10.1103/PhysRevLett.96.065001}, 2644 petsc_uses = {KSP} 2645} 2646 2647@InProceedings{ ppc2005, 2648 author = {B. Philip and M. Pernice and L.Chacon}, 2649 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 2650 Refinement}, 2651 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 2652 methods}, 2653 year = {2005}, 2654 lab = {LANL}, 2655 petsc_uses = {KSP} 2656} 2657 2658@Article{ pp2005, 2659 author = {M. Pernice and B. Philip}, 2660 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 2661 Refinement}, 2662 year = {2005}, 2663 journal = {SIAM J. of Sci. Comput.}, 2664 lab = {LANL}, 2665 petsc_uses = {KSP} 2666} 2667 2668@Article{ gt2004, 2669 author = {A. H. Glasser and X. Z. Tang}, 2670 title = {The {SEL} macroscopic modeling code}, 2671 year = {2004}, 2672 journal = {Computer Physics Communications}, 2673 pages = {237--243}, 2674 volume = {164}, 2675 lab = {LANL}, 2676 petsc_uses = {KSP} 2677} 2678 2679@Article{ nl2006, 2680 author = {Y. Nishimura and Z.Lin}, 2681 title = {A finite element mesh in a tokamak edge geometry}, 2682 year = {2006}, 2683 journal = {Contributions to Plasma Physics}, 2684 volume = {22}, 2685 lab = {PPPL}, 2686 petsc_uses = {KSP} 2687} 2688 2689@Article{ nlle2004, 2690 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 2691 title = {A finite element {P}oisson solver for gyrokinetic particle simulations in a global 2692 field aligned mesh}, 2693 year = {2006}, 2694 journal = {J. Comput. Phys.}, 2695 volume = {214}, 2696 pages = {657}, 2697 lab = {PPPL}, 2698 petsc_uses = {KSP} 2699} 2700 2701@InProceedings{ lnlle2004, 2702 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 2703 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 2704 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2705 year = {2004}, 2706 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 2707 lab = {PPPL}, 2708 petsc_uses = {KSP} 2709} 2710 2711@InProceedings{ nlclew2004, 2712 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 2713 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 2714 model}, 2715 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2716 year = {2004}, 2717 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 2718 lab = {PPPL}, 2719 petsc_uses = {KSP} 2720} 2721 2722@Article{ tb1, 2723 author = {X.~Z.~Tang and A.~H.~Boozer}, 2724 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 2725 plasma}, 2726 journal = {Physics of Plasmas}, 2727 year = {2004}, 2728 pages = {171--185}, 2729 volume = {11}, 2730 lab = {LANL}, 2731 petsc_uses = {KSP} 2732} 2733 2734@Unpublished{ nlcw, 2735 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 2736 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 2737 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 2738 Albuquerque, New Mexico, October 2003}, 2739 year = {2003}, 2740 petsc_uses = {KSP} 2741} 2742 2743@TechReport{ tang2001, 2744 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 2745 Strauss}, 2746 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 2747 year = {2001}, 2748 institution = {Princeton Plasma Physics Laboratory}, 2749 number = {PPPL-3532}, 2750 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 2751 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 2752 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 2753 March 12-14, 2001.}, 2754 lab = {PPPL}, 2755 petsc_uses = {KSP} 2756} 2757 2758% LiteralHTML: 2759% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 2760% LiteralHTML: 2761@Article{ valerathomasgarciacastillo2019, 2762 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 2763 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 2764 Coastal Ocean Model}, 2765 journal = {Journal of Marine Science and Engineering}, 2766 volume = {7}, 2767 number = {6}, 2768 article-number= {185}, 2769 url = {https://www.mdpi.com/2077-1312/7/6/185}, 2770 issn = {2077-1312}, 2771 doi = {10.3390/jmse7060185}, 2772 year = {2019}, 2773 petsc_uses = {KSP} 2774} 2775 2776@Article{ furuichimat2015, 2777 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 2778 thermal convection simulation surrounded by free surface}, 2779 author = {Mikito Furuichi and Dave A May}, 2780 journal = {Computer Physics Communications}, 2781 volume = {192}, 2782 pages = {1--11}, 2783 year = {2015}, 2784 petsc_uses = {KSP} 2785} 2786 2787@Article{ sharplesmoresivelicjadamecmay2016, 2788 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 2789 model}, 2790 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 2791 Dave A May}, 2792 journal = {Physics of the Earth and Planetary Interiors}, 2793 volume = {252}, 2794 pages = {77--90}, 2795 year = {2016}, 2796 petsc_uses = {KSP} 2797} 2798 2799@Article{ spiegelmanmaywilson2016, 2800 title = {On the solvability of incompressible {S}tokes with viscoplastic rheologies in 2801 geodynamics}, 2802 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 2803 journal = {Geochemistry, Geophysics, Geosystems}, 2804 volume = {17}, 2805 number = {6}, 2806 pages = {2213--2238}, 2807 year = {2016}, 2808 petsc_uses = {KSP} 2809} 2810 2811@Article{ buiteretal2016, 2812 title = {Benchmarking numerical models of brittle thrust wedges}, 2813 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 2814 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 2815 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 2816 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 2817 journal = {Journal of structural geology}, 2818 volume = {92}, 2819 pages = {140--177}, 2820 year = {2016}, 2821 petsc_uses = {KSP} 2822} 2823 2824@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 2825 title = {Modular and flexible spectral-element waveform modelling in two and three 2826 dimensions}, 2827 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 2828 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 2829 journal = {Geophysical Journal International}, 2830 volume = {216}, 2831 number = {3}, 2832 pages = {1675--1692}, 2833 doi = {10.1093/gji/ggy469}, 2834 year = {2019}, 2835 petsc_uses = {KSP} 2836} 2837 2838@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 2839 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 2840 Modeling}, 2841 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 2842 Martin van Driel and Lion Krischer and Andreas Fichtner}, 2843 journal = {SIAM Journal on Scientific Computing}, 2844 volume = {43}, 2845 number = {2}, 2846 pages = {C127--C153}, 2847 eprint = {http://arxiv.org/abs/2004.08729}, 2848 doi = {10.1137/20M1332748}, 2849 year = {2021}, 2850 petsc_uses = {KSP} 2851} 2852 2853@Article{ parsani2021, 2854 title = {High-order accurate entropy-stable discontinuous collocated {G}alerkin methods with 2855 the summation-by-parts property for compressible {CFD} frameworks: Scalable {SSDC} 2856 algorithms and flow solver}, 2857 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 2858 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 2859 journal = {Journal of Computational Physics}, 2860 volume = {424}, 2861 pages = {109844}, 2862 issn = {0021-9991}, 2863 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 2864 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 2865 year = {2021}, 2866 petsc_uses = {KSP} 2867} 2868 2869@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 2870 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 2871 governed by {PDEs}}, 2872 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 2873 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 2874 journal = {SIAM Journal of Scientific Computing}, 2875 volume = {42}, 2876 number = {5}, 2877 pages = {A3397--A3426}, 2878 year = {2020} 2879} 2880 2881@Article{ zampinibouakaramturkiyyahkniokeyes2022, 2882 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 2883 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 2884 Keyes}, 2885 journal = {Advances on Computational Mathematics}, 2886 note = {In press}, 2887 year = {2022} 2888} 2889 2890@Article{ dassizampiniscacchi2022, 2891 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 2892 discretizations of elliptic equations in mixed form}, 2893 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 2894 journal = {Computer Methods in Applied Mechanics and Engineering}, 2895 volume = {391}, 2896 pages = {114620}, 2897 year = {2022} 2898} 2899 2900@Article{ youngoppenheimdimant2017, 2901 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 2902 title = {Hybrid simulations of coupled {F}arley-{B}uneman/gradient drift instabilities in the 2903 equatorial E region ionosphere}, 2904 journal = {Journal of Geophysical Research: Space Physics}, 2905 volume = {122}, 2906 number = {5}, 2907 issn = {2169-9402}, 2908 doi = {10.1002/2017JA024161}, 2909 pages = {5768--5781}, 2910 year = {2017}, 2911 petsc_uses = {KSP} 2912} 2913 2914@Article{ rioussetpatylillisfillingimenglandwithershale2013, 2915 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in {M}ars' 2916 dynamo region}, 2917 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 2918 and Scott L England and Paul G Withers and John P M Hale}, 2919 journal = {Journal of Geophysical Research: Space Physics}, 2920 volume = {118}, 2921 number = {6}, 2922 pages = {3647--3659}, 2923 year = {2013}, 2924 publisher = {Wiley Online Library}, 2925 petsc_uses = {KSP} 2926} 2927 2928@Article{ chien2016representation, 2929 title = {Representation of topography by partial steps using the immersed boundary method 2930 in a vector vorticity equation model (VVM)}, 2931 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 2932 journal = {Journal of Advances in Modeling Earth Systems}, 2933 year = {2016}, 2934 publisher = {Wiley Online Library}, 2935 petsc_uses = {KSP} 2936} 2937 2938@Article{ berger2015parallel, 2939 title = {Parallel preconditioners for monolithic solution of shear bands}, 2940 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 2941 journal = {Journal of Computational Physics}, 2942 year = {2015}, 2943 publisher = {Elsevier}, 2944 petsc_uses = {KSP} 2945} 2946 2947@Article{ may2015496, 2948 title = {A scalable, matrix-free multigrid preconditioner for finite element 2949 discretizations of heterogeneous {S}tokes flow }, 2950 journal = {Computer Methods in Applied Mechanics and Engineering }, 2951 volume = {290}, 2952 number = {0}, 2953 pages = {496--523}, 2954 year = {2015}, 2955 issn = {0045-7825}, 2956 doi = {10.1016/j.cma.2015.03.014}, 2957 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 2958 petsc_uses = {KSP} 2959} 2960 2961@Article{ isaacknepley2017, 2962 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 2963 author = {Tobin Isaac and Matthew G. Knepley}, 2964 journal = {ArXiv e-prints}, 2965 eprint = {1508.02470}, 2966 year = {2017}, 2967 note = {\url{http://arxiv.org/abs/1508.02470}}, 2968 petsc_uses = {DMPlex} 2969} 2970 2971@Article{ knepleylangegorman2017, 2972 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 2973 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 2974 journal = {ArXiv e-prints}, 2975 eprint = {1506.06194}, 2976 year = {2017}, 2977 note = {\url{http://arxiv.org/abs/1506.06194}}, 2978 petsc_uses = {DMPlex} 2979} 2980 2981@Article{ langemitchellknepleygorman2015, 2982 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2983 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2984 journal = {SIAM Journal on Scientific Computing}, 2985 volume = {38}, 2986 number = {5}, 2987 pages = {S143--S155}, 2988 eprint = {http://arxiv.org/abs/1506.07749}, 2989 doi = {10.1137/15M1026092}, 2990 year = {2016}, 2991 petsc_uses = {DMPlex} 2992} 2993 2994@InProceedings{ langeknepleygorman2015, 2995 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 2996 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 2997 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 2998 month = apr, 2999 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 3000 year = {2015}, 3001 petsc_uses = {DMPlex} 3002} 3003 3004@InProceedings{ wallworkknepleybarralpiggott2022, 3005 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 3006 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 3007 Piggott}, 3008 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 3009 editor = {Trevor Robinson}, 3010 month = jan, 3011 address = {Seattle, WA}, 3012 pages = {1--5}, 3013 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 3014 year = {2022}, 3015 petsc_uses = {DMPlex} 3016} 3017 3018@InProceedings{ timalsinaknepley2023, 3019 title = {Tetrahedralization of a Hexahedral Mesh}, 3020 author = {Aman Timalsina and Matthew G. Knepley}, 3021 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 3022 year = {2023}, 3023 petsc_uses = {DMPlex} 3024} 3025 3026@Article{ farrellknepleywechsungmitchell2020, 3027 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 3028 methods}, 3029 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 3030 Wechsung}, 3031 journal = {ACM Transaction on Mathematical Software}, 3032 eprint = {http://arxiv.org/abs/1912.08516}, 3033 volume = {47}, 3034 number = {3}, 3035 pages = {1--22}, 3036 issn = {0098-3500}, 3037 doi = {10.1145/3445791}, 3038 publisher = {Association for Computing Machinery}, 3039 issue_date = {September 2021}, 3040 year = {2021}, 3041 petsc_uses = {KSP,DMPlex} 3042} 3043 3044@Article{ laakmann2022augmented, 3045 title = {An augmented Lagrangian preconditioner for the magnetohydrodynamics equations at high Reynolds and coupling numbers}, 3046 author = {Fabian Laakmann and Patrick E Farrell and Lawrence Mitchell}, 3047 journal = {SIAM Journal on Scientific Computing}, 3048 volume = {44}, 3049 number = {4}, 3050 pages = {B1018--B1044}, 3051 year = {2022} 3052} 3053 3054@Article{ papadopoulosfarrellsurowiec2021, 3055 title = {Computing multiple solutions of topology optimization problems}, 3056 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E and Surowiec, Thomas M}, 3057 journal = {SIAM Journal on Scientific Computing}, 3058 volume = {43}, 3059 number = {3}, 3060 pages = {A1555--A1582}, 3061 year = {2021} 3062} 3063 3064@Article{ jiangzhanghuschneiderzorinpanozzo2021, 3065 title = {Bijective and coarse high-order tetrahedral meshes}, 3066 author = {Jiang, Zhongshi and Zhang, Ziyi and Hu, Yixin and Schneider, Teseo and Zorin, Denis and Panozzo, Daniele}, 3067 journal = {ACM Transactions on Graphics (TOG)}, 3068 volume = {40}, 3069 number = {4}, 3070 pages = {1--16}, 3071 year = {2021} 3072} 3073 3074@Article{ abumaclachlanfarrell2023, 3075 title = {Monolithic multigrid for implicit {Runge--Kutta} discretizations of incompressible fluid flow}, 3076 author = {Abu-Labdeh, Razan and MacLachlan, Scott and Farrell, Patrick E}, 3077 journal = {Journal of Computational Physics}, 3078 volume = {478}, 3079 pages = {111961}, 3080 year = {2023} 3081} 3082 3083@Article{ farrellkirbymarchena2021, 3084 title = {{Irksome}: Automating {Runge--Kutta} time-stepping for finite element methods}, 3085 author = {Farrell, Patrick E and Kirby, Robert C and Marchena-Menendez, Jorge}, 3086 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3087 volume = {47}, 3088 number = {4}, 3089 pages = {1--26}, 3090 year = {2021} 3091} 3092 3093@Article{ farrellgazca2020, 3094 title = {An augmented Lagrangian preconditioner for implicitly constituted non-Newtonian incompressible flow}, 3095 author = {Farrell, Patrick E and Gazca-Orozco, Pablo Alexei}, 3096 journal = {SIAM Journal on Scientific Computing}, 3097 volume = {42}, 3098 number = {6}, 3099 pages = {B1329--B1349}, 3100 year = {2020} 3101} 3102 3103@Article{ farrellmitchellscottwechsung2022, 3104 title = {Robust multigrid methods for nearly incompressible elasticity using macro elements}, 3105 author = {Farrell, Patrick E and Mitchell, Lawrence and Scott, L Ridgway and Wechsung, Florian}, 3106 journal = {IMA Journal of Numerical Analysis}, 3107 volume = {42}, 3108 number = {4}, 3109 pages = {3306--3329}, 3110 year = {2022} 3111} 3112 3113@Article{ shihstadlerwechsung2022, 3114 title = {Robust multigrid techniques for augmented Lagrangian preconditioning of incompressible Stokes equations with extreme viscosity variations}, 3115 author = {Shih, Yu-hsuan and Stadler, Georg and Wechsung, Florian}, 3116 journal = {SIAM Journal on Scientific Computing}, 3117 volume = {45}, 3118 number = {3}, 3119 pages = {S27--S53}, 3120 year = {2022} 3121} 3122 3123@Article{ adlerhehumaclachlanohm2022, 3124 title = {Monolithic multigrid for a reduced-quadrature discretization of poroelasticity}, 3125 author = {Adler, James H and He, Yunhui and Hu, Xiaozhe and MacLachlan, Scott and Ohm, Peter}, 3126 journal = {SIAM Journal on Scientific Computing}, 3127 volume = {45}, 3128 number = {3}, 3129 pages = {S54--S81}, 3130 year = {2022} 3131} 3132 3133@Article{ xiafarrellwechsung2021, 3134 title = {Augmented Lagrangian preconditioners for the Oseen--Frank model of nematic and cholesteric liquid crystals}, 3135 author = {Xia, Jingmin and Farrell, Patrick E and Wechsung, Florian}, 3136 journal = {BIT Numerical Mathematics}, 3137 volume = {61}, 3138 pages = {607--644}, 3139 year = {2021} 3140} 3141 3142@Article{ budisahukuchtamardalzikatanov2023, 3143 title = {Algebraic multigrid methods for metric-perturbed coupled problems}, 3144 author = {Budisa, Ana and Hu, Xiaozhe and Kuchta, Miroslav and Mardal, Kent-Andre and Zikatanov, Ludmil Tomov}, 3145 journal = {arXiv preprint arXiv:2305.06073}, 3146 year = {2023} 3147} 3148 3149@Article{ laakmannhufarrell2023, 3150 title = {Structure-preserving and helicity-conserving finite element approximations and preconditioning for the Hall MHD equations}, 3151 author = {Laakmann, Fabian and Hu, Kaibo and Farrell, Patrick E}, 3152 journal = {Journal of Computational Physics}, 3153 volume = {492}, 3154 pages = {112410}, 3155 year = {2023} 3156} 3157 3158@Article{ hongkrauskuchtalymberymardalrognes2022, 3159 title = {Robust approximation of generalized Biot-Brinkman problems}, 3160 author = {Hong, Qingguo and Kraus, Johannes and Kuchta, Miroslav and Lymbery, Maria and Mardal, Kent-Andr{\'e} and Rognes, Marie E}, 3161 journal = {Journal of Scientific Computing}, 3162 volume = {93}, 3163 number = {3}, 3164 pages = {77}, 3165 year = {2022} 3166} 3167 3168@Article{ boonkuchtamardalruiz2021, 3169 title = {Robust preconditioners for perturbed saddle-point problems and conservative discretizations of {Biot's} equations utilizing total pressure}, 3170 author = {Boon, Wietse M and Kuchta, Miroslav and Mardal, Kent-Andre and Ruiz-Baier, Ricardo}, 3171 journal = {SIAM Journal on Scientific Computing}, 3172 volume = {43}, 3173 number = {4}, 3174 pages = {B961--B983}, 3175 year = {2021} 3176} 3177 3178@Article{ papadopoulosfarrell2023, 3179 title = {Preconditioners for computing multiple solutions in three-dimensional fluid topology optimization}, 3180 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E}, 3181 journal = {SIAM Journal on Scientific Computing}, 3182 volume = {45}, 3183 number = {6}, 3184 pages = {B853--B883}, 3185 year = {2023} 3186} 3187 3188@Article{ farrellhamdanmaclachlan2022, 3189 title = {A new mixed finite-element method for H2 elliptic problems}, 3190 author = {Farrell, Patrick E and Hamdan, Abdalaziz and MacLachlan, Scott P}, 3191 journal = {Computers \& Mathematics with Applications}, 3192 volume = {128}, 3193 pages = {300--319}, 3194 year = {2022} 3195} 3196 3197@Article{ harpertuminaro2023, 3198 title = {Compression and Reduced Representation Techniques for Patch-Based Relaxation}, 3199 author = {Harper, Graham and Tuminaro, Ray}, 3200 journal = {arXiv preprint arXiv:2306.10025}, 3201 year = {2023} 3202} 3203 3204@Article{ kirbykernell2021, 3205 title = {Preconditioning mixed finite elements for tide models}, 3206 author = {Kirby, Robert C and Kernell, Tate}, 3207 journal = {Computers \& Mathematics with Applications}, 3208 volume = {82}, 3209 pages = {212--227}, 3210 year = {2021} 3211} 3212 3213@Book{ xia2023, 3214 title = {Computing and Analysing Energy Minimisation Problems in Liquid Crystals: Implementation Using Firedrake}, 3215 author = {Xia, Jingmin}, 3216 year = {2023}, 3217 publisher = {World Scientific} 3218} 3219 3220@PhDThesis{ leveque2022, 3221 title = {Preconditioned iterative methods for optimal control problems with time-dependent PDEs as constraints}, 3222 author = {Leveque, Santolo}, 3223 school = {The University of Edinburgh}, 3224 year = {2022} 3225} 3226 3227@PhDThesis{ brubeck2022, 3228 title = {Optimal-complexity and robust multigrid methods for high-order FEM}, 3229 author = {Pablo D. Brubeck}, 3230 school = {Oxford University}, 3231 year = {2022} 3232} 3233 3234@Misc{ firedrakeproject, 3235 title = {{The {F}iredrake project}}, 3236 author = {David A Ham and Firedrake Team}, 3237 url = {http://firedrakeproject.org}, 3238 year = {2022}, 3239 petsc_uses = {KSP} 3240} 3241 3242@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 3243 title = {Firedrake: automating the finite element method by composing abstractions}, 3244 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 3245 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 3246 and Paul HJ Kelly}, 3247 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3248 volume = {43}, 3249 number = {3}, 3250 pages = {24}, 3251 year = {2016}, 3252 petsc_uses = {KSP} 3253} 3254 3255@Article{ mitchellmuller2016, 3256 title = {High level implementation of geometric multigrid solvers for finite element 3257 problems: Applications in atmospheric modelling}, 3258 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 3259 journal = {Journal of Computational Physics}, 3260 volume = {327}, 3261 pages = {1--18}, 3262 year = {2016}, 3263 petsc_uses = {KSP} 3264} 3265 3266@Article{ mcraeberceamitchellhamcotter2016, 3267 title = {Automated generation and symbolic manipulation of tensor product finite 3268 elements}, 3269 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 3270 and Colin J Cotter}, 3271 journal = {SIAM Journal on Scientific Computing}, 3272 volume = {38}, 3273 number = {5}, 3274 pages = {S25--S47}, 3275 year = {2016}, 3276 petsc_uses = {KSP} 3277} 3278 3279@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 3280 title = {A structure-exploiting numbering algorithm for finite elements on extruded 3281 meshes, and its performance evaluation in {Firedrake}}, 3282 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 3283 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 3284 journal = {Geoscientific Model Development}, 3285 volume = {9}, 3286 number = {10}, 3287 pages = {3803--3815}, 3288 doi = {10.5194/gmd-9-3803-2016}, 3289 year = {2016}, 3290 petsc_uses = {KSP} 3291} 3292 3293@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 3294 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 3295 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 3296 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 3297 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 3298 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 3299 publisher = {Springer Berlin Heidelberg}, 3300 pages = {279--289}, 3301 isbn = {978-3-642-38750-0}, 3302 doi = {10.1007/978-3-642-38750-0_21}, 3303 year = {2013}, 3304 petsc_uses = {KSP} 3305} 3306 3307@Article{ kirbymitchell2017, 3308 title = {Solver composition across the {PDE}/linear algebra barrier}, 3309 author = {Robert C Kirby and Lawrence Mitchell}, 3310 journal = {arXiv preprint arXiv:1706.01346}, 3311 year = {2017}, 3312 petsc_uses = {KSP} 3313} 3314 3315@Article{ saibaba2012application, 3316 title = {Application of hierarchical matrices to linear inverse problems in 3317 geostatistics}, 3318 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 3319 Peter K and Darve, Eric F}, 3320 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 3321 volume = {67}, 3322 number = {5}, 3323 pages = {857}, 3324 year = {2012}, 3325 petsc_uses = {KSP} 3326} 3327 3328@Article{ collignonkausmayfernandez14, 3329 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 3330 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 3331 journal = {Geochem Geophy Geosy}, 3332 year = {2014}, 3333 petsc_uses = {KSP} 3334} 3335 3336@Article{ fernandezkaus14, 3337 author = {Fern\'andez, N. and Kaus, B.}, 3338 title = {Fold interaction and wavelength selection in {3D} models of multilayer detachment 3339 folding}, 3340 journal = {Tectonophysics}, 3341 year = {2014}, 3342 petsc_uses = {KSP} 3343} 3344 3345@Article{ baumannkauspopov14, 3346 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 3347 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 3348 journal = {Tectonophysics}, 3349 year = {2014}, 3350 petsc_uses = {KSP} 3351} 3352 3353@Article{ lechmannschmalholzhetenyimaykaus14, 3354 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 3355 J. P.}, 3356 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 3357 of the modern {India-Asia} collisional system with {3-D} numerical models}, 3358 journal = { Journal of Geophysical Research - Solid Earth}, 3359 year = {2014}, 3360 petsc_uses = {KSP} 3361} 3362 3363@InBook{ fernandezkaus14b, 3364 author = {Fern\'andez N. and Kaus B.J.P.}, 3365 title = {Analytical and numerical investigation of {3D} multilayer detachment}, 3366 booktitle = {Mathematics of Planet Earth}, 3367 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 3368 and Dur\'an J.J. and Vargas-Guzman J.A.}, 3369 publisher = {Springer}, 3370 year = {2014}, 3371 petsc_uses = {KSP} 3372} 3373 3374@Article{ hossein-hsueh-etal-2014a, 3375 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 3376 journal = {J. Mech. Phys. Solids}, 3377 pages = {320--348}, 3378 title = {Effective toughness of heterogeneous media}, 3379 volume = {71}, 3380 year = {2014}, 3381 petsc_uses = {KSP} 3382} 3383 3384@Unpublished{ leon-baldelli-bourdin-2014a, 3385 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 3386 month = aug, 3387 note = {Submitted.}, 3388 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 3389 year = {2014}, 3390 petsc_uses = {KSP} 3391} 3392 3393@Article{ leon-baldelli-babadjian-etal-2013a, 3394 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 3395 Maurini, C.}, 3396 journal = {J. Mech. Phys. Solids}, 3397 pages = {15-32}, 3398 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 3399 volume = {70}, 3400 year = {2014}, 3401 petsc_uses = {KSP} 3402} 3403 3404@Article{ mesgarnejad-bourdin-etal-2014a, 3405 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 3406 journal = {Comp. Methods Appl. Mech. Engng.}, 3407 title = {Validation simulations for the variational approach to fracture}, 3408 volume = {Submitted}, 3409 year = {2014}, 3410 petsc_uses = {KSP} 3411} 3412 3413@InProceedings{ bourdin-chukwudozie-etal-2013a, 3414 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3415 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 3416 University, Stanford, CA}, 3417 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 3418 Fracturing Under In-Situ Stresses}, 3419 year = {2013}, 3420 petsc_uses = {KSP} 3421} 3422 3423@Article{ maurini-bourdin-etal-2012a, 3424 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 3425 journal = {Int. J. Fracture}, 3426 number = {1-2}, 3427 pages = {75-91}, 3428 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 3429 capillary tube: experiments and numerical simulations using a two-dimensional 3430 variational approach}, 3431 volume = {184}, 3432 year = {2013}, 3433 petsc_uses = {KSP} 3434} 3435 3436@Article{ mesgarnejad-bourdin-etal-2013a, 3437 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 3438 journal = {J. Mech. Phys Solids}, 3439 number = {11}, 3440 pages = {2360--2379}, 3441 title = {A variational approach to the fracture of brittle thin films under out of plane 3442 loading}, 3443 volume = {61}, 3444 year = {2013}, 3445 petsc_uses = {KSP} 3446} 3447 3448@InProceedings{ bourdin-chukwudozie-etal-2012a, 3449 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3450 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 3451 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 3452 volume = {SPE 159154}, 3453 year = {2012}, 3454 petsc_uses = {KSP} 3455} 3456 3457@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 3458 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 3459 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 3460 Langtangen}, 3461 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 3462 journal = {Advances in Water Resources}, 3463 volume = {51}, 3464 number = {0}, 3465 pages = {405--437}, 3466 year = {2013}, 3467 note = {35th Year Anniversary Issue}, 3468 issn = {0309-1708}, 3469 doi = {10.1016/j.advwatres.2012.05.008}, 3470 petsc_uses = {KSP} 3471} 3472 3473@Article{ scheltingamyerspietrzak10, 3474 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 3475 title = {A finite element sea ice model of the {C}anadian Arctic Archipelago}, 3476 journal = {Ocean Dynamics}, 3477 volume = {60}, 3478 number = {6}, 3479 pages = {1539-1558}, 3480 year = {2010}, 3481 issn = {1616-7341}, 3482 doi = {10.1007/s10236-010-0356-5}, 3483 publisher = {Springer-Verlag}, 3484 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 3485 Archipelago; Freshwater flux}, 3486 language = {English}, 3487 petsc_uses = {KSP} 3488} 3489 3490@InBook{ destefanoandreasisecchi13, 3491 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 3492 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 3493 inversions}, 3494 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 3495 chapter = {626}, 3496 pages = {3226--3230}, 3497 doi = {10.1190/segam2013-0244.1}, 3498 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 3499 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 3500 petsc_uses = {KSP} 3501} 3502 3503@Article{ pourhiethuetmaylabroussejolivet12, 3504 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 3505 title = {Kinematic interpretation of the {3D} shapes of metamorphic core complexes}, 3506 journal = {Geochem. Geophys. Geosyst.}, 3507 volume = {13}, 3508 pages = {Q09002}, 3509 year = {2012}, 3510 doi = {10.1029/2012GC004271}, 3511 petsc_uses = {KSP} 3512} 3513 3514@Article{ lechmannmaykausschmalholz11, 3515 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 3516 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 3517 collision}, 3518 journal = {Geophysical Journal International}, 3519 volume = {187}, 3520 pages = {10--33}, 3521 year = {2011}, 3522 doi = {10.1111/j.1365-246X.2011.05164.x}, 3523 petsc_uses = {KSP} 3524} 3525 3526@Article{ stefano:r69, 3527 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 3528 Virgilio and Fred F. Snyder}, 3529 collaboration = {}, 3530 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 3531 application to subsalt imaging}, 3532 publisher = {SEG}, 3533 year = {2011}, 3534 journal = {Geophysics}, 3535 volume = {76}, 3536 number = {3}, 3537 pages = {R69-R80}, 3538 keywords = {geophysical image processing; inverse problems; seismology}, 3539 doi = {10.1190/1.3554652}, 3540 petsc_uses = {KSP} 3541} 3542 3543@Article{ stefano:806, 3544 author = {Michele De Stefano}, 3545 collaboration = {}, 3546 title = {Simultaneous joint inversion for susceptibility and velocity}, 3547 publisher = {SEG}, 3548 year = {2011}, 3549 journal = {SEG Technical Program Expanded Abstracts}, 3550 volume = {30}, 3551 number = {1}, 3552 pages = {806-810}, 3553 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 3554 doi = {10.1190/1.3628198}, 3555 petsc_uses = {KSP} 3556} 3557 3558@Article{ mayknepley2011, 3559 author = {Dave A. May and Matthew G. Knepley}, 3560 title = {Optimal, scalable forward models for computing gravity anomalies}, 3561 journal = {Geophysical Journal International}, 3562 volume = {187}, 3563 number = {1}, 3564 pages = {161--177}, 3565 url = {http://arxiv.org/abs/1107.5951}, 3566 note = {\url{http://arxiv.org/abs/1107.5951}}, 3567 year = {2011}, 3568 petsc_uses = {KSP} 3569} 3570 3571@InProceedings{ bourdinknepleymaurini2010, 3572 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3573 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 3574 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 3575 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 3576 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 3577 address = {Stanford, CA}, 3578 year = {2010}, 3579 petsc_uses = {KSP} 3580} 3581 3582@InProceedings{ bourdinknepleymaurini2010b, 3583 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3584 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 3585 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 3586 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 3587 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 3588 address = {Sacramento, CA}, 3589 year = {2010}, 3590 petsc_uses = {KSP} 3591} 3592 3593@Article{ chen2007full, 3594 title = {Full {3D} tomography for the crustal structure of the {Los Angeles} region}, 3595 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 3596 journal = {Bulletin of the Seismological Society of America}, 3597 volume = {97}, 3598 number = {4}, 3599 pages = {1094}, 3600 year = {2007}, 3601 publisher = {Seismol Soc America}, 3602 petsc_uses = {KSP} 3603} 3604 3605@Article{ brown2010ens, 3606 author = {Brown, Jed}, 3607 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 3608 Zürich, Switzerland}, 3609 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 3610 journal = {Journal of Scientific Computing}, 3611 publisher = {Springer Netherlands}, 3612 issn = {0885-7474}, 3613 keyword = {Mathematics and Statistics}, 3614 pages = {48-63}, 3615 volume = {45}, 3616 issue = {1}, 3617 doi = {10.1007/s10915-010-9396-8}, 3618 year = {2010}, 3619 petsc_uses = {KSP} 3620} 3621 3622@PhDThesis{ brown2011, 3623 title = {Computational methods for ice flow simulation}, 3624 author = {Jed Brown}, 3625 school = {ETH Z{\"u}rich}, 3626 year = {2011}, 3627 petsc_uses = {KSP} 3628} 3629 3630@Article{ brown2013tmeice, 3631 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 3632 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 3633 journal = {SIAM Journal on Scientific Computing}, 3634 volume = {35}, 3635 number = {2}, 3636 year = {2013}, 3637 pages = {359--375}, 3638 doi = {10.1137/110834512}, 3639 note = {Also preprint ANL/MCS-P743-1298}, 3640 petsc_uses = {KSP} 3641} 3642 3643@InProceedings{ brown2013quasinewton, 3644 author = {Jed Brown and Peter Brune}, 3645 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 3646 methods}, 3647 year = {2013}, 3648 booktitle = {International Conference on Mathematics and Computational Methods Applied to 3649 Nuclear Science and Engineering}, 3650 pages = {2554--2565}, 3651 petsc_uses = {KSP} 3652} 3653 3654@Misc{ spiegelman-siampp10, 3655 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 3656 Earth Geodynamics}, 3657 author = {Marc Spiegelman}, 3658 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 3659 Computing}, 3660 year = {2010}, 3661 petsc_uses = {KSP} 3662} 3663 3664@Article{ schauer2011a, 3665 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 3666 Quintana-Ort\'{\i}}, 3667 title = {Large scale simulation of wave propagation in soils interacting with structures 3668 using {FEM} and {SBFEM}}, 3669 journal = {Journal of Computational Acoustics}, 3670 volume = {19}, 3671 number = {1}, 3672 pages = {75--93}, 3673 year = {2011}, 3674 doi = {10.1142/S0218396X11004316}, 3675 petsc_uses = {KSP} 3676} 3677 3678@Misc{ bsa2010, 3679 author = {J. Brown and B. Smith and A. Ahmadia}, 3680 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 3681 note = {submitted to SIAM Journal on Scientific Computing}, 3682 year = {2012}, 3683 petsc_uses = {KSP} 3684} 3685 3686@Article{ kellerkatz2016, 3687 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 3688 author = {Tobias Keller and Richard F. Katz}, 3689 journal = {Journal of Petrology}, 3690 doi = {10.1093/petrology/egw030}, 3691 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 3692 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 3693 year = {2016}, 3694 petsc_uses = {KSP} 3695} 3696 3697@Article{ weatherley12, 3698 author = {S. Weatherley and R.F. Katz}, 3699 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 3700 mantle}, 3701 journal = {Geochem.\ Geophys.\ Geosys.}, 3702 year = {2012}, 3703 volume = {13}, 3704 number = {1}, 3705 pages = {Q0AC18}, 3706 doi = {10.1029/2011GC003989}, 3707 petsc_uses = {KSP} 3708} 3709 3710@Article{ katz12, 3711 author = {R.F. Katz and S. Weatherley}, 3712 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 3713 journal = {Earth\ Planet.\ Sci.\ Lett.}, 3714 year = {2012}, 3715 doi = {10.1016/j.epsl.2012.04.042}, 3716 volume = {335-336}, 3717 pages = {226-237}, 3718 petsc_uses = {KSP} 3719} 3720 3721@Article{ katz10b, 3722 author = {R.F. Katz}, 3723 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 3724 journal = {Geochem.\ Geophys.\ Geosys.}, 3725 volume = {10}, 3726 number = {Q0AC07}, 3727 year = {2010}, 3728 doi = {10.1029/2010GC003282}, 3729 petsc_uses = {KSP} 3730} 3731 3732@Article{ england10, 3733 author = {P.C. England and R.F. Katz}, 3734 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 3735 journal = {Nature}, 3736 year = {2010}, 3737 volume = {467}, 3738 pages = {700--703}, 3739 doi = {10.1038/nature09417}, 3740 petsc_uses = {KSP} 3741} 3742 3743@Article{ weatherley10, 3744 author = {S. Weatherley and R.F. Katz}, 3745 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 3746 journal = {Geochem.\ Geophys.\ Geosys.}, 3747 year = {2010}, 3748 volume = {11}, 3749 number = {10}, 3750 doi = {10.1029/2010GC003192}, 3751 petsc_uses = {KSP} 3752} 3753 3754@Article{ katz10, 3755 author = {R.F. Katz and M.G. Worster}, 3756 title = {The stability of ice-sheet grounding lines}, 3757 journal = {Proc.~Roy.~Soc.~A}, 3758 year = {2010}, 3759 volume = {466}, 3760 pages = {1597--1620}, 3761 doi = {10.1098/rspa.2009.0434}, 3762 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 3763 petsc_uses = {KSP} 3764} 3765 3766@Article{ kyrkesmith2013stress, 3767 title = {Stress balances of ice streams in a vertically integrated, higher-order 3768 formulation}, 3769 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 3770 journal = {Journal of Glaciology}, 3771 volume = {59}, 3772 number = {215}, 3773 pages = {449--466}, 3774 year = {2013}, 3775 doi = {10.3189/2013JoG12J140}, 3776 petsc_uses = {KSP} 3777} 3778 3779@Article{ takei2013anisotropy1, 3780 author = {Takei Y. and R.F. Katz}, 3781 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 3782 Governing equations and linearised analysis}}, 3783 journal = {J.\ Fluid\ Mech.}, 3784 year = {2013}, 3785 volume = {734}, 3786 pages = {424-455}, 3787 doi = {10.1017/jfm.2013.482}, 3788 petsc_uses = {KSP} 3789} 3790 3791@Article{ katz2013anisotropy2, 3792 author = {Katz R.F. and Y. Takei}, 3793 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 3794 Numerical solutions of the full equations}}, 3795 journal = {J.\ Fluid\ Mech.}, 3796 year = {2013}, 3797 volume = {734}, 3798 pages = {456-485}, 3799 doi = {10.1017/jfm.2013.483}, 3800 petsc_uses = {KSP} 3801} 3802 3803@Article{ kyrke-smith2014subglacial, 3804 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 3805 title = {Subglacial hydrology and the formation of ice streams}, 3806 journal = {Proc.\ Roy.\ Soc.\ A}, 3807 year = {2014}, 3808 volume = {470}, 3809 number = {2161}, 3810 doi = {10.1098/rspa.2013.0494}, 3811 petsc_uses = {KSP} 3812} 3813 3814@Article{ spiegelmanwilsonvankeken2013, 3815 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 3816 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 3817 multi-physics problems in the solid Earth sciences}}, 3818 journal = {AGU Fall Meeting Abstracts}, 3819 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 3820 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 3821 year = {2013}, 3822 month = dec, 3823 pages = {A2208}, 3824 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 3825 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 3826 petsc_uses = {KSP} 3827} 3828 3829@Article{ bueler2009shallow, 3830 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 3831 ice sheet model}}, 3832 author = {Ed Bueler and Jed Brown}, 3833 journal = {Journal of Geophysical Research-Earth Surface}, 3834 volume = {114}, 3835 number = {F3}, 3836 pages = {F03008}, 3837 year = {2009}, 3838 publisher = {American Geophysical Union}, 3839 petsc_uses = {KSP} 3840} 3841 3842@Article{ bueler2007est, 3843 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 3844 effective tools for verification}}, 3845 author = {Ed Bueler and Jed Brown and Craig Lingle}, 3846 journal = {J. Glaciol}, 3847 volume = {53}, 3848 pages = {499--516}, 3849 year = {2007}, 3850 petsc_uses = {KSP} 3851} 3852 3853@Article{ bueler2007fcv, 3854 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 3855 simulations}}, 3856 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 3857 journal = {Ann. Glaciol}, 3858 volume = {46}, 3859 pages = {97--105}, 3860 year = {2007}, 3861 petsc_uses = {KSP} 3862} 3863 3864@Article{ bueler2005iso, 3865 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 3866 Latrice N. Bowman}, 3867 title = {Exact solutions and numerical verification for isothermal ice sheets}, 3868 journal = {J. Glaciol.}, 3869 volume = {51}, 3870 number = {173}, 3871 pages = {291--306}, 3872 year = {2005}, 3873 petsc_uses = {KSP} 3874} 3875 3876@Article{ chao2008programming, 3877 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 3878 author = {Chao-fan, Z. and Yao-lin, S.}, 3879 journal = {Earthquake}, 3880 year = {2008}, 3881 petsc_uses = {KSP} 3882} 3883 3884@Article{ marti2014, 3885 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 3886 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 3887 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 3888 title = {Full sphere hydrodynamic and dynamo benchmarks}, 3889 journal = {Geophysical Journal International}, 3890 year = {2014}, 3891 doi = {10.1093/gji/ggt518}, 3892 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 3893 petsc_uses = {KSP} 3894} 3895 3896@InProceedings{ ganfulukyangxueyang2013, 3897 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 3898 Guangwen}, 3899 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 3900 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 3901 Field-Programmable Custom Computing Machines}, 3902 series = {FCCM '13}, 3903 pages = {230--}, 3904 year = {2013}, 3905 isbn = {978-0-7695-4969-9}, 3906 doi = {10.1109/FCCM.2013.26}, 3907 acmid = {2495688}, 3908 publisher = {IEEE Computer Society}, 3909 petsc_uses = {KSP} 3910} 3911 3912@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 3913 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 3914 Xiaomeng Huang and Guangwen Yang}, 3915 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 3916 Conference on}, 3917 title = {A highly-efficient and green data flow engine for solving {E}uler atmospheric 3918 equations}, 3919 year = {2014}, 3920 month = sep, 3921 pages = {1-6}, 3922 doi = {10.1109/FPL.2014.6927462}, 3923 petsc_uses = {KSP} 3924} 3925 3926%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 3927%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 3928%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 3929@Article{ aagaardknepleywilliams13, 3930 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 3931 Models of Quasi-static and Dynamic Crustal Deformation}, 3932 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 3933 journal = {Journal of Geophysical Research: Solid Earth}, 3934 volume = {118}, 3935 number = {6}, 3936 pages = {3059--3079}, 3937 issn = {2169-9356}, 3938 doi = {10.1002/jgrb.50217}, 3939 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 3940 year = {2013}, 3941 petsc_uses = {KSP} 3942} 3943 3944@InProceedings{ aagaardknepleywilliams11, 3945 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3946 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3947 Deformation}, 3948 booktitle = {Eos Transactions of the AGU}, 3949 organization = {American Geophysical Union}, 3950 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 3951 year = {2011}, 3952 petsc_uses = {KSP} 3953} 3954 3955@InProceedings{ knepley10b, 3956 author = {Matthew G. {Knepley}}, 3957 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 3958 booktitle = {Eos Transactions of the AGU}, 3959 organization = {American Geophysical Union}, 3960 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 3961 year = {2010}, 3962 petsc_uses = {KSP} 3963} 3964 3965@InProceedings{ mayknepleygurnis09, 3966 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 3967 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 3968 booktitle = {Eos Transactions of the AGU}, 3969 organization = {American Geophysical Union}, 3970 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 3971 year = {2009}, 3972 petsc_uses = {KSP} 3973} 3974 3975@InProceedings{ yuenknepleyerlebacherwright09, 3976 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 3977 title = {The Coming Role of {GPU} in Computational Geodynamics}, 3978 booktitle = {Eos Transactions of the AGU}, 3979 organization = {American Geophysical Union}, 3980 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 3981 year = {2009}, 3982 petsc_uses = {KSP} 3983} 3984 3985@InProceedings{ aagaardknepleywilliams08, 3986 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 3987 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3988 Deformation}, 3989 booktitle = {Eos Transactions of the AGU}, 3990 organization = {American Geophysical Union}, 3991 volume = {89}, 3992 number = {53}, 3993 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 3994 year = {2007}, 3995 petsc_uses = {KSP} 3996} 3997 3998@InProceedings{ aagaardknepleywilliams07, 3999 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 4000 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 4001 Deformation}, 4002 booktitle = {Eos Transactions of the AGU}, 4003 organization = {American Geophysical Union}, 4004 volume = {88}, 4005 number = {52}, 4006 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 4007 year = {2007}, 4008 petsc_uses = {KSP} 4009} 4010 4011@InProceedings{ aagaardknepleywilliams05, 4012 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 4013 title = {Development of software for studying earthquakes across multiple spatial and 4014 temporal scales by coupling quasi-static and dynamic simulations}, 4015 booktitle = {Eos Transactions of the AGU}, 4016 organization = {American Geophysical Union}, 4017 volume = {86}, 4018 number = {52}, 4019 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 4020 year = {2005}, 4021 petsc_uses = {KSP} 4022} 4023 4024@InProceedings{ williamsgablehagermeadeaagaardknepley08, 4025 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 4026 Brad Aagaard and Matthew G. Knepley}, 4027 title = {Modeling of Multiple Earthquake Cycles in {S}outhern {C}alifornia Using the {SCEC} 4028 Community Fault Model}, 4029 booktitle = {Proceedings of Geosciences '08}, 4030 address = {Wellington, NZ}, 4031 month = nov, 4032 year = {2008}, 4033 petsc_uses = {KSP} 4034} 4035 4036@TechReport{ zhang07, 4037 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 4038 Tsunamis}, 4039 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 4040 type = {Preprint}, 4041 number = {ANL/MCS-P1459-0907}, 4042 institution = {ANL}, 4043 month = sep, 4044 year = {2007}, 4045 petsc_uses = {KSP} 4046} 4047 4048@Article{ katz08b, 4049 author = {Richard F. Katz}, 4050 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 4051 focusing at mid-ocean ridges}, 4052 journal = {J. Petrology}, 4053 year = {2008}, 4054 volume = {49}, 4055 pages = {2099--2121}, 4056 doi = {10.1093/petrology/egn058}, 4057 petsc_uses = {KSP} 4058} 4059 4060@Article{ hgrhkjvv2008, 4061 title = {On preconditioning for a parallel solution of the {R}ichards equation}, 4062 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 4063 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 4064 journal = {Computers and Geosciences}, 4065 volume = {34}, 4066 pages = {1958--1963}, 4067 year = {2008}, 4068 petsc_uses = {KSP} 4069} 4070 4071@Article{ maymoresi2008, 4072 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 4073 computational geodynamics}, 4074 journal = {Physics of the Earth and Planetary Interiors}, 4075 volume = {171}, 4076 number = {1-4}, 4077 pages = {33--47}, 4078 year = {2008}, 4079 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 4080 Applications}, 4081 issn = {0031-9201}, 4082 doi = {10.1016/j.pepi.2008.07.036}, 4083 author = {Dave A. May and Louis Moresi}, 4084 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 4085 petsc_uses = {KSP} 4086} 4087 4088@Article{ kausmuhlhausmay2010, 4089 title = {A stabilization algorithm for geodynamic numerical simulations with a free 4090 surface}, 4091 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 4092 journal = {Physics of the Earth and Planetary Interiors}, 4093 volume = {181}, 4094 number = {1}, 4095 pages = {12--20}, 4096 year = {2010}, 4097 petsc_uses = {KSP} 4098} 4099 4100@Article{ duretzmaygeryatackley2011, 4101 title = {Discretization errors and free surface stabilization in the finite difference and 4102 marker-in-cell method for applied geodynamics: A numerical study}, 4103 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 4104 journal = {Geochemistry, Geophysics, Geosystems}, 4105 volume = {12}, 4106 number = {7}, 4107 year = {2011}, 4108 petsc_uses = {KSP} 4109} 4110 4111@Article{ furuichimaytackley2011, 4112 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 4113 {Schur} complement approach with mixed precision arithmetic}, 4114 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 4115 journal = {Journal of Computational Physics}, 4116 volume = {230}, 4117 number = {24}, 4118 pages = {8835--8851}, 4119 year = {2011}, 4120 petsc_uses = {KSP} 4121} 4122 4123@Article{ kellermaykaus2013, 4124 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 4125 lithosphere and crust}, 4126 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 4127 journal = {Geophysical Journal International}, 4128 volume = {195}, 4129 number = {3}, 4130 pages = {1406--1442}, 4131 year = {2013}, 4132 petsc_uses = {KSP} 4133} 4134 4135@Article{ schellartfreemanstegmanmoresimay2007, 4136 title = {Evolution and diversity of subduction zones controlled by slab width}, 4137 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 4138 May}, 4139 journal = {Nature}, 4140 volume = {446}, 4141 number = {7133}, 4142 pages = {308--311}, 4143 year = {2007}, 4144 petsc_uses = {KSP} 4145} 4146 4147@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 4148 title = {A comparison of numerical surface topography calculations in geodynamic 4149 modelling: an evaluation of the sticky air method}, 4150 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 4151 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 4152 journal = {Geophysical Journal International}, 4153 volume = {189}, 4154 number = {1}, 4155 pages = {38--54}, 4156 year = {2012}, 4157 petsc_uses = {KSP} 4158} 4159 4160@Article{ stegmanfreemanschellartmoresimay2006, 4161 title = {Influence of trench width on subduction hinge retreat rates in {3-D} models of slab 4162 rollback}, 4163 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 4164 May}, 4165 journal = {Geochemistry, Geophysics, Geosystems}, 4166 volume = {7}, 4167 number = {3}, 4168 year = {2006}, 4169 petsc_uses = {KSP} 4170} 4171 4172@InProceedings{ may2014ptatin, 4173 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 4174 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 4175 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 4176 Computing, Networking, Storage and Analysis}}, 4177 organization = {ACM}, 4178 pages = {274--284}, 4179 year = {2014}, 4180 doi = {10.1109/SC.2014.28}, 4181 petsc_uses = {KSP} 4182} 4183 4184@Article{ maybrownpourhiet2015, 4185 title = {A scalable, matrix-free multigrid preconditioner for finite element 4186 discretizations of heterogeneous {Stokes} flow}, 4187 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 4188 journal = {Computer Methods in Applied Mechanics and Engineering}, 4189 volume = {290}, 4190 pages = {496--523}, 4191 year = {2015}, 4192 doi = {10.1016/j.cma.2015.03.014}, 4193 petsc_uses = {KSP} 4194} 4195 4196@Article{ duretzmayyamato2016, 4197 title = {A free surface capturing discretization for the staggered grid finite difference 4198 scheme}, 4199 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 4200 journal = {Geophysical Journal International}, 4201 volume = {204}, 4202 number = {3}, 4203 pages = {1518--1530}, 4204 year = {2016}, 4205 petsc_uses = {KSP} 4206} 4207 4208@Article{ rhebergenwellskatzwathen2014, 4209 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 4210 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 4211 journal = {SIAM J. Sci. Comput.}, 4212 volume = {36}, 4213 pages = {A1960--A1977}, 4214 year = {2014}, 4215 petsc_uses = {KSP} 4216} 4217 4218@Article{ katz08a, 4219 author = {R.F. Katz and M.G. Worster}, 4220 title = {Simulation of directional solidification, thermochemical convection, and chimney 4221 formation in a {H}ele-{S}haw cell}, 4222 journal = {J. Comp. Phys.}, 4223 volume = {227}, 4224 pages = {9823-9840}, 4225 year = {2008}, 4226 doi = {10.1016/j.jcp.2008.06.039}, 4227 petsc_uses = {KSP} 4228} 4229 4230@Article{ aabg2007, 4231 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 4232 title = {Full waveform inversion for seismic velocity and anelastic losses in 4233 heterogeneous structures}, 4234 journal = {Bulletin of Seismological Society of America}, 4235 year = {2007}, 4236 volume = {97}, 4237 pages = {1990--2008}, 4238 petsc_uses = {KSP} 4239} 4240 4241@Article{ katz2006, 4242 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 4243 title = {The dynamics of melt and shear localization in partially molten aggregates}, 4244 journal = {Nature}, 4245 year = {2006}, 4246 volume = {442}, 4247 pages = {676--679}, 4248 month = aug, 4249 day = {10}, 4250 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 4251 petsc_uses = {KSP} 4252} 4253 4254@InProceedings{ mqrs2003, 4255 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 4256 year = {2003}, 4257 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 4258 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 4259 Sozopol, Bulgaria, June 4-8, 2003}, 4260 petsc_uses = {KSP} 4261} 4262 4263@InProceedings{ lichtner1, 4264 author = {Chuan Lu and Peter C. Lichtner}, 4265 year = {2005}, 4266 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 4267 Geologic Media}, 4268 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 4269 lab = {LANL}, 4270 petsc_uses = {KSP} 4271} 4272 4273@Article{ hammondlichtnermills2014, 4274 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 4275 Example with {PFLOTRAN}}, 4276 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 4277 journal = {Water Resources Research}, 4278 volume = {50}, 4279 number = {1}, 4280 pages = {208--228}, 4281 doi = {10.1002/2012WR013483}, 4282 year = {2014}, 4283 petsc_uses = {KSP} 4284} 4285 4286@Article{ smw2003, 4287 author = {R. Scheichl and R. Masson and J. Wendebourg}, 4288 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 4289 journal = {Computational Geosciences}, 4290 year = {2003}, 4291 volume = {7}, 4292 pages = {295--318}, 4293 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 4294 petsc_uses = {KSP} 4295} 4296 4297@Article{ kees-miller-03, 4298 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 4299 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 4300 journal = {Computational Geosciences}, 4301 year = {2003}, 4302 volume = {7}, 4303 pages = {91--114}, 4304 petsc_uses = {KSP} 4305} 4306 4307@Article{ bk2003, 4308 author = {JN Buur and T Kuehnel}, 4309 title = {Improving depth imaging by automated model updating}, 4310 journal = {The Leading Edge}, 4311 year = {2003}, 4312 volume = {22}, 4313 pages = {310-318}, 4314 petsc_uses = {KSP} 4315} 4316 4317@Article{ frederickbuffett2016, 4318 title = {Submarine groundwater discharge as a possible formation mechanism for 4319 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 4320 author = {Jennifer M. Frederick and Bruce A. Buffett}, 4321 journal = {Journal of Geophysical Research: Solid Earth}, 4322 volume = {121}, 4323 number = {3}, 4324 pages = {1383--1404}, 4325 issn = {2169-9356}, 4326 doi = {10.1002/2015JB012627}, 4327 year = {2016}, 4328 petsc_uses = {KSP} 4329} 4330 4331% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4332% LiteralHTML:<font color="#FF0000"> 4333% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 4334% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 4335% LiteralHTML:variety of these simulations.</p> 4336% LiteralHTML:</font> 4337% LiteralHTML: 4338@InProceedings{ appelbe1, 4339 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4340 year = {2003}, 4341 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 4342 computational methodology}, 4343 page = {781}, 4344 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 4345 Proceedings}, 4346 publisher = {Springer-Verlag}, 4347 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 4348 petsc_uses = {KSP} 4349} 4350 4351% LiteralHTML:<a name="katz"> 4352@InProceedings{ gd1, 4353 author = {Guillaume Dumont and Michel Kern}, 4354 title = {Parallelization of a {3D} Seismic Migration Code with {PETSc}}, 4355 year = {1999}, 4356 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 4357 Computing}, 4358 petsc_uses = {KSP} 4359} 4360 4361% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 4362% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 4363% LiteralHTML:<font color="#FF0000"> 4364% LiteralHTML: Figures from the work of Richard Katz 4365@PhDThesis{ katzthesis, 4366 author = {R.F. Katz}, 4367 title = {The deep roots of volcanoes: models of magma dynamics with applications to 4368 subduction zones}, 4369 school = {Columbia University}, 4370 year = {2005}, 4371 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 4372 petsc_uses = {KSP} 4373} 4374 4375@InCollection{ knepleykatzsmith06, 4376 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 4377 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 4378 USA}, 4379 title = {Developing a Geodynamics Simulator with {PETSc}}, 4380 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 4381 series = {Lecture Notes in Computational Science and Engineering}, 4382 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 4383 publisher = {Springer Berlin Heidelberg}, 4384 isbn = {978-3-540-31619-0}, 4385 keyword = {Mathematics and Statistics}, 4386 pages = {413-438}, 4387 volume = {51}, 4388 doi = {10.1007/3-540-31619-1_12}, 4389 year = {2006}, 4390 petsc_uses = {KSP} 4391} 4392 4393@Article{ katz04, 4394 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 4395 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 4396 the global mid-ocean ridge system}, 4397 journal = {Geophys.\ Res.\ Letts.}, 4398 year = {2004}, 4399 volume = {31}, 4400 pages = {L15605}, 4401 petsc_uses = {KSP} 4402} 4403 4404@Article{ katz07, 4405 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 4406 Ethan Coon}, 4407 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 4408 Toolkit for Scientific Computation}}, 4409 journal = {Phys. Earth Planet. In.}, 4410 volume = {163}, 4411 pages = {52--68}, 4412 year = {2007}, 4413 petsc_uses = {KSP} 4414} 4415 4416@Article{ williams2006development, 4417 title = {{Development of a package for modeling stress in the lithosphere}}, 4418 author = {Williams, CA}, 4419 journal = {Eos Trans. AGU}, 4420 volume = {87}, 4421 pages = {36}, 4422 year = {2006}, 4423 petsc_uses = {KSP} 4424} 4425 4426@Article{ goverswortel05, 4427 author = {R. Govers and M.J.R. Wortel}, 4428 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 4429 journal = {Earth and Planetary Science Letters}, 4430 volume = {236/1-2}, 4431 pages = {505-523}, 4432 year = {2005}, 4433 petsc_uses = {KSP} 4434} 4435 4436@InProceedings{ snark2, 4437 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4438 year = {2002}, 4439 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 4440 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 4441 petsc_uses = {KSP} 4442} 4443 4444@Article{ snark1, 4445 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 4446 Tan and Feng Wang}, 4447 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 4448 journal = {Submitted to Pure and Applied Geosciences}, 4449 petsc_uses = {KSP} 4450} 4451 4452@InProceedings{ earthquake2003, 4453 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 4454 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 4455 Tiankai Tu}, 4456 year = {2003}, 4457 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 4458 booktitle = {Proceedings of SC2003}, 4459 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 4460 petsc_uses = {KSP} 4461} 4462 4463@InProceedings{ stefano12, 4464 author = {Michele De Stefano}, 4465 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 4466 booktitle = {PIERS Proceedings}, 4467 month = aug, 4468 address = {Moscow, RUSSIA}, 4469 pages = {491--495}, 4470 year = {2012}, 4471 petsc_uses = {KSP} 4472} 4473 4474%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 4475 4476% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4477% LiteralHTML: <center><img alt="" 4478% LiteralHTML: src="images/ocean.jpg"></center></p> 4479@Article{ khatiwala07, 4480 author = {Khatiwala, S.}, 4481 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 4482 journal = {Glob. Biogeochem. Cycles}, 4483 volume = {21}, 4484 doi = {10.1029/2007GB002923}, 4485 year = {2007}, 4486 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 4487} 4488 4489@Article{ dks2004, 4490 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 4491 journal = {Ocean Modelling}, 4492 year = {2004}, 4493 volume = {6(2)}, 4494 pages = {125-150}, 4495 title = {A finite-element Ocean Model: Principles and Evaluation}, 4496 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 4497 petsc_uses = {KSP} 4498} 4499 4500@Article{ danilov1, 4501 author = {S. Danilov and G. Kivman and J. Schroter}, 4502 year = {2004}, 4503 title = {Evaluation of an eddy-permitting finite-element ocean model in the {N}orth 4504 {A}tlantic}, 4505 journal = {Ocean Modelling}, 4506 petsc_uses = {KSP} 4507} 4508 4509@Article{ nerger1, 4510 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 4511 year = {2004}, 4512 title = {Data Assimilation with the Ensemble {K}alman Filter and the {SEIK} Filter applied to 4513 a Finite Element Model of the {N}orth {A}tlantic}, 4514 journal = {Journal of marine systems}, 4515 petsc_uses = {KSP} 4516} 4517 4518@Conference{ rakowsky2003self, 4519 title = {{A self-adaptive finite element model of the atmosphere}}, 4520 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 4521 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 4522 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 4523 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 4524 pages = {279}, 4525 isbn = {981238376X}, 4526 year = {2003}, 4527 organization = {World Scientific Pub Co}, 4528 petsc_uses = {KSP} 4529} 4530 4531@Article{ lauter3, 4532 author = {M. Lauter}, 4533 year = {2004}, 4534 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4535 AtmosphArenmodell}, 4536 journal = {Berichte zur Polar- und Meeresforschung}, 4537 petsc_uses = {KSP} 4538} 4539 4540@Article{ lauter2, 4541 author = {M. Lauter and D. Handorf and K. Dethloff}, 4542 year = {2004}, 4543 title = {Unsteady analytical solutions of the spherical shallow water equations}, 4544 journal = {Journal of computational physics}, 4545 petsc_uses = {KSP} 4546} 4547 4548@PhDThesis{ lauter1, 4549 author = {M. Lauter}, 4550 year = {2004}, 4551 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4552 AtmosphArenmodell}, 4553 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 4554 petsc_uses = {KSP} 4555} 4556 4557@Article{ frickenhaus1, 4558 author = {S. Frickenhaus and W. Hiller and M. Best}, 4559 year = {2005}, 4560 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 4561 parallel numerical atmosphere and ocean models}, 4562 journal = {Ocean Modelling}, 4563 volume = {10}, 4564 pages = {185--191}, 4565 petsc_uses = {KSP} 4566} 4567 4568@Article{ 0266-5611-24-3-034015, 4569 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 4570 title = {A {N}ewton-{CG} method for large-scale three-dimensional elastic full-waveform 4571 seismic inversion}, 4572 journal = {Inverse Problems}, 4573 volume = {24}, 4574 number = {3}, 4575 pages = {034015 (26pp)}, 4576 url = {http://stacks.iop.org/0266-5611/24/034015}, 4577 year = {2008}, 4578 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 4579 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 4580 iterations with inner conjugate gradient linear iterations, globalized by an 4581 Armijo backtracking line search, solved on a sequence of finer grids and higher 4582 frequencies to remain in the vicinity of the global optimum, inexactly terminated 4583 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 4584 variation operator to capture sharp interfaces, finely discretized by finite 4585 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 4586 implemented in matrix-free fashion with adjoint-based computation of reduced 4587 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 4588 waveform storage, and partitioned spatially across processors to parallelize the 4589 solutions of the forward and adjoint wave equations and the evaluation of 4590 gradient-like information. Several numerical examples demonstrate the grid 4591 independence of linear and nonlinear iterations, the effectiveness of the 4592 preconditioner, the ability to solve inverse problems with up to 17 million 4593 inversion parameters on up to 2048 processors, the effectiveness of multiscale 4594 continuation in keeping iterates in the basin of attraction of the global minimum, 4595 and the ability to fit the observational data while reconstructing the model with 4596 reasonable resolution and capturing sharp interfaces.}, 4597 petsc_uses = {KSP} 4598} 4599 4600% LiteralHTML: 4601% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 4602% LiteralHTML: 4603% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4604% LiteralHTML:<font color="#FF0000"> 4605% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 4606% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 4607% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 4608% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 4609% LiteralHTML:for a variety of these simulations.</p> 4610% LiteralHTML:</font> 4611% LiteralHTML: 4612@Article{ mills2009modeling, 4613 title = {Modeling subsurface reactive flows using leadership-class computing}, 4614 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4615 Mahinthakumar, G.K. and Smith, B.F.}, 4616 journal = {Journal of Physics: Conference Series}, 4617 volume = {180}, 4618 pages = {012062}, 4619 year = {2009}, 4620 publisher = {IOP Publishing}, 4621 petsc_uses = {KSP} 4622} 4623 4624@Conference{ mills2007simulating, 4625 title = {{Simulating subsurface flow and transport on ultrascale computers using 4626 PFLOTRAN}}, 4627 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 4628 booktitle = {Journal of Physics: Conference Series}, 4629 volume = {78}, 4630 pages = {012051}, 4631 year = {2007}, 4632 organization = {IOP Publishing}, 4633 petsc_uses = {KSP} 4634} 4635 4636@InProceedings{ mills2009, 4637 title = {Modeling subsurface reactive flows using leadership-class computing}, 4638 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4639 Mahinthakmuar, G. and Smith, B.}, 4640 booktitle = {Journal of Physics: Conference Series}, 4641 volume = {180}, 4642 pages = {102062}, 4643 year = {2009}, 4644 organization = {IOP Publishing}, 4645 petsc_uses = {KSP} 4646} 4647 4648@Article{ guo2013parallel, 4649 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 4650 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 4651 }, 4652 journal = {Advances in Water Resources }, 4653 volume = {53}, 4654 number = {0}, 4655 pages = {101 - 108}, 4656 year = {2013}, 4657 note = {}, 4658 issn = {0309-1708}, 4659 doi = {10.1016/j.advwatres.2012.10.010}, 4660 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 4661 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 4662 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 4663 preconditioner}, 4664 petsc_uses = {KSP} 4665} 4666 4667@Unpublished{ stomp, 4668 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 4669 url = {http://stomp.pnl.gov/}, 4670 petsc_uses = {KSP} 4671} 4672 4673@InProceedings{ htfc2003, 4674 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 4675 title = {Methods and Experiences For Parallelizing Flood Models}, 4676 year = {2003}, 4677 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 4678 European PVM/MPI User's Group Meeting}, 4679 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 4680 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 4681 petsc_uses = {KSP} 4682} 4683 4684@InProceedings{ hulchy-tran-astalos-fmsip, 4685 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 4686 D.Froehlich}, 4687 title = {Flood Modeling System and Its Parallelization}, 4688 year = {2002}, 4689 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 4690 Engineering}, 4691 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 4692 petsc_uses = {KSP} 4693} 4694 4695@InProceedings{ gy1, 4696 author = {J. P. Gwo and G. T. Yeh}, 4697 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 4698 Transport at Watershed Scale}, 4699 year = {2004}, 4700 booktitle = {The International Conference on Computational Methods}, 4701 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 4702 petsc_uses = {KSP} 4703} 4704 4705@Conference{ cheng2009efficient, 4706 title = {{An efficient parallel method for large-scale groundwater flow equation based on 4707 PETSc}}, 4708 author = {Cheng, T. and Ji, X. and Wang, Q.}, 4709 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 4710 Conference on}, 4711 pages = {190--193}, 4712 organization = {IEEE}, 4713 petsc_uses = {KSP} 4714} 4715 4716@Unpublished{ sfrsm, 4717 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 4718 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 4719 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 4720 its linear solves}, 4721 petsc_uses = {KSP} 4722} 4723 4724% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4725@InProceedings{ bart_omar:sc05, 4726 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 4727 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 4728 title = {Dynamic data driven inversion for terascale simulations: real-time 4729 indentification of airborne contaminants}, 4730 booktitle = {Proceedings of SC2005}, 4731 organization = {IEEE/ACM}, 4732 address = {Seattle, WA}, 4733 year = {2005}, 4734 month = nov, 4735 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 4736 lab = {SNL}, 4737 petsc_uses = {KSP} 4738} 4739 4740@InProceedings{ anton-krassimir-lscc, 4741 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 4742 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 4743 Simulations}, 4744 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 4745 volume = {2907}, 4746 year = {2003}, 4747 publisher = {Springer-Verlag}, 4748 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 4749 petsc_uses = {KSP} 4750} 4751 4752@InProceedings{ aa2001, 4753 author = {Anton Antonov}, 4754 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 4755 year = {2001}, 4756 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 4757 Sozopol, Bulgaria}, 4758 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 4759 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 4760 petsc_uses = {KSP} 4761} 4762 4763% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4764@Article{ grassley-simmons-kercher-00, 4765 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 4766 year = {2000}, 4767 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 4768 reactive transport models}, 4769 journal = {Applied Geochemistry}, 4770 volume = {17}, 4771 pages = {699--708}, 4772 lab = {LLNL} 4773} 4774 4775@Article{ glassey-nitao-03, 4776 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 4777 and Carl I. Steefel and James R. Kercher}, 4778 year = {2003}, 4779 title = {The impact of climate change on vadose zone pore waters and its implication for 4780 long-term monitoring}, 4781 journal = {Computers and Geosciences}, 4782 volume = {29}, 4783 pages = {399-411}, 4784 lab = {LLNL}, 4785 petsc_uses = {KSP} 4786} 4787 4788@Article{ steefel-depaolo-lichtner-05, 4789 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 4790 year = {2005}, 4791 title = {Reactive transport modeling: An essential tool and a new research approach for 4792 the Earth sciences}, 4793 journal = {Earth and Planetary Science Letters}, 4794 lab = {LLNL,LANL}, 4795 petsc_uses = {KSP} 4796} 4797 4798% LiteralHTML:<a name="scalinglarge"> 4799% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4800% LiteralHTML: <center><img alt="" 4801% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 4802% LiteralHTML:<font color="#FF0000"> 4803% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 4804@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 4805 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 4806 Strategies for Large-Scale Numerical Simulations}, 4807 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 4808 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 4809 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 4810 Large-Scale Systems (scalA)}, 4811 pages = {65-72}, 4812 doi = {10.1109/ScalA.2018.00012}, 4813 month = nov, 4814 year = {2018}, 4815 petsc_uses = {KSP} 4816} 4817 4818@Article{ km2004, 4819 author = {A. Keese and H. G. Matthies}, 4820 journal = {Computers and Structures}, 4821 year = {2005}, 4822 volume = {83}, 4823 pages = {1033--1047}, 4824 title = {Hierarchical parallelisation for the solution of stochastic finite element 4825 equations}, 4826 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 4827 petsc_uses = {KSP} 4828} 4829 4830@Unpublished{ hvl2002, 4831 title = {Numerical Modeling of {NAPL} Source Zone Treatment}, 4832 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 4833 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 4834 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 4835 year = {2002}, 4836 lab = {LANL}, 4837 petsc_uses = {KSP} 4838} 4839 4840@PhDThesis{ hammond2003, 4841 author = {Glenn E. Hammond}, 4842 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 4843 Transport on Supercomputers}, 4844 school = {University of Illinois at Urbana-Champaign}, 4845 year = {2003}, 4846 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 4847 petsc_uses = {KSP} 4848} 4849 4850@Unpublished{ uk, 4851 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 4852 Scale Environmental Flows and Transport Processes}, 4853 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 4854 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 4855 buildings and in Green Bay. Used PETSc for its linear solvers}, 4856 year = {1999}, 4857 petsc_uses = {KSP} 4858} 4859 4860@InProceedings{ hammond2002, 4861 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 4862 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 4863 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 4864 year = {2002}, 4865 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 4866 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 4867 Resources, Delft, The Netherlands.}, 4868 lab = {LANL}, 4869 petsc_uses = {KSP} 4870} 4871 4872@TechReport{ steefel1, 4873 author = {C. I. Steefel}, 4874 title = {Software for modeling multicomponent, multidimensional reactive transport}, 4875 year = {2001}, 4876 institution = {Lawrence Livermore National Laboratory}, 4877 number = {UCRL-MA-143182}, 4878 lab = {LLNL}, 4879 petsc_uses = {KSP} 4880} 4881 4882@Article{ steefel2, 4883 author = {C. I. Steefel and A. C. Lasaga}, 4884 title = {A coupled model for transport of multiple chemical-species and kinetic 4885 precipitation dissolution reactions with application to reactive flow in 4886 single-phase hydrothermal systems}, 4887 journal = {Americal Journal of Science}, 4888 year = {1994}, 4889 pages = {529-592}, 4890 volume = {294}, 4891 number = {5}, 4892 petsc_uses = {KSP} 4893} 4894 4895@TechReport{ steefel3, 4896 author = {C. I. Steefel and S. B. Yabusaki}, 4897 title = {{OS3D/GIMRT}, Software for Multicomponent-Multidimensional reactive transport: 4898 User's manual and programmer's guide}, 4899 year = {1996}, 4900 institution = {Pacific Northwest National Laboratory}, 4901 number = {PNNL-11166}, 4902 lab = {PNNL}, 4903 petsc_uses = {KSP} 4904} 4905 4906@Article{ 2005hvl, 4907 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 4908 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 4909 preconditioning to biogeochemical transport}, 4910 journal = {Advances in Water Resources}, 4911 year = {2005}, 4912 pages = {359--376}, 4913 volume = {28}, 4914 url = { 4915 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 4916 lab = {LANL}, 4917 petsc_uses = {KSP} 4918} 4919 4920@Article{ wang-zabar-05, 4921 author = {J Wang and N Zabaras}, 4922 journal = {Int. J. Heat and Mass Transfer}, 4923 title = {A Markov random field model of contamination source identification in porous 4924 media flow}, 4925 year = {2005}, 4926 petsc_uses = {KSP} 4927} 4928 4929@InBook{ kp1, 4930 author = {Jong G. Kim and Hyoung W. Park}, 4931 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 4932 Media}, 4933 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 4934 title = {Lecture Notes in Computer Science}, 4935 publisher = {Springer-Verlag}, 4936 volume = {3044}, 4937 year = {2004}, 4938 petsc_uses = {KSP} 4939} 4940 4941@Article{ 2001agusm...h32a06k, 4942 author = {{Kim}, J.~G. and {Kim}, J.}, 4943 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 4944 journal = {AGU Spring Meeting Abstracts}, 4945 year = {2001}, 4946 pages = {32-+}, 4947 petsc_uses = {KSP} 4948} 4949 4950@Article{ lzb2005, 4951 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 4952 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 4953 journal = {Journal of Hydraulic Engineering}, 4954 year = {2005}, 4955 volume = {131}, 4956 number = {4}, 4957 pages = {247--258}, 4958 petsc_uses = {KSP} 4959} 4960 4961@Article{ rao2005, 4962 author = {Prasada Rao}, 4963 title = {A parallel {RMA2} model for simulating large-scale free surface flows}, 4964 journal = {Environmental Modelling and Software}, 4965 year = {2005}, 4966 pages = {47--53}, 4967 petsc_uses = {KSP} 4968} 4969 4970@InProceedings{ pr1, 4971 author = {Prasada Rao}, 4972 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 4973 Hydrodynamic Flows}, 4974 year = {2003}, 4975 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 4976 Conference}, 4977 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 4978 petsc_uses = {KSP} 4979} 4980 4981@InProceedings{ lichtner2004, 4982 author = {Peter C. Lichtner and Andrew Wolfsberg}, 4983 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 4984 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 4985 Challenge Supercomputing Problem}, 4986 year = {2004}, 4987 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 4988 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 4989 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 4990 lab = {LANL}, 4991 petsc_uses = {KSP} 4992} 4993 4994% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4995@Article{ aba01:petsc-app, 4996 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 4997 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 4998 journal = {Int. J. High Performance Computing Applications}, 4999 year = {2001}, 5000 volume = {15}, 5001 number = {1}, 5002 pages = {13--21}, 5003 petsc_uses = {KSP} 5004} 5005 5006@PhDThesis{ tjb200, 5007 author = {Thomas James Byer}, 5008 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 5009 Facilities}, 5010 school = {Stanford}, 5011 year = {2000}, 5012 petsc_uses = {KSP} 5013} 5014 5015@InProceedings{ puchyr2006, 5016 author = {Peter J. Puchyr}, 5017 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 5018 {Win32} Cluster}, 5019 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 5020 note = {Paper number CIPC2006-207}, 5021 year = {2006}, 5022 petsc_uses = {KSP} 5023} 5024 5025@InProceedings{ texas98, 5026 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 5027 and G. A. Pope}, 5028 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 5029 Simulation}, 5030 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 5031 Symposium}, 5032 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 5033 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 5034 year = {1998}, 5035 petsc_uses = {KSP} 5036} 5037 5038% LiteralHTML: 5039% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 5040% LiteralHTML: 5041@Article{ farrellmitchellscottwechsung2021, 5042 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 5043 stationary incompressible {Navier-Stokes} equations}, 5044 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 5045 Wechsung}, 5046 journal = {The SMAI journal of computational mathematics}, 5047 volume = {7}, 5048 pages = {75--96}, 5049 year = {2021}, 5050 petsc_uses = {KSP} 5051} 5052 5053@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 5054 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 5055 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 5056 P MacLachlan and Ray S Tuminaro}, 5057 journal = {SIAM Journal on Scientific Computing}, 5058 number = {0}, 5059 pages = {S70--S91}, 5060 year = {2021}, 5061 petsc_uses = {KSP} 5062} 5063 5064@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 5065 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 5066 hyperelasticity}, 5067 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 5068 Oyar\'ua and Ricardo Ruiz-Baier}, 5069 journal = {Computer Methods in Applied Mechanics and Engineering}, 5070 volume = {374}, 5071 pages = {113562}, 5072 issn = {0045-7825}, 5073 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 5074 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 5075 year = {2021}, 5076 petsc_uses = {KSP} 5077} 5078 5079@Article{ farrellmitchellwechsung2018, 5080 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 5081 {Navier-Stokes} equations at high {Reynolds} number}, 5082 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 5083 journal = {SIAM Journal on Scientific Computing}, 5084 volume = {41}, 5085 number = {5}, 5086 eprint = {1810.03315}, 5087 pages = {A3073-A3096}, 5088 year = {2019}, 5089 petsc_uses = {KSP} 5090} 5091 5092@Article{ hevuikklaij2017, 5093 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 5094 discretized by a finite volume method}, 5095 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 5096 journal = {Journal of Numerical Mathematics}, 5097 volume = {25}, 5098 number = {2}, 5099 pages = {89--105}, 5100 year = {2017}, 5101 petsc_uses = {KSP} 5102} 5103 5104@InProceedings{ zou2015newton, 5105 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 5106 appearance/disappearance}, 5107 author = {Zou, L and Zhao, H and Zhang, H}, 5108 booktitle = {ANS 2015 Annual Meeting, June}, 5109 volume = {7}, 5110 number = {11}, 5111 year = {2015}, 5112 petsc_uses = {KSP} 5113} 5114 5115@Article{ guermond2009nonlinear, 5116 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 5117 Fourier/finite element technique and an interior penalty method}, 5118 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 5119 journal = {Journal of computational physics}, 5120 volume = {228}, 5121 number = {8}, 5122 pages = {2739--2757}, 5123 year = {2009}, 5124 publisher = {Elsevier}, 5125 petsc_uses = {KSP} 5126} 5127 5128@Article{ erzincanlisahin2015, 5129 title = {The numerical simulation of the wing kinematics effects on near wake topology and 5130 aerodynamic performance in hovering {D}rosophila flight}, 5131 author = {Belkis Erzincanli and Mehmet Sahin}, 5132 journal = {Computers \& Fluids}, 5133 volume = {122}, 5134 pages = {90--110}, 5135 year = {2015}, 5136 publisher = {Elsevier}, 5137 petsc_uses = {KSP} 5138} 5139 5140@Article{ ekensahin2015, 5141 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 5142 structure interaction problems}, 5143 author = {Ali Eken and Mehmet Sahin}, 5144 journal = {International Journal for Numerical Methods in Fluids}, 5145 year = {2015}, 5146 publisher = {Wiley Online Library}, 5147 petsc_uses = {KSP} 5148} 5149 5150@Article{ hwangsucai2015, 5151 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 5152 for transonic full potential equation}, 5153 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 5154 journal = {Computers \& Fluids}, 5155 volume = {110}, 5156 number = {30}, 5157 pages = {96--107}, 5158 year = {2015}, 5159 doi = {10.1016/j.compfluid.2014.04.005}, 5160 petsc_uses = {KSP} 5161} 5162 5163@Article{ yanghwangcai2016, 5164 title = {Nonlinear Preconditioning Techniques for Full-Space {L}agrange--{N}ewton Solution of 5165 {PDE}-Constrained Optimization Problems}, 5166 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 5167 journal = {SIAM Journal on Scientific Computing}, 5168 volume = {38}, 5169 number = {5}, 5170 pages = {A2756--A2778}, 5171 year = {2016}, 5172 petsc_uses = {KSP} 5173} 5174 5175@Article{ khanaidun2011, 5176 author = {Irfan Khan and Cyrus K. Aidun}, 5177 title = {Direct numerical simulation of saturated deformable porous media using parallel 5178 hybrid Lattice-{B}oltzmann and finite element method}, 5179 journal = {Int. J. Numer. Meth. Eng.}, 5180 volume = {86}, 5181 pages = {1379--1395}, 5182 year = {2011}, 5183 petsc_uses = {KSP} 5184} 5185 5186@Article{ khanaidun2014, 5187 author = {Irfan Khan and Cyrus K. Aidun}, 5188 title = {Modeling the deformation of saturate porous media using direct numerical 5189 simulation}, 5190 journal = {Int. J. Multiphase Flow}, 5191 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 5192 year = {2014}, 5193 petsc_uses = {KSP} 5194} 5195 5196@Article{ mofidi2014simulations, 5197 author = {A. Mofidi and P. M. Carrica}, 5198 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 5199 and Propeller}, 5200 journal = {Computers and Fluids}, 5201 pages = {191--203}, 5202 year = {2014}, 5203 petsc_uses = {KSP} 5204} 5205 5206@Article{ paik2014fluidstructure, 5207 author = {K. Paik and P. M. Carrica}, 5208 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 5209 Surface in a Rolling Tank}, 5210 journal = {Ocean Engineering}, 5211 pages = {201--212}, 5212 year = {2014}, 5213 petsc_uses = {KSP} 5214} 5215 5216@Article{ castro2013bubble, 5217 author = {A. M. Castro and P. M. Carrica}, 5218 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 5219 evaluation and numerical issues}, 5220 journal = {International Journal of Multiphase Flow 57}, 5221 pages = {131--150}, 5222 year = {2013}, 5223 petsc_uses = {KSP} 5224} 5225 5226@Article{ carrica2013turn, 5227 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 5228 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 5229 Dynamic Overset Grids}, 5230 journal = {Journal of Marine Science and Technology}, 5231 pages = {166--181}, 5232 year = {2013}, 5233 petsc_uses = {KSP} 5234} 5235 5236@Article{ castro2013eulerian, 5237 author = {A. M. Castro and P. M. Carrica}, 5238 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 5239 {Athena} {R}/V,}, 5240 journal = {International Shipbuilding Progress}, 5241 pages = {403--433}, 5242 year = {2013}, 5243 petsc_uses = {KSP} 5244} 5245 5246@Article{ chase2013overset, 5247 author = {N. Chase and T. Michael and P. M. Carrica}, 5248 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 5249 {Maneuvering} {Conditions}}, 5250 journal = {International Shipbuilding Progress}, 5251 pages = {171--205}, 5252 year = {2013}, 5253 petsc_uses = {KSP} 5254} 5255 5256@Article{ sadathosseini2013wu, 5257 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 5258 Stern}, 5259 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 5260 Free Surge Conditions in Short and Long Head Waves}, 5261 journal = {Ocean Engineering}, 5262 volume = {59}, 5263 pages = {240--273}, 5264 year = {2013}, 5265 petsc_uses = {KSP} 5266} 5267 5268@Article{ chase2013cfd, 5269 author = {N. Chase and P. M. Carrica}, 5270 title = {{CFD} Simulations of a Submarine Propeller and Application to Self-Propulsion of a 5271 Submarine}, 5272 journal = {Ocean Engineering}, 5273 pages = {68--80}, 5274 year = {2013}, 5275 petsc_uses = {KSP} 5276} 5277 5278@Article{ carrica2012cfd, 5279 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 5280 title = {{CFD} Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 5281 of Moving Rudders and Rotating Propellers}, 5282 journal = {Computers and Fluids 53}, 5283 pages = {117--132}, 5284 year = {2012}, 5285 petsc_uses = {KSP} 5286} 5287 5288@Article{ sakamoto2012urans, 5289 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5290 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 5291 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 5292 publisher = {Journal of Marine Science and Technology}, 5293 pages = {422--445}, 5294 year = {2012}, 5295 petsc_uses = {KSP} 5296} 5297 5298@Article{ sakamoto2012uransb, 5299 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5300 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 5301 Analysis and Validation of Local Flow Characteristics}, 5302 journal = {Journal of Marine Science and Technology}, 5303 pages = {446--468}, 5304 year = {2012}, 5305 petsc_uses = {KSP} 5306} 5307 5308@Article{ li2012dynamic, 5309 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 5310 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 5311 journal = {Renewable Energy}, 5312 pages = {285--298}, 5313 year = {2012}, 5314 petsc_uses = {KSP} 5315} 5316 5317@Article{ huang2012a, 5318 author = {J. Huang and P. M. Carrica and F. Stern}, 5319 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 5320 journal = {International Journal for Numerical Methods in Fluids}, 5321 pages = {160--180}, 5322 year = {2012}, 5323 petsc_uses = {KSP} 5324} 5325 5326@Article{ huang2012b, 5327 author = {J. Huang and P. M. Carrica and F. Stern}, 5328 title = {A geometry-based level set method for curvilinear overset grids with application 5329 to ship hydrodynamics}, 5330 journal = {International Journal for Numerical Methods in Fluids}, 5331 pages = {494--521}, 5332 year = {2012}, 5333 petsc_uses = {KSP} 5334} 5335 5336@Article{ carrica2011computations, 5337 author = {P. M. Carrica and H. Fu and F. Stern}, 5338 title = {Computations of self-propulsion free to sink and trim and of motions in head 5339 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 5340 journal = {Applied Ocean Research}, 5341 pages = {309--320}, 5342 year = {2011}, 5343 petsc_uses = {KSP} 5344} 5345 5346@Article{ bhushan2011scalability, 5347 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 5348 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 5349 Using {CFDShip}-Iowa}, 5350 journal = {International Journal of High Performance Computing Applications}, 5351 pages = {466--487}, 5352 year = {2011}, 5353 petsc_uses = {KSP} 5354} 5355 5356@Article{ castro2011full, 5357 author = {A. M. Castro and P. M. Carrica and F. Stern}, 5358 title = {Full scale self-propulsion computations using discretized propeller for the 5359 {KRISO} container ship {KCS}}, 5360 journal = {Computers and Fluids}, 5361 pages = {35--47}, 5362 year = {2011}, 5363 petsc_uses = {KSP} 5364} 5365 5366@Article{ kandasamy2011multifidelity, 5367 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5368 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5369 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing {C}atamaran 5370 for Low Wake}, 5371 journal = {Journal of Marine Science and Technology}, 5372 pages = {143--156}, 5373 year = {2011}, 5374 petsc_uses = {KSP} 5375} 5376 5377@Article{ kandasamy2011cfd, 5378 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5379 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5380 title = {{CFD} Validation Studies for a High-speed Foil-assisted Semi-planing {C}atamaran}, 5381 journal = {Journal of Marine Science and Technology}, 5382 pages = {157--167}, 5383 year = {2011}, 5384 petsc_uses = {KSP} 5385} 5386 5387@Article{ sadathosseini2011cfd, 5388 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 5389 and S. Yamamura and A. Mastuda}, 5390 title = {{CFD} System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 5391 Periodic Motion and Broaching}, 5392 journal = {Ocean Engineering}, 5393 pages = {88--110}, 5394 year = {2011}, 5395 petsc_uses = {KSP} 5396} 5397 5398@Article{ mosaviraad2010development, 5399 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 5400 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 5401 with Comparison to Regular Wave and Transient Wave Group Procedures Using 5402 {URANS}}, 5403 journal = {Ocean Engineering}, 5404 pages = {653--666}, 5405 year = {2010}, 5406 petsc_uses = {KSP} 5407} 5408 5409@Article{ carrica2010largescale, 5410 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5411 Stern}, 5412 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5413 Heave Problems for a Surface Combatant}, 5414 journal = {Computers and Fluids}, 5415 pages = {1095--1111}, 5416 year = {2010}, 5417 petsc_uses = {KSP} 5418} 5419 5420@Article{ carrica2010selfpropulsion, 5421 author = {P. M. Carrica and A. M. Castro and F. Stern}, 5422 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 5423 with Dynamic Overset Grids}, 5424 journal = {Journal of Marine Science and Technology}, 5425 pages = {316--330}, 5426 year = {2010}, 5427 petsc_uses = {KSP} 5428} 5429 5430@Article{ ismail2010evaluation, 5431 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 5432 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 5433 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 5434 journal = {International Journal of Numerical Methods in Fluids}, 5435 pages = {850--886}, 5436 year = {2010}, 5437 petsc_uses = {KSP} 5438} 5439 5440@Article{ kandasamy2010integral, 5441 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 5442 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 5443 journal = {Journal of Fluids Engineering}, 5444 pages = {101103}, 5445 year = {2010}, 5446 petsc_uses = {KSP} 5447} 5448 5449@Article{ kirk:2014de, 5450 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 5451 title = {{Modeling hypersonic entry with the fully-implicit {N}avier--{S}tokes (FIN-S) 5452 stabilized finite element flow solver}}, 5453 journal = {Computers {\&} Fluids}, 5454 year = {2014}, 5455 volume = {92}, 5456 number = {0}, 5457 pages = {281--292}, 5458 month = mar, 5459 petsc_uses = {KSP} 5460} 5461 5462@Article{ carracciuolo20111382, 5463 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 5464 in high performance computing environment}, 5465 journal = {Journal of Non-Newtonian Fluid Mechanics }, 5466 volume = {166}, 5467 number = {23--24}, 5468 pages = {1382--1395}, 5469 year = {2011}, 5470 issn = {0377-0257}, 5471 doi = {10.1016/j.jnnfm.2011.08.014}, 5472 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 5473 Maffettone and A. Murli}, 5474 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 5475 method, High performance computing}, 5476 petsc_uses = {KSP} 5477} 5478 5479@Article{ bungartzgatzhammerliebmehlneckel11, 5480 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 5481 Miriam and Neckel, Tobias}, 5482 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 5483 journal = {Computational Mechanics}, 5484 volume = {48}, 5485 number = {3}, 5486 pages = {365-376}, 5487 year = {2011}, 5488 issn = {0178-7675}, 5489 doi = {10.1007/s00466-011-0626-1}, 5490 publisher = {Springer-Verlag}, 5491 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 5492 Thermohydraulics; Two-phase flow}, 5493 language = {English}, 5494 petsc_uses = {KSP} 5495} 5496 5497@Article{ bpr:cfl, 5498 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 5499 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 5500 Equations}}, 5501 journal = {International Journal for Numerical Methods in Fluids}, 5502 year = {2009}, 5503 volume = {59}, 5504 number = {1}, 5505 pages = {1--18}, 5506 doi = {10.1002/fld.1798}, 5507 petsc_uses = {KSP} 5508} 5509 5510@InBook{ bonfiglioli_campobasso_carpentieri_2010, 5511 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 5512 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 5513 preconditioned newton-krylov solver}, 5514 publisher = {Curran Associates}, 5515 year = {2010}, 5516 url = {http://www.proceedings.com/05932.html}, 5517 petsc_uses = {KSP} 5518} 5519 5520@Article{ bonfiglioli_rans_2005, 5521 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 5522 Bernardo}, 5523 title = {RANS simulations of a junction flow}, 5524 journal = {International Journal of Computational Fluid Dynamics}, 5525 volume = {19}, 5526 number = {2}, 5527 pages = {179-189}, 5528 year = {2005}, 5529 doi = {10.1080/10618560410001729126}, 5530 petsc_uses = {KSP} 5531} 5532 5533@InCollection{ bonfiglioli__carpentieri_rans_2008, 5534 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 5535 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 5536 Italy}, 5537 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 5538 Equations Using Fluctuation Splitting Schemes}, 5539 booktitle = {Numerical Mathematics and Advanced Applications}, 5540 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 5541 publisher = {Springer Berlin Heidelberg}, 5542 isbn = {978-3-540-69777-0}, 5543 pages = {151-158}, 5544 doi = {10.1007/978-3-540-69777-0_17}, 5545 year = {2008}, 5546 petsc_uses = {KSP} 5547} 5548 5549@InCollection{ bonfiglioli__carpentieri_ens_2007, 5550 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 5551 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 5552 Italy}, 5553 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 5554 Problems on Unstructured Grids}, 5555 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 5556 series = {Lecture Notes in Computer Science}, 5557 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 5558 publisher = {Springer Berlin / Heidelberg}, 5559 isbn = {978-3-540-75754-2}, 5560 pages = {676-685}, 5561 volume = {4699}, 5562 doi = {10.1007/978-3-540-75755-9_83}, 5563 year = {2007}, 5564 petsc_uses = {KSP} 5565} 5566 5567@Article{ terrelscottknepleykirby08, 5568 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 5569 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 5570 journal = {BIT}, 5571 volume = {48}, 5572 number = {2}, 5573 year = {2008}, 5574 petsc_uses = {KSP} 5575} 5576 5577@Article{ martamadermartinsweidealonso07, 5578 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 5579 J. Alonso}, 5580 title = {A methodology for the development of discrete adjoint solvers using automatic 5581 differentiation tools}, 5582 journal = {Computational Fluid Dyanmics}, 5583 volume = {21}, 5584 pages = {307--327}, 5585 year = {2007}, 5586 petsc_uses = {KSP} 5587} 5588 5589@TechReport{ avb2008, 5590 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 5591 title = {Variational Space-time (Dis)continuous {G}alerkin Method for Linear Free Surface 5592 Waves}, 5593 year = {2008}, 5594 institution = {University of Twente, the Netherlands}, 5595 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 5596 petsc_uses = {KSP} 5597} 5598 5599@InProceedings{ bdsm2005, 5600 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 5601 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 5602 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 5603 year = {2005}, 5604 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 5605 petsc_uses = {KSP} 5606} 5607 5608@InProceedings{ ms2006, 5609 author = {S. Muller and Y. Stiriba}, 5610 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 5611 STEADY COMPRESSIBLE FLOWS}, 5612 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 5613 year = {2006}, 5614 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 5615 petsc_uses = {KSP} 5616} 5617 5618@Article{ araujoteixeiracunhagroth08, 5619 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 5620 title = {Parallel three-dimensional simulation of the injection molding process}, 5621 journal = {International Journal for Numerical Methods in Fluids}, 5622 year = {2008}, 5623 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 5624 petsc_uses = {KSP} 5625} 5626 5627@PhDThesis{ a2008, 5628 author = {A. Cubero}, 5629 title = {a parallel coupled algorithm for collocated grids and its application to Large 5630 Eddy Simulation of a turbulent wake}, 5631 school = {University of Zaragoza (Spain)}, 5632 year = {2008}, 5633 petsc_uses = {KSP} 5634} 5635 5636@Article{ afa2007, 5637 author = {A. Cubero and N. Fueyo}, 5638 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 5639 journal = {Numerical Heat Transfer, part B-Fundamentals}, 5640 volume = {56}, 5641 number = {6}, 5642 pages = {507--529}, 5643 year = {2007}, 5644 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 5645 petsc_uses = {KSP} 5646} 5647 5648@TechReport{ af2007, 5649 title = {Preconditioning based on a partially implicit implementation of Momentum 5650 Interpolation for coupled solvers}, 5651 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 5652 year = {2007}, 5653 author = {A. Cubero and N. Fueyo}, 5654 petsc_uses = {KSP} 5655} 5656 5657@InCollection{ dwight2004, 5658 author = {Richard Dwight}, 5659 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 5660 booktitle = {Computational Fluid Dynamics 2006}, 5661 editor = {H. Deconinck and E. Dick}, 5662 publisher = {Springer}, 5663 year = {2006}, 5664 url = {http://www.maths.man.ac.uk/\~{ 5665 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 5666 petsc_uses = {KSP} 5667} 5668 5669@InProceedings{ dwight2006, 5670 author = {Richard Dwight and Joel Brezillon}, 5671 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 5672 Optimization}, 5673 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 5674 AIAA-2006-0690}, 5675 year = {2006}, 5676 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 5677 petsc_uses = {KSP} 5678} 5679 5680@PhDThesis{ dwight2006a, 5681 author = {Richard Dwight}, 5682 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 5683 and Adjoint Methods on Unstructured Grids}, 5684 school = {School of Mathematics, University of Manchester}, 5685 year = {2006}, 5686 url = {http://www.maths.man.ac.uk/\~{ 5687 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 5688 petsc_uses = {KSP} 5689} 5690 5691@InProceedings{ lhdfrh, 5692 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 5693 W. Hiller}, 5694 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 5695 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 5696 March, 10-14, 2003, Munich University of Technology, German}, 5697 year = {2003}, 5698 petsc_uses = {KSP} 5699} 5700 5701@InProceedings{ brios-ying-2002, 5702 author = {George Biros and Lexing Ying and Denis Zorin}, 5703 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 5704 {Navier-Stokes} equations}, 5705 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 5706 year = {2002}, 5707 petsc_uses = {KSP} 5708} 5709 5710@InProceedings{ mohsen-straatman-ins, 5711 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 5712 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 5713 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 5714 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 5715 Systems and Applications}, 5716 pages = {11--16}, 5717 year = {2005}, 5718 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 5719 petsc_uses = {KSP} 5720} 5721 5722@TechReport{ bonglioli-icnmfd98, 5723 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 5724 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 5725 institution = {Universita della Basilicata via della Tecnica 3}, 5726 year = {1996}, 5727 author = {A. Bonglioli}, 5728 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 5729 petsc_uses = {KSP} 5730} 5731 5732@Article{ deng-piquet-ctf, 5733 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 5734 title = {A new fully coupled method for computing turbulent flows}, 5735 journal = {Computers and Fluids}, 5736 volume = {30}, 5737 pages = {445--472}, 5738 year = {2001}, 5739 petsc_uses = {KSP} 5740} 5741 5742@InProceedings{ knepleysarinsameh99b, 5743 title = {Multilevel Preconditioning for Parallel {CFD}}, 5744 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 5745 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 5746 Problems In Industrial Applications}, 5747 address = {Minneapolis, MN}, 5748 year = {1999}, 5749 petsc_uses = {KSP} 5750} 5751 5752@InProceedings{ garbey1, 5753 author = {M. Garbey and B. Hadri and W. Shyy.}, 5754 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 5755 Problems on the Grid}, 5756 booktitle = {Aerospace Sciences Meeting and Exhibit}, 5757 note = {Paper No. 2005-1386}, 5758 year = {2005}, 5759 petsc_uses = {KSP} 5760} 5761 5762@Article{ carrica2007unsteady, 5763 title = {An unsteady single-phase level set method for viscous free surface flows}, 5764 author = {Carrica, PM and Wilson, RV and Stern, F.}, 5765 journal = {International Journal for Numerical Methods in Fluids}, 5766 volume = {53}, 5767 number = {2}, 5768 pages = {229--256}, 5769 year = {2007}, 5770 publisher = {Chichester; New York: Wiley, c1981-}, 5771 petsc_uses = {KSP} 5772} 5773 5774@Article{ pctw2004, 5775 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 5776 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 5777 Spillways}, 5778 journal = {Journal of Hydraulic Research}, 5779 note = {accepted for publication}, 5780 year = {2004}, 5781 petsc_uses = {KSP} 5782} 5783 5784@Article{ wcs2004, 5785 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 5786 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 5787 Combatant}, 5788 journal = {Computers and Fluids}, 5789 note = {in press}, 5790 year = {2004}, 5791 petsc_uses = {KSP} 5792} 5793 5794@Article{ cws2005, 5795 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 5796 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 5797 journal = {Computers and Fluids}, 5798 note = {accepted for publication}, 5799 year = {2005}, 5800 petsc_uses = {KSP} 5801} 5802 5803@Article{ chndss2010, 5804 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5805 Stern}, 5806 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5807 Heave Problems for a Surface Combatant}, 5808 journal = {Computers and Fluids}, 5809 year = {2010}, 5810 volume = {39}, 5811 number = {7}, 5812 pages = {1095--1111}, 5813 petsc_uses = {KSP} 5814} 5815 5816@InProceedings{ chnkss2008, 5817 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5818 Stern}, 5819 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 5820 Grids}, 5821 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 5822 year = {2008}, 5823 petsc_uses = {KSP} 5824} 5825 5826@MastersThesis{ mtj, 5827 author = {M. T. Jozkowski}, 5828 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 5829 About Submerged Bodies}, 5830 school = {The Pennsylvania State University}, 5831 year = {2005}, 5832 petsc_uses = {KSP} 5833} 5834 5835@Article{ pp, 5836 author = {E. G. Paterson and L. J. Peltier}, 5837 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 5838 Wakes}, 5839 journal = {ASME Journal of Fluids Engineering}, 5840 note = {In press}, 5841 year = {2005}, 5842 petsc_uses = {KSP} 5843} 5844 5845@Article{ eps, 5846 author = {B. A. Edge and E. G. Paterson and G. Settles}, 5847 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 5848 journal = {ASME Journal of Fluids Engineering}, 5849 note = {In press}, 5850 year = {2005}, 5851 petsc_uses = {KSP} 5852} 5853 5854@InProceedings{ rp, 5855 author = {B. Racine and E. G. Paterson}, 5856 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 5857 Using Unsteady {RANS} {CFD}}, 5858 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 5859 year = {2005}, 5860 petsc_uses = {KSP} 5861} 5862 5863@InProceedings{ etpp, 5864 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 5865 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 5866 and DES}, 5867 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5868 year = {2004}, 5869 petsc_uses = {KSP} 5870} 5871 5872@InProceedings{ pp8, 5873 author = {E. G. Paterson and L. J. Peltier}, 5874 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 5875 refinement grids and detached-eddy simulation}, 5876 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5877 year = {2004}, 5878 petsc_uses = {KSP} 5879} 5880 5881@InProceedings{ mzwp, 5882 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 5883 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 5884 booktitle = {25th Symposium on Naval Hydrodynamics}, 5885 year = {2004}, 5886 petsc_uses = {KSP} 5887} 5888 5889@InProceedings{ ppph, 5890 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 5891 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 5892 booktitle = {25th Symposium on Naval Hydrodynamics}, 5893 year = {2004}, 5894 petsc_uses = {KSP} 5895} 5896 5897@InProceedings{ ppd, 5898 author = {E. G. Paterson and L. J. Peltier}, 5899 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 5900 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 5901 year = {2004}, 5902 petsc_uses = {KSP} 5903} 5904 5905@InProceedings{ bp, 5906 author = {W. J. Baker and E. G. and Paterson}, 5907 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 5908 Control Wing}, 5909 booktitle = {NASA/ONR Workshop on Circulation Control}, 5910 year = {2004}, 5911 petsc_uses = {KSP} 5912} 5913 5914@InProceedings{ pb, 5915 author = {E. G. Paterson and W. J. Baker}, 5916 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 5917 booktitle = {NASA/ONR Workshop on Circulation Control}, 5918 year = {2004}, 5919 petsc_uses = {KSP} 5920} 5921 5922@InProceedings{ pb3, 5923 author = {E. G. Paterson and W. J. Baker}, 5924 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 5925 Surfaces}, 5926 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 5927 year = {2004}, 5928 petsc_uses = {KSP} 5929} 5930 5931@InProceedings{ gid1, 5932 author = {G. Frank and J. D'Elia}, 5933 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 5934 year = {2004}, 5935 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 5936 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 5937 petsc_uses = {KSP} 5938} 5939 5940@InBook{ b1, 5941 author = {A.Bonfiglioli}, 5942 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 5943 year = {2001}, 5944 title = {Science and Supercomputing at CINECA}, 5945 pages = {397--400}, 5946 petsc_uses = {KSP} 5947} 5948 5949@InProceedings{ b2004, 5950 author = {L. A. Barba}, 5951 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 5952 fully meshless formulation}, 5953 year = {2004}, 5954 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 5955 note = {Submitted}, 5956 petsc_uses = {KSP} 5957} 5958 5959@InProceedings{ bl2004, 5960 author = {L. A. Barba and A. Leonard}, 5961 title = {Computation of Viscous Vortices with Fully Meshless Method}, 5962 year = {2004}, 5963 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 5964 note = {Submitted}, 5965 petsc_uses = {KSP} 5966} 5967 5968@Article{ vws1, 5969 author = {B. G. M. Van Wachem and J. C. Schouten}, 5970 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 5971 Velocity}, 5972 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 5973 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 5974 Netherlands}, 5975 journal = {AIChE}, 5976 volumne = {48}, 5977 number = {12}, 5978 month = dec, 5979 year = {2002}, 5980 petsc_uses = {KSP} 5981} 5982 5983@TechReport{ lbam1, 5984 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 5985 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 5986 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 5987 di Bari Italy}, 5988 year = {2002}, 5989 number = {25/02}, 5990 petsc_uses = {KSP} 5991} 5992 5993@Article{ kees_miller_02, 5994 author = {C. E. Kees and C. T. Miller}, 5995 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 5996 journal = {Advances in Water Resources}, 5997 year = {2002}, 5998 volume = {25}, 5999 number = {2}, 6000 pages = {159-177.}, 6001 petsc_uses = {KSP} 6002} 6003 6004@InProceedings{ lepotmeersessers2001, 6005 author = {I. Lepot and F. Meers and J.A. Essers}, 6006 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 6007 Unstructured Meshes}, 6008 year = {2001}, 6009 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 6010 url = {http://www.ulg.ac.be/aerodyn}, 6011 petsc_uses = {KSP} 6012} 6013 6014@InProceedings{ knepley98, 6015 author = {Matthew Knepley and Denis Vanderstraeten}, 6016 title = {Parallel Building Blocks for Finite Element Simulations: Application to 6017 Solid-Liquid Mixture Flows}, 6018 booktitle = {Proceedings of Parallel CFD'97}, 6019 publisher = {Elsevier}, 6020 pages = {281--287}, 6021 year = {1998}, 6022 petsc_uses = {KSP} 6023} 6024 6025@InProceedings{ pcfd97, 6026 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6027 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 6028 publisher = {Elsevier}, 6029 year = {1998}, 6030 booktitle = {Proceedings of Parallel CFD'97}, 6031 pages = {333-344}, 6032 petsc_uses = {KSP} 6033} 6034 6035@InProceedings{ knepleysamehsari98, 6036 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6037 title = {Parallel Simulation of Particulate Flows}, 6038 booktitle = {Solving Irregularly Structured Problems in Parallel}, 6039 editors = {A. Ferreira et al}, 6040 year = {1998}, 6041 series = {Lecture Notes in Computer Science}, 6042 volume = {1457}, 6043 pages = {226--237}, 6044 petsc_uses = {KSP} 6045} 6046 6047@Article{ gkmt98, 6048 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6049 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 6050 Implicit {CFD}}, 6051 journal = {Int. J. High Performance Computing Applications}, 6052 year = {2000}, 6053 volume = {14}, 6054 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 6055 pages = {102-136}, 6056 petsc_uses = {KSP} 6057} 6058 6059@InProceedings{ agkks-sc99, 6060 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 6061 Smith}, 6062 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 6063 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 6064 editor = {}, 6065 publisher = {}, 6066 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 6067 year = {1999}, 6068 note = {Winner of Gordon Bell Special Prize at SC 99}, 6069 petsc_uses = {KSP} 6070} 6071 6072@Article{ gkks01, 6073 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6074 title = {High Performance Parallel Implicit {CFD}}, 6075 journal = {Journal of Parallel Computing}, 6076 year = {2001}, 6077 volume = {27}, 6078 pages = {337-362}, 6079 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 6080 petsc_uses = {KSP} 6081} 6082 6083@Article{ cristea-sofonea-02, 6084 author = {Artur Cristea and Victor Sofonea}, 6085 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 6086 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6087 Sciences, Information Sciences}, 6088 volume = {3}, 6089 number = {3}, 6090 year = {2002}, 6091 petsc_uses = {KSP} 6092} 6093 6094@Article{ cristea2, 6095 author = {Artur Cristea and Victor Sofonea}, 6096 title = {Two component lattice Boltzmann model with flux limiter techniques}, 6097 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6098 Sciences, Information Sciences}, 6099 volume = {4}, 6100 number = {1}, 6101 year = {2003}, 6102 pages = {59--64}, 6103 petsc_uses = {KSP} 6104} 6105 6106@Article{ cristea1, 6107 author = {Artur Cristea and Victor Sofonea}, 6108 title = {Two component lattice Boltzmann model with flux limiters}, 6109 journal = {Central European Journal of Physics}, 6110 volume = {2}, 6111 number = {2}, 6112 year = {2004}, 6113 pages = {382--396}, 6114 petsc_uses = {KSP} 6115} 6116 6117@Article{ sofnea-lamura1, 6118 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 6119 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 6120 systems}, 6121 journal = {Physical Review E}, 6122 volume = {70}, 6123 number = {4}, 6124 year = {2004}, 6125 pages = {046702-1 / 046702-9}, 6126 petsc_uses = {KSP} 6127} 6128 6129@InProceedings{ gkks01b, 6130 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6131 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 6132 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 6133 Mechanics}, 6134 editor = {}, 6135 location = {Cambridge, MA}, 6136 year = {2001}, 6137 month = jun, 6138 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 6139 petsc_uses = {KSP} 6140} 6141 6142@InProceedings{ gkks00, 6143 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6144 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 6145 Code}, 6146 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 6147 (HiPC '2000)}, 6148 editor = {}, 6149 location = {Bangalore, India}, 6150 year = {2000}, 6151 pages = {395--404}, 6152 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 6153 petsc_uses = {KSP} 6154} 6155 6156@InProceedings{ gkks-sc00, 6157 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6158 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 6159 booktitle = {Proceedings of SC2000}, 6160 editor = {}, 6161 publisher = {IEEE Computer Society}, 6162 year = {2000}, 6163 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 6164 petsc_uses = {KSP} 6165} 6166 6167@InProceedings{ knepleysamehsarin99, 6168 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6169 title = {Design of Large Scale Parallel Simulations}, 6170 booktitle = {Proceedings of Parallel CFD'99}, 6171 editors = {A. {Ecer et al.}}, 6172 publisher = {Elsevier}, 6173 year = {1999}, 6174 petsc_uses = {KSP} 6175} 6176 6177@InProceedings{ gkks-pcfd99, 6178 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 6179 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 6180 booktitle = {Proceedings of Parallel CFD'99}, 6181 editors = {A. {Ecer et al.}}, 6182 publisher = {Elsevier}, 6183 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 6184 year = {1999}, 6185 petsc_uses = {KSP} 6186} 6187 6188@InProceedings{ kks97, 6189 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6190 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 6191 Parallelization of an Unstructured Grid Incompressible Flow Code}, 6192 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 6193 Methods}, 6194 editor = {J. Mandel et al.}, 6195 pages = {311--319}, 6196 publisher = {Wiley}, 6197 note = {}, 6198 year = {1997}, 6199 petsc_uses = {KSP} 6200} 6201 6202@InProceedings{ kks99, 6203 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6204 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 6205 Incompressible Flows on Unstructured Grids}, 6206 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6207 Methods}, 6208 editors = {C.-H. {Lai et al.}}, 6209 publisher = {Domain Decomposition Press, Bergen}, 6210 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 6211 year = {1999}, 6212 petsc_uses = {KSP} 6213} 6214 6215@InCollection{ kks97_cfd, 6216 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 6217 title = {Perspectives for {CFD} on Petaflops Systems}, 6218 booktitle = {CFD Review 1998}, 6219 editor = {M. Hafez and K. Oshima}, 6220 publisher = {World Scientific, Singapore}, 6221 pages = {1079--1096}, 6222 note = {}, 6223 year = {1998}, 6224 petsc_uses = {KSP} 6225} 6226 6227@Article{ hm99, 6228 author = {P. D. Hovland and L. C. McInnes}, 6229 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 6230 {PETSc}}, 6231 year = {2000}, 6232 journal = {Parallel Computing}, 6233 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 6234 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 6235 petsc_uses = {KSP} 6236} 6237 6238@InProceedings{ cruzbarbaknepley08, 6239 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 6240 title = {Fast Multipole Method for particle interactions: an open source parallel library 6241 component}, 6242 booktitle = {Proceedings of ParCFD2008}, 6243 year = {2008}, 6244 editor = {Tromeur-Dervout et. al.}, 6245 publisher = {Elsevier}, 6246 petsc_uses = {KSP} 6247} 6248 6249@Article{ hwangcai05, 6250 author = {F.-N. Hwang and X.-C. Cai}, 6251 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 6252 for incompressible {Navier-Stokes} equations}, 6253 journal = {J. Comput. Phys.}, 6254 volume = {204}, 6255 year = {2005}, 6256 pages = {666--691}, 6257 petsc_uses = {KSP} 6258} 6259 6260@Article{ barbaleonard07, 6261 author = {Lorena A Barba and Anthony Leonard}, 6262 title = {Emergence and evolution of tripole vortices from net-circulation initial 6263 conditions}, 6264 journal = {Phys. Fluids}, 6265 volume = {19}, 6266 pages = {017101}, 6267 year = {2007}, 6268 doi = {10.1063/1.2409734}, 6269 petsc_uses = {KSP} 6270} 6271 6272@Article{ barba07, 6273 author = {Lorena A Barba}, 6274 title = {Non-shielded multipolar vortices at high Reynolds number}, 6275 journal = {Phys. Rev. E}, 6276 volume = {73}, 6277 pages = {065303}, 6278 year = {2006}, 6279 doi = {10.1103/PhysRevE.73.065303}, 6280 petsc_uses = {KSP} 6281} 6282 6283@Article{ schofield2010multi, 6284 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 6285 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 6286 Lowrie, R.B. and Swartz, B.K.}, 6287 journal = {International Journal for Numerical Methods in Fluids}, 6288 volume = {63}, 6289 number = {8}, 6290 pages = {931--952}, 6291 year = {2010}, 6292 publisher = {Wiley Online Library}, 6293 petsc_uses = {KSP} 6294} 6295 6296% LiteralHTML: 6297% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 6298% LiteralHTML: 6299% LiteralHTML: article{DeGersem99, 6300% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 6301% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 6302% LiteralHTML: } 6303@Article{ nagler2014, 6304 title = {Sound transmission through a poroelastic layered panel}, 6305 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 6306 journal = {Computational Mechanics}, 6307 volume = {53}, 6308 number = {4}, 6309 pages = {549--560}, 6310 issn = {1432-0924}, 6311 doi = {10.1007/s00466-013-0916-x}, 6312 year = {2014}, 6313 petsc_uses = {KSP} 6314} 6315 6316@Article{ sheikh2013, 6317 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 6318 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 6319 deflation}, 6320 journal = {Numerical Linear Algebra with Applications}, 6321 volume = {20}, 6322 number = {4}, 6323 issn = {1099-1506}, 6324 doi = {10.1002/nla.1882}, 6325 pages = {645--662}, 6326 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 6327 analysis}, 6328 year = {2013}, 6329 petsc_uses = {KSP} 6330} 6331 6332@InProceedings{ silence, 6333 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 6334 Fuenmayor}, 6335 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 6336 Application to the study of acoustic behaviour of silencers}, 6337 year = {2004}, 6338 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 6339 (ECCOMAS)}, 6340 petsc_uses = {KSP} 6341} 6342 6343@Article{ degersem99, 6344 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 6345 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 6346 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 6347 journal = {COMPEL}, 6348 year = {1999}, 6349 volume = {18}, 6350 number = {3}, 6351 pages = {298--310}, 6352 bibdate = {}, 6353 petsc_uses = {KSP} 6354} 6355 6356@InProceedings{ widlund-wave-98, 6357 author = {Olof B. Widlund}, 6358 title = {Schwarz Methods for {H}elmholtz's Equation}, 6359 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6360 editor = {John A. DeSanto}, 6361 year = {1998}, 6362 publisher = {SIAM}, 6363 pages = {620--622}, 6364 address = {Philadelphia}, 6365 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6366 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6367 petsc_uses = {KSP} 6368} 6369 6370@InProceedings{ toselli-wave-98, 6371 author = {Andrea Toselli}, 6372 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 6373 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6374 editor = {John A. DeSanto}, 6375 year = {1998}, 6376 publisher = {SIAM}, 6377 address = {Philadelphia}, 6378 pages = {540--542}, 6379 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6380 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6381 petsc_uses = {KSP} 6382} 6383 6384@InProceedings{ mcinnes-wave-98, 6385 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 6386 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 6387 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6388 editor = {John A. DeSanto}, 6389 year = {1998}, 6390 publisher = {SIAM}, 6391 address = {Philadelphia}, 6392 pages = {623--625}, 6393 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6394 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6395 petsc_uses = {KSP} 6396} 6397 6398@InProceedings{ mska98, 6399 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 6400 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 6401 Parallel Computation of {H}elmholtz Problems}, 6402 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6403 editor = {J. Mandel et al.}, 6404 publisher = {AMS}, 6405 pages = {349--357}, 6406 year = {1998}, 6407 petsc_uses = {KSP} 6408} 6409 6410@InProceedings{ ccew98, 6411 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 6412 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 6413 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6414 editor = {J. Mandel et al.}, 6415 publisher = {AMS}, 6416 pages = {437-445}, 6417 year = {1998}, 6418 petsc_uses = {KSP} 6419} 6420 6421@InProceedings{ ra98a, 6422 author = {R. Susan-Resiga and H. M. Atassi}, 6423 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 6424 Problems}, 6425 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 6426 publisher = {AIAA}, 6427 pages = {86-96}, 6428 note = {AIAA paper 98-2218}, 6429 year = {1998}, 6430 petsc_uses = {KSP} 6431} 6432 6433@InProceedings{ ar98c, 6434 author = {H. M. Atassi and R. Susan-Resiga}, 6435 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 6436 General Formulation}, 6437 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6438 publisher = {ASME}, 6439 note = {NCA-25}, 6440 pages = {375-379}, 6441 year = {1998}, 6442 petsc_uses = {KSP} 6443} 6444 6445@InProceedings{ ra98b, 6446 author = {R. Susan-Resiga and H. M. Atassi}, 6447 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 6448 Numerical Implementation and Applications}, 6449 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6450 publisher = {ASME}, 6451 note = {NCA-25}, 6452 pages = {381 -388}, 6453 year = {1998}, 6454 petsc_uses = {KSP} 6455} 6456 6457@InProceedings{ cai-dd10-98, 6458 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 6459 Widlund}, 6460 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 6461 booktitle = {Domain Decomposition Methods 10}, 6462 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 6463 series = {Contemporary Mathematics}, 6464 volume = {218}, 6465 publisher = {American Mathematical Society}, 6466 address = {Providence, Rhode Island}, 6467 year = {1998}, 6468 pages = {437--445}, 6469 petsc_uses = {KSP} 6470} 6471 6472@InProceedings{ alghamdi2011petclaw, 6473 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 6474 booktitle = {Proceedings of SpringSim 2011}, 6475 publisher = {ACM}, 6476 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 6477 Kyle T. Mandli and Lisandro Dalcin}, 6478 year = {2011}, 6479 petsc_uses = {KSP} 6480} 6481 6482@Article{ pyclaw2012, 6483 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 6484 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 6485 Emmett}, 6486 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 6487 journal = {SIAM Journal on Scientific Computing}, 6488 volume = {34}, 6489 number = {4}, 6490 pages = {C210--C231}, 6491 note = {\url{http://arxiv.org/abs/1111.6583}}, 6492 year = {2012}, 6493 petsc_uses = {KSP} 6494} 6495 6496% LiteralHTML: 6497% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 6498% LiteralHTML: 6499@Article{ sojkahorakhaplacermak2018, 6500 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 6501 decomposition method}, 6502 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 6503 journal = {Applied Mathematics and Computation}, 6504 volume = {319}, 6505 pages = {586--597}, 6506 year = {2018}, 6507 petsc_uses = {KSP} 6508} 6509 6510@Article{ chencai2014, 6511 title = {A parallel two-level domain decomposition based one-shot method for shape 6512 optimization problems}, 6513 author = {Rongliang Chen and Xiao‐Chuan Cai}, 6514 journal = {International Journal for Numerical Methods in Engineering}, 6515 volume = {99}, 6516 number = {13}, 6517 year = {2014}, 6518 doi = {10.1002/nme.4711}, 6519 petsc_uses = {KSP} 6520} 6521 6522@PhDThesis{ prudencio2005, 6523 author = {Ernesto Prudencio}, 6524 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 6525 for Optimization Problems Constrained by Partial Differential Equations}, 6526 school = {University of Colorado, Boulder}, 6527 year = {2005}, 6528 petsc_uses = {KSP} 6529} 6530 6531@Article{ prudenciocai2007, 6532 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 6533 for {PDE}-constrained optimization}, 6534 author = {Ernesto Prudencio and X. C. Cai}, 6535 journal = {SIAM J. Sci. Comp.}, 6536 volume = {29}, 6537 number = {3}, 6538 pages = {964--985}, 6539 year = {2007}, 6540 petsc_uses = {KSP} 6541} 6542 6543@Article{ prudenciobyrdcai2006, 6544 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6545 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 6546 {PDE}-constrained Optimization Problems}, 6547 journal = {SIAM J. Sci. Comp.}, 6548 volume = {27}, 6549 pages = {1305--1328}, 6550 year = {2006}, 6551 petsc_uses = {KSP} 6552} 6553 6554@InProceedings{ prudenciobyrdcai2004, 6555 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 6556 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6557 booktitle = {VECPAR 2004}, 6558 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 6559 publisher = {Springer}, 6560 pages = {569--582}, 6561 year = {2004}, 6562 petsc_uses = {KSP} 6563} 6564 6565@Article{ belhamadia-fortin-pcp, 6566 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 6567 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 6568 journal = {Journal of Computational Physics}, 6569 volume = {201}, 6570 pages = {753-770}, 6571 year = {2004}, 6572 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 6573 petsc_uses = {KSP} 6574} 6575 6576@Article{ biros00, 6577 author = {George Biros and Omar Ghattas}, 6578 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 6579 journal = {SIAG-Opt Views and News}, 6580 volume = {11}, 6581 number = {2}, 6582 year = {2000}, 6583 month = aug, 6584 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 6585 petsc_uses = {KSP} 6586} 6587 6588@Article{ bmm01, 6589 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 6590 journal = {ACM Transactions on Mathematical Software}, 6591 title = {A case study in the performance and scalability of optimization algorithms}, 6592 year = {2001}, 6593 volume = {27}, 6594 number = {3}, 6595 pages = {361--376}, 6596 petsc_uses = {KSP} 6597} 6598 6599@InProceedings{ oghattas1999, 6600 author = {George Biros and Omar Ghattas}, 6601 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 6602 incompressible flows}, 6603 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 6604 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 6605 year = {1999}, 6606 petsc_uses = {KSP} 6607} 6608 6609@InProceedings{ hkms00, 6610 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 6611 PDE-constrained Optimization}, 6612 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 6613 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 6614 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 6615 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 6616 Hasco\"{e}t and Uwe Naumann}, 6617 publisher = {Springer}, 6618 year = {2002}, 6619 petsc_uses = {KSP} 6620} 6621 6622% old version: replace with biros2005pln1 6623@TechReport{ bg011, 6624 author = {George Biros and Omar Ghattas}, 6625 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 6626 Part I: The Krylov-Schur Solver}, 6627 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6628 year = {2001}, 6629 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 6630 petsc_uses = {KSP} 6631} 6632 6633% old version: replace with biros2005pln2 6634@TechReport{ bg012, 6635 author = {George Biros and Omar Ghattas}, 6636 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 6637 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 6638 Optimal Control of Steady Viscous Flows}, 6639 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6640 year = {2001}, 6641 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 6642 petsc_uses = {KSP} 6643} 6644 6645% LiteralHTML: 6646% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 6647% LiteralHTML: 6648@InProceedings{ ly2003, 6649 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 6650 title = {A New Parallel Kernel-independent Fast Multipole Method}, 6651 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 6652 year = {2003}, 6653 note = {Winner of the Best Student Paper at SC2003}, 6654 petsc_uses = {KSP} 6655} 6656 6657@Article{ yokotabarbaknepley10, 6658 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 6659 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 6660 journal = {Computer Methods in Applied Mechanics and Engineering}, 6661 volume = {199}, 6662 number = {25-28}, 6663 pages = {1793--1804}, 6664 url = {http://arxiv.org/abs/0909.5413v1}, 6665 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 6666 year = {2010}, 6667 petsc_uses = {KSP} 6668} 6669 6670@Article{ cruzknepleybarba10, 6671 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 6672 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 6673 journal = {International Journal of Numerical Methods in Engineering}, 6674 volume = {85}, 6675 number = {4}, 6676 pages = {403--428}, 6677 url = {http://arxiv.org/abs/0905.2637}, 6678 note = {\url{http://arxiv.org/abs/0905.2637}}, 6679 year = {2010}, 6680 petsc_uses = {KSP} 6681} 6682 6683% LiteralHTML: 6684% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 6685% LiteralHTML: 6686@Article{ buchanpainumplebysmedleystevenson2012, 6687 title = {A sub-grid scale finite element agglomeration multigrid method with application 6688 to the Boltzmann transport equation}, 6689 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 6690 journal = {International Journal for Numerical Methods in Engineering}, 6691 volume = {92}, 6692 number = {3}, 6693 pages = {318--342}, 6694 year = {2012}, 6695 publisher = {Wiley Online Library}, 6696 petsc_uses = {KSP} 6697} 6698 6699@Article{ magoulesahamedsuzuki2015, 6700 title = {Green computing on graphics processing units}, 6701 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 6702 journal = {Concurrency and Computation: Practice and Experience}, 6703 year = {2015}, 6704 publisher = {Wiley Online Library}, 6705 petsc_uses = {KSP} 6706} 6707 6708@InProceedings{ yanrhodes11, 6709 author = {Yan, Baoqiang and Rhodes, Philip J.}, 6710 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 6711 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 6712 series = {ICPP '11}, 6713 pages = {355--364}, 6714 year = {2011}, 6715 isbn = {978-0-7695-4510-3}, 6716 numpages = {10}, 6717 doi = {10.1109/ICPP.2011.70}, 6718 acmid = {2066965}, 6719 publisher = {IEEE Computer Society}, 6720 address = {Washington, DC, USA}, 6721 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 6722 petsc_uses = {KSP} 6723} 6724 6725@Article{ hakansson2013mdstochasticliouville, 6726 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 6727 Stulz, Eugen}, 6728 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 6729 equation study}, 6730 journal = {Phys. Chem. Chem. Phys.}, 6731 year = {2013}, 6732 volume = {15}, 6733 issue = {26}, 6734 pages = {10930-10941}, 6735 publisher = {The Royal Society of Chemistry}, 6736 doi = {10.1039/C3CP50788B}, 6737 petsc_uses = {KSP} 6738} 6739 6740@Article{ hakansson2011stochasticliouville, 6741 author = {Hakansson, Par and Nair, Prasanth B.}, 6742 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 6743 form}, 6744 journal = {Phys. Chem. Chem. Phys.}, 6745 year = {2011}, 6746 volume = {13}, 6747 issue = {20}, 6748 pages = {9578-9589}, 6749 publisher = {The Royal Society of Chemistry}, 6750 doi = {10.1039/C1CP20400A}, 6751 petsc_uses = {KSP} 6752} 6753 6754@InProceedings{ wang:lee:scidac2011, 6755 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 6756 McInnes and Todd Munson and Barry Smith}, 6757 title = {A Differential Variational Inequality Approach for the Simulation of 6758 Heterogeneous Materials}, 6759 booktitle = {Proceedings of SciDAC 2011 Conference}, 6760 year = {2011}, 6761 petsc_uses = {KSP} 6762} 6763 6764@Article{ bourdinlarsenrichardson2011, 6765 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 6766 title = {A time-discrete model for dynamic fracture based on crack regularization}, 6767 journal = {International Journal of Fracture}, 6768 volume = {168}, 6769 issue = {2}, 6770 pages = {133--143}, 6771 doi = {10.1007/s10704-010-9562-x}, 6772 year = {2011}, 6773 petsc_uses = {KSP} 6774} 6775 6776@Article{ bourdinfrancfortmarigo2008, 6777 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 6778 title = {The Variational Approach to Fracture}, 6779 journal = {J. Elasticity}, 6780 volume = {91}, 6781 issue = {1}, 6782 pages = {1--148}, 6783 doi = {10.1007/s10659-007-9107-3}, 6784 year = {2008}, 6785 petsc_uses = {KSP} 6786} 6787 6788@Article{ lahtinen2008spectrum, 6789 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 6790 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 6791 J.K.}, 6792 journal = {Annals of Physics}, 6793 volume = {323}, 6794 number = {9}, 6795 pages = {2286--2310}, 6796 year = {2008}, 6797 publisher = {Elsevier}, 6798 petsc_uses = {KSP} 6799} 6800 6801@InProceedings{ roark2004discriminative, 6802 title = {Discriminative language modeling with conditional random fields and the 6803 perceptron algorithm}, 6804 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 6805 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 6806 Linguistics}, 6807 pages = {47}, 6808 year = {2004}, 6809 organization = {Association for Computational Linguistics}, 6810 petsc_uses = {KSP} 6811} 6812 6813@Article{ roark2007discriminative, 6814 title = {Discriminative n-gram language modeling}, 6815 author = {Roark, B. and Saraclar, M. and Collins, M.}, 6816 journal = {Computer Speech \& Language}, 6817 volume = {21}, 6818 number = {2}, 6819 pages = {373--392}, 6820 year = {2007}, 6821 publisher = {Elsevier}, 6822 petsc_uses = {KSP} 6823} 6824 6825@Conference{ garcia2011parallel, 6826 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 6827 nanodevice simulators}}, 6828 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 6829 Aldegunde, M.}, 6830 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 6831 pages = {1--4}, 6832 organization = {IEEE}, 6833 petsc_uses = {KSP} 6834} 6835 6836@Conference{ wesley2006parallel, 6837 title = {{A parallel artificial neural network implementation}}, 6838 author = {Wesley-Smith, I.}, 6839 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 6840 year = {2006}, 6841 petsc_uses = {KSP} 6842} 6843 6844@Article{ hcsw1, 6845 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 6846 title = {Parallel {N}ewton--{K}rylov--{S}chwarz algorithms for the three-dimensional 6847 {P}oisson--{B}oltzmann equation in numerical simulation of colloidal particle 6848 interactions}, 6849 journal = {Computer Physics Communications}, 6850 volumne = {181}, 6851 year = {2010}, 6852 pages = {1529--1537}, 6853 petsc_uses = {KSP} 6854} 6855 6856@Article{ hh1, 6857 author = {C.-Y. Huang and F.-N. Hwang}, 6858 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 6859 bifurcation analysis of incompressible sudden expansion flows}, 6860 journal = {Applied Numerical Mathematics}, 6861 volume = {60}, 6862 year = {2010}, 6863 pages = {738--751}, 6864 petsc_uses = {KSP} 6865} 6866 6867@Article{ hwhw1, 6868 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 6869 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 6870 polynomial eigenvalue problems in quantum dot simulation}, 6871 journal = {Journal of Computational Physics}, 6872 volume = {229}, 6873 year = {2010}, 6874 pages = {2932--2947}, 6875 petsc_uses = {KSP} 6876} 6877 6878@Article{ wei2011parallel, 6879 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 6880 Application in Quantum Dot Simulation}}, 6881 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 6882 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 6883 pages = {157--164}, 6884 year = {2011}, 6885 publisher = {Springer}, 6886 petsc_uses = {KSP} 6887} 6888 6889@Article{ flores2007sequential, 6890 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 6891 equation using second-degree iterative methods}}, 6892 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 6893 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 6894 pages = {426--438}, 6895 year = {2007}, 6896 publisher = {Springer}, 6897 petsc_uses = {KSP} 6898} 6899 6900@InProceedings{ gordonbell09, 6901 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 6902 Siegel and Won Sik Yang}, 6903 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 6904 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 6905 note = {{SC'09 Gordon Bell} Prize Finalist}, 6906 year = {2009}, 6907 petsc_uses = {KSP} 6908} 6909 6910@Article{ knepleykarpeevdavidovitseisenberggillespie10, 6911 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 6912 Eisenberg and Dirk Gillespie}, 6913 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 6914 Dimensions: Ionic Solutions}, 6915 journal = {Journal of Physical Chemistry}, 6916 volume = {132}, 6917 number = {12}, 6918 pages = {124101--124111}, 6919 url = {http://arxiv.org/abs/0910.1531}, 6920 year = {2010}, 6921 petsc_uses = {KSP} 6922} 6923 6924@Article{ knepleykarpeeveisenberggillespie09, 6925 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 6926 D.}, 6927 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 6928 Functional Theory Approach}}, 6929 journal = {Biophysical Journal}, 6930 month = feb, 6931 volume = {96}, 6932 pages = {661}, 6933 doi = {10.1016/j.bpj.2008.12.3494}, 6934 year = {2009}, 6935 petsc_uses = {KSP} 6936} 6937 6938@Article{ scx2008, 6939 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 6940 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 6941 CONCRETE}, 6942 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 6943 volume = {3}, 6944 number = {4}, 6945 year = {2006}, 6946 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 6947 petsc_uses = {KSP} 6948} 6949 6950@TechReport{ kdgs2008, 6951 year = {2008}, 6952 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 6953 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 6954 Chips}, 6955 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 6956 Stortia}, 6957 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 6958 petsc_uses = {KSP} 6959} 6960 6961@Article{ springerlink:10.1007/s10915-011-9551-x, 6962 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 6963 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 6964 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 6965 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 6966 Coupled FEM/SBFEM Approach}, 6967 journal = {Journal of Scientific Computing}, 6968 publisher = {Springer Netherlands}, 6969 issn = {0885-7474}, 6970 keyword = {Mathematics and Statistics}, 6971 pages = {1-22}, 6972 doi = {10.1007/s10915-011-9551-x}, 6973 petsc_uses = {KSP} 6974} 6975 6976@TechReport{ jj2007, 6977 author = {Boris Jeremic and Guanzhou Jie}, 6978 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 6979 Problems Report}, 6980 institution = {UCD CompGeoMech 02--2007}, 6981 year = {2007}, 6982 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 6983 petsc_uses = {KSP} 6984} 6985 6986@Unpublished{ kuiper08, 6987 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 6988 author = {Rolf Kuiper}, 6989 institution = {Max-Planck-Institute for Astronomy}, 6990 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 6991 year = {2008}, 6992 petsc_uses = {KSP} 6993} 6994 6995@Article{ williamson2012multidimensional, 6996 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 6997 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 6998 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 6999 journal = {Journal of Nuclear Materials}, 7000 volume = {423}, 7001 number = {1}, 7002 pages = {149--163}, 7003 year = {2012}, 7004 publisher = {Elsevier}, 7005 petsc_uses = {KSP} 7006} 7007 7008@InProceedings{ kucukboyaci2015cobra, 7009 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 7010 analysis}, 7011 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 7012 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 7013 Nuclear Applications and the Monte Carlo Method}, 7014 pages = {1--18}, 7015 year = {2015}, 7016 petsc_uses = {KSP} 7017} 7018 7019@Article{ hales2012solving, 7020 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 7021 {K}rylov Method}, 7022 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 7023 M.R.}, 7024 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 7025 volume = {84}, 7026 number = {2}, 7027 pages = {123--153}, 7028 year = {2012}, 7029 publisher = {Tech Science Press}, 7030 petsc_uses = {KSP} 7031} 7032 7033@InProceedings{ srksyp2008, 7034 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 7035 Palmiotti}, 7036 title = {Fast reactor core simulations using the {UNIC} code}, 7037 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 7038 Power: A Sustainable Resource}, 7039 year = {2008}, 7040 petsc_uses = {KSP} 7041} 7042 7043@InProceedings{ psrlkssl2007, 7044 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 7045 Siegel and B. Smith and E. E. Lewis}, 7046 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 7047 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7048 Supercomputing in Nuclear Applications}, 7049 year = {2007}, 7050 petsc_uses = {KSP} 7051} 7052 7053@InProceedings{ sprkssl2007, 7054 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 7055 Smith and E. E. Lewis}, 7056 title = {{PNFE} Component of the {UNIC} Code}, 7057 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7058 Supercomputing in Nuclear Applications}, 7059 year = {2007}, 7060 petsc_uses = {KSP} 7061} 7062 7063@InProceedings{ dc-oop-03, 7064 author = {H. Digonnet and T. Coupez}, 7065 title = {Object-oriented programming for fast-and-easy development of parallel 7066 applications in forming processes simulation}, 7067 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 7068 Mechanics}, 7069 year = {2003}, 7070 petsc_uses = {KSP} 7071} 7072 7073@InProceedings{ dc-cfm-03, 7074 author = {H. Digonnet and T. Coupez}, 7075 title = {Calcul parallele en mise en forme des materiaux}, 7076 booktitle = {XVIeme Congres Francais de Mecanique}, 7077 year = {2003}, 7078 petsc_uses = {KSP} 7079} 7080 7081@InProceedings{ dsc-pcsev-04, 7082 author = {H. Digonnet and L. Silva and T. Coupez}, 7083 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 7084 booktitle = {Proceedings of ECCOMAS 2004}, 7085 year = {2004}, 7086 petsc_uses = {KSP} 7087} 7088 7089@InProceedings{ dsc-pca3fs-04, 7090 author = {H. Digonnet and L. Silva and T. Coupez}, 7091 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 7092 booktitle = {Proceedings of WCCM VI}, 7093 year = {2004}, 7094 petsc_uses = {KSP} 7095} 7096 7097@InProceedings{ dbcs-cpaac-05, 7098 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 7099 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 7100 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 7101 year = {2005}, 7102 petsc_uses = {KSP} 7103} 7104 7105@Article{ sz2010, 7106 author = {B. Smith and H. Zhang}, 7107 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 7108 Performance}, 7109 journal = {International Journal of High Performance Computing Applications}, 7110 volume = {25}, 7111 number = {4}, 7112 pages = {386--391}, 7113 year = {2011}, 7114 petsc_uses = {KSP} 7115} 7116 7117@Article{ zssz2006, 7118 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 7119 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 7120 journal = {TOMS}, 7121 url = {http://math.nist.gov/toms/Current.html#v33n2}, 7122 volumne = {33}, 7123 number = {2}, 7124 year = {2007}, 7125 petsc_uses = {KSP} 7126} 7127 7128@Article{ gs2006, 7129 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 7130 title = {The detachment of a viscous drop in a viscous solution in the presence of a 7131 soluble surfactant}, 7132 journal = {Phys. Fluids}, 7133 volume = {18}, 7134 year = {2006}, 7135 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 7136 petsc_uses = {KSP} 7137} 7138 7139@Article{ jmemsci, 7140 author = {Bo Zhou and Adam Powell}, 7141 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 7142 of Polymeric Membranes in 2D and 3D}, 7143 journal = {J. Membrane Sci.}, 7144 volume = {268}, 7145 number = {2}, 7146 pages = {150--164}, 7147 year = {2006}, 7148 month = jan, 7149 day = {15}, 7150 doi = {10.1016/j.memsci.2005.05.030}, 7151 petsc_uses = {KSP} 7152} 7153 7154@InProceedings{ vbde2002, 7155 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 7156 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 7157 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 7158 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7159 year = {2002}, 7160 petsc_uses = {KSP} 7161} 7162 7163@InProceedings{ wid2005, 7164 author = {Alexander I. Bobenko and Peter Schrader}, 7165 title = {Discrete Willmore Flow}, 7166 booktitle = {Eurographics Symposium on Geometry Processing}, 7167 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 7168 year = {2005}, 7169 editor = {M. Desbrun and H. Pottmann}, 7170 petsc_uses = {KSP} 7171} 7172 7173@Article{ stj2003, 7174 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 7175 journal = {International Journal for Numerical Methods in Fluids}, 7176 volume = {41}, 7177 issue = {4}, 7178 title = {A numerical method for inverse design based on the inverse Euler equations}, 7179 year = {2003}, 7180 pages = {339--355}, 7181 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 7182 petsc_uses = {KSP} 7183} 7184 7185@PhDThesis{ as2001, 7186 author = {ANDREA SCASCIGHINI}, 7187 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 7188 Inverse Euler Equations}, 7189 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 7190 year = {2001}, 7191 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 7192 petsc_uses = {KSP} 7193} 7194 7195@Article{ hb2005, 7196 author = {E. McKay Hyde and Oscar P. Bruno}, 7197 journal = {Journal of Computational Physics}, 7198 volume = {202}, 7199 title = {A fast, higher-order solver for scattering by penetrable bodies in three 7200 dimensions}, 7201 year = {2005}, 7202 pages = {236--261}, 7203 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 7204 petsc_uses = {KSP} 7205} 7206 7207@MastersThesis{ d2002, 7208 author = {Matthew F Dixon}, 7209 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 7210 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 7211 school = {READING UNIVERSITY}, 7212 year = {2002}, 7213 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 7214 petsc_uses = {KSP} 7215} 7216 7217@TechReport{ gzb, 7218 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 7219 title = {Fast Parallel PageRank: A Linear System Approach}, 7220 institution = {Stanford University}, 7221 year = {2004}, 7222 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 7223 petsc_uses = {KSP} 7224} 7225 7226@PhDThesis{ yergeau-99, 7227 author = {Daniel W. Yergeau}, 7228 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 7229 SEMICONDUCTORS}, 7230 school = {Stanford}, 7231 year = {1999}, 7232 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 7233 petsc_uses = {KSP} 7234} 7235 7236@InProceedings{ rathkopf-miller-00, 7237 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 7238 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 7239 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 7240 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 7241 year = {2000}, 7242 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 7243 Physics and Mathematics and Computation into the Next Millennium}, 7244 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 7245 lab = {LLNL}, 7246 petsc_uses = {KSP} 7247} 7248 7249@Article{ bonfi-palma-pas-05, 7250 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 7251 journal = {Journal of Turbomachinery}, 7252 volume = {127}, 7253 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 7254 year = {2005}, 7255 pages = {395-401}, 7256 petsc_uses = {KSP} 7257} 7258 7259@InProceedings{ fettig-sobh-05, 7260 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 7261 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 7262 year = {2005}, 7263 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 7264 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 7265 petsc_uses = {KSP} 7266} 7267 7268@TechReport{ melnikov-matagne-05, 7269 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 7270 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 7271 title = {Spin configurations in circular and rectangular vertical quantum dots in a 7272 magnetic field: Three-dimensional self-consistent simulation}, 7273 year = {2005}, 7274 number = {Arxiv preprint cond-mat/0506585}, 7275 url = {http://arxiv.org/pdf/cond-mat/0506585}, 7276 petsc_uses = {KSP} 7277} 7278 7279@InProceedings{ richard-smedley-03, 7280 author = {Richard P. Smedley-Stevenson}, 7281 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 7282 year = {2003}, 7283 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 7284 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 7285 petsc_uses = {KSP} 7286} 7287 7288@Article{ guan-godoy-ravaioli-03, 7289 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 7290 journal = {Journal of Computational Electronics}, 7291 volume = {2}, 7292 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 7293 for Transport in a Silicon Quantum Wire Structure}, 7294 year = {2003}, 7295 pages = {335--339}, 7296 petsc_uses = {KSP} 7297} 7298 7299@Article{ ovtchinnikovcai04, 7300 author = {S. Ovtchinnikov and X.-C. Cai}, 7301 journal = {Numer. Lin. Alg. Applics}, 7302 volume = {11}, 7303 title = {One-level {N}ewton--{K}rylov--{S}chwarz algorithm for unsteady nonlinear radiation 7304 diffusion problem}, 7305 year = {2004}, 7306 pages = {867--881}, 7307 petsc_uses = {KSP} 7308} 7309 7310@Article{ mixedstress, 7311 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 7312 author = {Adam Powell and David Dussault}, 7313 journal = {Appl. Numer. Anal. Comp. Math.}, 7314 volume = {2}, 7315 number = {1}, 7316 year = {2005}, 7317 pages = {157--166}, 7318 petsc_uses = {KSP} 7319} 7320 7321@Article{ dhh2005, 7322 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 7323 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 7324 journal = {International Journal for Computation and Mathematics in Electrical and 7325 Electronic Engineering (COMPEL)}, 7326 year = {2005}, 7327 petsc_uses = {KSP} 7328} 7329 7330@Article{ dhh2004, 7331 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 7332 title = {Finite element modelling of ion convection by electrostatic forces}, 7333 journal = {IEE Proceedings Science, Measurement and Technology}, 7334 year = {2004}, 7335 volume = {151}, 7336 number = {6}, 7337 petsc_uses = {KSP} 7338} 7339 7340@Article{ adams-07b, 7341 author = {Adams M.F.}, 7342 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 7343 Frequency Response Analysis in Solid Mechanics}, 7344 journal = {Computional Mechanics}, 7345 year = {2007}, 7346 volume = {39}, 7347 number = {4}, 7348 pages = {497-507}, 7349 petsc_uses = {KSP} 7350} 7351 7352@InProceedings{ wc2004, 7353 author = {A. Wheelock and D. Cooke}, 7354 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 7355 Dimensions}, 7356 year = {2004}, 7357 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 7358 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 7359 petsc_uses = {KSP} 7360} 7361 7362@InProceedings{ allard-gouranton-ipts2002, 7363 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 7364 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 7365 year = {2002}, 7366 booktitle = {Immersive Projection Technology Symposium}, 7367 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 7368 petsc_uses = {KSP} 7369} 7370 7371@Article{ icc, 7372 author = {D Ioan and G Ciuprina and C Ciobotaru}, 7373 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 7374 journal = {IEEE Transactions on Magnetics}, 7375 year = {2000}, 7376 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 7377 petsc_uses = {KSP} 7378} 7379 7380@InProceedings{ hs1, 7381 author = {Brian J. Henz and Dale R. Shires}, 7382 title = {Development and Performance Analysis of a Parallel Finite Element Application 7383 Implemented in an Object-Oriented Programming Framework}, 7384 year = {2003}, 7385 booktitle = {PDPTA 2003}, 7386 pages = {1286-1292}, 7387 note = {Resin Transfer Modeling}, 7388 petsc_uses = {KSP} 7389} 7390 7391@TechReport{ b2000, 7392 author = {Rickard Bergstrom}, 7393 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 7394 year = {2000}, 7395 institution = {Chalmers}, 7396 number = {2000-05}, 7397 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 7398 petsc_uses = {KSP} 7399} 7400 7401@Article{ fs2004, 7402 author = {Petri Fast and Michael J. Shelley}, 7403 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 7404 Shaw Flow}, 7405 journal = {Journal of Computational Physics}, 7406 year = {2004}, 7407 volume = {195}, 7408 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 7409 pages = {117-142}, 7410 petsc_uses = {KSP} 7411} 7412 7413@MastersThesis{ wallach, 7414 author = {Hanna Wallach}, 7415 title = {Efficient Training of Conditional Random Fields}, 7416 school = {University of Edinburgh}, 7417 year = {2002}, 7418 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 7419 }osborne/msc-projects/wallach.ps.gz}, 7420 petsc_uses = {KSP} 7421} 7422 7423@Article{ something, 7424 author = {T Rylander and A Bondeson}, 7425 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 7426 equations}, 7427 journal = {Journal of Computational Physics}, 7428 year = {2002}, 7429 volume = {179}, 7430 pages = {426-438}, 7431 petsc_uses = {KSP} 7432} 7433 7434@TechReport{ uf1, 7435 author = {Uwe Fabricius}, 7436 title = {Comparison of two implementations of {AMG}-preconditioned {CG} considering an 7437 electrostatic problem}, 7438 year = {2004}, 7439 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 7440 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 7441 number = {04-1}, 7442 petsc_uses = {KSP} 7443} 7444 7445@InBook{ sg1, 7446 author = {Natalia Seoane and A.J.Garca-Loureiro}, 7447 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 7448 Equation}, 7449 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 7450 title = {Lecture Notes in Computer Science}, 7451 publisher = {Springer-Verlag}, 7452 volume = {3037}, 7453 year = {2004}, 7454 petsc_uses = {KSP} 7455} 7456 7457@Article{ nikyilmazgivisheikhipope10, 7458 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 7459 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 7460 journal = {AIAA Journal}, 7461 volume = {48}, 7462 number = {7}, 7463 pages = {1513--1522}, 7464 year = {2010}, 7465 petsc_uses = {KSP} 7466} 7467 7468@Article{ nikyilmazsheikhigivi10, 7469 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 7470 title = {Grid Resolution Effects on VSFMDF/LES}, 7471 journal = {Flow, Turbulence and Combustion}, 7472 doi = {10.1007/s10494-010-9272-5}, 7473 year = {2010}, 7474 petsc_uses = {KSP} 7475} 7476 7477@Article{ idema2013towards, 7478 title = {Towards faster solution of large power flow problems}, 7479 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 7480 and van der Sluis, Lou}, 7481 journal = {Power Systems, IEEE Transactions on}, 7482 volume = {28}, 7483 number = {4}, 7484 pages = {4918--4925}, 7485 year = {2013}, 7486 publisher = {IEEE}, 7487 petsc_uses = {KSP} 7488} 7489 7490@Article{ 6026245, 7491 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 7492 journal = {Power Systems, IEEE Transactions on}, 7493 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 7494 year = {2012}, 7495 month = feb, 7496 volume = {27}, 7497 number = {1}, 7498 pages = {390-396}, 7499 doi = {10.1109/TPWRS.2011.2165860}, 7500 issn = {0885-8950}, 7501 petsc_uses = {KSP} 7502} 7503 7504@Book{ idema2014computational, 7505 title = {Computational Methods in Power System Analysis}, 7506 author = {Idema, Reijer and Lahaye, Domenico JP}, 7507 year = {2014}, 7508 publisher = {Springer}, 7509 petsc_uses = {KSP} 7510} 7511 7512@PhDThesis{ abhyankar2011thesis, 7513 author = {Shrirang Abhyankar}, 7514 title = {Development of an implicitly coupled electromechanical and electromagnetic 7515 transients simulator for power systems}, 7516 school = {Illinois Institute of Technology}, 7517 year = {2011}, 7518 petsc_uses = {KSP} 7519} 7520 7521@InProceedings{ abhyankarhipcna11-1, 7522 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 7523 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 7524 year = {2011}, 7525 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7526 Networking and Analytics for the Power Grid}, 7527 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 7528 publisher = {ACM}, 7529 petsc_uses = {KSP} 7530} 7531 7532@InProceedings{ abhyankarhipcna11-2, 7533 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 7534 title = {Development of a parallel three-phase transient stability simulator for power 7535 systems}, 7536 year = {2011}, 7537 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7538 Networking and Analytics for the Power Grid}, 7539 publisher = {ACM}, 7540 petsc_uses = {KSP} 7541} 7542 7543@InProceedings{ abhyankarpesgeneral2012, 7544 author = {Shrirang Abhyankar and A. Flueck}, 7545 title = {An implicitly-coupled solution approach for combined electromechanical and 7546 electromagnetic transients simulation}, 7547 year = {2012}, 7548 booktitle = {Proceedings of the IEEE PES General Meeting}, 7549 publisher = {IEEE}, 7550 petsc_uses = {KSP} 7551} 7552 7553@Article{ idemalahayevuiksluis2012, 7554 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 7555 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 7556 journal = {IEEE Transactions on Power Systems}, 7557 year = {2012}, 7558 volume = {27}, 7559 pages = {390-396}, 7560 petsc_uses = {KSP} 7561} 7562 7563@Article{ korrestzavellasgalinas2013, 7564 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 7565 title = {A distributed implementation of multi-area power system state estimation on a 7566 cluster of computers }, 7567 journal = {Electric Power Systems Research }, 7568 volume = {102}, 7569 number = {0}, 7570 pages = {20 - 32}, 7571 year = {2013}, 7572 issn = {0378-7796}, 7573 doi = {10.1016/j.epsr.2013.04.002}, 7574 petsc_uses = {KSP} 7575} 7576 7577% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7578% LiteralHTML:<font color="#FF0000"> 7579% LiteralHTML: Material failure, for example, cracking of steel beams resulting 7580% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 7581% LiteralHTML: are important for prediction and prevention. PETSc has been used 7582% LiteralHTML: in a variety of studies of material failure.</p> 7583% LiteralHTML:</font> 7584% LiteralHTML: 7585@InProceedings{ gray2, 7586 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 7587 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 7588 year = {2004}, 7589 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 7590 petsc_uses = {KSP} 7591} 7592 7593@InProceedings{ gray1, 7594 author = {J. Gray and C. Homescu and L. Petzold and Richard Alkire}, 7595 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 7596 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 7597 year = {2003}, 7598 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 7599 petsc_uses = {KSP} 7600} 7601 7602@InProceedings{ crack2, 7603 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 7604 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 7605 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 7606 Conference}, 7607 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 7608 year = {2003}, 7609 petsc_uses = {KSP} 7610} 7611 7612@TechReport{ hdams1, 7613 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 7614 Lynd Stringer}, 7615 title = {Fracture Mechanics on the Intel Itanium Architecture}, 7616 year = {2001}, 7617 institution = {Intel Corporation}, 7618 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 7619 petsc_uses = {KSP} 7620} 7621 7622@InProceedings{ ihwi, 7623 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 7624 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 7625 booktitle = {International Conference ON Computational Engineering and Sciences}, 7626 year = {2002}, 7627 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 7628 petsc_uses = {KSP} 7629} 7630 7631@InProceedings{ crack, 7632 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 7633 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 7634 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 7635 and Paul A. Wawrzynek}, 7636 title = {Parallel FEM Simulation of Crack Propagation}, 7637 booktitle = {Proceedings of Irregular 2000}, 7638 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 7639 year = {2000}, 7640 petsc_uses = {KSP} 7641} 7642 7643@InProceedings{ beaudoin98, 7644 author = {A. J. Beaudoin}, 7645 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 7646 booktitle = {Simulation of materials processing: Theory, methods, and applications - 7647 Proceedings of the Sixth International Conference, NUMIFORM'98}, 7648 editor = {J. Hu\'etink and F. P. T. Baaijens}, 7649 optvolume = {}, 7650 optnumber = {}, 7651 optseries = {}, 7652 year = {1998}, 7653 optorganization={}, 7654 publisher = {A. A. Balkema Publishers}, 7655 address = {Rotterdam, Netherlands}, 7656 month = jun, 7657 optpages = {}, 7658 petsc_uses = {KSP} 7659} 7660 7661% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7662@TechReport{ defordheld1, 7663 author = {JF DeFord and BL Held}, 7664 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 7665 year = {2002}, 7666 institution = {Simulation Technology and Applied Research}, 7667 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 7668 note = {Discusses their parallel commercial solver that uses PETSc}, 7669 petsc_uses = {KSP} 7670} 7671 7672@PhDThesis{ sande2003, 7673 author = {Hans Vande Sande}, 7674 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 7675 Quasi-Static Electromagnetic Systems}, 7676 school = {Katholieke Universiteit Leuven, Belgium}, 7677 year = {2003}, 7678 petsc_uses = {KSP} 7679} 7680 7681@Article{ sdchh2004, 7682 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 7683 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 7684 Tolerance}, 7685 journal = {IEEE Transactions on Magnetics}, 7686 year = {2004}, 7687 volume = {40}, 7688 pages = {1306--1309}, 7689 petsc_uses = {KSP} 7690} 7691 7692@Article{ holst-lindblom-etal:2004, 7693 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 7694 Scheel and Lawrence E. Kidder}, 7695 title = {Optimal constraint projection for hyperbolic evolution systems, }, 7696 journal = {Phys. Rev. D}, 7697 year = {2004}, 7698 volume = {70}, 7699 pages = {084017}, 7700 petsc_uses = {KSP} 7701} 7702 7703@Article{ marm2005, 7704 author = {Matthew Anderson and Richard A. Matzner}, 7705 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 7706 journal = {Foundations of Physics}, 7707 volume = {35}, 7708 pages = {1572--9516}, 7709 year = {2005}, 7710 petsc_uses = {KSP} 7711} 7712 7713@Article{ cook-pfeiffer:2004, 7714 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 7715 title = {Excision boundary conditions for black hole initial data}, 7716 journal = {Phys. Rev. D}, 7717 volume = {70}, 7718 pages = {104016--24}, 7719 year = {2004}, 7720 petsc_uses = {KSP} 7721} 7722 7723@Article{ pfeiffer-kidder-etal:2005, 7724 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 7725 Shoemaker}, 7726 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 7727 journal = {Phys. Rev. D}, 7728 year = {2005}, 7729 volume = {71}, 7730 pages = {024020}, 7731 petsc_uses = {KSP} 7732} 7733 7734@Article{ pfeiffer-kidder-etal:2003, 7735 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 7736 Saul A.}, 7737 title = {A multidomain spectral method for solving elliptic equations}, 7738 journal = {CPC}, 7739 year = {2003}, 7740 volume = {152}, 7741 pages = {253--273}, 7742 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 7743 For a related online version, see arXiv:gr-qc/0202096}, 7744 petsc_uses = {KSP} 7745} 7746 7747@Article{ pfeiffer-cook-teukolsky:2002, 7748 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 7749 title = {Comparing initial-data sets for binary black hole}, 7750 journal = {PRD}, 7751 year = {2002}, 7752 volume = {66}, 7753 pages = {024047}, 7754 note = {for a related online version, seearXiv:gr-qc/0203085}, 7755 petsc_uses = {KSP} 7756} 7757 7758@PhDThesis{ pfeiffer:2003, 7759 author = {Pfeiffer, Harald P.}, 7760 title = {Initial Data for Black Hole Evolutions}, 7761 school = {Cornell University}, 7762 year = {2003}, 7763 petsc_uses = {KSP} 7764} 7765 7766@TechReport{ h1, 7767 author = {Erik Schnetter}, 7768 title = {A fast apparent horizon algorithm}, 7769 year = {2002}, 7770 number = {Arxiv preprint gr-qc/0206003}, 7771 url = {http://arxiv.org/pdf/gr-qc/0206003}, 7772 petsc_uses = {KSP} 7773} 7774 7775@Article{ h2, 7776 author = {Erik Schnetter}, 7777 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 7778 year = {2003}, 7779 journal = {Class. Quantum Grav.}, 7780 pages = {4719-4737}, 7781 volume = {20}, 7782 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 7783 petsc_uses = {KSP} 7784} 7785 7786@Article{ adams-03a, 7787 author = {Adams, M.~F.}, 7788 journal = {Numerical Linear Algebra with Applications}, 7789 number = {2-3}, 7790 pages = {141-153}, 7791 title = {Algebraic multigrid methods for constrained linear systems with applications to 7792 contact problems in solid mechanics}, 7793 volume = {11}, 7794 year = {2004}, 7795 petsc_uses = {KSP} 7796} 7797 7798@Article{ vandesande1, 7799 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 7800 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 7801 year = {2003}, 7802 volume = {39}, 7803 pages = {1709--1712}, 7804 title = {Solving Nonlinear Magnetic Problems Using {N}ewton Trust Region Methods}, 7805 petsc_uses = {KSP} 7806} 7807 7808@InProceedings{ vbde1, 7809 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 7810 year = {2002}, 7811 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 7812 Uintah PSE}, 7813 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 7814 2002}, 7815 pages = {49-55}, 7816 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7817 note = {Extended abstract}, 7818 petsc_uses = {KSP} 7819} 7820 7821@Unpublished{ ep1, 7822 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 7823 author = {Bradley R. Eccleston and Todd S. Palmer}, 7824 institution = {Department of Nuclear Engineering, Oregon State University}, 7825 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 7826 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 7827 Parallel Simulations}, 7828 year = {1999}, 7829 petsc_uses = {KSP} 7830} 7831 7832@InProceedings{ teo2007scalable, 7833 title = {A scalable modular convex solver for regularized risk minimization}, 7834 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 7835 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 7836 discovery and data mining}, 7837 pages = {727--736}, 7838 year = {2007}, 7839 organization = {ACM}, 7840 petsc_uses = {KSP} 7841} 7842 7843@InProceedings{ rm02, 7844 author = {Robert Malouf}, 7845 year = {2002}, 7846 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 7847 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 7848 (CoNLL-2002)}, 7849 pages = {49-55}, 7850 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 7851 petsc_uses = {KSP} 7852} 7853 7854@Unpublished{ hrv02, 7855 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 7856 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7857 note = {Submitted to CMMSE}, 7858 petsc_uses = {KSP} 7859} 7860 7861@Article{ tmh2001, 7862 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 7863 journal = {Journal of Economic Dynamics and Control}, 7864 year = {2002}, 7865 volume = {26}, 7866 pages = {1499-1515}, 7867 title = {Solving finite difference schemes arising in trivariate option pricing}, 7868 petsc_uses = {KSP} 7869} 7870 7871@InProceedings{ a2, 7872 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 7873 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 7874 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 7875 Methods}, 7876 editor = {C.-H. Lai et al.}, 7877 publisher = {Domain Decomposition Press, Bergen}, 7878 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 7879 year = {1999}, 7880 petsc_uses = {KSP} 7881} 7882 7883@Unpublished{ mmmdcmaa-web-page, 7884 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 7885 {A}coustics {W}eb Page}, 7886 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 7887 author = {David E. Keyes}, 7888 institution = {Old Dominion University}, 7889 petsc_uses = {KSP} 7890} 7891 7892@Conference{ liu2010parallelization, 7893 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 7894 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 7895 booktitle = {International Symposium on Parallel and Distributed Processing with 7896 Applications}, 7897 pages = {528--535}, 7898 year = {2010}, 7899 organization = {IEEE}, 7900 petsc_uses = {KSP} 7901} 7902 7903@Unpublished{ oil-reservoir-sim-web-page, 7904 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 7905 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 7906 institution = {University of Texas at Austin and Argonne National Laboratory}, 7907 key = {University of Texas at Austin and Argonne National Laboratory}, 7908 petsc_uses = {KSP} 7909} 7910 7911@Article{ tmh2001b, 7912 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 7913 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 7914 year = {2001}, 7915 volume = {37}, 7916 pages = {143--146}, 7917 title = {Adapting EMAP3D to parallel processing}, 7918 petsc_uses = {KSP} 7919} 7920 7921@Article{ harbury98, 7922 author = {HK Harbury and W Porod}, 7923 journal = {VLSI Design}, 7924 year = {1998}, 7925 volume = {6}, 7926 pages = {47--51}, 7927 title = {Parallel computation for electronic waves in quantum corrals}, 7928 petsc_uses = {KSP} 7929} 7930 7931@Article{ bludszuwei98, 7932 author = {Mark Bludszuweit}, 7933 journal = {Journal of Lightwave Technology}, 7934 year = {1998}, 7935 volume = {16}, 7936 number = {7}, 7937 pages = {1336--42}, 7938 title = {Mixed Finite Element Beam Propagation Method}, 7939 petsc_uses = {KSP} 7940} 7941 7942@Article{ s1, 7943 author = {J. L. Friedman and N. Stergioulas}, 7944 journal = {Astrophysics Journal}, 7945 year = {1998}, 7946 volume = {492}, 7947 number = {301}, 7948 pages = {}, 7949 title = {}, 7950 petsc_uses = {KSP} 7951} 7952 7953@Article{ s1a, 7954 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 7955 journal = {Astrophysics Journal}, 7956 year = {1999}, 7957 volume = {510}, 7958 number = {854}, 7959 pages = {}, 7960 title = {}, 7961 petsc_uses = {KSP} 7962} 7963 7964@PhDThesis{ s2, 7965 author = {N. Stergioulas}, 7966 title = {Ph. D. thesis}, 7967 year = {1996}, 7968 institution = {University of Wisconsin-Milwaukee}, 7969 petsc_uses = {KSP} 7970} 7971 7972@InProceedings{ coral1, 7973 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7974 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 7975 Parallel Computing Environment}, 7976 booktitle = {Proceedings of the Miami TEAM Workshop}, 7977 location = {Florida International University, Department of Electrical Engineering and 7978 Computing Science}, 7979 month = nov, 7980 year = {1993}, 7981 petsc_uses = {KSP} 7982} 7983 7984@InProceedings{ coral2, 7985 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7986 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 7987 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 7988 month = dec, 7989 year = {1994}, 7990 petsc_uses = {KSP} 7991} 7992 7993@InProceedings{ coral3, 7994 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7995 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 7996 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 7997 location = {Florida International University, Department of Electrical Engineering and 7998 Computing Science}, 7999 year = {1995}, 8000 petsc_uses = {KSP} 8001} 8002 8003@InProceedings{ mijalkovic, 8004 author = {Slobodan Mijalkovi\'{c}}, 8005 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 8006 Process Simulation}, 8007 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 8008 Gent, Belgium, September 27--30, 1999.}, 8009 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 8010 optvolume = {14}, 8011 optseries = {Lecture Notes in Computational Science and Engineering}, 8012 year = {2000}, 8013 publisher = {Springer}, 8014 address = {Berlin}, 8015 optpages = {179--184}, 8016 petsc_uses = {KSP} 8017} 8018 8019@Article{ bludszuwei98a, 8020 author = {Mark Bludszuweit}, 8021 journal = {Journal of Lightwave Technology}, 8022 year = {1998}, 8023 volume = {16}, 8024 number = {7}, 8025 pages = {1336--42}, 8026 title = {Mixed Finite Element Beam Propagation Method}, 8027 petsc_uses = {KSP} 8028} 8029 8030@Article{ gilli-pauletto-1998, 8031 author = {Manfred Gilli and Giorgio Pauletto}, 8032 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 8033 journal = {Computational Economics}, 8034 year = {2000}, 8035 volume = {16}, 8036 pages = {173--186}, 8037 petsc_uses = {KSP} 8038} 8039 8040% LiteralHTML: 8041% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 8042% LiteralHTML: 8043@Article{ collierdalcincalo2013, 8044 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 8045 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 8046 journal = {arxiv}, 8047 year = {2013}, 8048 number = {1305.4452}, 8049 note = {\url{http://arxiv.org/abs/1305.4452}}, 8050 petsc_uses = {KSP} 8051} 8052 8053@Article{ collierdalcinvignalcortescalo2016, 8054 title = {PetIGA: A framework for high-performance isogeometric analysis}, 8055 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 8056 Victor M. Calo}, 8057 journal = {Computer Methods in Applied Mechanics and Engineering}, 8058 year = {2016}, 8059 petsc_uses = {KSP} 8060} 8061 8062@Misc{ petiga-web-page, 8063 author = {N. Collier and L. Dalcin and V.M. Calo}, 8064 title = {{PetIGA} {W}eb page}, 8065 url = {https://bitbucket.org/dalcinl/petiga/}, 8066 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 8067 year = {2014}, 8068 petsc_uses = {KSP} 8069} 8070 8071@Article{ logg07, 8072 author = {Logg, Anders}, 8073 title = {Automating the Finite Element Method}, 8074 journal = {Archives of Computational Methods in Engineering}, 8075 volume = {14}, 8076 number = {2}, 8077 pages = {93-138}, 8078 year = {2007}, 8079 doi = {10.1007/s11831-007-9003-9}, 8080 publisher = {Kluwer Academic Publishers}, 8081 issn = {1134-3060}, 8082 language = {English}, 8083 petsc_uses = {KSP} 8084} 8085 8086@Article{ jezequelcouturierdenis12, 8087 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 8088 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 8089 versus the PETSc library}, 8090 journal = {The Journal of Supercomputing}, 8091 volume = {59}, 8092 number = {3}, 8093 pages = {1517-1532}, 8094 year = {2012}, 8095 issn = {0920-8542}, 8096 doi = {10.1007/s11227-011-0563-y}, 8097 publisher = {Springer US}, 8098 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 8099 Sparse linear solver}, 8100 language = {English}, 8101 petsc_uses = {KSP} 8102} 8103 8104@Unpublished{ feap-web-page, 8105 title = {FEAP: A Finite Element Analysis Program}, 8106 url = {http://www.ce.berkeley.edu/projects/feap/}, 8107 author = {FEAP Team}, 8108 note = {Uses PETSc linear solvers - iterative and direct}, 8109 petsc_uses = {KSP} 8110} 8111 8112@Unpublished{ parpre-web-page, 8113 title = {{ParPre} {W}eb {P}age}, 8114 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 8115 institution = {University of Tennessee}, 8116 author = {Victor Eijkhout}, 8117 note = {This is no longer supported. A set of preconditioners built on PETSc}, 8118 petsc_uses = {KSP} 8119} 8120 8121@Unpublished{ pism, 8122 title = {{PISM}: a Parallel Ice Sheet Model}, 8123 author = {{PISM Team}}, 8124 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 8125 Sheet Model). The thickness, temperature, velocity and age of the ice are all 8126 simulated, as is the deformation of the earth underneath the ice. New techniques 8127 for fast ice dynamics, earth deformation, and verification have are included.}, 8128 note = {\url{http://www.pism-docs.org/}}, 8129 petsc_uses = {KSP} 8130} 8131 8132@Unpublished{ oofem, 8133 title = {OOFEM - an object oriented finite element package}, 8134 author = {Borek Patzak}, 8135 url = {http://www.oofem.org}, 8136 petsc_uses = {KSP} 8137} 8138 8139@Unpublished{ dks2openfvm, 8140 title = {OpenFVM - a finite volume based general purpose CFD solver}, 8141 author = {Open source development}, 8142 url = {http://openfvm.sourceforge.net/}, 8143 petsc_uses = {KSP} 8144} 8145 8146@Unpublished{ sundar-2008w, 8147 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 8148 octree meshes}, 8149 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 8150 institution = {University of Pennsylvania}, 8151 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 8152 petsc_uses = {KSP} 8153} 8154 8155@Unpublished{ khatiwala07-software, 8156 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 8157 author = {Khatiwala, S.}, 8158 institution = {Columbia University}, 8159 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 8160 petsc_uses = {KSP} 8161} 8162 8163@InBook{ jiaolima99, 8164 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 8165 chapter = {{SIFFEA}:Scalable Integrated Framework for Finite Element Analysis}, 8166 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 8167 title = {Lecture Notes in Computer Science}, 8168 publisher = {Springer-Verlag}, 8169 volume = {1732}, 8170 year = {1999}, 8171 petsc_uses = {KSP} 8172} 8173 8174@Article{ crow1, 8175 author = {C. S. Crow IV}, 8176 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 8177 journal = {Hopkins Undergraduate Research Journal}, 8178 year = {2003}, 8179 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 8180 petsc_uses = {KSP} 8181} 8182 8183@Unpublished{ petsc-python, 8184 title = {PETSc for Python}, 8185 author = {L. Dalcin}, 8186 url = {https://petsc.org/main/petsc4py}, 8187 note = {Provides Python bindings for PETSc}, 8188} 8189 8190@Unpublished{ cfdship, 8191 title = {{CFDShip-Iowa}}, 8192 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 8193 institution = {University of Iowa}, 8194 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 8195 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 8196 structured grids, designed for ship applications}, 8197 petsc_uses = {KSP} 8198} 8199 8200@Unpublished{ bvw, 8201 title = {Multiflow}, 8202 author = {Berend van Wachem}, 8203 institution = {Mechanical Engineering - Chalmers University of Technology}, 8204 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 8205 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 8206 flows.}, 8207 petsc_uses = {KSP} 8208} 8209 8210@Unpublished{ dks2, 8211 title = {FENA - A Finite Element Model for the North Atlantic}, 8212 author = {Jens Schroeter}, 8213 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 8214 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 8215 petsc_uses = {KSP} 8216} 8217 8218@TechReport{ piwonski2010idea, 8219 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 8220 and Simulation in {3-D}}, 8221 author = {Piwonski, J. and Slawig, T.}, 8222 year = {2010}, 8223 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8224 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 8225 petsc_uses = {KSP} 8226} 8227 8228@Unpublished{ metos3d-web, 8229 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 8230 author = {Piwonski, J. and Slawig, T.}, 8231 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8232 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 8233 petsc_uses = {KSP} 8234} 8235 8236@Unpublished{ magpar, 8237 author = {W. Scholz}, 8238 title = {Magpar: Parallel Micromagnetics Code}, 8239 institution = {Vienna University of Technology}, 8240 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 8241 petsc_uses = {KSP} 8242} 8243 8244@Misc{ libmesh:sourceforge, 8245 author = {}, 8246 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 8247 equations on serial and parallel platforms}, 8248 note = {[Online]}, 8249 url = {http://libmesh.github.io}, 8250 petsc_uses = {KSP} 8251} 8252 8253@Misc{ moose-web-page, 8254 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 8255 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 8256 Gaston and John Peterson and Jason Miller}, 8257 institution = {Idaho National Laboratory}, 8258 howpublished = {\url{http://mooseframework.org}}, 8259 petsc_uses = {KSP} 8260} 8261 8262@Article{ gaston2009moose, 8263 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 8264 equations}, 8265 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 8266 journal = {Nuclear Engineering and Design}, 8267 volume = {239}, 8268 number = {10}, 8269 pages = {1768--1778}, 8270 year = {2009}, 8271 publisher = {Elsevier}, 8272 petsc_uses = {KSP} 8273} 8274 8275@Article{ tonks2012object, 8276 title = {An object-oriented finite element framework for multiphysics phase field 8277 simulations}, 8278 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 8279 journal = {Computational Materials Science}, 8280 volume = {51}, 8281 number = {1}, 8282 pages = {20--29}, 8283 year = {2012}, 8284 publisher = {Elsevier}, 8285 petsc_uses = {KSP} 8286} 8287 8288@Misc{ pylithmanual, 8289 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 8290 Strand and Charles Williams}, 8291 title = {{PyLith} User Manual Version 2.0.0}, 8292 year = {2014}, 8293 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 8294 petsc_uses = {KSP} 8295} 8296 8297@Misc{ pylith-web-page, 8298 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 8299 title = {{PyLith}}, 8300 year = {2012}, 8301 url = {http://geodynamics.org/resources/pylith/}, 8302 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 8303 petsc_uses = {KSP} 8304} 8305 8306@Misc{ galemanual, 8307 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 8308 title = {Gale User Manual Version 2.0.0}, 8309 year = {2011}, 8310 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 8311 petsc_uses = {KSP} 8312} 8313 8314@Unpublished{ underworld, 8315 author = {Louis Moresi}, 8316 title = {{UnderWorld}: A Geodynamics Modelling Code}, 8317 institution = {Monash University}, 8318 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 8319 petsc_uses = {KSP} 8320} 8321 8322@Article{ moresi2007computational, 8323 title = {Computational approaches to studying non-linear dynamics of the crust and 8324 mantle}, 8325 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 8326 M{\"u}hlhaus, H.B.}, 8327 journal = {Physics of the Earth and Planetary Interiors}, 8328 volume = {163}, 8329 number = {1-4}, 8330 pages = {69--82}, 8331 year = {2007}, 8332 publisher = {Elsevier}, 8333 petsc_uses = {KSP} 8334} 8335 8336@Article{ pitt2009chaste, 8337 title = {Chaste: a test-driven approach to software development for biological modelling}, 8338 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 8339 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 8340 and Walter, A. and others}, 8341 journal = {Computer Physics Communications}, 8342 volume = {180}, 8343 number = {12}, 8344 pages = {2452--2471}, 8345 year = {2009}, 8346 publisher = {Elsevier}, 8347 petsc_uses = {KSP} 8348} 8349 8350@Misc{ fenicsproject, 8351 title = {{The FEniCS project}}, 8352 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 8353 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 8354 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 8355 url = {http://fenicsproject.org}, 8356 year = {2011}, 8357 petsc_uses = {KSP} 8358} 8359 8360@Unpublished{ snark, 8361 title = {Snark: A suite of software for geoscientific applications and a philosophy of 8362 scientific software development}, 8363 institution = {Victorian Partnership for Advanced Computing}, 8364 url = {http://vpac.org/Snark}, 8365 petsc_uses = {KSP} 8366} 8367 8368@Misc{ imoose:sourceforge, 8369 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 8370 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 8371 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 8372 note = {[Online]}, 8373 url = {http://imoose.sourceforge.net}, 8374 petsc_uses = {KSP} 8375} 8376 8377@Unpublished{ fossi, 8378 author = {Stephan Frickenhaus}, 8379 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 8380 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 8381 codes}, 8382 institution = {AWI-Bremerhaven, Germanny}, 8383 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 8384 petsc_uses = {KSP} 8385} 8386 8387@Unpublished{ fun3dweb, 8388 author = {Dinesh Kaushik}, 8389 title = {PETSC-FUN3D Benchmark Page}, 8390 institution = {ODU/ANL}, 8391 url = {http://www.mcs.anl.gov/petsc-fun3d}, 8392 note = {CFD Benchmark of some solvers in PETSc}, 8393 petsc_uses = {KSP} 8394} 8395 8396@Unpublished{ scirun, 8397 author = {SCIRun Development Team}, 8398 title = {SCIRun}, 8399 institution = {University of Utah}, 8400 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 8401 note = {SCIRun now uses PETSc linear solvers}, 8402 petsc_uses = {KSP} 8403} 8404 8405@Misc{ prometheus, 8406 author = {Mark F. Adams}, 8407 title = {Prometheus - A scalable unstructured finite element solver}, 8408 institution = {Berkeley}, 8409 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 8410 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 8411 petsc_uses = {KSP} 8412} 8413 8414@Unpublished{ illuminator, 8415 author = {Adam C. Powell, IV}, 8416 title = {Illuminator Distributed Visualization Library}, 8417 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 8418 petsc_uses = {KSP} 8419} 8420 8421@Unpublished{ rheoplast, 8422 title = {RheoPlast Phase Field Multi-Physics Code}, 8423 author = {Adam Powell and David Dussault and Bo Zhou}, 8424 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 8425 petsc_uses = {KSP} 8426} 8427 8428@Misc{ tao-web-page, 8429 title = {{Toolkit for Advanced Optimization ({TAO})} {W}eb Page}, 8430 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8431 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 8432 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8433 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 8434 petsc_uses = {KSP} 8435} 8436 8437@TechReport{ tao-user-ref, 8438 title = {{Toolkit for Advanced Optimization ({TAO}) users manual}}, 8439 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8440 and Steve Benson and Lois Curfman McInnes}, 8441 institution = {Argonne National Laboratory}, 8442 year = {2019}, 8443 number = {ANL/MCS-TM-322 - Rev 3.12}, 8444 petsc_uses = {KSP} 8445} 8446 8447% url = "http://www.mcs.anl.gov/tao", 8448@Unpublished{ mefpp-web-page, 8449 title = {{MEF++} {W}eb {P}age}, 8450 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 8451 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 8452 author = {Eric Chamberland}, 8453 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 8454 multiphysics}, 8455 petsc_uses = {KSP} 8456} 8457 8458@Unpublished{ tipetsc-titanium, 8459 title = {Ti-PETSc - an interface to PETSc from Titanium}, 8460 institution = {Berkeley}, 8461 author = {He, Yun and Liblit, Bun and Lin, Chang}, 8462 url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, 8463 year = {1999}, 8464 petsc_uses = {KSP}, 8465} 8466 8467@Unpublished{ ptatin-web-page, 8468 title = {ptatin3d}, 8469 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 8470 url = {https://bitbucket.org/jedbrown/ptatin3d}, 8471 year = {2018}, 8472 petsc_uses = {KSP} 8473} 8474 8475@Misc{ multiphase-web-page, 8476 author = {Q. Zou}, 8477 title = {Multiphase flow with {PETSc}}, 8478 institution = {LANL}, 8479 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 8480 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 8481 lab = {LANL}, 8482 petsc_uses = {KSP} 8483} 8484 8485@Misc{ electromag-web-page, 8486 title = {{EMSolve Web} page}, 8487 institution = {LLNL}, 8488 howpublished = {http://www.llnl.gov/casc/emsolve}, 8489 url = {http://www.Llnl.gov/casc/emsolve}, 8490 author = {Daniel {White et al.}}, 8491 lab = {LLNL}, 8492 petsc_uses = {KSP} 8493} 8494 8495@Unpublished{ fe-software-web-page, 8496 institution = {Kuleuven}, 8497 title = {Finite element software}, 8498 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 8499 petsc_uses = {KSP} 8500} 8501 8502@Misc{ petsc-web-page, 8503 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8504 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 8505 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8506 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8507 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8508 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8509 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8510 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8511 Zhang}, 8512 title = {{PETS}c {W}eb page}, 8513 url = {https://petsc.org/}, 8514 howpublished = {\url{https://petsc.org/}}, 8515 year = {2024} 8516} 8517 8518@Unpublished{ petsc-debian-package, 8519 author = {Adam C. Powell, IV}, 8520 title = {Debian package for PETSc}, 8521 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 8522 petsc_uses = {KSP} 8523} 8524 8525@Unpublished{ cactus, 8526 title = {Cactus Website}, 8527 url = {http://www.cactuscode.org/}, 8528 note = {Provides two interface to the PETSc solvers}, 8529 petsc_uses = {KSP} 8530} 8531 8532@Unpublished{ petsc-fem, 8533 author = {Mario Storti and Norberto Nigro}, 8534 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 8535 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 8536 url = {http://www.cimec.org.ar/petscfem}, 8537 petsc_uses = {KSP} 8538} 8539 8540@Misc{ fidap, 8541 title = {FIDAP 8.5}, 8542 howpublished = {\url{http://www.fluent.com}}, 8543 url = {http://www.fluent.com}, 8544 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 8545 solves.}, 8546 key = {FIDAP 8.5}, 8547 petsc_uses = {KSP} 8548} 8549 8550@Unpublished{ slepc, 8551 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8552 Vicente Hern\'andez and Vicent Vidal}, 8553 title = {{SLEPc} Website}, 8554 url = {http://slepc.upv.es/}, 8555 note = {Scalable Library for Eigenvalue Problem Computations}, 8556 petsc_uses = {KSP} 8557} 8558 8559@TechReport{ slepc-users-manual, 8560 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8561 Vicente Hern\'andez and Vicent Vidal}, 8562 title = {{SLEPc} Users Manual}, 8563 number = {DISC-II/24/02}, 8564 url = {http://slepc.upv.es/}, 8565 note = {Scalable Library for Eigenvalue Problem Computations}, 8566 petsc_uses = {KSP} 8567} 8568 8569@Misc{ deal.ii, 8570 title = {deal.II}, 8571 howpublished = {\url{http://www.dealii.org}}, 8572 url = {http://www.dealii.org}, 8573 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 8574 It allows PETSc linear algebra and solvers to be used underneath.}, 8575 key = {deal.II 5.0}, 8576 petsc_uses = {KSP} 8577} 8578 8579@Article{ bangerth2007deal, 8580 title = {{deal.II---A general-purpose object-oriented finite element library}}, 8581 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 8582 journal = {ACM Transactions on Mathematical Software (TOMS)}, 8583 volume = {33}, 8584 number = {4}, 8585 pages = {24--es}, 8586 issn = {0098-3500}, 8587 year = {2007}, 8588 publisher = {ACM}, 8589 petsc_uses = {KSP} 8590} 8591 8592@Misc{ globalarrays, 8593 author = {Jarek {Nieplocha et al.}}, 8594 title = {Global Arrays}, 8595 institution = {Pacific Northwest National Laboratories}, 8596 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 8597 url = {http://www.emsl.pnl.gov/docs/global}, 8598 note = {Global arrays can use PETSc linear solvers}, 8599 lab = {PNNL}, 8600 petsc_uses = {KSP} 8601} 8602 8603% LiteralHTML: 8604% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 8605% LiteralHTML: 8606@Article{ petsccommunity2022, 8607 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 8608 Community}, 8609 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 8610 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 8611 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 8612 and Hong Zhang and Junchao Zhang}, 8613 journal = {Computing in Science and Engineering}, 8614 volume = {24}, 8615 number = {03}, 8616 pages = {6--15}, 8617 issn = {1558-366X}, 8618 doi = {10.1109/MCSE.2022.3169974}, 8619 publisher = {IEEE Computer Society}, 8620 address = {Los Alamitos, CA, USA}, 8621 month = may, 8622 year = {2022}, 8623 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 8624 petsc_uses = {KSP} 8625} 8626 8627@Article{ brownknepleysmith14, 8628 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 8629 title = {Run-time extensibility and librarization of simulation software}, 8630 journal = {IEEE Computing in Science and Engineering}, 8631 month = jan, 8632 volume = {17}, 8633 number = {1}, 8634 pages = {38--45}, 8635 doi = {10.1109/MCSE.2014.95}, 8636 year = {2015}, 8637 petsc_uses = {KSP} 8638} 8639 8640@TechReport{ ass2012, 8641 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 8642 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 8643 institution = {Argonne National Laboratory}, 8644 type = {Preprint}, 8645 year = {2012}, 8646 number = {ANL/MCS-P2011-0112}, 8647 petsc_uses = {KSP} 8648} 8649 8650@TechReport{ clearyknepley99, 8651 author = {Andrew Cleary and Matthew G. Knepley}, 8652 title = {Solvers as Operators}, 8653 institution = {Lawrence Livermore National Laboratory}, 8654 type = {Technical Report}, 8655 number = {UCRL-ID-135342}, 8656 year = {1999}, 8657 petsc_uses = {KSP} 8658} 8659 8660@TechReport{ smcabbkz2012, 8661 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 8662 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 8663 title = {{PETSc's} software strategy for the design space of composable extreme-scale 8664 solvers}, 8665 institution = {Argonne National Laboratory}, 8666 type = {Preprint}, 8667 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 8668 year = {2012}, 8669 number = {ANL/MCS-P2059-0312}, 8670 petsc_uses = {KSP} 8671} 8672 8673@InProceedings{ mhwpmhs2009, 8674 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 8675 and G. E. Hammond and B. Smith}, 8676 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 8677 Toolkit {MPI} at Scale}, 8678 booktitle = {Cray Users Group Conference}, 8679 year = {2009}, 8680 petsc_uses = {KSP} 8681} 8682 8683@InProceedings{ msmhls2010, 8684 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 8685 Lichtner and B. F. Smith}, 8686 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 8687 {BlueGene} Architectures}, 8688 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 8689 year = {2010}, 8690 petsc_uses = {KSP} 8691} 8692 8693@InCollection{ msk2013, 8694 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 8695 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 8696 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8697 series = {Lecture Notes in Earth System Sciences}, 8698 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8699 Yaolin Shi}, 8700 doi = {10.1007/978-3-642-16405-7_7}, 8701 publisher = {Springer Berlin Heidelberg}, 8702 pages = {131--140}, 8703 year = {2013}, 8704 isbn = {978-3-642-16404-0}, 8705 petsc_uses = {KSP} 8706} 8707 8708@InCollection{ knepleyyuen13, 8709 author = {Matthew G. Knepley and David A. Yuen}, 8710 title = {Why Scientists and Engineers need {GPU}s today}, 8711 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8712 series = {Lecture Notes in Earth System Sciences}, 8713 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8714 Yaolin Shi}, 8715 doi = {10.1007/978-3-642-16405-7_1}, 8716 publisher = {Springer Berlin Heidelberg}, 8717 pages = {131--140}, 8718 year = {2013}, 8719 isbn = {978-3-642-16404-0}, 8720 petsc_uses = {KSP} 8721} 8722 8723@InCollection{ karpeevknepleybrune13, 8724 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 8725 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 8726 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8727 series = {Lecture Notes in Earth System Sciences}, 8728 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8729 Yaolin Shi}, 8730 doi = {10.1007/978-3-642-16405-7_30}, 8731 publisher = {Springer Berlin Heidelberg}, 8732 pages = {487--501}, 8733 year = {2013}, 8734 isbn = {978-3-642-16404-0}, 8735 petsc_uses = {KSP} 8736} 8737 8738@InCollection{ zhengetal13, 8739 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 8740 Variable Viscosity}, 8741 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8742 Zhang and Yaolin Shi}, 8743 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8744 series = {Lecture Notes in Earth System Sciences}, 8745 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8746 Yaolin Shi}, 8747 doi = {10.1007/978-3-642-16405-7_21}, 8748 publisher = {Springer Berlin Heidelberg}, 8749 pages = {321--333}, 8750 year = {2013}, 8751 isbn = {978-3-642-16404-0}, 8752 petsc_uses = {KSP} 8753} 8754 8755@Article{ zhengetal13b, 8756 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 8757 strongly variable viscosity based on {M}atlab and {CUDA}}, 8758 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8759 Zhang and Yaolin Shi}, 8760 journal = {IJHPCA}, 8761 volume = {28}, 8762 number = {1}, 8763 pages = {50--60}, 8764 doi = {10.1177/1094342013478640}, 8765 year = {2013}, 8766 petsc_uses = {KSP} 8767} 8768 8769@InBook{ s2011, 8770 author = {B. Smith}, 8771 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 8772 title = {Encyclopedia of Parallel Computing}, 8773 bookeditor = {D. Padua}, 8774 publisher = {Springer}, 8775 year = {2011}, 8776 petsc_uses = {KSP} 8777} 8778 8779@Article{ acostamejia06, 8780 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 8781 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 8782 journal = {Lecturas Matem\'aticas}, 8783 volume = {27}, 8784 year = {2006}, 8785 pages = {213--224}, 8786 petsc_uses = {KSP} 8787} 8788 8789@InProceedings{ quenettemoresisunterappelbe07, 8790 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 8791 title = {Explaining StGermain: An aspect oriented environment for building extensible 8792 computational mechanics modeling software}, 8793 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 8794 publisher = {IEEE}, 8795 pages = {1--8}, 8796 yerar = {2007}, 8797 petsc_uses = {KSP} 8798} 8799 8800@Article{ dfm1, 8801 title = {Vectorized sparse matrix multiply for compressed row storage format}, 8802 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 8803 journal = {Lecture Notes in Computer Science}, 8804 year = {2005}, 8805 pages = {99--106}, 8806 volume = {3514}, 8807 lab = {ORNL}, 8808 petsc_uses = {KSP} 8809} 8810 8811@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 8812 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 8813 Vandewalle and Stefaan Poedts}, 8814 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 8815 Scientific Computing Software}, 8816 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 8817 year = {2005}, 8818 note = {Lecture Notes in Computer Science}, 8819 volume = {3514}, 8820 publisher = {Springer-Verlag GmbH}, 8821 petsc_uses = {KSP} 8822} 8823 8824@InProceedings{ dalcin-paz-storti, 8825 author = {L. Dalcin and R. Paz and M. Storti}, 8826 title = {Desarrollo de Aplicaciones Paralelas en Python}, 8827 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 8828 Bariloche, Argentina}, 8829 year = {2004}, 8830 petsc_uses = {KSP} 8831} 8832 8833@Article{ mpi-python, 8834 author = {L. Dalcin and R. Paz and M. Storti}, 8835 title = {MPI for Python}, 8836 journal = {Journal of Parallel and Distributed Computing}, 8837 year = {2005}, 8838 petsc_uses = {KSP} 8839} 8840 8841@Unpublished{ hrv02a, 8842 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 8843 author = {V. Hernandex and J. E. Roman and V. Vidal}, 8844 note = {Submited to VecPar 2002}, 8845 year = {2002}, 8846 petsc_uses = {KSP} 8847} 8848 8849@Article{ knyazev2007block, 8850 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 8851 {PETSc}}, 8852 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 8853 journal = {SIAM Journal on Scientific Computing}, 8854 volume = {29}, 8855 pages = {2224-2239}, 8856 doi = {10.1137/060661624}, 8857 year = {2007}, 8858 petsc_uses = {KSP} 8859} 8860 8861@MastersThesis{ aarrestad-master, 8862 author = {Asbjorn Hoiland Aarrestad}, 8863 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 8864 school = {University of Bergen}, 8865 month = aug, 8866 year = {2003}, 8867 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 8868 note = {Implemented Runge-Kutta methods using PETSc}, 8869 petsc_uses = {KSP} 8870} 8871 8872@PhDThesis{ kaushik-phd, 8873 author = {D. K. Kaushik}, 8874 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 8875 Differential Equations on Unstructured Grids}, 8876 school = {Old Dominion University}, 8877 month = dec, 8878 year = {2002}, 8879 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 8880 petsc_uses = {KSP} 8881} 8882 8883@TechReport{ rb1, 8884 author = {Rickard Bergstrom}, 8885 title = {Object Oriented Implementation of a General Finite Element Code}, 8886 number = {2002-13}, 8887 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 8888 year = {2002}, 8889 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 8890 note = {Discribes a finite element software package that uses PETSc for its solvers}, 8891 petsc_uses = {KSP} 8892} 8893 8894@InProceedings{ dbl1, 8895 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 8896 title = {A Parallel General Purpose Finite Element System}, 8897 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 8898 publisher = {SIAM}, 8899 year = {1999}, 8900 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 8901 note = {Describes software that uses PETSc for its parallel linear solves}, 8902 petsc_uses = {KSP} 8903} 8904 8905@Article{ p1, 8906 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 8907 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 8908 and B. Smith}, 8909 journal = {Parallel Computing}, 8910 year = {2002}, 8911 pages = {1811--1831}, 8912 volume = {28 (12)}, 8913 petsc_uses = {KSP} 8914} 8915 8916@Article{ automatic-ad, 8917 author = {Paul Hovland and Boyana Norris and Barry Smith}, 8918 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 8919 year = {2005}, 8920 journal = {Future Generation Computer Systems}, 8921 volume = {21}, 8922 number = {8}, 8923 pages = {1426--1438}, 8924 petsc_uses = {KSP} 8925} 8926 8927@TechReport{ remote-math, 8928 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 8929 Smith}, 8930 title = {Remote Access to Mathematical Software}, 8931 number = {ANL/MCS-P889-0601}, 8932 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8933 month = jun, 8934 year = {2001}, 8935 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 8936 petsc_uses = {KSP} 8937} 8938 8939@InProceedings{ gropp98, 8940 author = {William D. Gropp}, 8941 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 8942 publisher = {SIAM}, 8943 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8944 Scientific and Engineering Computing}, 8945 year = {1999}, 8946 pages = {21-29}, 8947 petsc_uses = {KSP} 8948} 8949 8950@InProceedings{ knepleysarin99, 8951 author = {Matthew Knepley and Vivek Sarin}, 8952 title = {Algorithm Development for Large Scale Computing}, 8953 publisher = {SIAM}, 8954 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8955 Scientific and Engineering Computing}, 8956 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 8957 year = {1999}, 8958 petsc_uses = {KSP} 8959} 8960 8961@InBook{ bgms00, 8962 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8963 chapter = {Software for the Scalable Solution of {PDEs}}, 8964 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 8965 title = {CRPC Handbook of Parallel Computing}, 8966 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 8967 and A. White}, 8968 publisher = {Morgan Kaufmann Publishers}, 8969 year = {2002}, 8970 petsc_uses = {KSP} 8971} 8972 8973@InProceedings{ hovland_norris_smith98, 8974 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 8975 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 8976 Computations}, 8977 publisher = {SIAM}, 8978 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8979 Scientific and Engineering Computing}, 8980 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 8981 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 8982 year = {1999}, 8983 pages = {129-137}, 8984 petsc_uses = {KSP} 8985} 8986 8987@InProceedings{ efficient, 8988 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8989 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 8990 Libraries}, 8991 booktitle = {Modern Software Tools in Scientific Computing}, 8992 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 8993 publisher = {Birkhauser Press}, 8994 pages = {163--202}, 8995 year = {1997}, 8996 petsc_uses = {KSP} 8997} 8998 8999% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 9000@TechReport{ petsc-user-ref, 9001 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 9002 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 9003 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 9004 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 9005 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 9006 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 9007 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 9008 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 9009 Zhang}, 9010 title = {{PETSc/TAO} Users Manual}, 9011 institution = {Argonne National Laboratory}, 9012 number = {ANL-21/39 - Revision 3.21}, 9013 doi = {10.2172/2205494}, 9014 year = {2024} 9015} 9016 9017% url = {https://petsc.org/release} 9018@TechReport{ petsc-developers, 9019 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 9020 title = {{PETS}c Developers Guide}, 9021 institution = {Argonne National Laboratory}, 9022 number = {ANL-18/18}, 9023 year = {2018}, 9024 url = {https://petsc.org/release/developers}, 9025 petsc_uses = {KSP} 9026} 9027 9028@Unpublished{ alice-memory-snooper, 9029 author = {Ibrahima Ba and Barry~F. Smith}, 9030 title = {The {ALICE} Memory Snooper}, 9031 year = {1999}, 9032 petsc_uses = {KSP} 9033} 9034 9035@TechReport{ petsc-user-ref-polish, 9036 author = {Marcin Bojko and Piotr Krzyzanowski}, 9037 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 9038 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 9039 year = {1998}, 9040 note = {An introduction to PETSc in Polish}, 9041 petsc_uses = {KSP} 9042} 9043 9044@InProceedings{ abghmn00, 9045 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 9046 High-Performance Scientific Computing}, 9047 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 9048 Norris}, 9049 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 9050 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 9051 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 9052 Hasco\"{e}t and Uwe Naumann}, 9053 publisher = {Springer}, 9054 year = {2002}, 9055 petsc_uses = {KSP} 9056} 9057 9058@Unpublished{ petsc-mpi-paper, 9059 author = {Lois Curfman McInnes and Barry F. Smith}, 9060 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 9061 Libraries}, 9062 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 9063 month = jun, 9064 year = {1995}, 9065 petsc_uses = {KSP} 9066} 9067 9068@InProceedings{ miss-paper, 9069 author = {William D. Gropp and Barry F. Smith}, 9070 title = {Scalable, Extensible, and Portable Numerical Libraries}, 9071 publisher = {IEEE}, 9072 year = {1994}, 9073 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9074 address = {Mississippi State University}, 9075 pages = {87--93}, 9076 keyword = {numerical libraries, scientific computing, parallel computing}, 9077 petsc_uses = {KSP} 9078} 9079 9080@InProceedings{ snes-paper, 9081 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9082 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 9083 Minimization Problems}, 9084 publisher = {IEEE}, 9085 year = {1995}, 9086 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9087 address = {Mississippi State University}, 9088 pages = {60-67}, 9089 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 9090 petsc_uses = {KSP} 9091} 9092 9093@Article{ dsneutral, 9094 author = {Barry F. Smith and William D. Gropp}, 9095 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 9096 Sparse Linear Systems}, 9097 journal = {Scientific Programming}, 9098 volume = {5}, 9099 pages = {329--336}, 9100 key = {GroppSmith96 ! KSP design}, 9101 year = {1996}, 9102 petsc_uses = {KSP} 9103} 9104 9105@InProceedings{ bgms98, 9106 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9107 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 9108 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 9109 Scientific and Engineering Computing}, 9110 publisher = {SIAM}, 9111 pages = {58-67}, 9112 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 9113 year = {1998}, 9114 petsc_uses = {KSP} 9115} 9116 9117@Article{ hkm98, 9118 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 9119 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 9120 {PDE} Computation}, 9121 journal = {Advances in Engineering Software}, 9122 volume = {29}, 9123 pages = {415-424}, 9124 year = {1998}, 9125 petsc_uses = {KSP} 9126} 9127 9128@TechReport{ pdpta99, 9129 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 9130 Smith}, 9131 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 9132 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 9133 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 9134 Vegas, Nevada}, 9135 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9136 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 9137 number = {ANL/MCS-P751-0599}, 9138 year = {1999}, 9139 petsc_uses = {KSP} 9140} 9141 9142@InProceedings{ bbh:com, 9143 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 9144 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 9145 Computing}}, 9146 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 9147 Euro-Par Conference, Munich, Germany, August/September 2000}, 9148 year = {2000}, 9149 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 9150 volume = {1900}, 9151 series = {Lecture Notes in Computer Science}, 9152 pages = {86--94}, 9153 address = {Berlin}, 9154 publisher = {Springer}, 9155 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 9156 petsc_uses = {KSP} 9157} 9158 9159@InProceedings{ overture00, 9160 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 9161 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 9162 Components}, 9163 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 9164 booktitle = {Proceedings of the International Federation for Information Processing Working 9165 Conference on Software Architectures for Scientific Computing, Kluwer}, 9166 year = {2000}, 9167 pages = {57--68}, 9168 petsc_uses = {KSP} 9169} 9170 9171@TechReport{ smith97, 9172 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 9173 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 9174 number = {ANL/MCS-P701}, 9175 author = {Barry F. Smith}, 9176 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9177 petsc_uses = {KSP} 9178} 9179 9180@Article{ smith98, 9181 author = {Barry Smith}, 9182 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 9183 journal = {SIGNUM Newsletter}, 9184 year = {1998}, 9185 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 9186 petsc_uses = {KSP} 9187} 9188 9189@TechReport{ ad-petsc-tm, 9190 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 9191 {PETSc}}, 9192 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 9193 year = {1997}, 9194 type = {Technical Memorandum}, 9195 institution = {ANL}, 9196 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 9197 number = {ANL/MCS-TM-233}, 9198 petsc_uses = {KSP} 9199} 9200 9201% LiteralHTML: 9202% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 9203% LiteralHTML: 9204@PhDThesis{ klotzthesis2019, 9205 author = {Thomas S. Klotz}, 9206 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 9207 Biology}, 9208 school = {Rice University}, 9209 year = {2019}, 9210 petsc_uses = {KSP} 9211} 9212 9213@Article{ klotzbardhanknepley2018, 9214 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 9215 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 9216 journal = {arXiv e-prints}, 9217 eprint = {1708.06028}, 9218 archiveprefix = {arXiv}, 9219 primaryclass = {math.na}, 9220 year = {2018}, 9221 note = {\url{http://arxiv.org/abs/1708.06028}}, 9222 petsc_uses = {KSP} 9223} 9224 9225@Misc{ brown2016, 9226 title = {Threading Tradeoffs in Domain Decomposition}, 9227 author = {Jed Brown}, 9228 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 9229 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 9230 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 9231 year = {2016}, 9232 petsc_uses = {KSP} 9233} 9234 9235@Article{ changnakshatralaknepleyjohnsson2017, 9236 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 9237 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 9238 Johnsson}, 9239 journal = {Concurency: Practice and Experience}, 9240 volume = {30}, 9241 number = {11}, 9242 eprint = {1705.03625}, 9243 doi = {10.1002/cpe.4401}, 9244 year = {2017}, 9245 petsc_uses = {KSP} 9246} 9247 9248@Article{ changfabienknepleymills2018, 9249 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 9250 spectrum analysis}, 9251 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 9252 journal = {SIAM Journal on Scientific Computing}, 9253 volume = {40}, 9254 number = {6}, 9255 pages = {C779--C802}, 9256 eprint = {1802.07832}, 9257 doi = {10.1137/18M1172260}, 9258 year = {2018}, 9259 petsc_uses = {KSP} 9260} 9261 9262@Article{ joshaghanichangnakshatralaknepley2019, 9263 title = {Composable solvers for the four-field double porosity/permeability model}, 9264 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 9265 Knepley}, 9266 journal = {Journal of Computational Physics}, 9267 volume = {386}, 9268 pages = {428--466}, 9269 doi = {10.1016/j.jcp.2019.02.020}, 9270 year = {2019}, 9271 petsc_uses = {KSP} 9272} 9273 9274@InProceedings{ barralknepleylangepiggottgorman2016, 9275 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 9276 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 9277 and Gerard J. Gorman}, 9278 booktitle = {25th International Meshing Roundtable}, 9279 editor = {Steve Owen and Hang Si}, 9280 month = sep, 9281 address = {Washington, DC}, 9282 pages = {1--5}, 9283 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 9284 year = {2016}, 9285 petsc_uses = {KSP} 9286} 9287 9288@Article{ adamsbrownknepleysamtaney2016, 9289 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 9290 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 9291 journal = {SIAM Journal on Scientific Computing}, 9292 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 9293 epub = {http://arxiv.org/abs/1406.7808}, 9294 volume = {8}, 9295 number = {4}, 9296 pages = {C426--C440}, 9297 doi = {10.1137/140975127}, 9298 year = {2016}, 9299 petsc_uses = {KSP} 9300} 9301 9302@InProceedings{ maysananruppknepleysmith2016, 9303 title = {Extreme-Scale Multigrid Components within {PETSc}}, 9304 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 9305 Smith}, 9306 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 9307 series = {PASC '16}, 9308 isbn = {978-1-4503-4126-4}, 9309 location = {Lausanne, Switzerland}, 9310 pages = {5:1--5:12}, 9311 articleno = {5}, 9312 numpages = {12}, 9313 doi = {10.1145/2929908.2929913}, 9314 acmid = {2929913}, 9315 publisher = {ACM}, 9316 address = {New York, NY, USA}, 9317 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 9318 preconditioning}, 9319 year = {2016}, 9320 petsc_uses = {KSP} 9321} 9322 9323@Article{ liu2015field, 9324 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 9325 author = {Lulu Liu and David E Keyes}, 9326 journal = {SIAM Journal on Scientific Computing}, 9327 volume = {37}, 9328 number = {3}, 9329 pages = {A1388--A1409}, 9330 year = {2015}, 9331 publisher = {SIAM}, 9332 petsc_uses = {KSP} 9333} 9334 9335@Article{ lujiaomissirlis2014, 9336 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 9337 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 9338 journal = {Numerical Linear Algebra with Applications}, 9339 volume = {21}, 9340 number = {2}, 9341 pages = {221--238}, 9342 year = {2014}, 9343 publisher = {Wiley Online Library}, 9344 petsc_uses = {KSP} 9345} 9346 9347@Article{ badiamartinprincipe2013, 9348 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 9349 solid mechanics}, 9350 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 9351 journal = {International Journal for Numerical Methods in Engineering}, 9352 volume = {96}, 9353 number = {4}, 9354 pages = {203--230}, 9355 year = {2013}, 9356 petsc_uses = {KSP} 9357} 9358 9359@Article{ morganknepleysananscott2016, 9360 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 9361 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 9362 journal = {Concurrency and Computation: Practice and Experience}, 9363 volume = {28}, 9364 pages = {4532--4542}, 9365 year = {2016}, 9366 url = {http://arxiv.org/abs/1602.04873}, 9367 doi = {10.1002/cpe.3820}, 9368 petsc_uses = {KSP} 9369} 9370 9371@Article{ morgansananknepleymills2020, 9372 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 9373 solvers}, 9374 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 9375 journal = {The International Journal of High Performance Computing Applications}, 9376 volume = {35}, 9377 issue = {1}, 9378 doi = {10.1177/1094342020966835}, 9379 url = {https://doi.org/10.1177/1094342020966835}, 9380 eprint = {https://doi.org/10.1177/1094342020966835}, 9381 year = {2020}, 9382 petsc_uses = {KSP} 9383} 9384 9385@Article{ msz2013, 9386 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 9387 author = {M. McCourt and B. F. Smith and H. Zhang}, 9388 journal = {SIAM Journal on Matrix Analysis and Applications}, 9389 year = {2015}, 9390 note = {To appear}, 9391 petsc_uses = {KSP} 9392} 9393 9394@Article{ bassi2014agglomeration, 9395 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 9396 free}, 9397 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 9398 journal = {Mathematical Models and Methods in Applied Sciences}, 9399 volume = {24}, 9400 number = {08}, 9401 pages = {1495--1539}, 9402 year = {2014}, 9403 publisher = {World Scientific}, 9404 petsc_uses = {KSP} 9405} 9406 9407@Article{ jhuranidemkowicz12, 9408 author = {{Jhurani}, C. and {Demkowicz}, L.}, 9409 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 9410 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 9411 journal = {Computer Methods in Applied Mechanics and Engineering}, 9412 volume = {213}, 9413 pages = {418-426}, 9414 year = {2012}, 9415 month = mar, 9416 doi = {10.1016/j.cma.2011.06.003}, 9417 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 9418 petsc_uses = {KSP} 9419} 9420 9421@Article{ yangcai11, 9422 author = {Yang, Haijian and Cai, Xiao-Chuan}, 9423 title = {Parallel Two-Grid Semismooth {N}ewton--{K}rylov--{S}chwarz Method for Nonlinear 9424 Complementarity Problems}, 9425 journal = {J. Sci. Comput.}, 9426 issue_date = {May 2011}, 9427 volume = {47}, 9428 number = {2}, 9429 month = may, 9430 pages = {258--280}, 9431 year = {2011}, 9432 issn = {0885-7474}, 9433 numpages = {23}, 9434 doi = {10.1007/s10915-010-9436-4}, 9435 acmid = {1971246}, 9436 publisher = {Plenum Press}, 9437 address = {New York, NY, USA}, 9438 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 9439 preconditioners, Semismooth Newton, Two-level methods}, 9440 petsc_uses = {KSP} 9441} 9442 9443@Article{ rheinbach09, 9444 author = {Rheinbach, Oliver}, 9445 title = {Parallel Iterative Substructuring in Structural Mechanics}, 9446 journal = {Archives of Computational Methods in Engineering}, 9447 volume = {16}, 9448 number = {4}, 9449 pages = {425-463}, 9450 year = {2009}, 9451 issn = {1134-3060}, 9452 doi = {10.1007/s11831-009-9035-4}, 9453 publisher = {Springer Netherlands}, 9454 language = {English}, 9455 petsc_uses = {KSP} 9456} 9457 9458@Article{ knepleyterrel2013, 9459 author = {Matthew G. Knepley and Andy R. Terrel}, 9460 title = {Finite Element Integration on {GPUs}}, 9461 journal = {{ACM} Transactions on Mathematical Software}, 9462 volume = {39}, 9463 number = {2}, 9464 accepted = {17 April 2012}, 9465 year = {2013}, 9466 abstract = {We present a novel finite element integration method for low order elements on 9467 GPUs. We achieve more than 100GF for element integration on first order 9468 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 9469 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 9470 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 9471 url = {http://arxiv.org/abs/1103.0066}, 9472 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 9473 petsc_uses = {KSP} 9474} 9475 9476@Article{ knepleyruppterrel2016, 9477 title = {Finite Element Integration with Quadrature on the GPU}, 9478 journal = {ArXiv e-prints}, 9479 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 9480 version = {1}, 9481 date = {2016-07-14}, 9482 eprinttype = {arxiv}, 9483 eprintclass = {cs.MS}, 9484 eprint = {1607.04245v1}, 9485 petsc_uses = {KSP} 9486} 9487 9488@Article{ klawonnlanserrheinbach2014, 9489 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 9490 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 9491 journal = {SIAM Journal on Scientific Computing}, 9492 volume = {36}, 9493 number = {2}, 9494 pages = {A737--A765}, 9495 year = {2014}, 9496 petsc_uses = {KSP} 9497} 9498 9499@Article{ bruneknepleysmithtu15, 9500 title = {Composing Scalable Nonlinear Algebraic Solvers}, 9501 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 9502 journal = {SIAM Review}, 9503 volume = {57}, 9504 number = {4}, 9505 pages = {535--565}, 9506 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 9507 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 9508 doi = {10.1137/130936725}, 9509 year = {2015}, 9510 petsc_uses = {KSP} 9511} 9512 9513@Article{ mszm2014, 9514 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 9515 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9516 volume = {40}, 9517 pages = {17--31}, 9518 year = {2014}, 9519 journal = {Parallel Computing}, 9520 doi = {10.1016/j.parco.2013.10.001}, 9521 petsc_uses = {KSP} 9522} 9523 9524@TechReport{ mszm2012, 9525 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 9526 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9527 year = {2012}, 9528 number = {ANL/MCS-P2097-0512}, 9529 institution = {Argonne National Laboratory}, 9530 petsc_uses = {KSP} 9531} 9532 9533@InProceedings{ bkmms2012, 9534 author = {Jed Brown and Matthew G. Knepley and David A. May and Lois C. McInnes and Barry 9535 F. Smith}, 9536 title = {Composable linear solvers for multiphysics}, 9537 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 9538 Computing} ({ISPDC} 2012)}, 9539 year = {2012}, 9540 doi = {10.1109/ISPDC.2012.16}, 9541 publisher = {IEEE Computer Society}, 9542 pages = {55--62}, 9543 petsc_uses = {KSP} 9544} 9545 9546@Article{ bourdinbucuroudet2009, 9547 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 9548 title = {Optimal Partitions for Eigenvalues}, 9549 journal = {SIAM J. Sci. Comput.}, 9550 volume = {31}, 9551 number = {6}, 9552 pages = {4100--4114}, 9553 year = {2009}, 9554 petsc_uses = {KSP} 9555} 9556 9557@InBook{ kimnbourdin2007, 9558 author = {J.-H. Kimn and Blaise Bourdin}, 9559 title = {Numerical implementation of overlapping balancing domain decomposition methods on 9560 unstructured meshes}, 9561 editor = {O. B. Widlund and D. E. Keyes}, 9562 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 9563 series = {Lecture Notes in Computational Science and Engineering}, 9564 number = {55}, 9565 publisher = {Springer-Verlag}, 9566 pages = {309--315}, 9567 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 9568 year = {2007}, 9569 petsc_uses = {KSP} 9570} 9571 9572@Article{ bjm2005, 9573 author = {AH Baker and ER Jessup and T Manteuffel}, 9574 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 9575 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 9576 year = {2005}, 9577 petsc_uses = {KSP} 9578} 9579 9580@Unpublished{ sundar-2008a, 9581 author = {R.S. Sampath and G. Biros}, 9582 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 9583 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9584 petsc_uses = {KSP} 9585} 9586 9587@Article{ sundar-2008, 9588 author = {H. Sundar and R.S. Sampath and G. Biros}, 9589 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 9590 journal = {SIAM Journal on Scientific Computing}, 9591 year = {2008}, 9592 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9593 petsc_uses = {KSP} 9594} 9595 9596@InProceedings{ sundar-2007, 9597 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 9598 title = {Low-constant parallel algorithms for finite element simulations using linear 9599 octrees}, 9600 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 9601 year = {2007}, 9602 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9603 petsc_uses = {KSP} 9604} 9605 9606@InProceedings{ adams-98a, 9607 author = {Adams, Mark ~F.}, 9608 title = {A Parallel Maximal Independent Set Algorithm}, 9609 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 9610 year = {1998}, 9611 petsc_uses = {KSP} 9612} 9613 9614@Article{ akcelik2005ddd, 9615 title = {{Dynamic data-driven inversion for terascale simulations: real-time 9616 identification of airborne contaminants}}, 9617 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 9618 van Bloemen Waanders, B.}, 9619 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 9620 year = {2005}, 9621 publisher = {IEEE Computer Society Washington, DC, USA}, 9622 petsc_uses = {KSP} 9623} 9624 9625@InBook{ akcelik-2006, 9626 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 9627 Bloemen Waanders}, 9628 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 9629 title = {Frontiers of Parallel Computing}, 9630 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 9631 publisher = {SIAM}, 9632 year = {2006}, 9633 petsc_uses = {KSP} 9634} 9635 9636@Article{ dt, 9637 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 9638 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 9639 Convection Diffusion Equations}, 9640 journal = {The Journal of Supercomputing}, 9641 year = {2004}, 9642 pages = {235--253}, 9643 volume = {28}, 9644 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 9645 petsc_uses = {KSP} 9646} 9647 9648@PhDThesis{ hwang2004, 9649 author = {Feng-Nan Hwang}, 9650 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 9651 Computational Fluid Dynamics}, 9652 school = {University of Colorado at Boulder}, 9653 year = {2004}, 9654 petsc_uses = {KSP} 9655} 9656 9657@PhDThesis{ baker, 9658 author = {{A. H.} Baker}, 9659 title = {On improving the performance of the linear solver restarted {GMRES}}, 9660 school = {University of Colorado at Boulder}, 9661 year = {2003}, 9662 petsc_uses = {KSP} 9663} 9664 9665@TechReport{ klawonnrheinbach601, 9666 author = {Axel Klawonn and Oliver Rheinbach}, 9667 title = {A Parallel Implementation of Dual-Primal {FETI-DP} Methods for Three Dimensional 9668 Linear Elasticity Using a Transformation of Basis}, 9669 institution = {Universit\"at Duisburg-Essen}, 9670 year = {2005}, 9671 type = {Technical Report}, 9672 number = {SM-E-601}, 9673 petsc_uses = {KSP} 9674} 9675 9676@TechReport{ klawonnrheinbach609, 9677 author = {Axel Klawonn and Oliver Rheinbach}, 9678 title = {Inexact FETI-DP Methods}, 9679 institution = {Universit\"at Duisburg-Essen}, 9680 year = {2005}, 9681 type = {Technical Report}, 9682 number = {SM-E-609}, 9683 petsc_uses = {KSP} 9684} 9685 9686@TechReport{ klawonnrheinbach607, 9687 author = {Axel Klawonn and Oliver Rheinbach}, 9688 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 9689 institution = {Universit\"at Duisburg-Essen}, 9690 year = {2005}, 9691 type = {Technical Report}, 9692 number = {SM-E-607}, 9693 petsc_uses = {KSP} 9694} 9695 9696@Article{ kul-natraj-pbp, 9697 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 9698 title = {Performance of a parallel mixed finite element implementation for fourth order 9699 clamped anisotropic plate bending problems in distributed memory environments}, 9700 journal = {Applied Mathematics and Computation}, 9701 volume = {155}, 9702 year = {2004}, 9703 number = {3}, 9704 pages = {753--777}, 9705 petsc_uses = {KSP} 9706} 9707 9708@Article{ bramkamp2006uej, 9709 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 9710 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 9711 journal = {Computers \& Fluids}, 9712 volume = {35}, 9713 number = {10}, 9714 pages = {1063--1073}, 9715 doi = {10.1016/j.compfluid.2005.10.003}, 9716 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 9717 derivation of the analytic flux Jacobian can become quite complicated depending on 9718 the complexity of the numerical flux calculation. Practically, the derivation of 9719 the exact Jacobian by hand is an unrealistic option because of the enormous 9720 man-hour investment needed. In this work, automatic differentiation is used to 9721 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 9722 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 9723 approximated by first-order forward differences. For a two-dimensional airfoil 9724 under three different flight conditions (quasi-incompressible flow, compressible 9725 subsonic flow, and transonic flow), we show that the robustness and performance of 9726 the present finite volume scheme is significantly improved by using exact 9727 Jacobians.}, 9728 year = {2006}, 9729 petsc_uses = {KSP} 9730} 9731 9732@Article{ shahbazi1, 9733 author = {Khosro Shahbazi}, 9734 title = {An explicit expression for the penalty parameter of the interior penalty method}, 9735 journal = {Journal of Computational Physics}, 9736 volume = {205}, 9737 year = {2005}, 9738 pages = {401--407}, 9739 petsc_uses = {KSP} 9740} 9741 9742@TechReport{ kk, 9743 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 9744 author = {Hans-Peter Kersken and Uwe Kuster}, 9745 year = {1999}, 9746 institution = {University of Stuttgart}, 9747 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 9748 number = {310}, 9749 petsc_uses = {KSP} 9750} 9751 9752@Article{ miha-mija, 9753 author = {M. D. Mihajlovi and S. Mijalkovi}, 9754 title = {A component decomposition preconditioning for 3D stress analysis problems}, 9755 journal = {Numerical Linear Algebra with Applications}, 9756 volume = {9}, 9757 year = {2002}, 9758 pages = {567--583}, 9759 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 9760 petsc_uses = {KSP} 9761} 9762 9763@Article{ bjm, 9764 author = {M Benzi and W Joubert and G Mateescu}, 9765 journal = {Electronic Transactions on Numerical Analysis}, 9766 year = {1999}, 9767 volume = {8}, 9768 pages = {88--114}, 9769 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 9770 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 9771 petsc_uses = {KSP} 9772} 9773 9774@PhDThesis{ hyde, 9775 author = {EMK Hyde}, 9776 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 9777 school = {Caltech}, 9778 year = {2003}, 9779 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 9780 petsc_uses = {KSP} 9781} 9782 9783@Article{ km2003, 9784 author = {A. Keese and H. G. Matthies}, 9785 journal = {Proceedings in Applied Mathematics and Mechanics}, 9786 year = {2003}, 9787 volume = {2}, 9788 pages = {485--486}, 9789 title = {Parallel Solution of Stochastic PDEs}, 9790 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 9791 petsc_uses = {KSP} 9792} 9793 9794@Article{ whszss, 9795 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 9796 and Otmar Scherzer and H. Siegfried Stiehl}, 9797 journal = {Real Time Imaging}, 9798 year = {2001}, 9799 volume = {7}, 9800 pages = {31--45}, 9801 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 9802 approaches}, 9803 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 9804 petsc_uses = {KSP} 9805} 9806 9807@TechReport{ baker1, 9808 title = {An Efficient Block Variant of GMRES}, 9809 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 9810 year = {2003}, 9811 type = {Technical Report}, 9812 institution = {University of Colorado, Boulder}, 9813 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 9814 number = {CU-CS-957-03}, 9815 petsc_uses = {KSP} 9816} 9817 9818@InProceedings{ mc2003, 9819 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 9820 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 9821 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9822 Methods}, 9823 pages = {639--646}, 9824 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9825 note = {}, 9826 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9827 year = {2003}, 9828 petsc_uses = {KSP} 9829} 9830 9831@InProceedings{ kt2003, 9832 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 9833 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 9834 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9835 Methods}, 9836 pages = {615--622}, 9837 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9838 note = {}, 9839 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9840 year = {2003}, 9841 petsc_uses = {KSP} 9842} 9843 9844@InProceedings{ krw2003, 9845 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 9846 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 9847 3D}, 9848 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9849 Methods}, 9850 pages = {361--368}, 9851 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9852 note = {}, 9853 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9854 year = {2003}, 9855 petsc_uses = {KSP} 9856} 9857 9858@InProceedings{ hc2003, 9859 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 9860 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 9861 Nonlinear Preconditioning}, 9862 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9863 Methods}, 9864 pages = {201--208}, 9865 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9866 note = {}, 9867 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9868 year = {2003}, 9869 petsc_uses = {KSP} 9870} 9871 9872@InProceedings{ g2003, 9873 author = {P. Goldfeld}, 9874 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 9875 (Generalized) {Stokes} and Parallel Implementation}, 9876 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9877 Methods}, 9878 pages = {209--216}, 9879 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9880 publisher = {National Autonomous University of Mexico (UNAM)}, 9881 note = {}, 9882 url = {http://www.ddm.org/DD14}, 9883 year = {2003}, 9884 petsc_uses = {KSP} 9885} 9886 9887@InProceedings{ dhv2003, 9888 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 9889 title = {Toward scalable {FETI} algorithm for variational inequalities with applications to 9890 composites}, 9891 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9892 Methods}, 9893 pages = {395--401}, 9894 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9895 publisher = {National Autonomous University of Mexico (UNAM)}, 9896 note = {}, 9897 url = {http://www.ddm.org/DD14}, 9898 year = {2003}, 9899 petsc_uses = {KSP} 9900} 9901 9902@InProceedings{ dhsv2002, 9903 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9904 title = {Scalabilities of {FETI} for variational inequalities and contact shape 9905 optimization}, 9906 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9907 Methods}, 9908 pages = {359--367}, 9909 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9910 publisher = {CIMNE, Barcelona, Spain}, 9911 note = {}, 9912 url = {http://www.ddm.org/DD13}, 9913 year = {2002}, 9914 petsc_uses = {KSP} 9915} 9916 9917@InProceedings{ cky2002, 9918 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 9919 title = {A Nonlinear Additive {S}chwarz Preconditioned Inexact {N}ewton Method for Shocked 9920 Duct Flows}, 9921 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9922 Methods}, 9923 pages = {343--350}, 9924 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9925 publisher = {CIMNE, Barcelona, Spain}, 9926 note = {}, 9927 url = {http://www.ddm.org/DD13}, 9928 year = {2002}, 9929 petsc_uses = {KSP} 9930} 9931 9932@Conference{ li-etal:03, 9933 author = {Li, Z. and Lanteri S. and Saad, Y.}, 9934 title = {Multiplicative-additive preconditioning combination for general sparse linear 9935 systems}, 9936 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 9937 Matrix Problems in Scientific and Industrial Applications}, 9938 address = {Napa, California, USA}, 9939 date = {october 27-29}, 9940 year = {2003}, 9941 petsc_uses = {KSP} 9942} 9943 9944@Article{ bashir2008hessian, 9945 title = {Hessian-based model reduction for large-scale systems with initial-condition 9946 inputs}, 9947 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 9948 J.}, 9949 journal = {International journal for numerical methods in engineering}, 9950 volume = {73}, 9951 number = {6}, 9952 pages = {844--868}, 9953 year = {2008}, 9954 publisher = {Wiley Online Library}, 9955 petsc_uses = {KSP} 9956} 9957 9958@Article{ bashir2007hessian, 9959 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 9960 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 9961 K.}, 9962 journal = {Computational Science--ICCS 2007}, 9963 pages = {1010--1017}, 9964 year = {2007}, 9965 publisher = {Springer}, 9966 petsc_uses = {KSP} 9967} 9968 9969@Article{ akcelik2011fast, 9970 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 9971 inverse problems based on low-rank partial {H}essian approximations}, 9972 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 9973 Waanders, B. and Wilcox, L.}, 9974 journal = {SIAM Journal on Scientific Computing}, 9975 volume = {33}, 9976 number = {1}, 9977 year = {2011}, 9978 petsc_uses = {KSP} 9979} 9980 9981@InProceedings{ ff2003, 9982 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 9983 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 9984 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 9985 year = {2003}, 9986 petsc_uses = {KSP} 9987} 9988 9989@InProceedings{ d2b2004, 9990 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 9991 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 9992 Ordering Strategies}, 9993 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 9994 year = {2004}, 9995 petsc_uses = {KSP} 9996} 9997 9998@InProceedings{ d2v2005, 9999 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 10000 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 10001 Flow Equations}, 10002 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 10003 year = {2005}, 10004 petsc_uses = {KSP} 10005} 10006 10007@InProceedings{ dvs2006, 10008 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 10009 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 10010 Mixed Convection Equations}, 10011 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 10012 year = {2006}, 10013 petsc_uses = {KSP} 10014} 10015 10016@Article{ dsv2006, 10017 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 10018 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 10019 Flow Equations}, 10020 journal = {Computational Fluid Dynamics}, 10021 year = {2006}, 10022 volume = {15}, 10023 number = {1}, 10024 petsc_uses = {KSP} 10025} 10026 10027@Article{ lahaye03, 10028 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 10029 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10030 journal = {J. Comput. Appl. Math.}, 10031 year = {2004}, 10032 pages = {267--275}, 10033 volume = {168}, 10034 petsc_uses = {KSP} 10035} 10036 10037@TechReport{ brmn, 10038 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 10039 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 10040 year = {2002}, 10041 type = {Technical Report}, 10042 institution = {ANL}, 10043 number = {ANL/MCS-P993-0902}, 10044 note = {To appear in Future Generation Computer Systems}, 10045 petsc_uses = {KSP} 10046} 10047 10048@InProceedings{ mnbr, 10049 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 10050 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 10051 Algorithms}, 10052 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 10053 Mechanics}, 10054 year = {2003}, 10055 petsc_uses = {KSP} 10056} 10057 10058@InProceedings{ bmnr, 10059 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 10060 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 10061 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 10062 Applications, Lecture notes in Computer Science 2677}, 10063 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 10064 pages = {828--839}, 10065 year = {2003}, 10066 petsc_uses = {KSP} 10067} 10068 10069@Article{ ph03, 10070 author = {M. Pernice and R. D. Hornung}, 10071 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 10072 journal = {Computing and Visualization in Science}, 10073 year = {2003}, 10074 lab = {LANL}, 10075 petsc_uses = {KSP} 10076} 10077 10078@Article{ adams-02, 10079 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 10080 journal = {J. Comp. Phys.}, 10081 number = {2}, 10082 pages = {593-610}, 10083 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 10084 volume = {188}, 10085 year = {2003}, 10086 petsc_uses = {KSP} 10087} 10088 10089@InProceedings{ adams2001distributed, 10090 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 10091 smoothers}, 10092 author = {Adams, M.F.}, 10093 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 10094 pages = {14--14}, 10095 year = {2001}, 10096 organization = {IEEE}, 10097 petsc_uses = {KSP} 10098} 10099 10100@PhDThesis{ els01, 10101 author = {Ulrich Elsner}, 10102 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 10103 algorithms}, 10104 school = {Technical University Chemnitz}, 10105 year = {2002}, 10106 publisher = {Logos Verlag, Berlin}, 10107 isbn = {3-89722-923-4}, 10108 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 10109 different graph partitioning algorithms}, 10110 petsc_uses = {KSP} 10111} 10112 10113@TechReport{ ckk02, 10114 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 10115 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 10116 year = {2002}, 10117 type = {Technical Report}, 10118 institution = {ODU}, 10119 url = {http://www.math.odu.edu/\~{ }keyes}, 10120 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 10121 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 10122 Methods}, 10123 petsc_uses = {KSP} 10124} 10125 10126@Article{ gpw2002, 10127 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 10128 Heterogeneous Problems in Linear Elasticity}, 10129 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 10130 year = {2003}, 10131 pages = {283--324}, 10132 volume = {95}, 10133 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 10134 journal = {Numerische Mathematik}, 10135 petsc_uses = {KSP} 10136} 10137 10138@Article{ dh1, 10139 title = {Scalability and FETI based algorithm for large discretized variational 10140 inequalities}, 10141 author = {Z Dostal and D Horak}, 10142 year = {2003}, 10143 pages = {347--357}, 10144 volume = {61}, 10145 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 10146 journal = {Mathematics and Computers in Simulation}, 10147 petsc_uses = {KSP} 10148} 10149 10150@InProceedings{ dhsv1, 10151 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 10152 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 10153 title = {36 Scalabilities of {FETI} for Variational Inequalities and Contact Shape 10154 Optimization}, 10155 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10156 Methods}, 10157 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10158 Kuznetsov}, 10159 petsc_uses = {KSP} 10160} 10161 10162@Article{ lahaye02, 10163 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 10164 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10165 journal = {IEEEMAGN}, 10166 year = {2002}, 10167 volume = {38}, 10168 number = {2}, 10169 pages = {413-416}, 10170 petsc_uses = {KSP} 10171} 10172 10173@Article{ ckm01, 10174 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 10175 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 10176 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 10177 fluid dynamics}, 10178 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 10179 year = {2002}, 10180 volume = {40}, 10181 pages = {1463--1470}, 10182 petsc_uses = {KSP} 10183} 10184 10185@InProceedings{ cky01, 10186 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 10187 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 10188 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 10189 duct flow}, 10190 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10191 Methods}, 10192 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10193 Kuznetsov}, 10194 year = {2002}, 10195 petsc_uses = {KSP} 10196} 10197 10198@Article{ ck02, 10199 author = {X.-C. Cai and D. E. Keyes}, 10200 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 10201 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 10202 journal = {SIAM J. Sci. Comput.}, 10203 year = {2002}, 10204 pages = {183--200}, 10205 volume = {24}, 10206 petsc_uses = {KSP} 10207} 10208 10209@Article{ c04, 10210 author = {Feng-Nan Hwang and X.-C. Cai}, 10211 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 10212 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 10213 for incompressible {Navier-Stokes} equations}, 10214 journal = {Journal of Computational Physics}, 10215 year = {2005}, 10216 volume = {204}, 10217 pages = {666--691}, 10218 petsc_uses = {KSP} 10219} 10220 10221@Article{ hc06, 10222 author = {Feng-Nan Hwang and X.-C. Cai}, 10223 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 10224 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 10225 Algorithms}, 10226 journal = {Computer Methods in Applied Mechanics and Engineering}, 10227 year = {2006}, 10228 volume = {196}, 10229 pages = {1603--1611}, 10230 petsc_uses = {KSP} 10231} 10232 10233@InProceedings{ adams-01, 10234 author = {Mark F. Adams}, 10235 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 10236 Smoothers}, 10237 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 10238 address = {Denver, Colorado}, 10239 month = nov, 10240 year = {2001}, 10241 petsc_uses = {KSP} 10242} 10243 10244@Book{ 1dl, 10245 author = {Domenico Lahaye}, 10246 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 10247 Computations}, 10248 year = {2001}, 10249 publisher = {Katholieke Universiteit Leuven}, 10250 notes = {Thesis}, 10251 petsc_uses = {KSP} 10252} 10253 10254@Article{ adams-00, 10255 author = {Adams, M.~F.}, 10256 journal = {International Journal for Numerical Methods in Engineering}, 10257 number = {8}, 10258 pages = {1241-1262}, 10259 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 10260 Deformation Elasticity and Plasticity}, 10261 volume = {48}, 10262 year = {2000}, 10263 petsc_uses = {KSP} 10264} 10265 10266@Article{ adams2002evaluation, 10267 author = {Adams, M.~F.}, 10268 journal = {International Journal for Numerical Methods in Engineering}, 10269 number = {1}, 10270 pages = {519-534}, 10271 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 10272 Problems in Solid Mechanics}, 10273 volume = {55}, 10274 year = {2002}, 10275 petsc_uses = {KSP} 10276} 10277 10278@Article{ lahaye00, 10279 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 10280 title = {Algebraic Multigrid for Complex Symmetric Systems}, 10281 journal = {IEEEMAGN}, 10282 year = {2000}, 10283 volume = {36}, 10284 number = {4}, 10285 pages = {1535--1538}, 10286 petsc_uses = {KSP} 10287} 10288 10289@InProceedings{ adams-99c, 10290 author = {Mark F. Adams and J. Demmel}, 10291 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 10292 Finite Element Problems}, 10293 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 10294 address = {Portland, Oregon}, 10295 month = nov, 10296 year = {1999}, 10297 petsc_uses = {KSP} 10298} 10299 10300@Article{ chan95, 10301 author = {T. Chan and B. Smith and J. Zou}, 10302 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 10303 Grids}, 10304 journal = {Numer. Math.}, 10305 year = {1995}, 10306 volume = {73}, 10307 pages = {149--167}, 10308 petsc_uses = {KSP} 10309} 10310 10311@TechReport{ adams-csd-98-993, 10312 pages = {11}, 10313 year = {1998}, 10314 type = {Technical Report}, 10315 number = {CSD-98-993}, 10316 institution = {University of California, Berkeley}, 10317 title = {A Parallel Maximal Independent Set Algorithm}, 10318 bibdate = {March 11, 1998}, 10319 author = {Mark F. Adams and James Demmel}, 10320 abstract = {The parallel construction of maximal independent sets is a useful building block 10321 for many algorithms in the computational sciences, including graph coloring and 10322 multigrid coarse grid creation on unstructured meshes. We present an efficient 10323 asynchronous maximal independent set algorithm for use on parallel computers, for 10324 ``well partitioned'' graphs, that arise from finite element (FE) models. For 10325 appropriately partitioned bounded degree graphs, it is shown that the running time 10326 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 10327 improvement over the previous best P-RAM complexity for this class of graphs. We 10328 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 10329 model is indicative of the performance one can expect with practical partitions on 10330 graphs from FE problems.}, 10331 month = mar, 10332 petsc_uses = {KSP} 10333} 10334 10335@Article{ benzigolubliesen2005, 10336 title = {Numerical solution of saddle point problems}, 10337 author = {Michele Benzi and Gene H. Golub and J\"org Liesen}, 10338 volume = {14}, 10339 journal = {Acta Numerica}, 10340 pages = {1-–137}, 10341 doi = {10.1017/S0962492904000212}, 10342 year = {2005} 10343} 10344 10345@Article{ mardal2011preconditioning, 10346 title = {Preconditioning discretizations of systems of partial differential equations}, 10347 author = {Kent-Andre Mardal and Ragnar Winther}, 10348 journal = {Numerical Linear Algebra with Applications}, 10349 volume = {18}, 10350 number = {1}, 10351 pages = {1--40}, 10352 year = {2011} 10353} 10354 10355@TechReport{ k676, 10356 year = {1994}, 10357 type = {Technical Report}, 10358 number = {TR1994-676}, 10359 institution = {New York University}, 10360 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 10361 Term}, 10362 author = {Axel Klawonn}, 10363 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 10364 petsc_uses = {KSP} 10365} 10366 10367@Book{ ak1, 10368 author = {Axel Klawonn}, 10369 title = {Preconditioners for Indefinite Problems}, 10370 year = {1995}, 10371 publisher = {Westfalishen Wilhelms-Universitat Munster}, 10372 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 10373 notes = {Thesis}, 10374 petsc_uses = {KSP} 10375} 10376 10377@TechReport{ knepleykarpeev05, 10378 pages = {41}, 10379 year = {2005}, 10380 type = {Technical Report}, 10381 number = {ANL/MCS-P1295-1005}, 10382 institution = {Argonne National Laboratory}, 10383 title = {Flexible Representation of Computational Meshes}, 10384 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10385 abstract = {}, 10386 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 10387 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 10388 month = oct, 10389 petsc_uses = {DMPlex} 10390} 10391 10392@TechReport{ knepleykarpeev07a, 10393 pages = {14}, 10394 year = {2007}, 10395 type = {Technical Report}, 10396 number = {ANL/MCS-P1455-0907}, 10397 institution = {Argonne National Laboratory}, 10398 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10399 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10400 abstract = {}, 10401 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 10402 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 10403 month = feb, 10404 petsc_uses = {DMPlex} 10405} 10406 10407@Article{ knepleykarpeev09, 10408 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10409 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10410 journal = {Scientific Programming}, 10411 volume = {17}, 10412 number = {3}, 10413 pages = {215--230}, 10414 year = {2009}, 10415 doi = {10.3233/SPR-2009-0249}, 10416 url = {http://arxiv.org/abs/0908.4427}, 10417 note = {\url{http://arxiv.org/abs/0908.4427}}, 10418 petsc_uses = {DMPlex} 10419} 10420 10421@Article{ biezuner2012computing, 10422 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 10423 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 10424 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 10425 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 10426 Sublinear Supersolutions}, 10427 journal = {Journal of Scientific Computing}, 10428 publisher = {Springer Netherlands}, 10429 issn = {0885-7474}, 10430 keyword = {Mathematics and Statistics}, 10431 pages = {180--201}, 10432 volume = {52}, 10433 issue = {1}, 10434 year = {2012}, 10435 doi = {10.1007/s10915-011-9540-0}, 10436 petsc_uses = {KSP} 10437} 10438 10439% LiteralHTML: 10440% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 10441% LiteralHTML: 10442@Book{ knepley2017, 10443 title = {Computational Science I}, 10444 author = {Matthew G. Knepley}, 10445 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 10446 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 10447 publisher = {PETSc}, 10448 year = {2017}, 10449 petsc_uses = {KSP} 10450} 10451 10452@Article{ verleyeuser, 10453 title = {{User friendly permeability predicting software for technical textiles}}, 10454 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 10455 Roose, D.}, 10456 journal = {status: published}, 10457 issn = {1560-6074}, 10458 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 10459 petsc_uses = {KSP} 10460} 10461 10462@Book{ pacheco, 10463 author = {Peter Pacheco}, 10464 title = {Parallel Programming with MPI}, 10465 year = {1997}, 10466 publisher = {Morgan-Kaufmann}, 10467 note = {Devotes a couple of sections to PETSc}, 10468 petsc_uses = {KSP} 10469} 10470 10471@Book{ 1sbg, 10472 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 10473 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 10474 Differential Equations}, 10475 year = {1996}, 10476 publisher = {Cambridge University Press}, 10477 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 10478 petsc_uses = {KSP} 10479} 10480 10481@Misc{ petsc-fem:homepage, 10482 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 10483 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 10484 G. Rodriguez and G. Filippini}, 10485 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 10486 petsc_uses = {KSP} 10487} 10488 10489@Misc{ petsc4py-web-page, 10490 author = {Lisandro Dalcin}, 10491 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 10492 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 10493 note = {http://code.google.com/p/petsc4py/}, 10494 petsc_uses = {KSP} 10495} 10496 10497@Article{ libmeshpaper06, 10498 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 10499 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 10500 Simulations}}, 10501 journal = {Engineering with Computers}, 10502 volume = {22}, 10503 number = {3--4}, 10504 pages = {237--254}, 10505 year = {2006}, 10506 doi = {10.1007/s00366-006-0049-3}, 10507 petsc_uses = {KSP} 10508} 10509 10510@Misc{ sisiphus:homepage, 10511 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 10512 High-Resolution, Unstructured Simulations}, 10513 author = {T. {Tautges et al.}}, 10514 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 10515 petsc_uses = {KSP} 10516} 10517 10518@Misc{ pflotran:homepage, 10519 title = {{PFLOTRAN} project}, 10520 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 10521 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 10522 howpublished = {\url{http://pflotran.org/}}, 10523 petsc_uses = {KSP} 10524} 10525 10526@Misc{ pism:homepage, 10527 title = {{PISM}: A Parallel Ice Sheet Model}, 10528 author = {E. {Bueler et al.}}, 10529 howpublished = {\url{http://pism-docs.org}}, 10530 petsc_uses = {KSP} 10531} 10532 10533@Misc{ dohp:homepage, 10534 title = {Dohp: Dual order $hp$-finite elements}, 10535 author = {J. Brown}, 10536 howpublished = {\url{http://dohp.org}}, 10537 petsc_uses = {KSP} 10538} 10539 10540@Article{ mccourtrognlienetal12, 10541 title = {Improving parallel scalability for edge plasma transport simulations with neutral 10542 gas species}, 10543 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 10544 journal = {Computational Science and Discovery}, 10545 year = {2012}, 10546 volume = {5}, 10547 number = {014012}, 10548 doi = {10.1088/1749-4699/5/1/014012}, 10549 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 10550 2011)}, 10551 petsc_uses = {KSP} 10552} 10553 10554@Misc{ petclaw-github, 10555 title = {Pet{C}law Software}, 10556 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 10557 year = {2011}, 10558 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 10559 petsc_uses = {KSP} 10560} 10561 10562@Misc{ pyclaw-web-page, 10563 author = {Kyle T. Mandli and David I. Ketcheson and others}, 10564 title = {{PyClaw} software}, 10565 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 10566 url = {http://clawpack.github.io/doc/pyclaw/}, 10567 year = {2012}, 10568 petsc_uses = {KSP} 10569} 10570 10571@Article{ ketcheson2011highorder, 10572 title = {High-order wave propagation algorithms for general hyperbolic systems}, 10573 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 10574 year = {2011}, 10575 note = {submitted}, 10576 petsc_uses = {KSP} 10577} 10578 10579@Article{ biros2005pln1, 10580 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 10581 optimization. Part I: The {Krylov-Schur} solver}}, 10582 author = {Biros, G. and Ghattas, O.}, 10583 journal = {SIAM Journal on Scientific Computing}, 10584 volume = {27}, 10585 number = {2}, 10586 pages = {687--713}, 10587 year = {2005}, 10588 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10589 petsc_uses = {KSP} 10590} 10591 10592@Article{ biros2005pln2, 10593 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 10594 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 10595 optimal control of steady viscous flows}, 10596 author = {Biros, G. and Ghattas, O.}, 10597 journal = {SIAM Journal on Scientific Computing}, 10598 volume = {27}, 10599 number = {2}, 10600 pages = {714--739}, 10601 year = {2005}, 10602 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10603 petsc_uses = {KSP} 10604} 10605 10606@Misc{ issm:homepage, 10607 title = {{I}ce {S}heet {S}ystem {M}odel}, 10608 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 10609 year = {2010}, 10610 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 10611 petsc_uses = {KSP} 10612} 10613 10614@Article{ morlighem2010spatial, 10615 title = {Spatial patterns of basal drag inferred using control methods from a 10616 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 10617 {A}ntarctica}, 10618 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 10619 Aubry, D.}, 10620 journal = {Geophysical Research Letters}, 10621 volume = {37}, 10622 number = {14}, 10623 pages = {L14502}, 10624 year = {2010}, 10625 publisher = {American Geophysical Union}, 10626 petsc_uses = {KSP} 10627} 10628 10629@Article{ jardin2012plasmas, 10630 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 10631 of tokamak plasmas}, 10632 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 10633 journal = {Computational Science \& Discovery}, 10634 volume = {5}, 10635 number = {1}, 10636 url = {http://stacks.iop.org/1749-4699/5/014002}, 10637 year = {2012}, 10638 petsc_uses = {KSP} 10639} 10640 10641@Article{ cmz2016, 10642 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10643 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 10644 journal = {Journal of Scientific Computing}, 10645 publisher = {Springer}, 10646 pages = {803--825}, 10647 volume = {68}, 10648 issue = {2}, 10649 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 10650 doi = {10.1007/s10915-015-0159-4}, 10651 year = {2016}, 10652 note = {Also preprint ANL/MCS-P3039-0912}, 10653 petsc_uses = {KSP} 10654} 10655 10656@Article{ knepleybrownruppsmith13, 10657 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 10658 title = {Achieving High Performance with Unified Residual Evaluation}, 10659 journal = {ArXiv e-prints}, 10660 eprint = {1309.1204}, 10661 archiveprefix = {arXiv}, 10662 primaryclass = {cs.MS}, 10663 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 10664 Engineering, Finance, and Science}, 10665 year = {2013}, 10666 month = sep, 10667 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 10668 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10669 petsc_uses = {KSP} 10670} 10671 10672@Book{ fenicsbook, 10673 title = {Automated Solution of Differential Equations by the Finite Element Method: The 10674 FEniCS Book}, 10675 series = {Lecture Notes in Computational Science and Engineering}, 10676 volume = {84}, 10677 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 10678 publisher = {Springer}, 10679 isbn = {978-3-642-23098-1}, 10680 year = {2012}, 10681 petsc_uses = {KSP} 10682} 10683 10684@Article{ demidovahnertruppgottschling12, 10685 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 10686 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 10687 journal = {ArXiv e-prints}, 10688 archiveprefix = {arXiv}, 10689 eprint = {1212.6326}, 10690 primaryclass = {cs.MS}, 10691 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 10692 Parallel, and Cluster Computing, Physics - Computational Physics}, 10693 year = {2012}, 10694 month = dec, 10695 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 10696 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10697 petsc_uses = {KSP} 10698} 10699 10700@InProceedings{ viennacl, 10701 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 10702 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 10703 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 10704 year = {2010}, 10705 pages = {51-56}, 10706 petsc_uses = {KSP} 10707} 10708 10709@Article{ knepleybrownmcinnessmithruppadams2015, 10710 title = {Exascale Computing without Threads}, 10711 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10712 Karl Rupp and Mark Adams}, 10713 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 10714 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10715 Scientific Software Architecture for Portability and Performance}, 10716 doi = {10.6084/m9.figshare.5824950.v1}, 10717 year = {2015}, 10718 petsc_uses = {KSP} 10719} 10720 10721@Article{ knepleybrownmcinnessmithruppadams2015b, 10722 title = {Overview of the {PETSc} Library}, 10723 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10724 Karl Rupp and Mark Adams}, 10725 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 10726 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10727 Scientific Software Architecture for Portability and Performance}, 10728 year = {2015}, 10729 petsc_uses = {KSP} 10730} 10731 10732@InCollection{ balaybrownknepleymcinnessmith2015, 10733 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 10734 Smith}, 10735 title = {Providing Mixed Language and Legacy Support within a Library}, 10736 editor = {J. Carver}, 10737 booktitle = {Software Engineering for Science}, 10738 publisher = {Taylor \& Francis}, 10739 year = {2015}, 10740 petsc_uses = {KSP} 10741} 10742 10743@Article{ ruppbalaybrownknepleymcinnessmith2015, 10744 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 10745 Software}, 10746 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 10747 McInnes and Barry F. Smith}, 10748 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 10749 Productivity Challenges}, 10750 journal = {ArXiv e-prints}, 10751 archiveprefix = {arXiv}, 10752 eprint = {1510.01122}, 10753 year = {2015}, 10754 petsc_uses = {KSP} 10755} 10756 10757@InProceedings{ knepley2013accurately, 10758 title = {Accurately Citing Software and Algorithms Used in Publications}, 10759 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 10760 F.}, 10761 year = {2013}, 10762 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10763 (WSSSPE), held at SC13}, 10764 doi = {10.6084/m9.figshare.785731}, 10765 petsc_uses = {KSP} 10766} 10767 10768@InProceedings{ milleretal2013, 10769 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 10770 Strategies Developed for {FASTMath}}, 10771 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 10772 Barry Smith}, 10773 year = {2013}, 10774 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10775 (WSSSPE), held at SC13}, 10776 doi = {10.6084/m9.figshare.789055}, 10777 petsc_uses = {KSP} 10778} 10779 10780@TechReport{ dudsonetal2012, 10781 title = {Improved Nonlinear Solvers in {BOUT++}}, 10782 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 10783 institution = {Argonne National Laboratory}, 10784 number = {ANL/MCS-P3025-0812}, 10785 year = {2012}, 10786 petsc_uses = {KSP} 10787} 10788 10789@Misc{ brown13, 10790 author = {J. Brown}, 10791 title = {Scalable Repository Workflows}, 10792 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10793 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10794 year = {2013}, 10795 petsc_uses = {KSP} 10796} 10797 10798@Misc{ starforest11, 10799 title = {Star forests as a parallel communication model}, 10800 author = {Jed Brown}, 10801 url = {https://jedbrown.org/files/StarForest.pdf}, 10802 year = {2011}, 10803 petsc_uses = {KSP} 10804} 10805 10806@Misc{ brownknepleysmith13, 10807 author = {J. Brown and M. Knepley and B. Smith}, 10808 title = {Run-time Extensibility: Anything Less is Unsustainable}, 10809 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10810 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10811 year = {2013}, 10812 petsc_uses = {KSP} 10813} 10814 10815@Article{ jzhaoyliwkliu15, 10816 author = {J. Zhao and Y. Li and W.K. Liu}, 10817 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 10818 via {XFEM}}, 10819 journal = {Computational Mechanics}, 10820 year = {2015}, 10821 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 10822 petsc_uses = {KSP} 10823} 10824 10825@Article{ alisic14, 10826 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 10827 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 10828 journal = {J. Geophys. Res.}, 10829 year = {2014}, 10830 volume = {119}, 10831 number = {7}, 10832 pages = {5903-5920}, 10833 doi = {10.1002/2013JB010906}, 10834 petsc_uses = {KSP} 10835} 10836 10837@Article{ rhebergen14, 10838 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 10839 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 10840 journal = {SIAM J. Sci. Comp.}, 10841 year = {2014}, 10842 volume = {36}, 10843 number = {4}, 10844 pages = {1960-1977}, 10845 doi = {10.1137/130946678}, 10846 petsc_uses = {KSP} 10847} 10848 10849@Article{ allwright14, 10850 author = {J. Allwright and R.F. Katz}, 10851 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 10852 journal = {Geophys. J. Int.}, 10853 year = {2014}, 10854 volume = {199}, 10855 number = {3}, 10856 pages = {1608--1624}, 10857 doi = {10.1093/gji/ggu345}, 10858 petsc_uses = {KSP} 10859} 10860 10861@Misc{ gropp10, 10862 author = {William D. Gropp}, 10863 title = {Update on libraries for {B}lue {W}aters}, 10864 address = {Bordeaux, France}, 10865 year = {2010}, 10866 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 10867 petsc_uses = {KSP} 10868} 10869 10870@InProceedings{ mayknepley2017, 10871 title = {{DMSwarm}: Particles in {PETSc}}, 10872 author = {Dave A May and Matthew G Knepley}, 10873 booktitle = {EGU General Assembly Conference Abstracts}, 10874 volume = {19}, 10875 pages = {10133}, 10876 year = {2017}, 10877 petsc_uses = {KSP} 10878} 10879 10880@InProceedings{ adamsbrownknepley2013, 10881 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 10882 title = {Low-communication techniques for extreme-scale multilevel solvers}, 10883 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 10884 organization = {DOE Office of Advanced Scientific Computing Research}, 10885 year = {2013}, 10886 petsc_uses = {KSP} 10887} 10888 10889@Article{ bhallagriffithknepleyadamsguy2017, 10890 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 10891 boundary equations}, 10892 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 10893 Adams and Robert D. Guy}, 10894 journal = {arXiv e-prints}, 10895 eprint = {1612.02208}, 10896 year = {2017}, 10897 note = {\url{http://arxiv.org/abs/1612.02208}}, 10898 petsc_uses = {KSP} 10899} 10900 10901@Article{ zampini2016pcbddc, 10902 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 10903 author = {Zampini, Stefano}, 10904 journal = {SIAM Journal on Scientific Computing}, 10905 volume = {38}, 10906 number = {5}, 10907 pages = {S282--S306}, 10908 year = {2016}, 10909 publisher = {SIAM}, 10910 petsc_uses = {KSP} 10911} 10912 10913@Article{ jolivetromanzampini2020, 10914 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 10915 robust multilevel overlapping {Schwarz} preconditioners}, 10916 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 10917 journal = {Computers and Mathematics with Applications}, 10918 volume = {84}, 10919 pages = {277--295}, 10920 year = {2020} 10921} 10922 10923@Article{ zampinitu2017, 10924 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 10925 porous media}, 10926 author = {Stefano Zampini and Xuemin Tu}, 10927 journal = {SIAM Journal of Scientific Computing}, 10928 volume = {39}, 10929 number = {4}, 10930 pages = {A1389--A1415}, 10931 year = {2017} 10932} 10933 10934@Article{ ohwidlundzampinidohrmann2017, 10935 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 10936 constraints for {Raviart-Thomas} vector fields}, 10937 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 10938 journal = {Mathematics of Computation}, 10939 volume = {87}, 10940 number = {310}, 10941 pages = {659--692}, 10942 year = {2017} 10943} 10944 10945@Article{ veigapavarinoscacchiwidlundzampini2016, 10946 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 10947 preconditioners}, 10948 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 10949 Stefano Zampini}, 10950 journal = {SIAM Journal of Scientific Computing}, 10951 volume = {39}, 10952 number = {1}, 10953 pages = {A281--A302}, 10954 year = {2016} 10955} 10956 10957@Article{ pavarinoscacchiwidlundzampini2018, 10958 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 10959 analysis}, 10960 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 10961 journal = {Mathematical Models and Methods in Applied Sciences}, 10962 volume = {28}, 10963 number = {7}, 10964 pages = {1337--1370}, 10965 year = {2018} 10966} 10967 10968@Article{ bergervergiatwaisman2017, 10969 title = {An overlapping Domain Decomposition preconditioning method for monolithic 10970 solution of shear bands}, 10971 author = {Luc Berger-Vergiat and Haim Waisman}, 10972 journal = {Computer Methods in Applied Mechanics and Engineering}, 10973 volume = {318}, 10974 pages = {33--60}, 10975 year = {2017}, 10976 petsc_uses = {KSP} 10977} 10978 10979@Article{ abhyankarmaldonadosmithzhang2020, 10980 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 10981 Simulations}, 10982 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 10983 H. Zhang}, 10984 journal = {ACM Transactions on Mathematical Software}, 10985 volume = {46}, 10986 number = {1}, 10987 year = {2020}, 10988 doi = {10.1145/3344587}, 10989 petsc_uses = {KSP} 10990} 10991 10992@InProceedings{ zhangellpack2018, 10993 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 10994 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 10995 {AVX-512}}, 10996 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 10997 year = {2018}, 10998 petsc_uses = {KSP} 10999} 11000 11001@Misc{ petsc-user-meetings:website, 11002 title = {{PETSc User Meetings}}, 11003 key = {PETSc User Meetings}, 11004 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 11005 petsc_uses = {KSP} 11006} 11007 11008@Article{ flexible-bicgstab-chen16, 11009 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 11010 author = {J. Chen and L.C. McInnes and H. Zhang}, 11011 journal = {Journal of Scientific Computing}, 11012 volume = {68}, 11013 number = {2}, 11014 month = jul, 11015 year = {2016}, 11016 pages = {803--825}, 11017 doi = {10.1007/s10915-015-0159-4}, 11018 petsc_uses = {KSP} 11019} 11020 11021@Misc{ petsc-extensibility2016, 11022 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 11023 title = {{Extensibility in PETSc}}, 11024 note = {SIAM News, available via 11025 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 11026 year = {2016}, 11027 petsc_uses = {KSP} 11028} 11029 11030@Misc{ error-estimation-whitepaper2017, 11031 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 11032 title = {End-to-end error estimation and control}, 11033 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 11034 doi = {10.6084/m9.figshare.5339866}, 11035 year = {2017}, 11036 petsc_uses = {KSP} 11037} 11038 11039@Misc{ petsc-user-support15, 11040 title = {On the Evolution of User Support Topics in Computational Science and Engineering 11041 Software}, 11042 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 11043 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 11044 15-16, 2015}, 11045 year = {2015}, 11046 petsc_uses = {KSP} 11047} 11048 11049@InBook{ petsc-mixed-language-support2016, 11050 title = {Numerical Library Support for High-Performance Mixed Language Applications and 11051 Legacy Code}, 11052 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 11053 booktitle = {Software Engineering for Science}, 11054 editors = {J. Carver et al.}, 11055 publisher = {CRC Press}, 11056 pages = {201--214}, 11057 year = {2016}, 11058 petsc_uses = {KSP} 11059} 11060 11061@InProceedings{ konolige2018parallel, 11062 title = {A Parallel Solver for Graph {L}aplacians}, 11063 author = {Tristan Konolige and Jed Brown}, 11064 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 11065 doi = {10.1145/3218176.3218227}, 11066 note = {Best Paper Award}, 11067 archiveprefix = {arXiv}, 11068 eprint = {1705.06266}, 11069 year = {2018}, 11070 petsc_uses = {KSP} 11071} 11072 11073@InProceedings{ werner-kimn2019, 11074 title = {Parallel implementation of {AC} optimal power flow and time-constrained optimal 11075 power flow using high-performance computing}, 11076 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 11077 Jung-Han Kimn}, 11078 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 11079 note = {Best Paper in Track}, 11080 year = {2019}, 11081 petsc_uses = {KSP} 11082} 11083 11084@MastersThesis{ rinaldo-ceresoli18, 11085 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 11086 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 11087 Applications}, 11088 school = {Politecnico di Milano}, 11089 year = {2018}, 11090 month = apr, 11091 petsc_uses = {KSP} 11092} 11093 11094@Article{ sananschneppmay2016, 11095 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 11096 author = {P. Sanan and S. M. Schnepp and D. A. May}, 11097 journal = {SIAM Journal on Scientific Computing}, 11098 volume = {38}, 11099 number = {5}, 11100 pages = {C441-C470}, 11101 year = {2016}, 11102 doi = {10.1137/15M1049130}, 11103 petsc_uses = {KSP} 11104} 11105 11106@Article{ petscsf2022, 11107 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 11108 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 11109 Smith, Barry F. and Zampini, Stefano}, 11110 journal = {IEEE Transactions on Parallel and Distributed Systems}, 11111 title = {The {PetscSF} Scalable Communication Layer}, 11112 year = {2022}, 11113 volume = {33}, 11114 number = {4}, 11115 pages = {842-853}, 11116 doi = {10.1109/TPDS.2021.3084070} 11117} 11118 11119@Article{ brandt2000, 11120 title = {General highly accurate algebraic coarsening}, 11121 author = {Achi Brandt}, 11122 journal = {Electronic Transactions on Numerical Analysis}, 11123 volume = {10}, 11124 number = {9680}, 11125 pages = {1--20}, 11126 issn = {10689613}, 11127 year = {2000} 11128} 11129 11130@Article{ dalcinpazklercosimo2011, 11131 title = {Parallel distributed computing using Python}, 11132 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 11133 journal = {Advances in Water Resources}, 11134 volume = {34}, 11135 number = {9}, 11136 pages = {1124 - 1139}, 11137 note = {New Computational Methods and Software Tools}, 11138 issn = {0309-1708}, 11139 doi = {10.1016/j.advwatres.2011.04.013}, 11140 year = {2011} 11141} 11142 11143@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 11144 title = {Cython: The Best of Both Worlds}, 11145 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 11146 Seljebotn,Dag Sverre and Smith,Kurt }, 11147 journal = {Computing in Science \& Engineering}, 11148 volume = {13}, 11149 number = {2}, 11150 pages = {31-39}, 11151 doi = {10.1109/MCSE.2010.118}, 11152 year = {2011} 11153} 11154 11155@Article{ dalcinpazstorti2005, 11156 title = {MPI for Python}, 11157 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 11158 journal = {Journal of Parallel and Distributed Computing}, 11159 volume = {65}, 11160 number = {9}, 11161 pages = {1108 - 1115}, 11162 issn = {0743-7315}, 11163 doi = {10.1016/j.jpdc.2005.03.010}, 11164 year = {2005} 11165} 11166 11167@Article{ dalcincolliervignalcortescalo2016, 11168 title = {PetIGA: A framework for high-performance isogeometric analysis}, 11169 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 11170 Calo}, 11171 journal = {Computer Methods in Applied Mechanics and Engineering}, 11172 volume = {308}, 11173 pages = {151 - 181}, 11174 issn = {0045-7825}, 11175 doi = {10.1016/j.cma.2016.05.011}, 11176 year = {2016} 11177} 11178 11179@Article{ collierpardodalcinpaszynskicalo2012, 11180 title = {The cost of continuity: A study of the performance of isogeometric finite 11181 elements using direct solvers}, 11182 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 11183 Calo}, 11184 journal = {Computer Methods in Applied Mechanics and Engineering}, 11185 volume = {213-216}, 11186 pages = {353 - 361}, 11187 issn = {0045-7825}, 11188 doi = {10.1016/j.cma.2011.11.002}, 11189 year = {2012} 11190} 11191 11192@Article{ collierdalcinpardocalo2013, 11193 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 11194 Elements}, 11195 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 11196 journal = {SIAM Journal on Scientific Computing}, 11197 volume = {35}, 11198 number = {2}, 11199 pages = {A767-A784}, 11200 doi = {10.1137/120881038}, 11201 year = {2013} 11202} 11203 11204@Article{ dunning2017jump, 11205 title = {{JuMP}: a modeling language for mathematical optimization}, 11206 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 11207 journal = {SIAM Review}, 11208 volume = {59}, 11209 number = {2}, 11210 pages = {295--320}, 11211 year = {2017}, 11212 publisher = {SIAM} 11213} 11214 11215@InProceedings{ prudencioschulz2011, 11216 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 11217 Estimation, Simulation and Optimization}, 11218 author = {Ernesto E Prudencio and Karl W Schulz}, 11219 booktitle = {European Conference on Parallel Processing}, 11220 pages = {398--407}, 11221 year = {2011} 11222} 11223 11224@Misc{ rol-website, 11225 key = {ROL}, 11226 title = {{Rapid Optimization Library} Website}, 11227 howpublished = {\url{https://trilinos.org/packages/rol}}, 11228 year = {2018} 11229} 11230 11231@Article{ more1994line, 11232 title = {Line search algorithms with guaranteed sufficient decrease}, 11233 author = {Mor{\'e}, Jorge J and Thuente, David J}, 11234 journal = {ACM Transactions on Mathematical Software}, 11235 volume = {20}, 11236 number = {3}, 11237 pages = {286--307}, 11238 year = {1994}, 11239 publisher = {ACM} 11240} 11241 11242@Article{ griewank2000algorithm, 11243 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 11244 adjoint mode of computational differentiation}, 11245 author = {Griewank, Andreas and Walther, Andrea}, 11246 journal = {ACM Transactions on Mathematical Software}, 11247 volume = {26}, 11248 number = {1}, 11249 pages = {19--45}, 11250 year = {2000}, 11251 publisher = {ACM} 11252} 11253 11254@Article{ metcalf2011seven, 11255 title = {The seven ages of fortran}, 11256 author = {Metcalf, Michael}, 11257 journal = {Journal of Computer Science \& Technology}, 11258 volume = {11}, 11259 year = {2011} 11260} 11261 11262@Article{ giraldo_2013, 11263 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 11264 model of the atmosphere {(NUMA)}}, 11265 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 11266 journal = {SIAM Journal on Scientific Computing}, 11267 year = {2013}, 11268 number = {5}, 11269 pages = {B1162-B1194}, 11270 volume = {35}, 11271 doi = {10.1137/120876034} 11272} 11273 11274@Article{ constantinescu_tr2016b, 11275 author = {Constantinescu, E.M.}, 11276 title = {Estimating Global Errors in Time Stepping}, 11277 journal = {ArXiv e-prints}, 11278 archiveprefix = {arXiv}, 11279 eprint = {1503.05166}, 11280 primaryclass = {math.NA}, 11281 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 11282 year = {2016}, 11283 month = mar, 11284 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 11285 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 11286} 11287 11288@Article{ pareschi_2005, 11289 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 11290 with Relaxation}, 11291 author = {L. Pareschi and G. Russo}, 11292 journal = {Journal of Scientific Computing}, 11293 year = {2005}, 11294 number = {1}, 11295 pages = {129--155}, 11296 volume = {25} 11297} 11298 11299@Article{ kennedy_2003, 11300 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 11301 author = {C.A. Kennedy and M.H. Carpenter}, 11302 journal = {Appl. Numer. Math.}, 11303 year = {2003}, 11304 number = {1-2}, 11305 pages = {139--181}, 11306 volume = {44}, 11307 doi = {10.1016/S0168-9274(02)00138-1}, 11308 publisher = {Elsevier Science Publishers B. V.} 11309} 11310 11311@Unpublished{ boscarino_tr2011, 11312 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 11313 equations in the diffusion limit}, 11314 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 11315 note = {Arxiv preprint arXiv:1110.4375}, 11316 year = {2011} 11317} 11318 11319@Article{ ascher_1997, 11320 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 11321 equations}, 11322 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 11323 journal = {Applied Numerical Mathematics}, 11324 year = {1997}, 11325 pages = {151--167}, 11326 volume = {25} 11327} 11328 11329@Book{ ascherpetzold1998, 11330 title = {Computer methods for ordinary differential equations and differential-algebraic 11331 equations}, 11332 author = {Uri M Ascher and Linda R Petzold}, 11333 volume = {61}, 11334 publisher = {SIAM}, 11335 year = {1998} 11336} 11337 11338@Article{ colomesbadia2016, 11339 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 11340 equations}, 11341 author = {Oriol Colom{\'e}s and Santiago Badia}, 11342 journal = {International Journal for Numerical Methods in Engineering}, 11343 volume = {105}, 11344 number = {5}, 11345 pages = {372--400}, 11346 year = {2016} 11347} 11348 11349@Article{ sandu_1997, 11350 title = {Benchmarking stiff {ODE} solvers for atmospheric chemistry problems {II}: 11351 {R}osenbrock solvers}, 11352 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 11353 Potra}, 11354 journal = {Atmospheric Environment}, 11355 year = {1997}, 11356 number = {20}, 11357 pages = {3459--3472}, 11358 volume = {31}, 11359 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 11360 task is the integration of the stiff systems of ordinary differential equations 11361 describing the chemical transformations. It is therefore of interest to 11362 systematically search for stiff solvers which can be identified as close to 11363 optimal for atmospheric applications. In this paper we continue our investigation 11364 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 11365 and compare eight solvers on a set of seven box-models used in present day models. 11366 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 11367 application when they are provided with highly efficient sparse matrix techniques 11368 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 11369 the literature, viz. and 4, and two are new and specially developed for air 11370 quality applications, viz. 3 and 3. } 11371} 11372 11373@Article{ rang_2005, 11374 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 11375 equations of index 1}, 11376 author = {Rang, J. and Angermann, L.}, 11377 journal = {BIT Numerical Mathematics}, 11378 year = {2005}, 11379 number = {4}, 11380 pages = {761--787}, 11381 volume = {45}, 11382 publisher = {Springer}, 11383 doi = {10.1007/s10543-005-0035-y} 11384} 11385 11386@article{rang2015improved, 11387 title = {Improved traditional {R}osenbrock--{W}anner methods for stiff {ODE}s and {DAE}s}, 11388 author = {Rang, Joachim}, 11389 journal = {Journal of Computational and Applied Mathematics}, 11390 volume = {286}, 11391 pages = {128--144}, 11392 year = {2015}, 11393 publisher = {Elsevier}, 11394 doi = {10.1016/j.cam.2015.03.010} 11395} 11396 11397@Article{ gottliebketchesonshu2009, 11398 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 11399 title = {{High order strong stability preserving time discretizations}}, 11400 journal = {Journal of Scientific Computing}, 11401 volume = {38}, 11402 number = {3}, 11403 pages = {251--289}, 11404 doi = {10.1007/s10915-008-9239-z}, 11405 year = {2009} 11406} 11407 11408@Article{ ketcheson_2008, 11409 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 11410 Low-Storage Implementations}, 11411 author = {D.I. Ketcheson}, 11412 journal = {SIAM Journal on Scientific Computing}, 11413 year = {2008}, 11414 number = {4}, 11415 pages = {2113--2136}, 11416 volume = {30}, 11417 doi = {10.1137/07070485X}, 11418 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 11419 RungeKutta methods}, 11420 publisher = {SIAM} 11421} 11422 11423@Article{ jansen_2000, 11424 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 11425 equations with a stabilized finite element method}, 11426 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 11427 journal = {Computer Methods in Applied Mechanics and Engineering}, 11428 year = {2000}, 11429 number = {3}, 11430 pages = {305--319}, 11431 volume = {190}, 11432 publisher = {Elsevier} 11433} 11434 11435@Article{ butcher_2007, 11436 title = {Error propagation of general linear methods for ordinary differential equations}, 11437 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 11438 journal = {Journal of Complexity}, 11439 year = {2007}, 11440 number = {4-6}, 11441 pages = {560--580}, 11442 volume = {23}, 11443 abstract = {We discuss error propagation for general linear methods for ordinary differential 11444 equations up to terms of order p+2, where p is the order of the method. These 11445 results are then applied to the estimation of local discretization errors for 11446 methods of order p and for the adjacent order p+1. The results of numerical 11447 experiments confirm the reliability of these estimates. This research has 11448 applications in the design of robust stepsize and order changing strategies for 11449 algorithms based on general linear methods.}, 11450 doi = {10.1016/j.jco.2007.01.009}, 11451 issn = {0885-064X} 11452} 11453 11454@Article{ constantinescu_a2010a, 11455 title = {Extrapolated implicit-explicit time stepping}, 11456 author = {E.M. Constantinescu and A. Sandu}, 11457 journal = {SIAM Journal on Scientific Computing}, 11458 year = {2010}, 11459 number = {6}, 11460 pages = {4452-4477}, 11461 volume = {31}, 11462 comment = {Preprint \# ANL/MCS-P1612-0409}, 11463 doi = {10.1137/080732833} 11464} 11465 11466@InProceedings{ devito2011liszt, 11467 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 11468 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 11469 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 11470 Aiken, Alex and Duraisamy, Karthik and others}, 11471 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 11472 Networking, Storage and Analysis}, 11473 pages = {9}, 11474 year = {2011}, 11475 organization = {ACM} 11476} 11477 11478@Article{ devito2011designing, 11479 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 11480 author = {DeVito, Zachary and Hanrahan, Pat}, 11481 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 11482 year = {2011} 11483} 11484 11485@Misc{ pgasintro, 11486 author = {Tim Stitt}, 11487 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 11488 Model}, 11489 note = {\url{http://cnx.org/content/m20649/latest/}} 11490} 11491 11492@InProceedings{ el2006upc, 11493 title = {UPC: unified parallel C}, 11494 author = {El-Ghazawi, Tarek and Smith, Lauren}, 11495 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 11496 pages = {27}, 11497 year = {2006}, 11498 organization = {ACM} 11499} 11500 11501@InProceedings{ numrich1998co, 11502 title = {Co-Array Fortran for parallel programming}, 11503 author = {Numrich, Robert W and Reid, John}, 11504 booktitle = {ACM Sigplan Fortran Forum}, 11505 volume = {17}, 11506 number = {2}, 11507 pages = {1--31}, 11508 year = {1998}, 11509 organization = {ACM} 11510} 11511 11512@Article{ aiken1997titanium, 11513 title = {Titanium: A high-performance Java dialect}, 11514 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 11515 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 11516 Geoff and Semenzato, Luigi and others}, 11517 year = {1997} 11518} 11519 11520@Article{ charles2005x10, 11521 title = {X10: an object-oriented approach to non-uniform cluster computing}, 11522 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 11523 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 11524 Sarkar, Vivek}, 11525 journal = {Acm Sigplan Notices}, 11526 volume = {40}, 11527 number = {10}, 11528 pages = {519--538}, 11529 year = {2005}, 11530 publisher = {ACM} 11531} 11532 11533@Article{ chamberlain2007parallel, 11534 title = {Parallel programmability and the chapel language}, 11535 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 11536 journal = {International Journal of High Performance Computing Applications}, 11537 volume = {21}, 11538 number = {3}, 11539 pages = {291--312}, 11540 year = {2007}, 11541 publisher = {SAGE Publications} 11542} 11543 11544@InProceedings{ charmppoopsla93, 11545 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 11546 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 11547 editor = {Paepcke, A.}, 11548 fulleditor = {Paepcke, Andreas}, 11549 pages = {91--108}, 11550 month = sep, 11551 year = {1993}, 11552 booktitle = {{Proceedings of OOPSLA'93}}, 11553 publisher = {{ACM Press}} 11554} 11555 11556@InProceedings{ hewitt1973universal, 11557 title = {A universal modular actor formalism for artificial intelligence}, 11558 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 11559 booktitle = {Proceedings of the 3rd international joint conference on Artificial 11560 intelligence}, 11561 pages = {235--245}, 11562 year = {1973}, 11563 organization = {Morgan Kaufmann Publishers Inc.} 11564} 11565 11566@Book{ yonezawa1990abcl, 11567 title = {ABCL: an object-oriented concurrent system}, 11568 author = {Yonezawa, Akinori}, 11569 year = {1990}, 11570 publisher = {MIT press} 11571} 11572 11573@InProceedings{ dally1988object, 11574 title = {Object-oriented concurrent programming in CST}, 11575 author = {Dally, William J and Chien, Andrew A}, 11576 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 11577 applications: Architecture, software, computer systems, and general issues-Volume 11578 1}, 11579 pages = {434--439}, 11580 year = {1988}, 11581 organization = {ACM} 11582} 11583 11584@Article{ grimshaw1993easy, 11585 title = {Easy-to-use object-oriented parallel processing with Mentat}, 11586 author = {Grimshaw, Andrew S.}, 11587 journal = {Computer}, 11588 volume = {26}, 11589 number = {5}, 11590 pages = {39--51}, 11591 year = {1993}, 11592 publisher = {IEEE} 11593} 11594 11595@InProceedings{ gannon1991object, 11596 title = {Object oriented parallelism: pC++ ideas and experiments}, 11597 author = {Gannon, Dennis and Lee, JK}, 11598 booktitle = {Proceedings of}, 11599 pages = {13--23}, 11600 year = {1991} 11601} 11602 11603@InProceedings{ lau1992object, 11604 title = {An object-oriented class library for scalable parallel heuristic search}, 11605 author = {Lau, Wing-cheong and Singh, Vineet}, 11606 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 11607 pages = {252--267}, 11608 year = {1992}, 11609 organization = {Springer} 11610} 11611 11612@Book{ chase1989amber, 11613 title = {The Amber system: Parallel programming on a network of multiprocessors}, 11614 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 11615 Littlefield, Richard}, 11616 volume = {23}, 11617 number = {5}, 11618 year = {1989}, 11619 publisher = {ACM} 11620} 11621 11622@InProceedings{ kaiser2009parallex, 11623 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 11624 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 11625 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 11626 pages = {394--401}, 11627 year = {2009}, 11628 organization = {IEEE} 11629} 11630 11631@TechReport{ ipm, 11632 author = {Barry F. Smith}, 11633 title = {A New Parallel Programming Model for Computer Simulation}, 11634 institution = {Argonne National Laboratory}, 11635 year = {2014}, 11636 number = {ANL/MCS-P5135-0414} 11637} 11638 11639@Article{ groppsnir, 11640 author = {William Gropp and Marc Snir}, 11641 title = {Programming for Exascale Computers}, 11642 journal = {Computing in Science and Engineering}, 11643 volume = {15}, 11644 number = {6}, 11645 issn = {1521-9615}, 11646 year = {2013}, 11647 pages = {27-35}, 11648 doi = {10.1109/MCSE.2013.96}, 11649 publisher = {IEEE Computer Society}, 11650 address = {Los Alamitos, CA} 11651} 11652 11653@Book{ mpi3, 11654 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 11655 author = {Message Passing Interface Forum}, 11656 year = {2012}, 11657 publisher = {High Performance Computing Center Stuttgart (HLRS)} 11658} 11659 11660@Book{ openmp4, 11661 title = {OpenMP Application Program Interface, Version 4.0}, 11662 year = {2013}, 11663 publisher = {OpenMP Architecture Review Board} 11664} 11665 11666@InProceedings{ hartono2009annotation, 11667 title = {Annotation-based empirical performance tuning using {Orio}}, 11668 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 11669 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 11670 Symposium on}, 11671 pages = {1--11}, 11672 year = {2009}, 11673 organization = {IEEE} 11674} 11675 11676@Book{ toselli2005domain, 11677 title = {Domain Decomposition Methods: Algorithms and Theory}, 11678 author = {Toselli, Andrea and Widlund, Olof B}, 11679 volume = {34}, 11680 year = {2005}, 11681 publisher = {Springer} 11682} 11683 11684@InBook{ st2016, 11685 author = {Barry F. Smith and Xumin Tu}, 11686 chapter = {Domain Decomposition}, 11687 title = {Encyclopedia of Applied and Computational Mathematics}, 11688 bookeditor = {B. Engquist}, 11689 publisher = {Springer}, 11690 pages = {375--381}, 11691 year = {2016} 11692} 11693 11694@TechReport{ saws, 11695 author = {Matt Otten and Jed Brown and Barry F. Smith}, 11696 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 11697 institution = {Argonne National Laboratory}, 11698 year = {2013} 11699} 11700 11701@Article{ smith1997domain, 11702 title = {Domain Decomposition Methods for Partial Differential Equations}, 11703 author = {Smith, B.F.}, 11704 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 11705 volume = {4}, 11706 pages = {225--244}, 11707 year = {1997}, 11708 publisher = {Citeseer} 11709} 11710 11711@Article{ spillane2011abstract, 11712 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 11713 in the overlaps}, 11714 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 11715 Scheichl, R}, 11716 journal = {NuMa-Report}, 11717 volume = {7}, 11718 pages = {2007}, 11719 year = {2011} 11720} 11721 11722@InProceedings{ jolivet2013scalabledd, 11723 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 11724 problems}, 11725 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 11726 Prud'homme, Christophe}, 11727 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 11728 Networking, Storage and Analysis}, 11729 pages = {80}, 11730 year = {2013}, 11731 organization = {ACM} 11732} 11733 11734@Book{ ks2000, 11735 author = {D. Kinderlehrer and G. Stampacchia}, 11736 publisher = {Society for Industrial Mathematics}, 11737 title = {An Introduction to Variational Inequalities and Their Applications}, 11738 year = {2000} 11739} 11740 11741@Article{ wan2000energy, 11742 title = {An energy-minimizing interpolation for robust multigrid methods}, 11743 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 11744 journal = {SIAM Journal on Scientific Computing}, 11745 volume = {21}, 11746 number = {4}, 11747 pages = {1632--1649}, 11748 year = {2000}, 11749 publisher = {Philadelphia, PA: SIAM, c1993-} 11750} 11751 11752@Article{ chansmith1994, 11753 title = {Domain decomposition and multigrid algorithms for elliptic problems on 11754 unstructured meshes}, 11755 author = {Chan, T.F. and Smith, B.F.}, 11756 journal = {Electronic Transactions on Numerical Analysis}, 11757 volume = {2}, 11758 pages = {171--182}, 11759 year = {1994} 11760} 11761 11762@TechReport{ proto-fsp, 11763 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 11764 and Michael Zarnstorff and Michael Zika}, 11765 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 11766 institution = {Princeton Plasma Physics Laboratory}, 11767 year = {2010}, 11768 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 11769} 11770 11771@Article{ hirvijoki2021, 11772 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 11773 particle-in-cell codes}, 11774 journal = {Plasma Phys. Control. Fusion}, 11775 author = {Eero Hirvijoki}, 11776 note = {in press}, 11777 doi = {10.1088/1361-6587/abe884}, 11778 year = {2021} 11779} 11780 11781@Article{ ipsen2001, 11782 author = {Ilse C. F. Ipsen}, 11783 journal = {SIAM J. Sci. Comput.}, 11784 pages = {1050--1051}, 11785 volume = {23}, 11786 publisher = {SIAM}, 11787 title = {A Note on Preconditioning Nonsymmetric Matrices}, 11788 year = {2001} 11789} 11790 11791% Random papers on solvers for GPUs 11792@InProceedings{ gpus-suck, 11793 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 11794 title = { On the Limits of {GPU} Acceleration}, 11795 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 11796 year = {2010}, 11797 publisher = {USENIX} 11798} 11799 11800@InProceedings{ 882364, 11801 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 11802 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11803 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 11804 year = {2003}, 11805 isbn = {1-58113-709-5}, 11806 pages = {917--924}, 11807 location = {San Diego, California}, 11808 doi = {10.1145/1201775.882364}, 11809 publisher = {ACM}, 11810 address = {New York, NY} 11811} 11812 11813@Conference{ feng2008multigrid, 11814 author = {Feng, Z. and Li, P.}, 11815 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 11816 date-added = {2010-08-19 15:57:06 -0500}, 11817 date-modified = {2010-08-19 15:57:06 -0500}, 11818 pages = {647--654}, 11819 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 11820 year = {2008} 11821} 11822 11823@Conference{ goodnight2003multigrid, 11824 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 11825 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 11826 date-added = {2010-08-19 15:45:20 -0500}, 11827 date-modified = {2010-08-19 15:45:20 -0500}, 11828 organization = {Eurographics Association}, 11829 pages = {102--111}, 11830 title = {A multigrid solver for boundary value problems using programmable graphics 11831 hardware}, 11832 year = {2003} 11833} 11834 11835@Article{ buatois2007concurrent, 11836 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 11837 date-added = {2010-08-19 15:45:02 -0500}, 11838 date-modified = {2010-08-19 15:45:02 -0500}, 11839 journal = {High Performance Computing and Communications}, 11840 pages = {358--371}, 11841 publisher = {Citeseer}, 11842 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 11843 year = {2007} 11844} 11845 11846@Article{ joldes2010real, 11847 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 11848 date-added = {2010-08-19 15:44:41 -0500}, 11849 date-modified = {2010-08-19 15:44:41 -0500}, 11850 journal = {Computer Methods in Applied Mechanics and Engineering}, 11851 publisher = {Elsevier}, 11852 title = {Real-time nonlinear finite element computations on {GPU}-application to 11853 neurosurgical simulation}, 11854 year = {2010} 11855} 11856 11857@Misc{ aharon2005gpu, 11858 author = {Aharon, S.}, 11859 date-added = {2010-08-19 15:44:32 -0500}, 11860 date-modified = {2010-08-19 15:44:32 -0500}, 11861 month = apr, 11862 note = {US Patent App. 11/115,642}, 11863 publisher = {Google Patents}, 11864 title = {{GPU}-based Finite Element}, 11865 year = {2005} 11866} 11867 11868@Article{ cevahir2009fast, 11869 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 11870 date-added = {2010-08-19 15:44:01 -0500}, 11871 date-modified = {2010-08-19 15:44:01 -0500}, 11872 journal = {Computational Science--ICCS 2009}, 11873 pages = {893--903}, 11874 publisher = {Springer}, 11875 title = {Fast conjugate gradients with multiple {GPU}s}, 11876 year = {2009} 11877} 11878 11879@Article{ maier1995symmetric, 11880 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 11881 date-added = {2010-08-19 15:43:57 -0500}, 11882 date-modified = {2010-08-19 15:43:57 -0500}, 11883 journal = {Computational Mechanics}, 11884 number = {1}, 11885 pages = {115--129}, 11886 publisher = {Springer}, 11887 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 11888 plasticity}, 11889 volume = {17}, 11890 year = {1995} 11891} 11892 11893@Article{ corrigan-running, 11894 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 11895 date-added = {2010-08-19 15:43:47 -0500}, 11896 date-modified = {2010-08-19 15:43:47 -0500}, 11897 journal = {International Journal for Numerical Methods in Fluids}, 11898 publisher = {John Wiley \& Sons}, 11899 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 11900} 11901 11902@InProceedings{ volkov08, 11903 author = {Vasily Volkov and James W. Demmel}, 11904 title = {Benchmarking GPUs to tune dense linear algebra}, 11905 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 11906 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 11907 year = {2008} 11908} 11909 11910@TechReport{ cray-mvmult, 11911 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 11912 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 11913 institution = {School of Computer Science, Carnegie Mellon University}, 11914 number = {CMU-CS-93-173}, 11915 month = aug, 11916 year = {1993} 11917} 11918 11919@Conference{ bell2009implementing, 11920 author = {Bell, N. and Garland, M.}, 11921 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 11922 and Analysis}, 11923 date-added = {2010-08-19 15:43:42 -0500}, 11924 date-modified = {2010-08-19 15:43:42 -0500}, 11925 organization = {ACM}, 11926 pages = {1--11}, 11927 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 11928 processors}, 11929 year = {2009} 11930} 11931 11932@Article{ bell2008efficient, 11933 author = {Bell, N. and Garland, M.}, 11934 date-added = {2010-08-19 15:43:36 -0500}, 11935 date-modified = {2010-08-19 15:43:36 -0500}, 11936 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 11937 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 11938 year = {2008} 11939} 11940 11941@Article{ cohen-fast, 11942 author = {Cohen, J. and Molemaker, M.J.}, 11943 date-added = {2010-08-19 15:43:34 -0500}, 11944 date-modified = {2010-08-19 15:43:34 -0500}, 11945 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 11946 pages = {414}, 11947 publisher = {DEStech Publications}, 11948 title = {A fast double precision CFD code using CUDA} 11949} 11950 11951@Article{ kazhdan2008streaming, 11952 author = {Kazhdan, M. and Hoppe, H.}, 11953 date-added = {2010-08-19 15:43:32 -0500}, 11954 date-modified = {2010-08-19 15:43:32 -0500}, 11955 journal = {ACM Transactions on Graphics (TOG)}, 11956 number = {3}, 11957 pages = {21}, 11958 publisher = {ACM}, 11959 title = {Streaming multigrid for gradient-domain operations on large images}, 11960 volume = {27}, 11961 year = {2008} 11962} 11963 11964@Article{ bonnet1998symmetric, 11965 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 11966 date-added = {2010-08-19 15:43:18 -0500}, 11967 date-modified = {2010-08-19 15:43:18 -0500}, 11968 journal = {Appl. Mech. Rev}, 11969 pages = {669--704}, 11970 title = {Symmetric {G}alerkin boundary element method.}, 11971 volume = {51}, 11972 year = {1998} 11973} 11974 11975@Conference{ zamith2007gpu, 11976 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 11977 Valente, L.}, 11978 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 11979 Entertainment}, 11980 date-added = {2010-08-19 15:43:14 -0500}, 11981 date-modified = {2010-08-19 15:43:14 -0500}, 11982 pages = {37--43}, 11983 title = {The {GPU} used as a math co-processor in real time applications}, 11984 year = {2007} 11985} 11986 11987@Article{ baskaran2009optimizing, 11988 author = {Baskaran, M.M. and Bordawekar, R.}, 11989 date-added = {2010-08-19 15:42:56 -0500}, 11990 date-modified = {2010-08-19 15:42:56 -0500}, 11991 journal = {IBM Research Report RC24704, IBM}, 11992 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 11993 year = {2009} 11994} 11995 11996@Misc{ szeliski2006locally, 11997 author = {Szeliski, R.}, 11998 date-added = {2010-08-19 15:42:45 -0500}, 11999 date-modified = {2010-08-19 15:42:45 -0500}, 12000 month = jul, 12001 note = {US Patent App. 11/459,724}, 12002 publisher = {Google Patents}, 12003 title = {Locally adapted hierarchical basis preconditioning}, 12004 year = {2006} 12005} 12006 12007@Article{ jung2006cholesky, 12008 author = {Jung, J.H. and O'Leary, D.P.}, 12009 date-added = {2010-08-19 15:42:34 -0500}, 12010 date-modified = {2010-08-19 15:42:34 -0500}, 12011 journal = {Scholarly Paper, University of Maryland}, 12012 publisher = {Citeseer}, 12013 title = {Cholesky decomposition and linear programming on a {GPU}}, 12014 year = {2006} 12015} 12016 12017@Conference{ filipovic2009gpu, 12018 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 12019 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 12020 date-added = {2010-08-19 15:42:33 -0500}, 12021 date-modified = {2010-08-19 15:42:33 -0500}, 12022 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 12023 Results}, 12024 year = {2009} 12025} 12026 12027@Article{ taylor2009modelling, 12028 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 12029 Atkinson, D. and Ourselin, S.}, 12030 date-added = {2010-08-19 15:42:23 -0500}, 12031 date-modified = {2010-08-19 15:42:23 -0500}, 12032 journal = {Medical Image Analysis}, 12033 number = {2}, 12034 pages = {234--244}, 12035 publisher = {Elsevier}, 12036 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 12037 solution and {GPU} execution}, 12038 volume = {13}, 12039 year = {2009} 12040} 12041 12042@Conference{ owens2007survey, 12043 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 12044 and Lefohn, A.E. and Purcell, T.J.}, 12045 booktitle = {Computer Graphics Forum}, 12046 date-added = {2010-08-19 15:42:21 -0500}, 12047 date-modified = {2010-08-19 15:42:21 -0500}, 12048 number = {1}, 12049 organization = {John Wiley \& Sons}, 12050 pages = {80--113}, 12051 title = {A survey of general-purpose computation on graphics hardware}, 12052 volume = {26}, 12053 year = {2007} 12054} 12055 12056@Article{ strzodka2005scientific, 12057 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 12058 date-added = {2010-08-19 15:42:18 -0500}, 12059 date-modified = {2010-08-19 15:42:18 -0500}, 12060 journal = {Simulation Modelling Practice and Theory}, 12061 number = {8}, 12062 pages = {667--680}, 12063 publisher = {Elsevier}, 12064 title = {Scientific computation for simulations on programmable graphics hardware}, 12065 volume = {13}, 12066 year = {2005} 12067} 12068 12069@Conference{ rumpf2001using, 12070 author = {Rumpf, M. and Strzodka, R.}, 12071 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 12072 (VIIP-01)}, 12073 date-added = {2010-08-19 15:42:15 -0500}, 12074 date-modified = {2010-08-19 15:42:15 -0500}, 12075 organization = {Citeseer}, 12076 pages = {193--202}, 12077 title = {Using graphics cards for quantized FEM computations}, 12078 year = {2001} 12079} 12080 12081@Article{ sirtori1992galerkin, 12082 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 12083 date-added = {2010-08-19 15:42:14 -0500}, 12084 date-modified = {2010-08-19 15:42:14 -0500}, 12085 journal = {International Journal for Numerical Methods in Engineering}, 12086 number = {2}, 12087 pages = {255--282}, 12088 publisher = {John Wiley \& Sons}, 12089 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 12090 implementation}, 12091 volume = {35}, 12092 year = {1992} 12093} 12094 12095@Article{ tejada2005large, 12096 author = {Tejada, E. and Ertl, T.}, 12097 date-added = {2010-08-19 15:42:09 -0500}, 12098 date-modified = {2010-08-19 15:42:09 -0500}, 12099 journal = {Simulation Modelling Practice and Theory}, 12100 number = {8}, 12101 pages = {703--715}, 12102 publisher = {Elsevier}, 12103 title = {Large steps in {GPU}-based deformable bodies simulation}, 12104 volume = {13}, 12105 year = {2005} 12106} 12107 12108@Article{ goddeke2008using, 12109 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 12110 and Becker, C. and Turek, S.}, 12111 date-added = {2010-08-19 15:42:06 -0500}, 12112 date-modified = {2010-08-19 15:42:06 -0500}, 12113 journal = {International Journal of Computational Science and Engineering}, 12114 number = {1}, 12115 pages = {36--55}, 12116 publisher = {Inderscience}, 12117 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 12118 volume = {4}, 12119 year = {2008} 12120} 12121 12122@Article{ garland2008parallel, 12123 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 12124 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 12125 date-added = {2010-08-19 15:41:51 -0500}, 12126 date-modified = {2010-08-19 15:41:51 -0500}, 12127 journal = {IEEE Micro}, 12128 number = {4}, 12129 pages = {13--27}, 12130 title = {Parallel computing experiences with CUDA}, 12131 volume = {28}, 12132 year = {2008} 12133} 12134 12135@Article{ wong1985method, 12136 author = {Wong, SH and Ciric, IR}, 12137 date-added = {2010-08-19 15:41:48 -0500}, 12138 date-modified = {2010-08-19 15:41:48 -0500}, 12139 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 12140 and Electronic Engineering}, 12141 publisher = {MCB UP Ltd}, 12142 title = {Method of conformal transformation for the finite-element solution of 12143 axisymmetric exterior-field problems}, 12144 volume = {4}, 12145 year = {1985} 12146} 12147 12148@Article{ turek-feast, 12149 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 12150 H.}, 12151 date-added = {2010-08-19 15:41:47 -0500}, 12152 date-modified = {2010-08-19 15:41:47 -0500}, 12153 journal = {Concurrency and Computation: Practice and Experience}, 12154 publisher = {John Wiley \& Sons}, 12155 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 12156 elements} 12157} 12158 12159@Article{ abedi2006space, 12160 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 12161 date-added = {2010-08-19 15:41:46 -0500}, 12162 date-modified = {2010-08-19 15:41:46 -0500}, 12163 journal = {Computer Methods in Applied Mechanics and Engineering}, 12164 number = {25-28}, 12165 pages = {3247--3273}, 12166 publisher = {Elsevier}, 12167 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 12168 element-wise momentum balance}, 12169 volume = {195}, 12170 year = {2006} 12171} 12172 12173@Conference{ georgii2005interactiveb, 12174 author = {Georgii, J. and Westermann, R.}, 12175 booktitle = {Proceedings of VMV}, 12176 date-added = {2010-08-19 15:41:36 -0500}, 12177 date-modified = {2010-08-19 15:41:36 -0500}, 12178 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 12179 year = {2005} 12180} 12181 12182@Article{ mosegaard2005gpu, 12183 author = {Mosegaard, J. and others}, 12184 date-added = {2010-08-19 15:41:35 -0500}, 12185 date-modified = {2010-08-19 15:41:35 -0500}, 12186 publisher = {IEEE Computer Society}, 12187 title = {{GPU} accelerated surgical simulators for complex morphology}, 12188 year = {2005} 12189} 12190 12191@Article{ meyer2007particle, 12192 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 12193 date-added = {2010-08-19 15:41:33 -0500}, 12194 date-modified = {2010-08-19 15:41:33 -0500}, 12195 journal = {IEEE Transactions on Visualization and Computer Graphics}, 12196 pages = {1015--1026}, 12197 publisher = {Published by the IEEE Computer Society}, 12198 title = {Particle systems for efficient and accurate high-order finite element 12199 visualization}, 12200 year = {2007} 12201} 12202 12203@Conference{ rumpf2001nonlinear, 12204 author = {Rumpf, M. and Strzodka, R.}, 12205 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 12206 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 12207 date-added = {2010-08-19 15:41:29 -0500}, 12208 date-modified = {2010-08-19 15:41:29 -0500}, 12209 organization = {Springer Verlag Wien}, 12210 pages = {75}, 12211 title = {Nonlinear diffusion in graphics hardware}, 12212 year = {2001} 12213} 12214 12215@Article{ georgii2005interactive, 12216 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 12217 date-added = {2010-08-19 15:41:28 -0500}, 12218 date-modified = {2010-08-19 15:41:28 -0500}, 12219 journal = {Simulation and Visualisation}, 12220 pages = {247--258}, 12221 publisher = {Citeseer}, 12222 title = {Interactive simulation of deformable bodies on {GPU}s}, 12223 volume = {2005}, 12224 year = {2005} 12225} 12226 12227@Article{ harish2007accelerating, 12228 author = {Harish, P. and Narayanan, P.}, 12229 date-added = {2010-08-19 15:41:27 -0500}, 12230 date-modified = {2010-08-19 15:41:27 -0500}, 12231 journal = {High Performance Computing--HiPC 2007}, 12232 pages = {197--208}, 12233 publisher = {Springer}, 12234 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 12235 year = {2007} 12236} 12237 12238@Article{ keunings1995parallel, 12239 author = {Keunings, R.}, 12240 date-added = {2010-08-19 15:41:19 -0500}, 12241 date-modified = {2010-08-19 15:41:19 -0500}, 12242 journal = {Computers and Chemical Engineering}, 12243 number = {6}, 12244 pages = {647--670}, 12245 publisher = {Oxford; New York: Pergamon Press, 1977-}, 12246 title = {Parallel finite element algorithms applied to computational rheology}, 12247 volume = {19}, 12248 year = {1995} 12249} 12250 12251@Conference{ taylor2007real, 12252 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12253 booktitle = {Proceedings of the 10th international conference on Medical image computing and 12254 computer-assisted intervention-Volume Part I}, 12255 date-added = {2010-08-19 15:41:17 -0500}, 12256 date-modified = {2010-08-19 15:41:17 -0500}, 12257 organization = {Springer-Verlag}, 12258 pages = {701--708}, 12259 title = {Real-time nonlinear finite element analysis for surgical simulation using 12260 graphics processing units}, 12261 year = {2007} 12262} 12263 12264@Article{ liu2000finite, 12265 author = {Liu, R. and Li, DY}, 12266 date-added = {2010-08-19 15:41:16 -0500}, 12267 date-modified = {2010-08-19 15:41:16 -0500}, 12268 journal = {Materials Science and Engineering A}, 12269 number = {1-2}, 12270 pages = {169--175}, 12271 publisher = {Elsevier}, 12272 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 12273 volume = {277}, 12274 year = {2000} 12275} 12276 12277@Conference{ kakadiaris1994active, 12278 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 12279 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 12280 date-added = {2010-08-19 15:41:15 -0500}, 12281 date-modified = {2010-08-19 15:41:15 -0500}, 12282 organization = {Citeseer}, 12283 pages = {980--980}, 12284 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 12285 physics-based approach}, 12286 year = {1994} 12287} 12288 12289@Conference{ de2004gpu, 12290 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 12291 booktitle = {Proceedings of Eurohaptics}, 12292 date-added = {2010-08-19 15:41:14 -0500}, 12293 date-modified = {2010-08-19 15:41:14 -0500}, 12294 organization = {Citeseer}, 12295 pages = {44--51}, 12296 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 12297 volume = {2004}, 12298 year = {2004} 12299} 12300 12301@Book{ taflove1995computational, 12302 author = {Taflove, A. and Hagness, S.C.}, 12303 date-added = {2010-08-19 15:41:14 -0500}, 12304 date-modified = {2010-08-19 15:41:14 -0500}, 12305 publisher = {Artech House Norwood, MA}, 12306 title = {Computational electrodynamics}, 12307 year = {1995} 12308} 12309 12310@Conference{ galoppo2005lu, 12311 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 12312 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 12313 date-added = {2010-08-19 15:41:13 -0500}, 12314 date-modified = {2010-08-19 15:41:13 -0500}, 12315 organization = {IEEE Computer Society}, 12316 pages = {3}, 12317 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 12318 hardware}, 12319 year = {2005} 12320} 12321 12322@Conference{ ryoo2008optimization, 12323 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 12324 and Hwu, W.W.}, 12325 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 12326 parallel programming}, 12327 date-added = {2010-08-19 15:41:12 -0500}, 12328 date-modified = {2010-08-19 15:41:12 -0500}, 12329 organization = {ACM}, 12330 pages = {73--82}, 12331 title = {Optimization principles and application performance evaluation of a multithreaded 12332 {GPU} using CUDA}, 12333 year = {2008} 12334} 12335 12336@Conference{ micikevicius20093d, 12337 author = {Micikevicius, P.}, 12338 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 12339 Units}, 12340 date-added = {2010-08-19 15:41:11 -0500}, 12341 date-modified = {2010-08-19 15:41:11 -0500}, 12342 organization = {ACM}, 12343 pages = {79--84}, 12344 title = {3D finite difference computation on {GPU}s using {CUDA}}, 12345 year = {2009} 12346} 12347 12348@Conference{ zhou2004pixel, 12349 author = {Zhou, Y. and Garland, M. and Haber, R.}, 12350 booktitle = {IEEE Visualization, 2004}, 12351 date-added = {2010-08-19 15:41:03 -0500}, 12352 date-modified = {2010-08-19 15:41:03 -0500}, 12353 pages = {425--432}, 12354 title = {Pixel-exact rendering of spacetime finite element solutions}, 12355 year = {2004} 12356} 12357 12358@Article{ komatitsch2009porting, 12359 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 12360 date-added = {2010-08-19 15:41:01 -0500}, 12361 date-modified = {2010-08-19 15:41:01 -0500}, 12362 journal = {Journal of Parallel and Distributed Computing}, 12363 number = {5}, 12364 pages = {451--460}, 12365 publisher = {Elsevier}, 12366 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 12367 graphics cards using CUDA}, 12368 volume = {69}, 12369 year = {2009} 12370} 12371 12372@Article{ komatitsch1998spectral, 12373 author = {Komatitsch, D. and Vilotte, J.P.}, 12374 date-added = {2010-08-19 15:40:59 -0500}, 12375 date-modified = {2010-08-19 15:40:59 -0500}, 12376 journal = {Bulletin of the Seismological Society of America}, 12377 number = {2}, 12378 pages = {368--392}, 12379 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 12380 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 12381 of 2D and 3D geological structures}, 12382 volume = {88}, 12383 year = {1998} 12384} 12385 12386@Article{ wu2005improved, 12387 author = {Wu, W. and Heng, P.A.}, 12388 date-added = {2010-08-19 15:40:59 -0500}, 12389 date-modified = {2010-08-19 15:40:59 -0500}, 12390 journal = {The Visual Computer}, 12391 number = {8}, 12392 pages = {707--716}, 12393 publisher = {Springer}, 12394 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 12395 cutting and deformation}, 12396 volume = {21}, 12397 year = {2005} 12398} 12399 12400@Article{ taylor2008high, 12401 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12402 date-added = {2010-08-19 15:40:57 -0500}, 12403 date-modified = {2010-08-19 15:40:57 -0500}, 12404 journal = {IEEE transactions on medical imaging}, 12405 number = {5}, 12406 pages = {650}, 12407 title = {High-speed nonlinear finite element analysis for surgical simulation using 12408 graphics processing units.}, 12409 volume = {27}, 12410 year = {2008} 12411} 12412 12413@Conference{ bolz2003sparse, 12414 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 12415 booktitle = {ACM SIGGRAPH 2003 Papers}, 12416 date-added = {2010-08-19 15:40:55 -0500}, 12417 date-modified = {2010-08-19 15:40:55 -0500}, 12418 organization = {ACM}, 12419 pages = {924}, 12420 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 12421 year = {2003} 12422} 12423 12424@Article{ wu2004hybrid, 12425 author = {Wu, W. and Heng, P.A.}, 12426 date-added = {2010-08-19 15:40:54 -0500}, 12427 date-modified = {2010-08-19 15:40:54 -0500}, 12428 journal = {Computer Animation and Virtual Worlds}, 12429 number = {3-4}, 12430 pages = {219--227}, 12431 publisher = {John Wiley \& Sons}, 12432 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 12433 3D soft tissue cutting}, 12434 volume = {15}, 12435 year = {2004} 12436} 12437 12438% ---------------------------------------------------------------------------------------------------------------- 12439@TechReport{ davis97, 12440 author = {T. Davis}, 12441 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 12442 institution = {University of Florida}, 12443 year = {1997} 12444} 12445 12446@Article{ davis2011, 12447 author = {Davis, T. A. and Hu, Y.}, 12448 title = {The {U}niversity of {F}lorida sparse matrix collection}, 12449 journal = {ACM Transactions on Mathematical Software}, 12450 volume = {38}, 12451 issue = {1}, 12452 year = {2011}, 12453 pages = {1--25} 12454} 12455 12456@Article{ davis2004algorithm, 12457 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 12458 author = {Davis, Timothy A}, 12459 journal = {ACM Transactions on Mathematical Software}, 12460 volume = {30}, 12461 number = {2}, 12462 pages = {196--199}, 12463 year = {2004}, 12464 publisher = {ACM} 12465} 12466 12467@TechReport{ streams, 12468 author = {J. D. McCalpin}, 12469 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 12470 institution = {University of Virginia}, 12471 url = {http://www.cs.virginia.edu/stream}, 12472 year = {1995} 12473} 12474 12475@Article{ areusken_1988b, 12476 author = {A. Reusken}, 12477 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 12478 mildly nonlinear boundary value problems}, 12479 journal = {Numer. Math.}, 12480 volume = {52}, 12481 year = {1988}, 12482 pages = {251--277} 12483} 12484 12485@Article{ areusken_1988c, 12486 author = {A. Reusken}, 12487 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 12488 journal = {Numer. Math.}, 12489 volume = {53}, 12490 year = {1988}, 12491 pages = {663--686} 12492} 12493 12494@Unpublished{ mgnet, 12495 title = {Multigrid Net; http://www.mgnet.org/}, 12496 author = {Craig Douglas}, 12497 note = {Contains enormous bibliography on multigrid publications}, 12498 year = {2009} 12499} 12500 12501@Unpublished{ copper, 12502 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 12503 author = {}, 12504 note = {Held bi-annually}, 12505 year = {2009} 12506} 12507 12508@Book{ wessling1992, 12509 author = {Pieter Wesseling}, 12510 title = {An Introduction to Multigrid Methods}, 12511 year = {2004}, 12512 publisher = {R. T. Edwards} 12513} 12514 12515@Book{ bhm2000, 12516 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 12517 title = {A Multigrid Tutorial}, 12518 year = {2000}, 12519 publisher = {SIAM} 12520} 12521 12522@Book{ trottenberg2001multigrid, 12523 title = {{Multigrid}}, 12524 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 12525 isbn = {012701070X}, 12526 year = {2001}, 12527 publisher = {Academic Press} 12528} 12529 12530@TechReport{ brandt1984, 12531 author = {Achi Brandt}, 12532 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 12533 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 12534 number = {GMD-Studien Nr. 85}, 12535 year = {1984} 12536} 12537 12538@Article{ yavneh1998coarse, 12539 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 12540 author = {Yavneh, I.}, 12541 journal = {SIAM Journal on Scientific Computing}, 12542 volume = {19}, 12543 number = {5}, 12544 pages = {1682--1699}, 12545 year = {1998}, 12546 publisher = {Society for Industrial and Applied Mathematics} 12547} 12548 12549@Article{ wan2003phase, 12550 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 12551 author = {Wan, WL and Chan, T.F.}, 12552 journal = {SIAM Journal on Scientific Computing}, 12553 volume = {25}, 12554 pages = {857}, 12555 year = {2003} 12556} 12557 12558@Article{ imex, 12559 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 12560 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 12561 journal = {SIAM Journel on Numerical Analysis}, 12562 volume = {32}, 12563 number = {3}, 12564 pages = {797--823}, 12565 year = {1995} 12566} 12567 12568@Article{ ow1, 12569 author = {T. Washio and C. W. Oosterlee}, 12570 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 12571 Recirculating Flow}, 12572 journal = {SIAM Journal on Scientific Computing}, 12573 volume = {21}, 12574 number = {5}, 12575 pages = {1670--1690}, 12576 year = {2000} 12577} 12578 12579@Article{ vm1, 12580 author = {V. A. Mousseau}, 12581 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 12582 Heat Conduction}, 12583 journal = {Journal Of Computational Physics}, 12584 volume = {200}, 12585 pages = {104--132}, 12586 year = {2004} 12587} 12588 12589@Article{ vm2, 12590 author = {V. A. Mousseau}, 12591 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 12592 journal = {Journal Of Heat Transfer}, 12593 volume = {127}, 12594 pages = {531--539}, 12595 year = {2005} 12596} 12597 12598@Misc{ salome1, 12599 author = {Laurent Dada and Daniel Caruge}, 12600 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 12601 Simulation}, 12602 year = {2005}, 12603 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 12604 note = {Presentation at an ESA/ESTEC conference} 12605} 12606 12607@InProceedings{ downar1, 12608 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 12609 A. Mousseau and D. E. Ebert}, 12610 title = {Application of a generalized interface module to the coupling of {PARCS} with 12611 both {RELAP5} and {TRAC-M}}, 12612 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 12613 year = {1999} 12614} 12615 12616@Article{ lopez1, 12617 author = {A. P. Lopez and J. B. Sandova}, 12618 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 12619 thermal-hydraulics}, 12620 journal = {Annals of Nuclear Energy}, 12621 volume = {32(6)}, 12622 pages = {621--634}, 12623 year = {2005} 12624} 12625 12626@InProceedings{ og-1996, 12627 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 12628 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 12629 Transport Code}, 12630 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 12631 Transport Codes}, 12632 editor = {}, 12633 publisher = {}, 12634 pages = {}, 12635 note = {Paris, France}, 12636 month = dec, 12637 year = {1996} 12638} 12639 12640@Article{ wo-2000, 12641 author = {P. Warner and C. R. E. de Oliveira}, 12642 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 12643 {EVENT} for Shielding Applications}, 12644 journal = {J. Nucl. Sci. and Tech.}, 12645 volume = {Supplement 1}, 12646 pages = {466--470}, 12647 year = {2000} 12648} 12649 12650@Unpublished{ gnep-web, 12651 author = {{U.S. Department of Energy}}, 12652 title = {Global Nuclear Energy Partnership ({GNEP})}, 12653 note = {\url{ http://www.gnep.energy.gov}}, 12654 year = {2007} 12655} 12656 12657@Book{ lewis-miller-1984, 12658 author = {E. E. Lewis and W. F. Miller, Jr.}, 12659 title = {Computational Methods of Neutron Transport}, 12660 address = {}, 12661 publisher = {Wiley}, 12662 year = {1984} 12663} 12664 12665@Article{ couple1, 12666 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 12667 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 12668 THE {IBM-704}}, 12669 journal = {Nuclear Sci. and Eng.}, 12670 year = {1959}, 12671 pages = {113--115}, 12672 volume = {2(1)} 12673} 12674 12675@InProceedings{ weber1, 12676 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 12677 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 12678 and component design}, 12679 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 12680 year = {2000} 12681} 12682 12683@Misc{ gnep:report, 12684 author = {Phillip Finck and David Keyes and Rick Stevens}, 12685 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 12686 Nuclear Energy Systems}}, 12687 year = {2006} 12688} 12689 12690@Misc{ subsurface-workshop-ref, 12691 author = {D. {Zachman (Chair)}}, 12692 title = {{Computational Subsurface Sciences Workshop}}, 12693 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 12694} 12695 12696@Misc{ fusion:report, 12697 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 12698 Panel}}, 12699 author = {{Fusion Energy Sciences Advisory Committee}}, 12700 year = {2002}, 12701 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 12702} 12703 12704@Misc{ hecrtf:report, 12705 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 12706 key = {HECRTF}, 12707 year = {2004}, 12708 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 12709} 12710 12711@Misc{ doesc20years, 12712 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 12713 key = {Office of Science, U.S. Department of Energy}, 12714 year = {2003}, 12715 howpublished = {Office of Science, U.S. Department of Energy, see 12716 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 12717} 12718 12719@PhDThesis{ karpeev-thesis, 12720 author = {D. A. Karpeyev}, 12721 title = {Geometric Integrators for Hamiltonian PDEs}, 12722 school = {Old Dominion University}, 12723 year = {2002} 12724} 12725 12726@InCollection{ fjp:ima, 12727 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12728 title = {The Scalability of Mesh Improvement Algorithms}, 12729 booktitle = {Algorithms for Parallel Processing}, 12730 publisher = {Springer-Verlag}, 12731 volume = {105}, 12732 series = {The IMA Volumes in Mathematics and Its Applications}, 12733 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 12734 year = {1998}, 12735 pages = {185--212} 12736} 12737 12738@InProceedings{ poet, 12739 author = {Rob Armstrong and Alex Cheung}, 12740 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 12741 for Scientific Distributed Computing}, 12742 booktitle = {Proceedings of {HICSS97}}, 12743 year = {1997} 12744} 12745 12746@Misc{ pseware-web-page, 12747 author = {}, 12748 title = {{PSEware} {Web} page}, 12749 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 12750 key = {{PSEware} {Web} page} 12751} 12752 12753@Article{ epperly2011high, 12754 title = {High-performance language interoperability for scientific computing through 12755 {B}abel}, 12756 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 12757 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 12758 journal = {International Journal of High Performance Computing Applications}, 12759 pages = {1094342011414036}, 12760 year = {2011}, 12761 publisher = {SAGE Publications} 12762} 12763 12764@Misc{ babel-web-page, 12765 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 12766 title = {{Babel} {Web} page}, 12767 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 12768} 12769 12770@Misc{ infospheres-web-page, 12771 author = {K.~M. {Chandy et al.}}, 12772 title = {{Infospheres} {W}eb page}, 12773 note = {\url{http://www.infospheres.caltech.edu}}, 12774 key = {{Infospheres} {Web} page} 12775} 12776 12777@Misc{ hammond, 12778 author = {Glenn Hammond}, 12779 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 12780 communication} 12781} 12782 12783@Misc{ ornl, 12784 author = {Oak Ridge National Laboratory}, 12785 title = {Private communication via petsc-maint email support} 12786} 12787 12788@Unpublished{ cumulvs-web-page, 12789 author = {}, 12790 title = {{Cumulvs} {W}eb page}, 12791 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 12792 key = {{Cumulvs} {W}eb page} 12793} 12794 12795@Article{ nonlineargmres, 12796 author = {T. Washio and C. W. Oosterlee}, 12797 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 12798 journal = {ETNA}, 12799 year = {1997}, 12800 pages = {271--290}, 12801 volume = {6} 12802} 12803 12804@Article{ pcice, 12805 author = {Richard C. Martineau and Ray A. Berry}, 12806 title = {The pressure-corrected ICE finite element method for compressible flows on 12807 unstructured meshes}, 12808 journal = {Journal of Computational Physics}, 12809 year = {2004}, 12810 pages = {659--685}, 12811 volume = {198(2)} 12812} 12813 12814@Article{ cumulvs97, 12815 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 12816 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 12817 Applications}, 12818 journal = {International Journal of Supercomputing Applications}, 12819 year = {1997} 12820} 12821 12822@TechReport{ daly2012interagency, 12823 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 12824 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 12825 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 12826 Paul Woodward}, 12827 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 12828 year = {2012}, 12829 publisher = {US Department of Defense} 12830} 12831 12832@Article{ karpeev1, 12833 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 12834 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 12835 journal = {J. Comp. Phys.}, 12836 year = {2001}, 12837 pages = {116--148}, 12838 volume = {173} 12839} 12840 12841@InProceedings{ scirun97, 12842 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 12843 title = {The {SCIRun} Computational Steering System}, 12844 booktitle = {Modern Software Tools in Scientific Computing}, 12845 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 12846 publisher = {Birkhauser Press}, 12847 year = {1997} 12848} 12849 12850@TechReport{ szyld, 12851 author = {Valeria Simoncini and Daniel B. Szyld}, 12852 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 12853 Computing}, 12854 year = {2002}, 12855 institution = {Department of Mathematics, Temple University}, 12856 number = {02-4-12} 12857} 12858 12859@TechReport{ pdelab, 12860 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 12861 and C. C. Chui and S. Markus}, 12862 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 12863 for {PDE} Based Applications}, 12864 year = {1994}, 12865 institution = {Department of Computer Sciences, Purdue University}, 12866 number = {CSD-TR-94-021} 12867} 12868 12869@Unpublished{ ilu-web-page, 12870 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 12871 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 12872 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 12873} 12874 12875@Unpublished{ doe2k-web-page, 12876 title = {{DOE2000 Initiative} {W}eb page}, 12877 note = {http://www.mcs.anl.gov/DOE2000}, 12878 key = {DOE2000 Initiative} 12879} 12880 12881@Misc{ pvode-web-page, 12882 title = {{PVODE} {W}eb Page}, 12883 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 12884 author = {A. {Hindmarsh et al.}} 12885} 12886 12887@Book{ szyperski97, 12888 author = {Clemens Szyperski}, 12889 title = {Component Software: Beyond Object-Oriented Programming}, 12890 publisher = {ACM Press}, 12891 address = {New York}, 12892 year = {1997} 12893} 12894 12895@Unpublished{ petsc:coloringuse, 12896 title = {Code for computing sparse {J}acobians}, 12897 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12898 institution = {Argonne National Laboratory} 12899} 12900 12901@Unpublished{ petsc:external, 12902 author = {B. F. {Smith et al.}}, 12903 title = {{External Software Used by PETSc}}, 12904 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12905 institution = {Argonne National Laboratory} 12906} 12907 12908@Unpublished{ petsc:use-by-external-packages, 12909 author = {B. F. {Smith et al.}}, 12910 title = {{Software Packages that Use or Interface to PETSc}}, 12911 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 12912 institution = {Argonne National Laboratory} 12913} 12914 12915@Unpublished{ petsc:prizes, 12916 author = {B. F. {Smith et al.}}, 12917 title = {{Prizes Won Using PETSc}}, 12918 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12919 institution = {Argonne National Laboratory} 12920} 12921 12922@Unpublished{ petsc:csgf, 12923 author = {B. F. {Smith et al.}}, 12924 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 12925 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12926 institution = {Argonne National Laboratory} 12927} 12928 12929@Unpublished{ flash-web-page, 12930 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 12931 {W}eb Page}, 12932 note = {http://www.asci.uchicago.edu}, 12933 author = {R. {Rosner et al.}}, 12934 institution = {University of Chicago} 12935} 12936 12937@Unpublished{ esi-web-page, 12938 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 12939 note = {http://z.ca.sandia.gov/esi}, 12940 author = {R. {Clay et al.}} 12941} 12942 12943@Unpublished{ infobus-web-page, 12944 title = {{I}nfo{B}us {W}eb Page}, 12945 note = {http://www.java.sun.com/beans/infobus}, 12946 key = {infobus} 12947} 12948 12949@Unpublished{ xray-web-page, 12950 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 12951 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 12952 note = {http://www.mcs.anl.gov/xray/}, 12953 institution = {Argonne National Laboratory} 12954} 12955 12956@InProceedings{ kohn98, 12957 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 12958 title = {Language Interoperability Mechanisms for High-Performance Scientific 12959 Applications}, 12960 publisher = {SIAM}, 12961 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12962 Scientific and Engineering Computing}, 12963 year = {1999}, 12964 pages = {30-39} 12965} 12966 12967@InProceedings{ kohn01, 12968 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 12969 title = {Divorcing Language Dependencies from a Scientific Software Library}, 12970 publisher = {SIAM}, 12971 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 12972 year = {2001} 12973} 12974 12975@InProceedings{ freitag_jones_plassmann98, 12976 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12977 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 12978 publisher = {SIAM}, 12979 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12980 Scientific and Engineering Computing}, 12981 year = {1999}, 12982 pages = {215-224} 12983} 12984 12985@Book{ templates, 12986 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 12987 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 12988 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 12989 Methods}, 12990 publisher = {SIAM}, 12991 year = {1994}, 12992 address = {Philadelphia, PA} 12993} 12994 12995@InProceedings{ parasha2, 12996 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 12997 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 12998 {PDE} Solutions}, 12999 booktitle = {SC97 Proceedings}, 13000 publisher = {IEEE Computer Society Press}, 13001 year = {1997} 13002} 13003 13004@TechReport{ parasha, 13005 author = {M. Parashar and J. C. Browne}, 13006 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 13007 Techniques}, 13008 institution = {Department of Computer Science, University of Texas at Austin}, 13009 year = {1995} 13010} 13011 13012@Article{ parti, 13013 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 13014 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 13015 Memory Architectures}, 13016 journal = {Journal of Parallel and Distributed Computing}, 13017 year = {1994}, 13018 volume = {22}, 13019 pages = {462--478} 13020} 13021 13022@Article{ mparti, 13023 author = {G. Agrawal and A. Sussman and J. Saltz}, 13024 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 13025 Block Structured Applications}, 13026 journal = {IEEE Trans. on Parallel and Distributed Systems}, 13027 volume = {6}, 13028 number = {7}, 13029 year = {1995} 13030} 13031 13032@Article{ gropp-lusk-doss-skjellum, 13033 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 13034 title = {A high-performance, portable implementation of the {MPI} Message Passing 13035 Interface standard}, 13036 journal = {Parallel Computing}, 13037 year = {1996}, 13038 volume = {22}, 13039 pages = {789--828} 13040} 13041 13042@InProceedings{ lam, 13043 author = {Greg Burns and Raja Daoud and James Vaigl}, 13044 title = {{LAM}: An Open Cluster Environment for {MPI}}, 13045 booktitle = {Proceedings of Supercomputing Symposium '94}, 13046 editor = {John W. Ross}, 13047 publisher = {University of Toronto}, 13048 pages = {379--386}, 13049 year = {1994} 13050} 13051 13052@Article{ cs99, 13053 author = {X.-C. Cai and M. Sarkis}, 13054 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 13055 systems}, 13056 journal = {SIAM J. Scientific Computing}, 13057 year = {1999}, 13058 volume = {21}, 13059 pages = {792-797} 13060} 13061 13062@Article{ cai2003restricted, 13063 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 13064 positive definite linear systems}, 13065 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 13066 journal = {SIAM Journal on Numerical Analysis}, 13067 volume = {41}, 13068 issue = {1}, 13069 pages = {1209--1231}, 13070 year = {2003}, 13071 doi = {10.1137/S0036142901389621} 13072} 13073 13074@TechReport{ caisaad, 13075 author = {Xiao-Chuan Cai and Youcef Saad}, 13076 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 13077 institution = {Army High Performance Computing Research Center, University of Minnesota }, 13078 year = {1993}, 13079 number = {Preprint 93-027 }, 13080 note = {SIAM J. Sci. Comp. (submitted)} 13081} 13082 13083@Book{ ruminations, 13084 author = {Andrew Koenig and Barbara Moo}, 13085 title = {Ruminations on C++}, 13086 year = {1996}, 13087 publisher = {Addison-Wesley} 13088} 13089 13090@Book{ mpi-complete, 13091 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 13092 Dongarra}, 13093 title = {{MPI}: The Complete Reference}, 13094 year = {1995}, 13095 publisher = {MIT Press} 13096} 13097 13098@Unpublished{ tcl-tk-web-page, 13099 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 13100 note = {http://www.sunlabs.com/research/tcl/}, 13101 year = {1996}, 13102 month = aug 13103} 13104 13105@Misc{ mpich-web-page, 13106 author = {William Gropp and {et. al.}}, 13107 title = {{MPICH} {W}eb page}, 13108 key = {MPICH}, 13109 url = {http://www.mpich.org}, 13110 howpublished = {\url{http://www.mpich.org}} 13111} 13112 13113@Article{ mpi-final, 13114 author = {MPI Forum}, 13115 title = {{MPI}: A Message-Passing Interface Standard}, 13116 journal = {International J. Supercomputing Applications}, 13117 volume = {8}, 13118 number = {3/4}, 13119 year = {1994}, 13120 key = {MPI Standard - final} 13121} 13122 13123@Unpublished{ npb-web-page, 13124 key = {NAS Parallel Benchmarks}, 13125 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 13126 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 13127 year = {1996}, 13128 month = dec 13129} 13130 13131@Book{ george81, 13132 title = {Computer Solution of Large Sparse Positive Definite Systems}, 13133 author = {Alan George and Joseph W. Liu}, 13134 publisher = {Prentice-Hall}, 13135 year = {1981}, 13136 key = {SparseDirect} 13137} 13138 13139@Book{ p4-book, 13140 title = {Portable Programs for Parallel Processors}, 13141 publisher = {Holt, Rinehart, {and} Winston}, 13142 year = {1987}, 13143 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 13144 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 13145 key = {P4Book} 13146} 13147 13148@Article{ stones, 13149 author = {H. L. Stone}, 13150 title = {Iterative solution of implicit approximations of multidimensional partial 13151 differential equations}, 13152 journal = {SIAM J. Numerical Analysis}, 13153 pages = {87--113}, 13154 volumne = {5}, 13155 year = {1968} 13156} 13157 13158@Article{ parallelstones, 13159 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 13160 title = {Parallel versions of {S}tones strongly implicit algorithm}, 13161 journal = {Concurrency and Computation: Practice and Experience}, 13162 pages = {1049--1062}, 13163 volumne = {13}, 13164 year = {2001} 13165} 13166 13167@Article{ p4-paper, 13168 author = {Ralph Butler and Ewing Lusk}, 13169 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 13170 journal = {Journal of Parallel Computing}, 13171 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 13172 Division preprint P362-0493)}, 13173 year = {1993} 13174} 13175 13176@TechReport{ picl, 13177 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 13178 title = {{PICL}: A portable instrumented communications library}, 13179 institution = {Oak Ridge National Laboratory}, 13180 number = {TM-11130}, 13181 year = {1990}, 13182 key = {PICL} 13183} 13184 13185@TechReport{ upshot, 13186 author = {Virginia Herrarte and Ewing Lusk}, 13187 title = {Studying Parallel Program Behavior with {U}pshot}, 13188 institution = {Argonne National Laboratory}, 13189 number = {ANL-91/15}, 13190 month = aug, 13191 year = {1991}, 13192 key = {Upshot} 13193} 13194 13195@TechReport{ p4-manual, 13196 author = {Ralph Butler and Ewing Lusk}, 13197 title = {User's Guide to the p4 Parallel Programming System}, 13198 institution = {Argonne National Laboratory}, 13199 number = {ANL-92/17}, 13200 month = oct, 13201 year = {1992}, 13202 key = {p4-Manual} 13203} 13204 13205@InProceedings{ oldparti, 13206 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 13207 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 13208 booktitle = {Proceedings of Supercomputing '93}, 13209 pages = {578--587}, 13210 year = {1993} 13211} 13212 13213@Article{ parti2, 13214 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 13215 and J. Saltz}, 13216 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 13217 journal = {ACM SIGPLAN Notices}, 13218 year = {1995}, 13219 pages = {68-79}, 13220 volume = {30}, 13221 number = {8} 13222} 13223 13224@Article{ parti3, 13225 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 13226 title = {Run-Time Parallelization and Scheduling of Loops}, 13227 journal = {IEEE Trans. Computers}, 13228 year = {1991}, 13229 pages = {604-612}, 13230 volume = {40}, 13231 number = {5} 13232} 13233 13234@InProceedings{ disz-lusk:wamtrace, 13235 author = {Terrence Disz and Ewing Lusk}, 13236 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 13237 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13238 year = {1987}, 13239 pages = {46--53} 13240} 13241 13242@InProceedings{ gorlick-kesselman:gauge, 13243 author = {Michael Gorlick and Carl Kesselman}, 13244 title = {Timing {Prolog} programs without Clocks}, 13245 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13246 year = {1996}, 13247 publisher = {Birkhauser} 13248} 13249 13250@TechReport{ aztec, 13251 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 13252 title = {Aztec User's Guide Version 1.1}, 13253 institution = {Sandia National Laboratories}, 13254 month = oct, 13255 year = {1995}, 13256 number = {SAND95/1559} 13257} 13258 13259@TechReport{ aztec2, 13260 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 13261 title = {Official {Aztec} User's Guide Version 2.1}, 13262 institution = {Sandia National Laboratories}, 13263 year = {1999} 13264} 13265 13266@Book{ taylor-chandy:pcn, 13267 author = {Chandy, M. and Taylor, S.}, 13268 title = {An Introduction to Parallel Programming}, 13269 year = {1991}, 13270 publisher = {Jones and Bartlett} 13271} 13272 13273@Book{ foster-taylor:strand, 13274 title = {Strand: New Concepts in Parallel Programming}, 13275 author = {Ian Foster and Stephen Taylor}, 13276 publisher = {Prentice-Hall}, 13277 adress = { Englewood Cliffs, New Jersey}, 13278 year = {1990} 13279} 13280 13281@Article{ aurora, 13282 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 13283 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 13284 Carlsson and A. Ciepielewski and B. Hausman}, 13285 title = {The Aurora OR-Parallel Prolog System}, 13286 journal = {New Generation Computing}, 13287 volume = {7}, 13288 number = {3}, 13289 year = {1990}, 13290 pages = {243--271} 13291} 13292 13293@TechReport{ roo, 13294 author = {E. Lusk and W. McCune and J. Slaney}, 13295 title = {Roo---a Parallel Theorem Prover}, 13296 institution = {Argonne National Laboratory}, 13297 number = {MCS--TM--149}, 13298 year = {1991} 13299} 13300 13301@TechReport{ heath-etheridge:vppp, 13302 author = {M. T. Heath and J. A. Etheridge}, 13303 title = {Visualizing the Performance of Parallel Programs}, 13304 institution = {Oak Ridge National Laboratory}, 13305 number = {ORNL TM-11813}, 13306 year = {1991} 13307} 13308 13309@TechReport{ chem:vis, 13310 author = {Ewing L. Lusk}, 13311 title = {Performance Visualization for Parallel Programs}, 13312 institution = {Argonne National Laboratory}, 13313 number = {ANL/MCS--P287--0192}, 13314 year = {1991}, 13315 note = {(to appear in {\em Theoretica Chimica Acta})} 13316} 13317 13318@TechReport{ picltrace, 13319 author = {P.~H.~Worley}, 13320 title = {A new {PICL} trace file format}, 13321 institution = {Oak Ridge National Laboratory}, 13322 number = {ORNL TM-12125}, 13323 month = jun, 13324 year = {1992} 13325} 13326 13327@InProceedings{ hideo, 13328 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 13329 title = {Inference of Phylogenetic trees using maximum likelihood}, 13330 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 13331 year = {1992}, 13332 pages = {247--262} 13333} 13334 13335@InProceedings{ dw90, 13336 author = {M. Dryja and O. Widlund}, 13337 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 13338 Problems}, 13339 booktitle = {Third International Symposium on Domain Decomposition Methods}, 13340 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 13341 year = {1990}, 13342 pages = {3-21}, 13343 publisher = {SIAM}, 13344 address = {Philadelphia}, 13345 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 13346 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 13347 references, good introduction to the theory. No computations}, 13348 key = {DryjaWidlund90 !AS} 13349} 13350 13351@Unpublished{ rosing, 13352 author = {Matt Rosing and Joel Saltz}, 13353 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 13354 key = {LowLatency}, 13355 note = {manuscript, 1992} 13356} 13357 13358@TechReport{ jp:incomplete, 13359 author = {Mark T. Jones and Paul E. Plassmann}, 13360 title = {An Improved Incomplete {C}holesky Factorization}, 13361 institution = {Argonne National Laboratory}, 13362 address = {Argonne, IL}, 13363 type = {Preprint}, 13364 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 13365 number = {MCS-P206-0191}, 13366 year = {1991}, 13367 key = {jones} 13368} 13369 13370@InCollection{ jp:ima, 13371 author = {Mark Jones and Paul Plassmann}, 13372 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 13373 booktitle = {Graph Theory and Sparse Matrix Computation}, 13374 publisher = {Springer-Verlag}, 13375 series = {The IMA Volumes in Mathematics and Its Applications}, 13376 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 13377 volume = {56}, 13378 year = {1993}, 13379 pages = {229--245} 13380} 13381 13382@Article{ pw98, 13383 author = {M. Pernice and H. F. Walker}, 13384 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 13385 journal = {SIAM J. Sci. Stat. Comput.}, 13386 year = {1998}, 13387 volume = {19}, 13388 pages = {302--318} 13389} 13390 13391@TechReport{ ysmp83, 13392 key = {Eisenstat}, 13393 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13394 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13395 institution = {Department of Computer Science, Yale University}, 13396 number = {YALE/DCS/RR-265}, 13397 month = apr, 13398 year = {1983} 13399} 13400 13401@InBook{ ysmp84, 13402 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13403 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13404 title = {Elliptic Problem Solvers II}, 13405 publisher = {Academic Press}, 13406 pages = {45--52}, 13407 editors = {G. Birkhoff and A. Schoenstadt}, 13408 year = {1984} 13409} 13410 13411@TechReport{ sparsekit, 13412 key = {Saad}, 13413 author = {Youcef Saad}, 13414 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 13415 institution = {Center for Supercomputing Research and Development, University of Illinois at 13416 Urbana-Champaign}, 13417 number = {1029}, 13418 year = {1990} 13419} 13420 13421@TechReport{ pde-user-ref, 13422 author = {Barry F. Smith}, 13423 title = {Extensible {PDE} Solvers Package Users Manual}, 13424 institution = {Argonne National Laboratory}, 13425 month = sep, 13426 year = {1994}, 13427 number = {ANL-93/40}, 13428 key = {Smith94 ! PDE} 13429} 13430 13431@TechReport{ bs-user-ref, 13432 author = {Mark T. Jones and Paul E. Plassmann}, 13433 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 13434 of Sparse Linear Systems}, 13435 institution = {Argonne National Laboratory}, 13436 month = dec, 13437 year = {1995}, 13438 number = {ANL-95/48} 13439} 13440 13441@TechReport{ snes-user-ref, 13442 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 13443 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 13444 institution = {Argonne National Laboratory}, 13445 month = feb, 13446 year = {1995}, 13447 number = {ANL/MCS-TM-193}, 13448 key = {GroppMcInnesSmith95 ! SNES} 13449} 13450 13451@TechReport{ sles-user-ref, 13452 author = {William D. Gropp and Barry F. Smith}, 13453 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 13454 institution = {Argonne National Laboratory}, 13455 month = mar, 13456 year = {1993}, 13457 number = {ANL-93/8}, 13458 key = {GroppSmith93 ! SLES} 13459} 13460 13461@TechReport{ chameleon-user-ref, 13462 author = {William D. Gropp and Barry F. Smith}, 13463 title = {Chameleon Parallel programming tools Users Manual}, 13464 institution = {Argonne National Laboratory}, 13465 month = mar, 13466 year = {1993}, 13467 number = {ANL-93/23}, 13468 key = {GroppSmith93 ! Chameleon} 13469} 13470 13471@Article{ euclid2, 13472 author = {D. Hysom and A. Pothen}, 13473 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 13474 journal = {SIAM J. Sci. Comput.}, 13475 volume = {22}, 13476 number = {6}, 13477 pages = {2194--2215} 13478} 13479 13480@TechReport{ euclid1, 13481 author = {D. Hysom and A. Pothen}, 13482 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 13483 Solution of Sparse Linear Systems)}, 13484 institution = {Old Dominion University}, 13485 year = {2001} 13486} 13487 13488@TechReport{ ksp-user-ref, 13489 author = {William D. Gropp and Barry F. Smith}, 13490 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 13491 Methods}, 13492 institution = {Argonne National Laboratory}, 13493 month = aug, 13494 year = {1993}, 13495 number = {ANL-93/30}, 13496 key = {GroppSmith93 ! KSP} 13497} 13498 13499@TechReport{ mpi-chameleon, 13500 author = {William D. Gropp and Ewing Lusk}, 13501 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 13502 institution = {Argonne National Laboratory}, 13503 month = dec, 13504 year = {1992}, 13505 number = {ANL-92/47}, 13506 key = {GroppLusk92 ! MPI} 13507} 13508 13509@TechReport{ blockcomm-fortran, 13510 author = {William D. Gropp}, 13511 title = {Block{C}omm for {F}ortran}, 13512 institution = {Argonne National Laboratory}, 13513 month = may, 13514 year = {1993}, 13515 number = {ANL-93/00 (to appear)}, 13516 key = {Gropp93 ! BlockComm} 13517} 13518 13519@TechReport{ autodocument, 13520 author = {William D. Gropp}, 13521 title = {Automatic documentation of {C} programs}, 13522 institution = {Argonne National Laboratory}, 13523 month = may, 13524 year = {1993}, 13525 number = {ANL-93/00}, 13526 key = {Gropp93 ! Autodoc} 13527} 13528 13529@TechReport{ zipcode, 13530 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 13531 Manfred Morari}, 13532 title = {The {Z}ipcode message-passing system}, 13533 institution = {Lawrence Livermore National Laboratory}, 13534 month = sep, 13535 year = {1992}, 13536 number = {Unpublished}, 13537 key = {Skjellum92 ! Zipcode} 13538} 13539 13540@Article{ paragraph, 13541 author = {Michael T. Heath and Jennifer Etheridge Finger}, 13542 title = {Visualizing performance of parallel programs}, 13543 journal = {IEEE Software}, 13544 volume = {8}, 13545 number = {5}, 13546 month = sep, 13547 year = {1991}, 13548 pages = {29--39}, 13549 key = {Heath91 ! Paragraph} 13550} 13551 13552@Article{ gropp90, 13553 author = {William Gropp and Edward Smith}, 13554 title = {Computational Fluid Dynamics on Parallel Processors}, 13555 journal = {Computers and Fluids}, 13556 volume = {18}, 13557 year = {1990}, 13558 pages = {289--304}, 13559 key = {Gropp90 ! performance} 13560} 13561 13562@Article{ foster92, 13563 author = {Ian Foster and William Gropp and Rick Stevens}, 13564 title = {The parallel scalability of the spectral transform method}, 13565 journal = {Monthly Weather Review}, 13566 volume = {120}, 13567 year = {1992}, 13568 pages = {835--850}, 13569 key = {Foster92 ! performance} 13570} 13571 13572@InBook{ fgn, 13573 author = {R. Freund and G. H. Golub and N. Nachtigal}, 13574 title = {Iterative Solution of Linear Systems}, 13575 series = {Acta Numerica}, 13576 year = {1992}, 13577 publisher = {Cambridge University Press}, 13578 pages = {57--100} 13579} 13580 13581@TechReport{ nachtigal90, 13582 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 13583 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13584 institution = {Massachusetts Institute of Technology}, 13585 month = mar, 13586 year = {1990}, 13587 number = {90-2}, 13588 key = {Nachtigal | Krylov} 13589} 13590 13591@Article{ nachtigal1992fnm, 13592 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13593 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 13594 journal = {SIAM Journal on Matrix Analysis and Applications}, 13595 volume = {13}, 13596 pages = {778}, 13597 year = {1992}, 13598 publisher = {SIAM} 13599} 13600 13601@TechReport{ embree1999descriptive, 13602 title = {How descriptive are {GMRES} convergence bounds}, 13603 author = {Embree, M.}, 13604 year = {1999}, 13605 number = {08}, 13606 institution = {Oxford University Computing Laboratory} 13607} 13608 13609@Article{ vorst92, 13610 author = {H. van der Vorst}, 13611 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 13612 of nonsymmetric linear systems}, 13613 journal = {SIAM J. Sci. Stat. Comput.}, 13614 year = {1992}, 13615 volume = {13}, 13616 pages = {631--644} 13617} 13618 13619@Article{ eisenstat81, 13620 author = {S. Eisenstat}, 13621 title = {Efficient Implementation of a Class of {CG} Methods}, 13622 journal = {SIAM J. Sci. Stat. Comput.}, 13623 year = {1981}, 13624 volume = {2}, 13625 pages = {1--4} 13626} 13627 13628@Manual{ ibm-essl, 13629 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 13630 Reference}, 13631 organization = {IBM}, 13632 year = {1992}, 13633 key = {IBM-ESSL} 13634} 13635 13636@Manual{ ibm-eui, 13637 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 13638 Release 2.0}, 13639 organization = {IBM}, 13640 month = jun, 13641 year = {1994}, 13642 key = {IBM-EUI} 13643} 13644 13645@Manual{ ibm-euih, 13646 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 13647 organization = {IBM}, 13648 author = {Peter Hochschild}, 13649 year = {1993}, 13650 key = {IBM-EUIH} 13651} 13652 13653@TechReport{ mpi, 13654 title = {Document for a Standard Message-Passing Interface}, 13655 author = {Message Passing Interface Forum}, 13656 institution = {University of Tennessee}, 13657 number = {CS-93-214}, 13658 month = nov, 13659 year = {1993}, 13660 key = {MPI Standard} 13661} 13662 13663@Unpublished{ mpi-final-web, 13664 author = {Message Passing Interface Forum}, 13665 title = {{MPI}: A Message-Passing Interface Standard}, 13666 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 13667 year = {1994}, 13668 month = may 13669} 13670 13671@Book{ hockney-jesshope, 13672 author = {R. W. Hockney and C. R. Jesshope}, 13673 title = {Parallel Computers 2}, 13674 publisher = {Adam Hilger}, 13675 year = {1988} 13676} 13677 13678@Book{ cm-fortran, 13679 author = {{Thinking Machines Corporation}}, 13680 title = {Users Manual for CM-Fortran}, 13681 publisher = {Thinking Machines Corporation}, 13682 year = {1993} 13683} 13684 13685@TechReport{ chang93, 13686 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 13687 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 13688 institution = {Yale Department of Computer Science}, 13689 number = {YALEU/DCS/RR-994}, 13690 month = nov, 13691 year = {1993}, 13692 key = {BDD|diag} 13693} 13694 13695@InProceedings{ gropplevine93, 13696 author = {N. Galbreath and W. Gropp and D. Levine}, 13697 title = {Applications-Driven Parallel {I/O}}, 13698 booktitle = {Proceedings of Supercomputing '93}, 13699 year = {1993}, 13700 pages = {462--471} 13701} 13702 13703@Book{ siegle85, 13704 author = {H. J. Siegel}, 13705 title = {Interconnection Networks for Large Scale Parallel Processing}, 13706 publisher = {Lexington Books}, 13707 year = {1985}, 13708 key = {Network Comparison} 13709} 13710 13711@Article{ lawrie75, 13712 author = {D. H. Lawrie}, 13713 title = {Access and alignment of data in an array processor}, 13714 journal = {IEEE Transactions on Computers}, 13715 volume = {C-24}, 13716 number = {12}, 13717 month = dec, 13718 year = {1975}, 13719 pages = {1145--1155}, 13720 key = {Omega Network} 13721} 13722 13723@Book{ knuth1986, 13724 title = {The {\TeX}{Book}}, 13725 author = {Donald Ervin Knuth and Duane Bibby}, 13726 volume = {1993}, 13727 year = {1986}, 13728 publisher = {Addison-Wesley Reading, Massachusetts} 13729} 13730 13731@Book{ lamport86, 13732 author = {Leslie Lamport}, 13733 title = {{LaTeX}: A document preparation system}, 13734 publisher = {Addison-Wesley}, 13735 year = {1986}, 13736 key = {Latex Manual} 13737} 13738 13739@InProceedings{ gropp-lusk:unix-tools, 13740 author = {William Gropp and Ewing Lusk}, 13741 title = {Scalable {U}nix Tools on Parallel Processors}, 13742 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 13743 publisher = {IEEE}, 13744 pages = {56--62} 13745} 13746 13747@InProceedings{ jp:bell_prize, 13748 author = {Mark Jones and Paul Plassmann}, 13749 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 13750 Applications}, 13751 booktitle = {Proceedings of Supercomputing '92}, 13752 publisher = {IEEE Computer Society Press}, 13753 year = {1992}, 13754 pages = {551--560} 13755} 13756 13757@COMMENT{WEB, CWEB references (for doctext)} 13758@TechReport{ web, 13759 author = {Donald E. Knuth}, 13760 title = {The {\tt WEB} system of structured documentation}, 13761 institution = {Computer Science Department, Stanford University}, 13762 year = {1983}, 13763 number = {980}, 13764 month = sep 13765} 13766 13767@Article{ literatepgm, 13768 author = {Donald E. Knuth}, 13769 title = {Literate Programming}, 13770 journal = {Computer Journal}, 13771 year = {1984}, 13772 volume = {27}, 13773 number = {2}, 13774 pages = {91--111} 13775} 13776 13777@Unpublished{ cweb-code, 13778 author = {Silvio Levy and Donald E. Knuth}, 13779 title = {CWEB}, 13780 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 13781} 13782 13783@Article{ jp:scalable, 13784 author = {Mark Jones and Paul Plassmann}, 13785 title = {Scalable Iterative Solution of Sparse Linear Systems}, 13786 journal = {Parallel Computing}, 13787 volume = {20}, 13788 number = {5}, 13789 month = may, 13790 year = {1994}, 13791 pages = {753--773} 13792} 13793 13794@Article{ jp:pcolor, 13795 author = {Mark T. Jones and Paul E. Plassmann}, 13796 title = {A Parallel Graph Coloring Heuristic}, 13797 journal = {SIAM J. Sci. Comput.}, 13798 volume = {14}, 13799 number = {3}, 13800 pages = {654-669}, 13801 year = {1993} 13802} 13803 13804@TechReport{ block_solve, 13805 author = {Mark T. Jones and Paul E. Plassmann}, 13806 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 13807 Sparse Linear Systems}, 13808 institution = {Argonne National Laboratory}, 13809 year = {1992}, 13810 number = {ANL-92/46}, 13811 key = {JonesPlassmann92 ! block_solve} 13812} 13813 13814@InProceedings{ supercond, 13815 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 13816 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 13817 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 13818 Conference}, 13819 month = feb, 13820 year = {1994}, 13821 key = {McInnesPalumbo94 ! superconductivity } 13822} 13823 13824@Unpublished{ preosti:93, 13825 author = {Gianfranco Preosti}, 13826 title = { }, 13827 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 13828 year = {1993}, 13829 key = {preosti93 ! GL-tilt3d} 13830} 13831 13832@Unpublished{ more:93, 13833 author = {Jorge J. Mor\'{e}}, 13834 title = { }, 13835 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 13836 {A}rgonne {N}ational {L}aboratory}, 13837 year = {1993}, 13838 key = {more93 ! MINPACK-2} 13839} 13840 13841@Article{ brownsaad:90, 13842 author = {Peter N. Brown and Youcef Saad}, 13843 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 13844 journal = {SIAM J. Sci. Stat. Comput.}, 13845 year = {1990}, 13846 volume = {11}, 13847 pages = {450-481} 13848} 13849 13850@Book{ using-mpi, 13851 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 13852 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 13853 publisher = {MIT Press}, 13854 year = {1994} 13855} 13856 13857@Book{ using-mpi2, 13858 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 13859 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 13860 publisher = {MIT Press}, 13861 year = {1999} 13862} 13863 13864@Article{ hs:52, 13865 author = {Magnus R. Hestenes and Eduard Steifel}, 13866 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 13867 journal = {J. Research of the National Bureau of Standards}, 13868 year = {1952}, 13869 volume = {49}, 13870 pages = {409-436} 13871} 13872 13873@Article{ so:89, 13874 author = {Peter Sonneveld}, 13875 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 13876 journal = {SIAM J. Sci. Stat. Comput.}, 13877 year = {1989}, 13878 volume = {10}, 13879 pages = {36-52} 13880} 13881 13882@Article{ v:92, 13883 author = {{H. A.} {van der Vorst}}, 13884 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 13885 of nonsymmetric linear systems}, 13886 journal = {SIAM J. Sci. Stat. Comput.}, 13887 volume = {13}, 13888 year = {1992}, 13889 pages = {631-644} 13890} 13891 13892@Article{ f:93, 13893 author = {Roland W. Freund}, 13894 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 13895 Systems}, 13896 journal = {SIAM J. Sci. Stat. Comput.}, 13897 volume = {14}, 13898 year = {1993}, 13899 pages = {470-482} 13900} 13901 13902@Article{ ish:89, 13903 author = {S. Ishizuka}, 13904 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 13905 journal = {Combustion and Flame}, 13906 volume = {75}, 13907 year = {1989}, 13908 pages = {367-379} 13909} 13910 13911@Book{ williams89, 13912 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 13913 author = {F.A. Williams}, 13914 publisher = {Addison-Wesley}, 13915 year = {1989}, 13916 pages = {367-379} 13917} 13918 13919@Book{ ra75, 13920 author = {R. Aris}, 13921 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 13922 publisher = {Oxford}, 13923 year = {1975} 13924} 13925 13926@Book{ bebernes89, 13927 author = {J. Bebernes and D. Eberly}, 13928 title = {Mathematical Problems from Combustion Theory}, 13929 publisher = {Springer-Verlag}, 13930 series = {Applied Mathematical Sciences 83}, 13931 year = {1989} 13932} 13933 13934@InProceedings{ kikuchi89, 13935 author = {F. Kikuchi}, 13936 booktitle = { Computing Methods in Applied Sciences and Engineering}, 13937 editor = {R. Glowinski and J. L. Lions}, 13938 publisher = {Springer-Verlag}, 13939 series = {Lecture Notes in Mathematics}, 13940 title = {Finite element approximations to bifurcation problems of turning point type}, 13941 year = {1977} 13942} 13943 13944@Article{ rg85, 13945 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 13946 title = {Continuation-conjugate Gradient Methods for the Least Squares Solution of 13947 Nonlinear Boundary Problems}, 13948 journal = {SIAM J. Sci. Stat. Comput.}, 13949 volume = {6}, 13950 year = {1985}, 13951 pages = {793-832} 13952} 13953 13954@InProceedings{ whitfield91, 13955 author = {D. Whitfield and L. Taylor}, 13956 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13957 Schemes}, 13958 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 13959 misc = {AIAA-91-1539}, 13960 pages = {134-145}, 13961 year = {1991} 13962} 13963 13964@InProceedings{ quinlan1, 13965 author = {M. Lemke and D. Quinlan}, 13966 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 13967 Architecture-Independent Development of Structured Grid Applications}, 13968 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 13969 publisher = {Springer Verlag}, 13970 year = {1992} 13971} 13972 13973@InProceedings{ quinlan2, 13974 author = {R. Parsons and D. Quinlan}, 13975 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 13976 Computations}, 13977 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 13978 year = {1994} 13979} 13980 13981% ***** Overview of functionality in Diffpack 13982@InBook{ dpoverview, 13983 author = {Bruaset, A. M. and Langtangen, H. P.}, 13984 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13985 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 13986 {Diffpack}}, 13987 publisher = {Birkh{\"{a}}user}, 13988 pages = {61--90}, 13989 year = {1997} 13990} 13991 13992% ***** Short overview of Diffpack 13993@InCollection{ dpoverview2, 13994 author = {Bruaset, A. M. and Langtangen, H. P.}, 13995 editor = {A. Sydow}, 13996 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 13997 and Applied Mathematics}, 13998 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 13999 pages = {553--558}, 14000 volume = {4}, 14001 year = {1997} 14002} 14003 14004% ***** Comprehensive documentation of Diffpack and 14005% associated numerical methods: 14006@Book{ dpbook, 14007 author = {H. P. Langtangen}, 14008 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 14009 Software. Part I}, 14010 series = {Lecture Notes in Computational Science and Engineering}, 14011 publisher = {Springer-Verlag}, 14012 year = {1998} 14013} 14014 14015% ***** Design issues of the linear solvers in Diffpack, serves also as a 14016% collection of examples on O-O in numerical computing 14017@Article{ ambhpl97a, 14018 author = {A. M. Bruaset and H. P. Langtangen }, 14019 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 14020 journal = {Transactions on Mathematical Software}, 14021 volume = {23 }, 14022 pages = {50--80}, 14023 year = {1997} 14024} 14025 14026@Misc{ dpurl, 14027 author = {{Diffpack Web page}}, 14028 howpublished = {\url{http://www.diffpack.com}} 14029} 14030 14031% ***** General intro to object-oriented numerics for "FORTRAN programmers" 14032@InCollection{ oonintro, 14033 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 14034 editor = {D{\ae}hlen, M. and Tveito, A.}, 14035 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14036 title = {Object-Oriented Numerics}, 14037 publisher = {Birkh{\"{a}}user}, 14038 year = {1997} 14039} 14040 14041% ***** Efficiency comparison: BLAS 1, Diffpack, C, 14042% and finite element applications (F77 vs Diffpack) 14043@InCollection{ dpefficiency, 14044 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 14045 H. P. and Miller, C. T.}, 14046 editor = {D{\ae}hlen, M. and Tveito, A.}, 14047 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14048 title = {On the Efficiency of {C++} in Scientific Computing}, 14049 publisher = {Birkh{\"{a}}user}, 14050 pages = {91--118}, 14051 year = {1997} 14052} 14053 14054% ***** Parallel concept in Diffpack: 14055@InCollection{ dpparallel, 14056 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 14057 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 14058 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 14059 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 14060 Simulators}, 14061 publisher = {Springer--Verlag}, 14062 series = {Lecture Notes in Computer Science}, 14063 pages = {161--168}, 14064 year = {1997} 14065} 14066 14067% ***** DD and ML methods in Diffpack: 14068@InCollection{ dpddml, 14069 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 14070 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 14071 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 14072 title = {Domain decomposition and multilevel methods in Diffpack}, 14073 year = {1997} 14074} 14075 14076@InProceedings{ bsca98, 14077 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 14078 Alexander}, 14079 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 14080 Optimization}, 14081 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14082 Scientific and Engineering Computing}, 14083 editor = {Mike Henderson et al.}, 14084 pages = {165-173}, 14085 year = {1998} 14086} 14087 14088@Book{ scalapack-user-guide, 14089 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 14090 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 14091 Stanley and D. Walker and R. C. Whaley}, 14092 title = {Sca{LAPACK} Users' Guide}, 14093 publisher = {SIAM}, 14094 address = {Philadelphia, PA}, 14095 year = {1997} 14096} 14097 14098@InProceedings{ keyes99, 14099 author = {D. E. Keyes}, 14100 title = {How Scalable is Domain Decomposition in Practice?}, 14101 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 14102 Methods}, 14103 editor = {C.-H. Lai et al.}, 14104 publisher = {Domain Decomposition Press, Bergen}, 14105 note = {To appear}, 14106 year = {1999} 14107} 14108 14109@Article{ fun3d, 14110 author = {W. K. Anderson and D. L. Bonhaus}, 14111 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 14112 grids}, 14113 journal = {Computers and Fluids}, 14114 year = {1994}, 14115 volume = {23}, 14116 pages = {1--21} 14117} 14118 14119% ------------------------------------------------------------------------- 14120% ------------------------------------------------------------------------- 14121@Article{ torczon, 14122 author = {Dennis, Jr., J. E. and V.~Torczon}, 14123 title = {Direct Search Methods on Parallel Machines}, 14124 journal = {SIAM J. Optimization}, 14125 volume = {1}, 14126 pages = {448--474}, 14127 year = {1991}, 14128 key = {Torczon !PDS} 14129} 14130 14131@InProceedings{ wt91, 14132 author = {D. L. Whitfield and L. K. Taylor}, 14133 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 14134 Schemes}, 14135 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 14136 misc = {AIAA-91-1539}, 14137 pages = {134-145}, 14138 year = {1991} 14139} 14140 14141@Article{ ew96, 14142 author = {S. C. Eisenstat and H. F. Walker}, 14143 title = {Choosing the forcing terms in an inexact {N}ewton method}, 14144 journal = {SIAM J. Scientific Computing}, 14145 volume = {17}, 14146 year = {1996}, 14147 pages = {16--32} 14148} 14149 14150@Book{ thi93, 14151 author = {{Thinking Machines Corporation}}, 14152 title = {Users Manual for CM-Fortran}, 14153 publisher = {Thinking Machines Corporation}, 14154 year = {1993} 14155} 14156 14157@Book{ mortonmayers94, 14158 author = {K. W. Morton and D. F. Mayers}, 14159 title = {Numerical Solution of Partial Differential Equations}, 14160 publisher = {Press Syndicate of the University of Cambridge}, 14161 year = {1994} 14162} 14163 14164@Book{ heath97, 14165 author = {Michael T. Heath}, 14166 title = {Scientific Computing: An Introductory Survey}, 14167 publisher = {McGraw Hill}, 14168 year = {1997} 14169} 14170 14171@Article{ captools96, 14172 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 14173 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 14174 Performance on the Parallelization of Structured Mesh Codes}, 14175 journal = {Parallel Computing}, 14176 volume = {22}, 14177 pages = {197-226}, 14178 year = {1996} 14179} 14180 14181@Misc{ nastran-web-page, 14182 author = {{MSC Software Corporation}}, 14183 title = {{NASTRAN} {W}eb page}, 14184 howpublished = {\url{http://www.mechsolutions.com/products/nastran/}}, 14185 year = {2024} 14186} 14187 14188@Book{ hpf, 14189 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 14190 Zosel}, 14191 title = {The High Performance Fotran Handbook}, 14192 publisher = {MIT Press}, 14193 year = {1994} 14194} 14195 14196@InProceedings{ keyes98, 14197 author = {D. E. Keyes}, 14198 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 14199 Architectures}, 14200 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 14201 editors = {M. D. Salas and W. K. Anderson}, 14202 ppublisher = {Elsevier}, 14203 year = {1998} 14204} 14205 14206@InProceedings{ pooma-atlas, 14207 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 14208 J. V. W. Reynders and M. Tholburn}, 14209 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 14210 Applications}, 14211 year = {1995}, 14212 month = dec, 14213 booktitle = {Supercomputing '95 Proceedings} 14214} 14215 14216% --------------------------------------------------------------------------------- 14217% New bib entries for CRPC paper 14218@Misc{ mgnet-web-page, 14219 author = {Craig C. Douglas}, 14220 title = {{MGNet Web page}}, 14221 note = {See {\tt http://\-www.mgnet.org}} 14222} 14223 14224@Misc{ dagh-web-page, 14225 author = {M. Parashar and J. C. Browne}, 14226 title = {{DAGH Web page}}, 14227 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 14228} 14229 14230@Misc{ parasol-web-page, 14231 key = {PARASOL}, 14232 title = {{PARASOL Web page}}, 14233 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 14234} 14235 14236@Misc{ pooma-web-page, 14237 author = {{POOMA Web page}}, 14238 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 14239} 14240 14241@Misc{ mudpack-web-page, 14242 author = {John C. Adams}, 14243 title = {{MUDPACK Web page}}, 14244 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 14245} 14246 14247@Misc{ pellpack-web-page, 14248 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 14249 title = {{Parallel ELLPACK Web page}}, 14250 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 14251} 14252 14253@InProceedings{ pellpack95, 14254 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 14255 Catlin and S. Weerawarana and T.S. Papatheodorou}, 14256 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 14257 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 14258 address = {Albuquerque, NM}, 14259 year = {1995} 14260} 14261 14262@Misc{ nhse-web-page, 14263 author = {{National High-Performance Software Exchange Web page}}, 14264 note = {See {\tt http://\-www.nhse.org}} 14265} 14266 14267@Misc{ doug-web-page, 14268 author = {Mark J. Hagger and Linda Stals}, 14269 title = {{DOUG Web Page}}, 14270 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 14271} 14272 14273@TechReport{ doug97, 14274 author = {Mark J. Hagger}, 14275 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 14276 institution = {Mathematical Sciences, University of Bath}, 14277 year = {1997}, 14278 number = {9706}, 14279 note = {Advances in Computational Mathematics (to appear)} 14280} 14281 14282@Misc{ ug-web-page, 14283 author = {{UG Web Page}}, 14284 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 14285} 14286 14287@Article{ ug97, 14288 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 14289 Rentz-Reichert and C. Wieners}, 14290 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 14291 journal = {Computing and Visualization in Science}, 14292 year = {1997}, 14293 volume = {}, 14294 pages = {} 14295} 14296 14297@Misc{ vecfem-web-page, 14298 author = {Lutz Grosz}, 14299 title = {{VECFEM Web Page}}, 14300 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 14301} 14302 14303@Misc{ atlas-web-page, 14304 author = {R. Clint {Whaley et al.}}, 14305 title = {{ATLAS Web Page}}, 14306 howpublished = {\url{http://math-atlas.sourceforge.net}} 14307} 14308 14309@Misc{ fenics-web-page, 14310 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 14311 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 14312 title = {{FEniCS Web Page}}, 14313 note = {\url{http://www.fenicsproject.org}}, 14314 year = {2005} 14315} 14316 14317@Misc{ matlab-web-page, 14318 author = {{The} {MathWorks}}, 14319 title = {{Matlab} {Web} page}, 14320 url = {http://www.mathworks.com} 14321} 14322 14323@Misc{ phipac-web-page, 14324 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 14325 and D. Lam}, 14326 title = {{PHiPAC Web Page}}, 14327 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 14328} 14329 14330@InProceedings{ kelp, 14331 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 14332 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 14333 booktitle = {Irregular '96}, 14334 year = {1996} 14335} 14336 14337@Unpublished{ kelp-web-page, 14338 author = {Scott Baden}, 14339 title = {{KeLP} {W}eb page}, 14340 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 14341} 14342 14343@InProceedings{ hk99, 14344 author = {R. Hornung and S. Kohn}, 14345 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 14346 Framework}, 14347 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 14348 Scientific and Engineering Computing}, 14349 pages = {235-244}, 14350 year = {1999}, 14351 note = {See \url{http://www.llnl.gov/CASC/samrai}} 14352} 14353 14354@Unpublished{ samrai-web-page, 14355 title = {{SAMRAI} {W}eb Page}, 14356 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 14357 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 14358} 14359 14360@Misc{ overture-web-page, 14361 author = {William Henshaw and Kyle Chand}, 14362 title = {{Overture} {W}eb page}, 14363 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 14364} 14365 14366@InProceedings{ overture99, 14367 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 14368 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 14369 on Overlapping Grids}, 14370 publisher = {SIAM}, 14371 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14372 Scientific and Engineering Computing}, 14373 year = {1999}, 14374 pages = {215-224}, 14375 note = {See \url{http://www.llnl.gov/CASC/Overture}} 14376} 14377 14378@InProceedings{ diffpack, 14379 author = {A.M. Bruaset and H.P. Langtangen}, 14380 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 14381 {D}iffpack}, 14382 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 14383 year = {1997}, 14384 pages = {61--90}, 14385 publisher = {Birkhauser Press} 14386} 14387 14388@Article{ dongarra:1984:ila, 14389 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 14390 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 14391 Machine}, 14392 journal = {SIAM Review}, 14393 volume = {26}, 14394 number = {1}, 14395 pages = {91--112}, 14396 month = jan, 14397 year = {1984}, 14398 coden = {SIREAD}, 14399 issn = {0036-1445 (print), 1095-7200 (electronic)}, 14400 mrclass = {65F10 (65F30)}, 14401 mrnumber = {85c:65032}, 14402 bibdate = {Mon Jan 20 1997}, 14403 abstract = {The authors examine common implementations of linear algebra algorithms, such as 14404 matrix-vector multiplication, matrix-matrix multiplication and the solution of 14405 linear equations. The different versions are examined for efficiency on a computer 14406 architecture which uses vector processing and has pipelined instruction execution. 14407 By using the advanced architectural features of such machines, one can usually 14408 achieve maximum performance, and tremendous improvements in terms of execution 14409 speed can be seen over conventional computers.}, 14410 classification= {723; 921}, 14411 journalabr = {SIAM Rev}, 14412 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 14413 mathematical programming; vector pipeline machine} 14414} 14415 14416@Book{ qv99, 14417 author = {Alfio Quarteroni and Alberto Valli}, 14418 title = {Domain Decomposition Methods for Partial Differential Equations}, 14419 publisher = {Oxford Science Publications}, 14420 address = {Oxford}, 14421 year = {1999} 14422} 14423 14424@Book{ ksv97, 14425 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 14426 title = {Parallel Numerical Algorithms}, 14427 publisher = {Kluwer Academic Publishers}, 14428 address = {the Netherlands}, 14429 year = {1997} 14430} 14431 14432@Book{ hackbusch94, 14433 author = {Wolfgang Hackbusch}, 14434 title = {Iterative Solution of Large Sparse Systems of Equations}, 14435 publisher = {Springer-Verlag}, 14436 address = {New York}, 14437 year = {1994} 14438} 14439 14440@Article{ hackbusch1980fast, 14441 title = {Fast solution of elliptic control problems}, 14442 author = {Hackbusch, W.}, 14443 journal = {Journal of Optimization Theory and Applications}, 14444 volume = {31}, 14445 number = {4}, 14446 pages = {565--581}, 14447 year = {1980}, 14448 publisher = {Springer} 14449} 14450 14451@Book{ hackbusch1985multi, 14452 title = {{Multi-grid methods and applications}}, 14453 author = {Hackbusch, W.}, 14454 isbn = {3540127615}, 14455 issn = {0179-3632}, 14456 year = {1985}, 14457 publisher = {Springer Verlag} 14458} 14459 14460@Book{ axelsson94, 14461 author = {Owe Axelsson}, 14462 title = {Iterative Solution Methods}, 14463 publisher = {Cambridge University Press}, 14464 address = {Cambridge}, 14465 year = {1994} 14466} 14467 14468@Book{ saad96, 14469 author = {Yousef Saad}, 14470 title = {Iterative Methods for Sparse Linear Systems}, 14471 publisher = {PWS Publishing Company}, 14472 address = {Boston}, 14473 year = {1996} 14474} 14475 14476@Book{ saad2003, 14477 title = {Iterative Methods for Sparse Linear Systems}, 14478 author = {Saad, Yousef}, 14479 doi = {10.1016/S1570-579X(01)80025-2}, 14480 edition = {2nd}, 14481 publisher = {SIAM}, 14482 year = {2003} 14483} 14484 14485@Book{ vandervorst03, 14486 author = {Henk A. {van der Vorst}}, 14487 title = {Iterative Krylov Methods for Large Linear Systems}, 14488 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 14489 year = {2003} 14490} 14491 14492@Book{ koniges00, 14493 editor = {Alice E. Koniges}, 14494 title = {Industrial Strength Parallel Computing}, 14495 publisher = {Morgan Kaufmann Publishers}, 14496 address = {San Francisco}, 14497 year = {2000} 14498} 14499 14500@Misc{ fftw-web-page, 14501 key = {Fftw}, 14502 title = {{FFTW} {Web} page}, 14503 note = {\texttt{http://www.fftw.org/}}, 14504 annote = {fast FFT. Parallel versions with MPI and Cilk} 14505} 14506 14507@InProceedings{ frigojohnson93, 14508 author = {Matteo Frigo and Steven G. Johnson}, 14509 title = {The Design and Implementation of {FFTW3}}, 14510 booktitle = {Proceedings of the IEEE}, 14511 volume = {93}, 14512 number = {2}, 14513 pages = {216--231}, 14514 year = {2005} 14515} 14516 14517@Book{ kelley95, 14518 author = {C. T. Kelley}, 14519 title = {Iterative Methods for Linear and Nonlinear Equations}, 14520 year = {1995}, 14521 publisher = {SIAM}, 14522 address = {Philadelphia} 14523} 14524 14525@Unpublished{ spai-web-page, 14526 title = {{SPAI} {W}eb {P}age}, 14527 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 14528 author = {Steven Bernard and Marcus Grote}, 14529 institution = {NASA Ames Research Center and ETH Zurich} 14530} 14531 14532@Article{ gh97, 14533 author = {M. J. Grote and T. Huckle}, 14534 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 14535 year = {1997}, 14536 journal = {SIAM J. of Scient. Comput.}, 14537 volume = {18}, 14538 pages = {838-853} 14539} 14540 14541@Article{ zhang96, 14542 author = {Wen Zhang}, 14543 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 14544 simulation of a sintering process}, 14545 year = {1996}, 14546 journal = {Appl. Numer. Math.}, 14547 volume = {20}, 14548 pages = {235-244} 14549} 14550 14551@Article{ zhang98, 14552 author = {Wen Zhang and Ian Gladwell}, 14553 title = {The sintering of two particles by surface and grain boundary diffusion - a 14554 three-dimensional numerical study}, 14555 journal = {Comp. Mater. Sci.}, 14556 year = {1998}, 14557 volume = {12} 14558} 14559 14560@InProceedings{ mollerschwartzbach01, 14561 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 14562 title = {The Pointer Assertion Logic Engine}, 14563 booktitle = {ACM Proceedings of PLDI'01}, 14564 year = {2001} 14565} 14566 14567@InProceedings{ klarlandschwartzbach97, 14568 author = {Nils Klarland and Michael I. Schwartzbach}, 14569 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 14570 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 14571 publisher = {USENIX}, 14572 month = oct, 14573 year = {1997}, 14574 address = {Santa Barbara, CA} 14575} 14576 14577@InProceedings{ conselmarlet98, 14578 author = {C. Consel and R. Marlet}, 14579 title = {Architecturing software using a methodology for language development}, 14580 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 14581 Implementations, Logics and Programs}, 14582 year = {1998}, 14583 pages = {170-174}, 14584 month = sep, 14585 address = {Pisa, Italy} 14586} 14587 14588@Misc{ sundials:homepage, 14589 author = {C. {Woodward et al.}}, 14590 title = {{SUNDIALS {W}eb page}}, 14591 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 14592} 14593 14594@article{gardner2022sundials, 14595 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 14596 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 14597 journal = {ACM Transactions on Mathematical Software (TOMS)}, 14598 publisher = {ACM}, 14599 year = {2022}, 14600 doi = {10.1145/3539801} 14601} 14602 14603@Misc{ sundials-user-ref, 14604 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14605 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 14606 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 14607 and Dan Shumaker and Carol Woodward}, 14608 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14609 number = {UCRL-JP-200037}, 14610 year = {2003} 14611} 14612 14613@Article{ sundials05, 14614 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 14615 and C. Woodward}, 14616 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14617 journal = {ACM Transactions on Mathematical Software}, 14618 volume = {31}, 14619 number = {3}, 14620 pages = {363--396}, 14621 year = {2005} 14622} 14623 14624@InProceedings{ serban2005cvodes, 14625 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 14626 author = {Serban, Radu and Hindmarsh, Alan C}, 14627 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 14628 Dynamics and Control, Long Beach, CA}, 14629 year = {2005} 14630} 14631 14632@Article{ pvode99, 14633 author = {G. Byrne and A. Hindmarsh}, 14634 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 14635 journal = {Int. J. High Perf. Comput. Apps.}, 14636 volume = {13}, 14637 number = {4}, 14638 year = {1999}, 14639 pages = {354 -- 365} 14640} 14641 14642@Article{ cvode95, 14643 author = {S. Cohen and A. Hindmarsh}, 14644 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 14645 journal = {Computers in Physics}, 14646 volume = {10}, 14647 number = {2}, 14648 year = {1996}, 14649 pages = {138 -- 143} 14650} 14651 14652@TechReport{ ifpack, 14653 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 14654 author = {Marzio Sala and Michael Heroux}, 14655 institution = {Sandia National Laboratories}, 14656 number = {SAND2005-0662}, 14657 year = {2005} 14658} 14659 14660@TechReport{ kinsol-user-ref, 14661 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 14662 Computers}, 14663 author = {Allan Taylor and Alan Hindmarsh}, 14664 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14665 number = {UCRL-ID-131185}, 14666 year = {1998} 14667} 14668 14669@Article{ fiardmanteuffelmccormick98, 14670 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 14671 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 14672 numerical results}, 14673 journal = {SIAM J. Sci. Comp.}, 14674 year = {1998}, 14675 volume = {19}, 14676 pages = {1958--1979} 14677} 14678 14679@InProceedings{ vuduc02, 14680 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 14681 Rajesh Nishtala and Benjamin Lee}, 14682 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 14683 booktitle = {Proceedings of Supercomputing}, 14684 year = {2002}, 14685 month = nov, 14686 address = {Baltimore} 14687} 14688 14689@Article{ beckerbraackrannacher1999, 14690 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 14691 elements}, 14692 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 14693 journal = {Combustion Theory and Modelling}, 14694 volume = {3}, 14695 pages = {503--534}, 14696 year = {1999} 14697} 14698 14699@Article{ beckerrannacher01, 14700 author = {R. Becker and R. Rannacher}, 14701 title = {An optimal control approach to a posteriori error estimation in finite element 14702 methods}, 14703 journal = {Acta Numerica}, 14704 year = {2001}, 14705 volume = {10}, 14706 pages = {1--102} 14707} 14708 14709@Article{ babuskamiller84a, 14710 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14711 title = {The post-processing approach in the finite element method, {I}: Calculations of 14712 displacements, stresses, and other higher derivatives of the displacements}, 14713 journal = {Int. J. Numer. Meth. Eng.}, 14714 year = {1984}, 14715 volume = {20}, 14716 pages = {1085--1109} 14717} 14718 14719@Article{ babuskamiller84b, 14720 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14721 title = {The post-processing approach in the finite element method, {II}: The calculation 14722 of stress intensity factors}, 14723 journal = {Int. J. Numer. Meth. Eng.}, 14724 year = {1984}, 14725 volume = {20}, 14726 pages = {1111--1129} 14727} 14728 14729@Article{ babuskamiller84c, 14730 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14731 title = {The post-processing approach in the finite element method, {III}: A posteriori 14732 error estimation and adaptive mesh refinement}, 14733 journal = {Int. J. Numer. Meth. Eng.}, 14734 year = {1984}, 14735 volume = {20}, 14736 pages = {2311--2324} 14737} 14738 14739@Unpublished{ jtb-web-page, 14740 title = {{The Java Tree Builder}}, 14741 note = {See \url{http://www.cs.purdue.edu/jtb}}, 14742 author = {Jens Palsberg}, 14743 institution = {Purdue University} 14744} 14745 14746@Unpublished{ palsberg98, 14747 title = {Why Visitors?}, 14748 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 14749 author = {Jens Palsberg}, 14750 institution = {Purdue University}, 14751 year = {1998} 14752} 14753 14754@Unpublished{ ply-web-page, 14755 title = {{PLY (Python Lex-Yacc)}}, 14756 note = {\url{http://systems.cs.chicago.edu/ply}}, 14757 author = {David Beazley}, 14758 institution = {University of Chicago} 14759} 14760 14761@Misc{ adic-web-page, 14762 title = {{ADIC Web page}}, 14763 note = {\url{http://www.mcs.anl.gov/autodiff}}, 14764 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 14765 institution = {Argonne National Laboratory} 14766} 14767 14768@Article{ naumann02, 14769 author = {Uwe Naumann}, 14770 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 14771 computational graph}, 14772 journal = {Mathematical Programming (to appear)}, 14773 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 14774 year = {2003} 14775} 14776 14777@Article{ kaper1, 14778 author = {H. G. Kaper and T. J. Kaper}, 14779 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 14780 journal = {Physica D}, 14781 year = {2002}, 14782 pages = {66--93}, 14783 volume = {165} 14784} 14785 14786@Misc{ veltisto-web-page, 14787 author = {George Biros}, 14788 title = {{Veltisto Web page}}, 14789 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 14790} 14791 14792@Article{ karypiskumar98, 14793 author = {George Karypis and Vipin Kumar}, 14794 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 14795 Ordering}, 14796 journal = {Journal of Parallel and Distributed Computing}, 14797 volume = {48}, 14798 pages = {71--85}, 14799 year = {1998} 14800} 14801 14802@TechReport{ karypiskumar97, 14803 author = {Karypis, George and Kumar, V.}, 14804 institution = {Department of Computer Science, University of Minnesota}, 14805 keywords = {graph partitioning; ParMetis}, 14806 note = {http://www.cs.umn.edu/~metis}, 14807 number = {97-060}, 14808 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 14809 year = {1997} 14810} 14811 14812@Misc{ parmetis-web-page, 14813 author = {George {Karypis et al.}}, 14814 title = {{ParMETIS Web page}}, 14815 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 14816 year = {2005} 14817} 14818 14819@Misc{ sparskit-web-page, 14820 author = {Yousef {Saad et al.}}, 14821 title = {{SPARSKIT Web page}}, 14822 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 14823} 14824 14825@Misc{ dscpack-web-page, 14826 author = {Padma Raghavan}, 14827 title = {{DSCPACK Web page}}, 14828 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 14829} 14830 14831@Misc{ gaussian-web-page, 14832 author = {}, 14833 title = {{Gaussian Web page}}, 14834 note = {\url{http://gaussian.com}}, 14835 key = {{Gaussian} {Web} page} 14836} 14837 14838@Book{ lapack-user-guide, 14839 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 14840 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 14841 Sorensen}, 14842 title = {LAPACK Users' Guide, Third Edition}, 14843 publisher = {SIAM}, 14844 year = {1999} 14845} 14846 14847@Manual{ nwchem4.1, 14848 author = {High Performance Computational Chemistry Group}, 14849 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 14850 year = {2002}, 14851 organization = {Pacific Northwest National Laboratory}, 14852 address = {Richland, Washington 99325-0999 USA}, 14853 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 14854} 14855 14856@TechReport{ tchem, 14857 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 14858 author = {Cosmin Safta and Habib Najm and Omar Knio}, 14859 institution = {Sandia National Laboratories}, 14860 number = {SAND2011-3282}, 14861 year = {2011} 14862} 14863 14864@Misc{ scidac-web-page, 14865 author = {}, 14866 title = {{{SciDAC Initiative Web page}}}, 14867 note = {\url{http://www.osti.gov/scidac}}, 14868 key = {{SciDAC Initiative Web page}} 14869} 14870 14871@Misc{ cmrs:homepage, 14872 author = {Amitava {Bhattacharjee (PI)}}, 14873 title = {{Center for Magnetic Reconnection Studies}}, 14874 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 14875} 14876 14877@Misc{ tops:homepage, 14878 author = {David {Keyes (PI)}}, 14879 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 14880 howpublished = {\url{http://scalablesolvers.org}} 14881} 14882 14883@Misc{ tstt:homepage, 14884 author = {David Brown and Jim Glimm and Lori Freitag}, 14885 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 14886 howpublished = {\url{http://www.tstt-scidac.org}}, 14887 year = {2005} 14888} 14889 14890@Misc{ petsc:applications, 14891 author = {B. F. {Smith et al.}}, 14892 title = {{Scientific Applications Using {PETSc}}}, 14893 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 14894} 14895 14896@Misc{ petsc:users, 14897 author = {B. F. {Smith et al.}}, 14898 title = {{PETSc User Statistics}}, 14899 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 14900} 14901 14902@Misc{ cemm:homepage, 14903 author = {Steve {Jardin (PI)}}, 14904 title = {{Center for Extended MHD Modeling}}, 14905 howpublished = {\url{http://w3.pppl.gov/CEMM}} 14906} 14907 14908@Misc{ m3d:homepage, 14909 author = {Steve {Jardin et al.}}, 14910 title = {{M3D Web page}}, 14911 howpublished = {\url{http://w3.pppl.gov/m3d}} 14912} 14913 14914@Misc{ nimrod:homepage, 14915 author = {Carl R. {Sovinec et al.}}, 14916 title = {{NIMROD Web page}}, 14917 howpublished = {http://nimrodteam.org} 14918} 14919 14920@Misc{ grace-web-page, 14921 author = {Manish {Parashar et al.}}, 14922 title = {{GrACE Web Page}}, 14923 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 14924} 14925 14926@Misc{ accel1, 14927 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 14928 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 14929 author = {K. Ko and R. Ryne (PIs)} 14930} 14931 14932@Unpublished{ katzspiegelman03, 14933 author = {Richard F. Katz and Marc Spiegelman}, 14934 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 14935 advection-diffusion problems}, 14936 note = {Columbia University, in preparation} 14937} 14938 14939@Misc{ acts:homepage, 14940 author = {}, 14941 title = {{Advanced CompuTational Software (ACTS) Web page}}, 14942 howpublished = {\url{http://acts.nersc.gov}}, 14943 key = {{Advanced CompuTational Software (ACTS) Web page}} 14944} 14945 14946@Article{ superlu99, 14947 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 14948 Joseph W. H. Liu}, 14949 title = {A supernodal approach to sparse partial pivoting}, 14950 journal = {SIAM J. Matrix Analysis and Applications}, 14951 year = {1999}, 14952 volume = {20}, 14953 number = {3}, 14954 pages = {720-755} 14955} 14956 14957@Misc{ superlu:homepage, 14958 author = {J. Demmel and J. Gilbert and X. Li}, 14959 title = {{SuperLU Web page}}, 14960 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 14961} 14962 14963@InProceedings{ ccf98, 14964 author = {E. Chow and A. Cleary and R. Falgout}, 14965 title = {Design of the hypre Preconditioner Library}, 14966 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14967 Scientific and Engineering Computing}, 14968 publisher = {SIAM}, 14969 year = {1999} 14970} 14971 14972@TechReport{ hypre-users-manual, 14973 author = {R. Falgout}, 14974 title = {{hypre} Users Manual}, 14975 number = {Revision 2.28}, 14976 institution = {Lawrence Livermore National Laboratory}, 14977 year = {2023}, 14978 url = {https://hypre.readthedocs.io/} 14979} 14980 14981@Misc{ hypre:homepage, 14982 author = {R. Falgout}, 14983 title = {{hypre Web page}}, 14984 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 14985} 14986 14987@InProceedings{ trilinos:gpu, 14988 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 14989 title = {A Light-weight API for Portable Multicore Programming}, 14990 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 14991 Network-Based Processing (PDP)}, 14992 pages = {601--606}, 14993 publisher = {IEEE}, 14994 year = {2010} 14995} 14996 14997@InProceedings{ heroux2004design, 14998 title = {The design of {T}rilinos}, 14999 author = {Heroux, Michael A and Sala, Marzio}, 15000 booktitle = {International Workshop on Applied Parallel Computing}, 15001 pages = {620--628}, 15002 year = {2004}, 15003 organization = {Springer} 15004} 15005 15006@Misc{ trilinos:homepage, 15007 author = {M. {Heroux et al.}}, 15008 title = {{Trilinos Web page}}, 15009 howpublished = {{\tt http://trilinos.sandia.gov/}} 15010} 15011 15012@Article{ trilinos:overview, 15013 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 15014 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 15015 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 15016 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 15017 Kendall S. Stanley}, 15018 title = {An overview of the {T}rilinos project}, 15019 journal = {ACM Transactions on Mathematical Software}, 15020 volume = {31}, 15021 number = {3}, 15022 year = {2005}, 15023 issn = {0098-3500}, 15024 pages = {397--423}, 15025 publisher = {ACM Press}, 15026 doi = {10.1145/1089014.1089021} 15027} 15028 15029@Misc{ rythmos:homepage, 15030 author = {T. Coffey and R. Bartlett}, 15031 title = {Rythmos: Transient Integration of Differential Equations}, 15032 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 15033} 15034 15035@Misc{ triangle:homepage, 15036 author = {J. {Shewchuk}}, 15037 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 15038 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 15039 year = {2005} 15040} 15041 15042@Misc{ tetgen:homepage, 15043 author = {Hang {Si}}, 15044 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 15045 Triangulator}}, 15046 howpublished = {\url{http://tetgen.berlios.de}}, 15047 year = {2005} 15048} 15049 15050@Misc{ opencascade:homepage, 15051 author = {{OpenCASCADE SAS}}, 15052 title = {{Open CASCADE Technology (OCCT)}}, 15053 howpublished = {\url{https://dev.opencascade.org/}}, 15054 year = {2024} 15055} 15056 15057@Misc{ eigen:homepage, 15058 author = {Benoit Jacob and Ga\"el Guennebaud}, 15059 title = {{Eigen} {W}eb page}, 15060 key = {Jacob}, 15061 url = {http://eigen.tuxfamily.org/}, 15062 howpublished = {\url{http://eigen.tuxfamily.org/}}, 15063 year = {2015} 15064} 15065 15066@Misc{ dune:homepage, 15067 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 15068 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 15069 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 15070 Oliver Sander}, 15071 title = {{DUNE} {W}eb page}, 15072 key = {Bastian}, 15073 url = {http://www.dune-project.org/}, 15074 howpublished = {\url{http://www.dune-project.org/}}, 15075 year = {2015} 15076} 15077 15078@Misc{ thrust, 15079 author = {N. Bell and J. Hoberock}, 15080 title = {The {T}hrust Library}, 15081 howpublished = {{\tt http://code.google.com/p/thrust/}}, 15082 year = {2010} 15083} 15084 15085@Misc{ cusp, 15086 author = {N. Bell and M. Garland}, 15087 title = {The {C}usp Library}, 15088 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 15089 year = {2010} 15090} 15091 15092@Misc{ cig:homepage, 15093 author = {M. {Gurnis et al.}}, 15094 title = {{Computational Infrastructure for Geodynamics}}, 15095 howpublished = {\url{http://www.geodynamics.org}} 15096} 15097 15098@Article{ maltsevselkov00, 15099 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 15100 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 15101 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 15102 metabolic reconstruction}, 15103 journal = {Nucleic Acids Res.}, 15104 year = {2000}, 15105 month = jan, 15106 pages = {123-125}, 15107 volume = {28}, 15108 number = {1} 15109} 15110 15111@Article{ more:coloring, 15112 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 15113 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 15114 journal = {SIAM Journal on Numerical Analysis}, 15115 year = {1983}, 15116 month = feb, 15117 pages = {187--209}, 15118 volume = {20}, 15119 number = {1} 15120} 15121 15122@Article{ selkovmaltsev97, 15123 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 15124 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 15125 data}, 15126 journal = {Gene}, 15127 year = {1997}, 15128 pages = {GC11-GC26}, 15129 volume = {197}, 15130 number = {1-2} 15131} 15132 15133@Unpublished{ rocketcenter, 15134 title = {Center for Simulation of Advanced Rockets}, 15135 note = {http://www.csar.uiuc.edu}, 15136 institution = {University of Illinois at Urbana-Champaign} 15137} 15138 15139@Article{ kirby03, 15140 title = {A posteriori error estimates for the mixed hybrid finite element method}, 15141 author = {Robert C Kirby}, 15142 journal = {Computational Geosciences}, 15143 volume = {7}, 15144 pages = {197--214}, 15145 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 15146 year = {2003} 15147} 15148 15149@Article{ kirby2003b, 15150 title = {On the convergence of high resolution methods with multiple time scales for 15151 hyperbolic conservation laws}, 15152 author = {Robert C Kirby}, 15153 journal = {Mathematics of computation}, 15154 volume = {72}, 15155 number = {243}, 15156 pages = {1239--1250}, 15157 year = {2003} 15158} 15159 15160@Article{ dawsonkirby2001, 15161 title = {High resolution schemes for conservation laws with locally varying time steps}, 15162 author = {Clint Dawson and Robert C Kirby}, 15163 journal = {SIAM Journal on Scientific Computing}, 15164 volume = {22}, 15165 number = {6}, 15166 pages = {2256--2281}, 15167 year = {2001}, 15168 publisher = {SIAM} 15169} 15170 15171@Article{ dawsonkirby1999, 15172 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 15173 a dynamically changing mesh}, 15174 author = {Clint Dawson and Robert C Kirby}, 15175 journal = {SIAM Journal on Numerical Analysis}, 15176 volume = {37}, 15177 number = {2}, 15178 pages = {423--442}, 15179 year = {1999}, 15180 publisher = {SIAM} 15181} 15182 15183@Article{ barthlarson00, 15184 author = {T. J. Barth and M. G. Larson}, 15185 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 15186 Hyperbolic Systems}, 15187 journal = {LNCS}, 15188 year = {2000}, 15189 volume = {11}, 15190 publisher = {Spinger-Verlag} 15191} 15192 15193@Article{ xu1, 15194 author = {J. Xu}, 15195 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 15196 journal = {SIAM Review}, 15197 volume = {34}, 15198 pages = {581--613}, 15199 year = {1992} 15200} 15201 15202@Article{ brandt77, 15203 author = {Achi Brandt}, 15204 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 15205 journal = {Mathematics of Computation}, 15206 month = apr, 15207 year = {1977}, 15208 pages = {333--390}, 15209 volume = {31}, 15210 number = {138}, 15211 doi = {10.2307/2006422} 15212} 15213 15214@Article{ brandt1979multigrid, 15215 title = {{Multigrid solutions to elliptic flow problems}}, 15216 author = {Brandt, A. and Dinar, N.}, 15217 journal = {Numerical Methods for Partial Differential Equations}, 15218 pages = {53--147}, 15219 year = {1979} 15220} 15221 15222@InCollection{ brandt1979singular, 15223 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 15224 author = {Achi Brandt}, 15225 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 15226 editor = {Hemker, Pieter W. and Miller, John J.H.}, 15227 pages = {53--142}, 15228 year = {1979}, 15229 publisher = {Academic Press} 15230} 15231 15232@Article{ amge1, 15233 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 15234 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 15235 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 15236 journal = {SIAM J. Scientific Computing}, 15237 volume = {22}, 15238 pages = {1570--1592}, 15239 year = {2000} 15240} 15241 15242@Book{ bramble1, 15243 author = {J. H. Bramble}, 15244 title = {Multigrid Methods}, 15245 publisher = {Longman Scientific and Technical}, 15246 address = {Essex, England}, 15247 year = {1993} 15248} 15249 15250@Book{ arpack98, 15251 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 15252 title = {ARPACK, Users' Guide}, 15253 publisher = {SIAM}, 15254 year = {1998} 15255} 15256 15257@Article{ bbder96, 15258 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 15259 title = {Algorithmic bombardment for the iterative solution of linear systems: A 15260 polyIterative approach}, 15261 journal = {J. of Computational and Applied Mathematics}, 15262 year = {1996}, 15263 volume = {74}, 15264 pages = {91--110} 15265} 15266 15267@Article{ egks94, 15268 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 15269 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 15270 journal = {SIAM J. Scientific Computing}, 15271 year = {1994}, 15272 volume = {15}, 15273 number = {3}, 15274 pages = {681--703} 15275} 15276 15277@Article{ dftb02, 15278 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 15279 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 15280 diamond grain boundaries,}, 15281 journal = {Phys. Rev}, 15282 year = {2002}, 15283 volume = {B65}, 15284 pages = {045403} 15285} 15286 15287@InBook{ lsa, 15288 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 15289 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 15290 title = {The linear system analyzer}, 15291 series = {enabling technologies for computational science}, 15292 year = {2002}, 15293 publisher = {Kluwer}, 15294 location = {Dordrecht} 15295} 15296 15297@Article{ kk97, 15298 author = {Carl T. Kelley and David E. Keyes}, 15299 title = {Convergence analysis of pseudo-transient continuation}, 15300 journal = {SIAM J. Numerical Analysis}, 15301 year = {1998}, 15302 volume = {35}, 15303 pages = {508--523} 15304} 15305 15306@Article{ swtm01, 15307 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 15308 journal = {Journal of Computational Physics}, 15309 year = {2001}, 15310 volume = {172}, 15311 number = {2}, 15312 pages = {472--514}, 15313 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 15314 Method} 15315} 15316 15317@TechReport{ zhou03, 15318 author = {Y. Zhou}, 15319 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 15320 IIGD, RQI and Newton} Updates}, 15321 institution = {Argonne National Laboratory}, 15322 number = {ANL/MCS-P1074-0803}, 15323 note = {Submitted to Numerical Linear Algebra with Applications}, 15324 year = {2003} 15325} 15326 15327@Unpublished{ mtwm03, 15328 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 15329 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 15330 Detailed analysis of one-dimensional applications}, 15331 note = {to appear in the Journal of Chemical Physics}, 15332 year = {2003} 15333} 15334 15335@Article{ singhjosephheslaglowinskipan00, 15336 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 15337 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 15338 particulate flows}, 15339 journal = {J. Non-Newtonian Fluid Mech.}, 15340 volume = {91}, 15341 pages = {165--188}, 15342 year = {2000} 15343} 15344 15345@Book{ joseph02, 15346 author = {Daniel D. Joseph}, 15347 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 15348 publisher = {Springer-Verlag}, 15349 month = mar, 15350 year = {2002}, 15351 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 15352} 15353 15354@Misc{ triangle-web-page, 15355 author = {Jonathan R. Shewchuk}, 15356 title = {{Triangle Web} page}, 15357 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 15358} 15359 15360@InCollection{ shewchuk96, 15361 author = {Jonathan R. Shewchuk}, 15362 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 15363 Triangulator}, 15364 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 15365 editor = {Ming C. Lin and Dinesh Manocha}, 15366 series = {Lecture Notes in Computer Science}, 15367 volume = {1148}, 15368 publisher = {Springer-Verlag}, 15369 pages = {203--222}, 15370 month = may, 15371 year = {1996}, 15372 note = {From the First ACM Workshop on Applied Computational Geometry} 15373} 15374 15375@Article{ leaf1, 15376 author = {Transient Dynamics of Pinning of Domain Walls}, 15377 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 15378 journal = {J. Magnetism and Magnetic Materials}, 15379 volume = {241}, 15380 pages = {118--123}, 15381 year = {2002} 15382} 15383 15384@Article{ leaf2, 15385 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 15386 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 15387 Superconductivity}, 15388 journal = {SIAM J. Sci. Comp.}, 15389 volume = {23}, 15390 pages = {1944--1959}, 15391 year = {2002} 15392} 15393 15394@Article{ leaf3, 15395 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 15396 title = {Hysteresis in Layered Spring Magnets}, 15397 journal = { Discreet and Continuous Dynamical Systems, Series B}, 15398 volume = {1}, 15399 pages = {219--232}, 15400 year = {2001} 15401} 15402 15403@Article{ leaf4, 15404 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 15405 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 15406 journal = {J. Phys. D Appl. Phys.}, 15407 volume = {35}, 15408 pages = {2339--2343}, 15409 year = {2002} 15410} 15411 15412@Article{ leaf5, 15413 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 15414 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 15415 journal = {Submitted to Phys. Rev. B.}, 15416 note = {Submitted}, 15417 year = {2003} 15418} 15419 15420@Article{ graysumpternoidbarnes01, 15421 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 15422 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 15423 Nanospheres}, 15424 journal = {Chem. Phys. Lett.}, 15425 volume = {333}, 15426 pages = {308--313}, 15427 year = {2001} 15428} 15429 15430@InProceedings{ petsc-efficient, 15431 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 15432 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 15433 Libraries}, 15434 booktitle = {Modern Software Tools in Scientific Computing}, 15435 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 15436 publisher = {Birkh{\"{a}}user Press}, 15437 pages = {163--202}, 15438 year = {1997} 15439} 15440 15441@Article{ mumps01, 15442 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 15443 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 15444 journal = {SIAM Journal on Matrix Analysis and Applications}, 15445 volume = {23}, 15446 number = {1}, 15447 pages = {15--41}, 15448 year = {2001} 15449} 15450 15451@Article{ mumps19, 15452 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 15453 Multicore Architectures}}, 15454 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 15455 journal = {ACM Transactions on Mathematical Software}, 15456 volume = {45}, 15457 issue = {1}, 15458 pages = {2:1--2:26}, 15459 year = {2019} 15460} 15461 15462@Article{ zoltan06, 15463 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 15464 \c{C}ataly\"urek and Robert H. Bisseling}, 15465 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 15466 journal = {SIAM Parallel Processing for Scientific Computing}, 15467 month = feb, 15468 year = {2006} 15469} 15470 15471@Article{ lidemmel03, 15472 author = {Xiaoye S. Li and James W. Demmel}, 15473 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 15474 unsymmetric linear systems}, 15475 journal = {ACM Transactions on Mathematical Software}, 15476 year = {2003}, 15477 month = jun, 15478 volume = {29}, 15479 number = {2}, 15480 pages = {110--140} 15481} 15482 15483@TechReport{ superlu, 15484 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 15485 title = {{SuperLU} Users' Guide}, 15486 number = {LBNL-44289}, 15487 institution = {Lawrence Berkeley National Laboratory}, 15488 year = {2003}, 15489 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 15490} 15491 15492@TechReport{ trilinos-overview03, 15493 title = {{An Overview of {T}rilinos}}, 15494 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 15495 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 15496 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 15497 Willenbring and Alan Williams}, 15498 institution = {Sandia National Laboratories}, 15499 number = {SAND2003-2927}, 15500 year = {2003} 15501} 15502 15503@TechReport{ trilinos-users-guide, 15504 title = {{Trilinos} Users Guide}, 15505 author = {Michael A. Heroux and James M. Willenbring}, 15506 institution = {Sandia National Laboratories}, 15507 number = {SAND2003-2952}, 15508 url = {http://trilinos.sandia.gov/}, 15509 year = {2003} 15510} 15511 15512@Article{ pilut01, 15513 author = {David Hysom and Alex Pothen}, 15514 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 15515 journal = {SIAM Journal on Scientific Computing}, 15516 volume = {22}, 15517 pages = {2194--2215}, 15518 year = {2001} 15519} 15520 15521@TechReport{ boomeramg00, 15522 author = {V.~E. Henson and U.~M. Yang}, 15523 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 15524 institution = {Lawrence Livermore National Laboratory}, 15525 number = {UCRL-JC-133948}, 15526 year = {2000} 15527} 15528 15529@InCollection{ baker2012scaling, 15530 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 15531 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 15532 and Schulz, Martin and Yang, Ulrike Meier}, 15533 booktitle = {Competence in High Performance Computing 2010}, 15534 pages = {215--226}, 15535 year = {2012}, 15536 publisher = {Springer} 15537} 15538 15539@Article{ knollkeyes:04, 15540 author = {D. A. Knoll and D. E. Keyes}, 15541 year = {2004}, 15542 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 15543 journal = {J. Comp. Phys.}, 15544 volume = {193}, 15545 pages = {357-397} 15546} 15547 15548@Article{ chacon02, 15549 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 15550 title = {An implicit nonlinear reduced resistive {MHD} solver}, 15551 journal = {J. Comput. Phys}, 15552 volume = {188}, 15553 year = {2002}, 15554 pages = {15--36} 15555} 15556 15557@Article{ mousseau03, 15558 author = {V. A. Mousseau and D. A. Knoll}, 15559 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 15560 Radiation Diffusion}, 15561 journal = {J. Comput. Physics}, 15562 year = {2003} 15563} 15564 15565@Article{ mousseau00, 15566 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 15567 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 15568 Radiation Diffusion}, 15569 journal = {J. Comput. Physics}, 15570 year = {2000}, 15571 pages = {743--765}, 15572 volume = {160} 15573} 15574 15575@Unpublished{ facets:homepage, 15576 author = {John {Cary (PI)}}, 15577 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 15578 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 15579} 15580 15581@Unpublished{ cpes:homepage, 15582 author = {{C.S.} {Chang (PI)}}, 15583 title = {{Center for Plasma Edge Simulation (CPES)}}, 15584 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 15585} 15586 15587@Misc{ epsi:homepage, 15588 author = {{C.S.} {Chang (PI)}}, 15589 title = {{Center for Edge Physics Simulation (EPSI)}}, 15590 note = {\url{http://epsi.pppl.gov}} 15591} 15592 15593@Unpublished{ groundwater-scidac2:web, 15594 author = {Peter {Lichtner (PI)}}, 15595 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15596 Advanced Computing}, 15597 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 15598} 15599 15600@Misc{ pflotran:web, 15601 author = {Peter {Lichtner (PI)}}, 15602 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15603 Advanced Computing}}, 15604 note = {\url{http://ees.lanl.gov/pflotran/}} 15605} 15606 15607@Misc{ accel-scidac2-solicitation, 15608 author = {{DOE Office of Science}}, 15609 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 15610 year = {2006}, 15611 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 15612} 15613 15614@Article{ nieter04, 15615 author = {C. Nieter and J. R. Cary}, 15616 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 15617 journal = {J. Comp. Phys.}, 15618 year = {2004}, 15619 volume = {196}, 15620 pages = {448} 15621} 15622 15623@Article{ synergia06, 15624 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 15625 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 15626 journal = {J. Comp. Phys.}, 15627 year = {2006}, 15628 volume = {211}, 15629 pages = {229-248} 15630} 15631 15632@Unpublished{ stoltz07, 15633 author = {P. H. Stoltz}, 15634 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 15635 year = {2007}, 15636 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 15637 Albuquerque, NM, 2007} 15638} 15639 15640@Misc{ iter:homepage, 15641 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15642 year = {2007}, 15643 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15644 howpublished = {\url{http://www.iter.org}} 15645} 15646 15647@Misc{ epp2010, 15648 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 15649 Council}}, 15650 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 15651 Particle Physics}, 15652 year = {2006}, 15653 howpublished = {The National Academies Press, ISBN: 0309101948} 15654} 15655 15656@Misc{ post-fsp-report, 15657 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 15658 and P.~Colella and S.~C.~Jardin}, 15659 title = {{Report of Fusion Simulation Project Steering Committee}}, 15660 month = aug, 15661 year = {2004}, 15662 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 15663} 15664 15665@Misc{ fsp:workshop2011, 15666 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15667 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15668 month = feb, 15669 year = {2011}, 15670 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 15671} 15672 15673@Book{ hazeltine-meiss-book, 15674 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 15675 title = {Plasma Confinement}, 15676 year = {1991}, 15677 publisher = {Addison-Wesley, Redwood City, CA} 15678} 15679 15680@Article{ falgout05a, 15681 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15682 title = {Conceptual Interfaces in hypre}, 15683 journal = {Future Generation Computer Systems}, 15684 note = {Special issue on PDE software}, 15685 volume = {22}, 15686 year = {2005}, 15687 pages = {239--251} 15688} 15689 15690@Article{ falgout05b, 15691 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15692 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 15693 journal = {ACM Trans. Math. Softw.}, 15694 volume = {31}, 15695 year = {2005}, 15696 pages = {326--350} 15697} 15698 15699@Unpublished{ compass:homepage, 15700 author = {Panagiotis {Spentzouris (PI)}}, 15701 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 15702 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 15703} 15704 15705@Unpublished{ cmsnf:homepage, 15706 author = {{Todd Allen, Director}}, 15707 title = {{Center for Materials Science of Nuclear Fuel}}, 15708 note = {Energy Frontier Research Center, see 15709 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 15710} 15711 15712@Unpublished{ dvi-materials:project, 15713 author = {{L.~C.} {McInnes (PI)}}, 15714 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 15715 note = {{SciDAC}-e project}, 15716 year = {2011} 15717} 15718 15719@Misc{ scidac:homepage, 15720 author = {{DOE Office of Science}}, 15721 title = {{Scientific Discovery through Advanced Computing}}, 15722 year = {2007}, 15723 howpublished = {\url{http://www.scidac.gov}} 15724} 15725 15726@Misc{ corba, 15727 author = {{Object Management Group}}, 15728 year = {2007}, 15729 title = {{Common Object Request Broker Architecture (CORBA)}}, 15730 howpublished = {\url{http://www.corba.org}} 15731} 15732 15733@Article{ uedge, 15734 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 15735 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 15736 Divertor Tokamak}, 15737 journal = {J. Plasma Physics}, 15738 year = {1999}, 15739 volume = {6}, 15740 pages = {1851}, 15741 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 15742} 15743 15744@Article{ bout, 15745 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 15746 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 15747 journal = {J. Plasma Physics}, 15748 year = {2000}, 15749 volume = {7}, 15750 pages = {1951}, 15751 note = {} 15752} 15753 15754@Article{ bout++, 15755 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 15756 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 15757 journal = {Computer Physics Communications}, 15758 year = {2009}, 15759 volume = {180}, 15760 issue = {9}, 15761 pages = {1467 -- 1480}, 15762 note = {} 15763} 15764 15765@Article{ tempest, 15766 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 15767 and G. Kerbel and W.M. Nevins and T. Rognlien}, 15768 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 15769 journal = {Bull. Am. Phys. Soc. }, 15770 year = {2005}, 15771 volume = {50}, 15772 number = {86}, 15773 pages = {CP1}, 15774 note = {} 15775} 15776 15777@Article{ ccahpc, 15778 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 15779 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 15780 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 15781 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 15782 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 15783 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 15784 and Theresa L. Windus and Shujia Zhou}, 15785 title = {A Component Architecture for High-Performance Scientific Computing}, 15786 journal = {Intl. J. High-Perf. Computing Appl.}, 15787 volume = {20}, 15788 pages = {163--202}, 15789 year = {2006}, 15790 note = {ACTS Collection special issue} 15791} 15792 15793@Misc{ cca-forum:homepage, 15794 author = {{Common Component Architecture Forum}}, 15795 note = {\url{http://www.cca-forum.org}}, 15796 year = {2010} 15797} 15798 15799@Misc{ petsc:driven-cavity-example, 15800 title = {{PETSc Driven Cavity Example Code}}, 15801 author = {B. F. {Smith et al.}}, 15802 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 15803} 15804 15805@Misc{ petsc-dm:webpage, 15806 author = {B. F. {Smith et al.}}, 15807 title = {{PETSc DM Webpage}}, 15808 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 15809 year = {2018} 15810} 15811 15812@Misc{ unic-ref, 15813 author = {Giuseppe Palmiotti}, 15814 title = {{UNIC} Neutronics Software}, 15815 note = {Nuclear Engineering Division, Argonne National Laboratory} 15816} 15817 15818% ----------------------------------------------------------------------- 15819% Model coupling refs 15820@Book{ greve-blatter, 15821 author = {Ralf Greve and Heinz Blatter}, 15822 title = {Dynamics of Ice Sheets and Glaciers}, 15823 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 15824 publisher = {Springer}, 15825 year = {2009} 15826} 15827 15828@Misc{ doe-isicles, 15829 key = {ISICLES}, 15830 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 15831 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 15832} 15833 15834@Article{ safta2011tchem, 15835 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 15836 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 15837 journal = {Sandia Report, SAND2011-3282}, 15838 year = {2011} 15839} 15840 15841@Misc{ chemkin-website, 15842 key = {chemkin}, 15843 title = {ANSYS Chemkin-Pro Website}, 15844 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 15845 year = {2017} 15846} 15847 15848@Misc{ mct-website, 15849 key = {MCT}, 15850 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 15851 howpublished = {\url{http://www.mcs.anl.gov/mct}} 15852} 15853 15854@Article{ larson:05, 15855 author = {Jay Larson and Robert Jacob and Everest Ong}, 15856 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 15857 Multi-Physics Parallel Coupled Models}, 15858 journal = {Int. J. High Perf. Comp. App.}, 15859 year = {2005}, 15860 pages = {277--292} 15861} 15862 15863@Article{ dennis2012computational, 15864 title = {Computational performance of ultra-high-resolution capability in the Community 15865 Earth System Model}, 15866 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 15867 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 15868 journal = {International Journal of High Performance Computing Applications}, 15869 volume = {26}, 15870 number = {1}, 15871 pages = {5--16}, 15872 year = {2012}, 15873 publisher = {SAGE Publications} 15874} 15875 15876@InProceedings{ bettge01, 15877 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 15878 year = {2001}, 15879 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 15880 Backroads}, 15881 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15882 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15883 pages = {148 -- 156}, 15884 series = {Lecture Notes in Computer Science}, 15885 volume = {2073}, 15886 publisher = {Springer-Verlag} 15887} 15888 15889@InProceedings{ jacob01, 15890 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 15891 year = {2001}, 15892 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 15893 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15894 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15895 series = {Lecture Notes in Computer Science}, 15896 volume = {2073}, 15897 publisher = {Springer-Verlag} 15898} 15899 15900@Article{ chen2008new, 15901 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 15902 design}, 15903 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 15904 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 15905 journal = {Chinese Science Bulletin}, 15906 volume = {53}, 15907 number = {22}, 15908 pages = {3433--3445}, 15909 year = {2008}, 15910 publisher = {Springer} 15911} 15912 15913@InProceedings{ baum01, 15914 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 15915 and C. Charman}, 15916 year = {2001}, 15917 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 15918 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15919 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15920 series = {Lecture Notes in Computer Science}, 15921 volume = {2073}, 15922 publisher = {Springer-Verlag} 15923} 15924 15925@InProceedings{ lefantzi03, 15926 author = {S. Lefantzi and J. Ray}, 15927 year = {2003}, 15928 title = {A Component-based Scientific Toolkit for Reacting Flows}, 15929 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 15930 volume = {2}, 15931 publisher = {Elsevier} 15932} 15933 15934@Article{ boville98, 15935 author = {B. A. Boville and P. R. Gent}, 15936 title = {The {NCAR} Climate System Model, Version One}, 15937 journal = {Journal of Climate}, 15938 volume = {11}, 15939 year = {1998}, 15940 pages = {1115--1130} 15941} 15942 15943@Misc{ paraschivoiu99, 15944 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 15945 title = {Multi-domain multi-model formulation for compressible flows: Conservative 15946 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 15947 note = {AIAA Paper 99-0784}, 15948 year = {1999} 15949} 15950 15951@Article{ peszynska, 15952 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 15953 title = {Mortar upscaling for multiphysics flow in porous media}, 15954 journal = {Computational Geosciences} 15955} 15956 15957@TechReport{ wheeler00, 15958 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 15959 title = {A distributed computing portal for coupling multi-physics and multiple domains in 15960 porous media}, 15961 institution = {University of Texas at Austin}, 15962 number = {TICAM 00-03}, 15963 year = {2000} 15964} 15965 15966@TechReport{ peszynska00, 15967 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 15968 title = {Multiphysics Coupling of Codes}, 15969 institution = {University of Texas at Austin}, 15970 number = {TICAM 00-02}, 15971 year = {2000} 15972} 15973 15974@Article{ joshaghanijoodatnakshatrala2019, 15975 title = {A stabilized mixed discontinuous Galerkin formulation for double 15976 porosity/permeability model}, 15977 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 15978 journal = {Computer Methods in Applied Mechanics and Engineering}, 15979 volume = {352}, 15980 pages = {508--560}, 15981 year = {2019} 15982} 15983 15984@InProceedings{ cai99, 15985 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 15986 title = {An explicit multi-model compressible flow formulation based on the full potential 15987 equation and the {Euler} equations on {3D} unstructured meshes}, 15988 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 15989 Methods}, 15990 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 15991 year = {1999} 15992} 15993 15994@Article{ he05, 15995 author = {Yun He and Chris H. Q. Ding}, 15996 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 15997 Architectures}, 15998 year = {2005}, 15999 volume = {19}, 16000 pages = {329--240}, 16001 number = {3}, 16002 journal = {Int. Journal of High Performance Computing Applications} 16003} 16004 16005@InProceedings{ uiuc-rocket-center02, 16006 author = {W. A. Dick and M. T. Heath}, 16007 title = {Whole System Simulation of Solid Propellant Rockets}, 16008 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 16009 month = jul, 16010 year = {2002} 16011} 16012 16013@InProceedings{ toth04, 16014 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 16015 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 16016 Oehmke}, 16017 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 16018 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 16019 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 16020 Sun-Earth Connection}, 16021 year = {2004}, 16022 publisher = {Elsevier}, 16023 pages = {383--397} 16024} 16025 16026@Misc{ csdrm:web, 16027 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 16028 Shepherd}, 16029 title = {{Center for Simulation of Dynamic Response of Materials}}, 16030 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 16031} 16032 16033@Misc{ csar:web, 16034 author = {M. {Heath (Director)}}, 16035 title = {{Center for Simulation of Advanced Rockets}}, 16036 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 16037} 16038 16039@Misc{ csafe:web, 16040 author = {D. {Pershing (Director)}}, 16041 title = {{Center for Simulation of Accidental Fires and Explosions}}, 16042 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 16043} 16044 16045@Misc{ cits:web, 16046 author = {P. {Moin (Director)}}, 16047 title = {{Center for Integrated Turbulence Simulations}}, 16048 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 16049} 16050 16051@Misc{ flash:web, 16052 author = {D. {Lamb (Director)}}, 16053 title = {{Center for Integrated Turbulence Simulations}}, 16054 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 16055} 16056 16057@TechReport{ utah-csafe03, 16058 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 16059 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 16060 Problems, Part 1: Algorithm Development}, 16061 institution = {University of Utah, Center for the Simulation of Accidental Fires and 16062 Explosions}, 16063 year = {2003} 16064} 16065 16066@InBook{ shepherd07, 16067 author = {M. Shepherd and E. Seol and B. FrantzDale}, 16068 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 16069 year = {2007}, 16070 booktitle = {CRC Handbook of Dynamic System Modeling}, 16071 publisher = {Wiley}, 16072 pages = {1--41}, 16073 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 16074} 16075 16076@InProceedings{ cactus02, 16077 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 16078 Radke and Edward Seidel and John Shalf}, 16079 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 16080 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 16081 year = {2002}, 16082 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 16083} 16084 16085@Misc{ cactus:homepage, 16086 author = {G. {Allen et al.}}, 16087 title = {{Cactus Web page}}, 16088 howpublished = {\url{http://cactuscode.org}} 16089} 16090 16091@Misc{ open-grid-forum:web, 16092 key = {{Open Grid Forum}}, 16093 title = {{Open Grid Forum}}, 16094 note = {See \url{http://www.ogf.org}} 16095} 16096 16097@Misc{ nox:web, 16098 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 16099 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 16100 note = {See \url{http://software.sandia.gov/nox}} 16101} 16102 16103@Misc{ chombo:web, 16104 author = {P. {Colella (PI)}}, 16105 title = {{Chombo}}, 16106 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 16107} 16108 16109@Article{ lanzkron96, 16110 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 16111 title = {An Analysis of Approximate Nonlinear Elimination}, 16112 journal = {SIAM J. Sci. Comput.}, 16113 volume = {17}, 16114 year = {1996}, 16115 pages = {538--559} 16116} 16117 16118@Article{ jiang95, 16119 author = {J. Jiang and P. Forsyth}, 16120 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 16121 Equations}, 16122 journal = {Computers and Fluids}, 16123 volume = {24}, 16124 pages = {753--770}, 16125 year = {1995} 16126} 16127 16128@Article{ young90, 16129 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 16130 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 16131 journal = {Int. J. Numer. Methods Fluids}, 16132 volume = {11}, 16133 pages = {1075--1095}, 16134 year = {1990} 16135} 16136 16137@Article{ fishwick04, 16138 author = {Paul A. Fishwick}, 16139 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 16140 to Interrelating Model Structures}, 16141 journal = {SCS Trans. on Simulation}, 16142 note = {Special Issue in Grand Challenges in Computer Simulation}, 16143 year = {2004} 16144} 16145 16146@Article{ fishwick03, 16147 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 16148 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 16149 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 16150 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 16151 year = {2003} 16152} 16153 16154@InProceedings{ kirner00, 16155 author = {T. G. Kirner and V. F. Martins}, 16156 title = {Development of an Information Visualization Tool Using Virtual Reality}, 16157 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 16158 year = {2000}, 16159 pages = {604--606} 16160} 16161 16162@InProceedings{ orso03, 16163 author = {A. Orso and J. Jones and M. J. Harrold}, 16164 title = {Visualization of Program-Execution Data for Deployed Software}, 16165 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 16166 year = {2003}, 16167 pages = {67--76} 16168} 16169 16170@Book{ tiller01, 16171 author = {M. Tiller}, 16172 title = {Introduction to Physical System Modeling with Modelica}, 16173 series = {Kluwer International Series inEngineering and Computer Science}, 16174 volume = {615}, 16175 publisher = {Kluwer}, 16176 year = {2001} 16177} 16178 16179@Article{ buck94, 16180 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 16181 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 16182 journal = {Int. Journal of Computer Simulation}, 16183 volume = {4}, 16184 pages = {155--182}, 16185 year = {1994} 16186} 16187 16188@Article{ mu95, 16189 author = {M. Mu and J.R. Rice}, 16190 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 16191 journal = {Comp. Syst. Engr.}, 16192 volume = {6}, 16193 year = {1995}, 16194 pages = {87--95} 16195} 16196 16197@TechReport{ drashansky96, 16198 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 16199 author = {R. Drashansky and A. Joshi and J. R. Rice}, 16200 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 16201 year = {1996} 16202} 16203 16204@Article{ michopoulos05, 16205 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 16206 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 16207 journal = {Journal of Computing and Information Science in Engineering}, 16208 volume = {5}, 16209 issue = {3}, 16210 pages = {198--213}, 16211 year = {2005} 16212} 16213 16214@Article{ dubey09, 16215 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 16216 Multiphysics Simulation Code}, 16217 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 16218 Siegel and K. Weide}, 16219 journal = {Parallel Computing}, 16220 volume = {35}, 16221 issue = {10 -- 11}, 16222 pages = {512 -- 522}, 16223 year = {2009} 16224} 16225 16226@Book{ bottloring95, 16227 author = {Raoul Bott and Loring W. Tu}, 16228 title = {Differential Forms in Algebraic Topology}, 16229 publisher = {Springer}, 16230 year = {1995} 16231} 16232 16233@Book{ kobayashinomizu96, 16234 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 16235 title = {Foundations of Differential Geometry}, 16236 publisher = {Wiley-Interscience}, 16237 year = {1996} 16238} 16239 16240@Article{ hornungkohn02, 16241 author = {Richard D. Hornung and Scott R. Kohn}, 16242 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 16243 journal = {Concurrency and Computation: Practice and Experience}, 16244 volume = {14}, 16245 pages = {347--368}, 16246 year = {2002} 16247} 16248 16249@InProceedings{ concepts06, 16250 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 16251 Gabriel Dos Reis and Andrew Lumsdaine}, 16252 title = {Concepts: Linguistic Support for Generic Programming in C++}, 16253 booktitle = {Proceedings of OOPSLA 2006}, 16254 year = {2006}, 16255 pages = {???--???} 16256} 16257 16258@Book{ hatcher02, 16259 author = {Hatcher, Allen}, 16260 title = {Algebraic Topology}, 16261 publisher = {Cambridge University Press}, 16262 year = {2002} 16263} 16264 16265@Book{ gammahelmjohnsonvlissides95, 16266 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 16267 development, offering timeless and elegant solutions to common problems in 16268 software design. It describes patterns for managing object creation, composing 16269 objects into larger structures, and coordinating control flow between objects. The 16270 book provides numerous examples where using composition rather than inheritance 16271 can improve the reusability and flexibility of code. Note, though, that it's not a 16272 tutorial but a catalog that you can use to find an object-oriented design pattern 16273 that's appropriate for the needs of your particular application--a selection for 16274 virtuoso programmers who appreciate (or require) consistent, well-engineered 16275 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 16276 more valuable than ever! 16277 16278 Use the contents of the CD to create your own design documents and reusable 16279 components. The CD contains: 23 patterns you can cut and paste into your own 16280 design documents; sample code demonstrating pattern implementation; complete 16281 Design Patterns content in standard HTML format, with numerous hyperlinked 16282 cross-references; accessed through a standard web browser; Java-based dynamic 16283 search mechanism, enhancing online search capabilities; graphical user environment, 16284 allowing ease of navigation. 16285 16286 First published in 1995, this landmark work on object-oriented software design 16287 presents a catalog of simple and succinct solutions to common design problems. 16288 Created by four experienced designers, the 23 patterns contained herein have 16289 become an essential resource for anyone developing reusable object-oriented 16290 software. In response to reader demand, the complete text and pattern catalog are 16291 now available on CD-ROM. This electronic version of Design Patterns enables 16292 programmers to install the book directly onto a computer or network for use as an 16293 online reference for creating reusable object-oriented software. 16294 16295 The authors first describe what patterns are and how they can help you in the 16296 design process. They then systematically name, explain, evaluate, and catalog 16297 recurring designs in object-oriented systems. All patterns are compiled from 16298 real-world examples and include code that demonstrates how they may be implemented 16299 in object-oriented programming languages such as C++ and Smalltalk. Readers who 16300 already own the book will want the CD to take advantage of its dynamic search 16301 mechanism and ready-to-install patterns.}}, 16302 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 16303 citeulike-article-id={115158}, 16304 howpublished = {Hardcover}, 16305 isbn = {0201633612}, 16306 keywords = {1995 algorithms architecture book books computer computing design design-pattern 16307 design-patterns design_patterns designpatterns development diplom entwurfsmuster 16308 four gang gof java mathgamespatterns no-tag object object-orientation 16309 object-oriented of oo-patterns oop oriented pattern patterns programming se 16310 software software-development software-engineering software_design 16311 softwareengineering standard}, 16312 month = jan, 16313 publisher = {{Addison-Wesley Professional}}, 16314 title = {Design Patterns}, 16315 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 16316 year = {1995} 16317} 16318 16319@InProceedings{ chaco95, 16320 author = {Bruce Hendrickson and Robert Leland}, 16321 title = {A multilevel algorithm for partitioning graphs}, 16322 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 16323 (CDROM)}, 16324 year = {1995}, 16325 isbn = {0-89791-816-9}, 16326 pages = {28}, 16327 location = {San Diego, California, United States}, 16328 doi = {10.1145/224170.224228}, 16329 publisher = {ACM Press}, 16330 address = {New York} 16331} 16332 16333@Book{ aleksandrov98, 16334 author = {Aleksandrov, Pavel S.}, 16335 title = {Combinatorial Topology}, 16336 publisher = {Dover}, 16337 volume = {3}, 16338 year = {1998} 16339} 16340 16341@Book{ steenrod99, 16342 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 16343 importance in modern physics--such as in gauge theory. This book, a succinct 16344 introduction to the subject by renown mathematician Norman Steenrod, was the first 16345 to present the subject systematically. 16346 16347 It begins with a general introduction to bundles, including such topics as 16348 differentiable manifolds and covering spaces. The author then provides brief 16349 surveys of advanced topics, such as homotopy theory and cohomology theory, before 16350 using them to study further properties of fibre bundles. The result is a classic 16351 and timeless work of great utility that will appeal to serious mathematicians and 16352 theoretical physicists alike. }}, 16353 author = {Steenrod, Norman}, 16354 citeulike-article-id={712999}, 16355 howpublished = {Paperback}, 16356 isbn = {0691005486}, 16357 keywords = {fibre_bundles topology}, 16358 month = apr, 16359 publisher = {{Princeton University Press}}, 16360 title = {The Topology of Fibre Bundles. (PMS-14)}, 16361 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 16362 year = {1999} 16363} 16364 16365@Book{ bredon97, 16366 author = {Bredon, Glen E.}, 16367 title = {Sheaf Theory}, 16368 publisher = {Springer}, 16369 pages = {524}, 16370 series = {Graduate Texts in Mathematics}, 16371 year = {1997} 16372} 16373 16374@TechReport{ tautgesmeyers04, 16375 title = {{MOAB}: A Mesh-Oriented Database}, 16376 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 16377 Ernst}, 16378 institution = {Sandia National Laboratories}, 16379 number = {SAND2004-1592}, 16380 month = apr, 16381 year = {2004} 16382} 16383 16384@Article{ tautges04, 16385 author = {Timothy J. Tautges}, 16386 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 16387 journal = {Engineering With Computers}, 16388 volume = {20}, 16389 pages = {286--293}, 16390 year = {2004} 16391} 16392 16393@InProceedings{ meyers02, 16394 author = {Ray Meyers et. al}, 16395 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 16396 booktitle = {8th International conference on numerical grid generation in computational field 16397 simulations}, 16398 month = jun, 16399 year = {2002} 16400} 16401 16402@InProceedings{ seolshepard05, 16403 author = {E. S. Seol and Mark S. Shephard}, 16404 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 16405 Analysis}, 16406 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 16407 year = {2005} 16408} 16409 16410@Article{ lishephardbeall2005, 16411 title = {3D anisotropic mesh adaptation by mesh modification}, 16412 author = {Xiangrong Li and Mark S Shephard and Mark W Beall}, 16413 journal = {Computer methods in applied mechanics and engineering}, 16414 volume = {194}, 16415 number = {48-49}, 16416 pages = {4915--4950}, 16417 year = {2005}, 16418} 16419 16420@Article{ lushephardtendulkarbeall2014, 16421 title = {Parallel mesh adaptation for high-order finite element methods with curved element geometry}, 16422 author = {Qiukai Lu and Mark S Shephard and Saurabh Tendulkar and Mark W Beall}, 16423 journal = {Engineering with Computers}, 16424 volume = {30}, 16425 pages = {271--286}, 16426 year = {2014}, 16427} 16428 16429@Article{ beallwalshshephard04, 16430 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 16431 title = {A comparison of techniques for geometry access related to mesh generation}, 16432 journal = {Engineering With Computers}, 16433 volume = {20}, 16434 number = {3}, 16435 pages = {210--221}, 16436 year = {2004} 16437} 16438 16439@Article{ careyandersoncarneskirk04, 16440 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 16441 Kirk}, 16442 title = {Some aspects of adaptive grid technology related to boundary and interior 16443 layers}, 16444 journal = {Journal of Computational Applied Mathematics}, 16445 volume = {166}, 16446 number = {1}, 16447 pages = {55--86}, 16448 year = {2004} 16449} 16450 16451@PhDThesis{ gralthesis, 16452 author = {Guntram Berti}, 16453 title = {Generic Software Components for Scientific Computing}, 16454 school = {TU Cottbus}, 16455 year = {2000}, 16456 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 16457} 16458 16459@Article{ whitehead1949, 16460 title = {Combinatorial homotopy. I}, 16461 author = {John HC Whitehead}, 16462 journal = {Bulletin of the American Mathematical Society}, 16463 volume = {55}, 16464 number = {3. P1}, 16465 pages = {213--245}, 16466 year = {1949}, 16467 publisher = {American Mathematical Society} 16468} 16469 16470@Article{ beylkincoifmanrokhlin91, 16471 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 16472 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 16473 journal = {Communications on Pure and Applied Mathematics}, 16474 volume = {44}, 16475 pages = {141--183}, 16476 year = {1991} 16477} 16478 16479@Book{ wesseling92, 16480 author = {Pieter Wesseling}, 16481 title = {An Introduction to Multigrid Methods}, 16482 publisher = {John Wiley and Sons}, 16483 year = {1992} 16484} 16485 16486@Book{ grakakos04, 16487 author = {Loukas Grakakos}, 16488 title = {Classical and Modern Fourier Analysis}, 16489 publisher = {Pearson Education}, 16490 address = {New Jersey}, 16491 year = {2004} 16492} 16493 16494@Misc{ hlib-web-page, 16495 key = {HLib}, 16496 title = {{HLib} {Web} page}, 16497 note = {{\texttt{http://www.hlib.org/}}}, 16498 annote = {Hierarchical matrices for fast integral transform} 16499} 16500 16501@Article{ hackbusch99, 16502 author = {Wolfgang Hackbusch}, 16503 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 16504 Introduction to {$\mathcal H$}-matrices}, 16505 journal = {Computing}, 16506 volume = {62}, 16507 pages = {89--108}, 16508 year = {1999} 16509} 16510 16511@TechReport{ kay1999green, 16512 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 16513 equations}, 16514 author = {Kay, D. and Loghin, D.}, 16515 year = {1999}, 16516 institution = {Oxford University Computing Laboratory}, 16517 number = {99/06} 16518} 16519 16520@Article{ bebendorf2003existence, 16521 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 16522 elliptic operators with {$L^\infty$}-coefficients}, 16523 author = {Bebendorf, M. and Hackbusch, W.}, 16524 journal = {Numerische Mathematik}, 16525 volume = {95}, 16526 number = {1}, 16527 pages = {1--28}, 16528 year = {2003}, 16529 publisher = {Springer} 16530} 16531 16532@Article{ hackbusch2005direct, 16533 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 16534 H$}-matrix approximation}, 16535 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 16536 journal = {Computing and Visualization in Science}, 16537 volume = {8}, 16538 number = {3}, 16539 pages = {179--188}, 16540 year = {2005}, 16541 publisher = {Springer} 16542} 16543 16544@TechReport{ duphof2003, 16545 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 16546 Logg and L. R. Scott}, 16547 title = {The {FE}ni{CS} project}, 16548 institution = {Chalmers Finite Element Center Preprint Series}, 16549 number = {2003--21}, 16550 year = {2003} 16551} 16552 16553@Article{ flame01, 16554 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 16555 Geijn}, 16556 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 16557 journal = {Transactions on Mathematical Software}, 16558 volume = {27}, 16559 number = {4}, 16560 year = {2001}, 16561 pages = {422--455} 16562} 16563 16564@Article{ puschel05, 16565 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 16566 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 16567 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 16568 Nick Rizzolo}, 16569 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 16570 journal = {Proceedings of the IEEE}, 16571 volume = {93}, 16572 number = {2}, 16573 year = {2005}, 16574 note = {special issue on "Program Generation, Optimization, and Adaptation"} 16575} 16576 16577@Article{ kirbylogg06, 16578 author = {Robert C. Kirby and Anders Logg}, 16579 title = {A compiler for variational forms}, 16580 journal = {ACM Transactions on Mathematical Software}, 16581 volume = {32}, 16582 number = {3}, 16583 year = {2006}, 16584 issn = {0098-3500}, 16585 pages = {417--444}, 16586 doi = {10.1145/1163641.1163644}, 16587 publisher = {ACM Press}, 16588 address = {New York, NY} 16589} 16590 16591@Article{ kirbylogg07, 16592 author = {Robert C. Kirby and Anders Logg}, 16593 title = {Efficient compilation of a class of variational forms}, 16594 journal = {ACM Transactions on Mathematical Software}, 16595 volume = {33}, 16596 number = {3}, 16597 year = {2007}, 16598 issn = {0098-3500}, 16599 pages = {17}, 16600 doi = {10.1145/1268769.1268771}, 16601 publisher = {ACM Press}, 16602 address = {New York, NY} 16603} 16604 16605@Article{ bankdupont81, 16606 author = {Randolph Bank and Todd Dupont}, 16607 title = {An optimal order process for solving finite element equations}, 16608 journal = {Mathematics of Computation}, 16609 volume = {36}, 16610 pages = {35--51}, 16611 year = {1981} 16612} 16613 16614@TechReport{ adams00, 16615 author = {Mark F. Adams}, 16616 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 16617 in solid mechanics}, 16618 institution = {UC Berkeley}, 16619 number = {CSD-00-1103}, 16620 year = {2000}, 16621 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 16622} 16623 16624@Article{ bergengradlhuelsemannruede06, 16625 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 16626 title = {A Massively Parallel Multigrid Method for Finite Elements}, 16627 journal = {Computing in Science \& Engineering}, 16628 volume = {8}, 16629 number = {6}, 16630 pages = {56--62}, 16631 year = {2006} 16632} 16633 16634@MastersThesis{ brunethesis08, 16635 author = {Peter R. Brune}, 16636 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 16637 school = {University of Chicago}, 16638 address = {Chicago, IL}, 16639 year = {2008}, 16640 month = feb 16641} 16642 16643@Article{ arnoldwinther02, 16644 author = {Douglas N. Arnold and Ragnar Winther}, 16645 title = {Mixed finite elements for elasticity}, 16646 journal = {Numerische Mathematik}, 16647 volume = {92}, 16648 number = {3}, 16649 month = sep, 16650 year = {2002}, 16651 pages = {401--419}, 16652 doi = {10.1007/s002110100348} 16653} 16654 16655@Article{ arnoldfalkwinther06, 16656 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 16657 title = {Finite element exterior calculus, homological techniques, and applications}, 16658 journal = {Acta Numerica}, 16659 year = {2006}, 16660 volume = {15}, 16661 pages = {1--155}, 16662 publisher = {Cambridge University Press}, 16663 doi = {10.1017/S0962492906210018} 16664} 16665 16666@Article{ kirby04, 16667 author = {Robert C. Kirby}, 16668 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 16669 functions}, 16670 journal = {ACM Transactions on Mathematical Software}, 16671 volume = {30}, 16672 number = {4}, 16673 year = {2004}, 16674 issn = {0098-3500}, 16675 pages = {502--516}, 16676 doi = {10.1145/1039813.1039820}, 16677 publisher = {ACM Press}, 16678 address = {New York, NY} 16679} 16680 16681@Article{ kirby06, 16682 author = {Robert C. Kirby}, 16683 title = {Optimizing {FIAT} with level 3 {BLAS}}, 16684 journal = {ACM Transactions on Mathematical Software}, 16685 volume = {32}, 16686 number = {2}, 16687 year = {2006}, 16688 issn = {0098-3500}, 16689 pages = {223--235}, 16690 doi = {10.1145/1141885.1141889}, 16691 publisher = {ACM Press}, 16692 address = {New York, NY} 16693} 16694 16695@Misc{ bluecrystal08, 16696 author = {{B}lue {C}rystal Cluster}, 16697 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 16698 year = {2008}, 16699 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 16700} 16701 16702@Article{ beylkin95, 16703 author = {Gregory Beylkin}, 16704 title = {On the Fast Fourier Transform of Functions With Singularities}, 16705 journal = {Applied and Computational Harmonic Analysis}, 16706 volume = {2}, 16707 pages = {363--381}, 16708 year = {1995} 16709} 16710 16711@InProceedings{ riehl08, 16712 author = {Jonathan Riehl}, 16713 title = {Implementing the MyFEM Embedded Domain-specific Language}, 16714 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 16715 Development (DSPD'08)}, 16716 address = {Nashville, TN}, 16717 year = {2008} 16718} 16719 16720@Article{ appel85, 16721 author = {Andrew W. Appel}, 16722 date-added = {2008-02-27 12:23:39 +0000}, 16723 date-modified = {2008-02-27 12:24:02 +0000}, 16724 doi = {10.1137/0906008}, 16725 journal = {SIAM Journal on Scientific and Statistical Computing}, 16726 keywords = {treecodes}, 16727 number = {1}, 16728 pages = {85-103}, 16729 publisher = {SIAM}, 16730 title = {An Efficient Program for Many-Body Simulation}, 16731 volume = {6}, 16732 year = {1985} 16733} 16734 16735@Article{ ewald21, 16736 author = {{Ewald}, P.~P.}, 16737 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 16738 journal = {Annalen der Physik}, 16739 year = {1921}, 16740 volume = {369}, 16741 pages = {253-287}, 16742 doi = {10.1002/andp.19213690304}, 16743 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 16744 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16745} 16746 16747@Article{ greengardrokhlin87, 16748 author = {L. Greengard and V. Rokhlin}, 16749 date-added = {2008-02-15 18:43:55 +0000}, 16750 date-modified = {2008-02-26 20:09:11 +0000}, 16751 doi = {10.1016/0021-9991(87)90140-9}, 16752 journal = {J. Comput.\ Phys.}, 16753 keywords = {FMM}, 16754 number = {2}, 16755 pages = {325--348}, 16756 title = {A Fast Algorithm for Particle Simulations}, 16757 url = {citeseer.ist.psu.edu/greengard87fast.html}, 16758 volume = {73}, 16759 year = {1987}, 16760 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 16761} 16762 16763@Article{ greengardrokhlin97, 16764 author = {L. Greengard and V. Rokhlin}, 16765 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 16766 Dimensions}, 16767 journal = {Acta Numerica}, 16768 volume = {6}, 16769 year = {1997}, 16770 pages = {229--269} 16771} 16772 16773@Article{ luchenghuangmccammon06, 16774 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 16775 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 16776 systems}, 16777 journal = {PNAS}, 16778 doi = {10.1073/pnas.0605166103}, 16779 volume = {102}, 16780 number = {51}, 16781 year = {2006}, 16782 pages = {19314--19319} 16783} 16784 16785@Article{ schussnadlereisenberg01, 16786 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 16787 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 16788 from a molecular model}, 16789 journal = {Physical Review E}, 16790 volume = {64}, 16791 number = {3}, 16792 year = {2001} 16793} 16794 16795@Book{ hairerlubichwanner02, 16796 author = {E. Hairer and Ch. Lubich and G. Wanner}, 16797 title = {Geometric Numerical Integration}, 16798 publisher = {Springer-Verlag}, 16799 address = {Berlin Heidelberg}, 16800 year = {2002} 16801} 16802 16803@Article{ holstbakerwang00, 16804 author = {M. Holst and N. Baker and F. Wang}, 16805 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 16806 equation on massively parallel computers}, 16807 journal = {Journal of Computational Chemistry}, 16808 volume = {21}, 16809 year = {2000} 16810} 16811 16812@Book{ hockneyeastwood81, 16813 author = {R. Hockney and J. Eastwood}, 16814 title = {Computer simulation using particles}, 16815 publisher = {McGraw-Hill}, 16816 address = {New York}, 16817 year = {1981} 16818} 16819 16820@Article{ lutydavistironigunsteren94, 16821 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 16822 Gunsteren}, 16823 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 16824 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 16825 journal = {Molecular Simulation}, 16826 volume = {14}, 16827 number = {1}, 16828 year = {1994}, 16829 pages = {11--20} 16830} 16831 16832@Book{ briggshensonmccormick00, 16833 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 16834 title = {A Multigrid Tutorial (2nd ed.)}, 16835 year = {2000}, 16836 isbn = {0-89871-462-1}, 16837 publisher = {Society for Industrial and Applied Mathematics}, 16838 address = {Philadelphia, PA} 16839} 16840 16841@Article{ chartier2003spectral, 16842 title = {Spectral AMGe ($\rho$ AMGe)}, 16843 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 16844 McCormick, S and Ruge, J and Vassilevski, PS}, 16845 journal = {SIAM Journal on Scientific Computing}, 16846 volume = {25}, 16847 number = {1}, 16848 pages = {1--26}, 16849 year = {2003}, 16850 publisher = {SIAM} 16851} 16852 16853@Article{ galvis2010domain, 16854 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 16855 media}, 16856 author = {Galvis, Juan and Efendiev, Yalchin}, 16857 journal = {Multiscale Modeling \& Simulation}, 16858 volume = {8}, 16859 number = {4}, 16860 pages = {1461--1483}, 16861 year = {2010}, 16862 publisher = {SIAM} 16863} 16864 16865@Book{ brennerscott02, 16866 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 16867 title = {The mathematical theory of finite element methods}, 16868 year = {2002}, 16869 isbn = {0-38795-451-1}, 16870 publisher = {Springer}, 16871 pages = {361} 16872} 16873 16874@Book{ trefethenbau97, 16875 author = {Lloyd N. Trefethen and David {Bau, III}}, 16876 title = {Numerical Linear Algebra}, 16877 publisher = {Society for Industrial and Applied Mathematics}, 16878 address = {Philadelphia, PA}, 16879 pages = {xii + 361}, 16880 year = {1997}, 16881 isbn = {0-89871-361-7}, 16882 isbn-13 = {978-0-89871-361-9}, 16883 lccn = {QA184 .T74 1997}, 16884 mrclass = {65-01 (65-02 65Fxx)}, 16885 mrnumber = {MR1444820 (98k:65002)}, 16886 mrreviewer = {Moody T. Chu}, 16887 bibdate = {Wed Jan 07 15:23:19 1998}, 16888 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 16889} 16890 16891@Article{ liptonreagan2014, 16892 title = {Quantum Algorithms via Linear Algebra: A Primer}, 16893 author = {Richard J Lipton and Kenneth W Regan}, 16894 pages = {206}, 16895 isbn = {978-0-26202-839-4}, 16896 year = {2014} 16897} 16898 16899@InProceedings{ rhea08, 16900 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 16901 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 16902 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16903 booktitle = {Proceedings of IEEE/ACM SC '08}, 16904 year = {2008} 16905} 16906 16907@Misc{ bursteddewilcox09, 16908 author = {Carsten Burstedde and Lucas~C. Wilcox}, 16909 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 16910 note = {in preparation} 16911} 16912 16913@Article{ skeeltezcanhardy02, 16914 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 16915 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 16916 journal = {J. Comp. Chem.}, 16917 volume = {23}, 16918 pages = {673--684}, 16919 year = {2002} 16920} 16921 16922@Article{ verschelde99, 16923 author = {Jan Verschelde}, 16924 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 16925 homotopy continuation}, 16926 journal = {ACM Trans. Math. Softw.}, 16927 volume = {25}, 16928 number = {2}, 16929 issn = {0098-3500}, 16930 pages = {251--276}, 16931 doi = {10.1145/317275.317286}, 16932 publisher = {ACM}, 16933 address = {New York, NY}, 16934 year = {1999} 16935} 16936 16937@InProceedings{ sommeseverscheldewampler08, 16938 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 16939 title = {Solving Polynomial Systems Equation by Equation}, 16940 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 16941 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 16942 pages = {133--152}, 16943 publisher = {Springer-Verlag}, 16944 year = {2008} 16945} 16946 16947@Article{ phanthientanner77, 16948 author = {N. Phan-Thien and R.~I. Tanner}, 16949 title = {A new constitutive equation derived from network theory}, 16950 journal = {J. Non-Newt. Fluid Mech.}, 16951 volume = {2}, 16952 pages = {353}, 16953 year = {1977} 16954} 16955 16956@Manual{ sage, 16957 key = {SAGE}, 16958 author = {W.\thinspace{}A. Stein and others}, 16959 organization = {The Sage~Development Team}, 16960 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 16961 note = {{\tt http://www.sagemath.org}}, 16962 year = {2009} 16963} 16964 16965@Misc{ bateshauensteinsommesewampler06, 16966 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 16967 Wampler}, 16968 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 16969 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 16970} 16971 16972@Article{ archer09, 16973 author = {A. J. Archer}, 16974 collaboration = {}, 16975 title = {Dynamical density functional theory for molecular and colloidal fluids: A 16976 microscopic approach to fluid mechanics}, 16977 publisher = {AIP}, 16978 year = {2009}, 16979 journal = {The Journal of Chemical Physics}, 16980 volume = {130}, 16981 number = {1}, 16982 eid = {014509}, 16983 numpages = {8}, 16984 pages = {014509}, 16985 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 16986 transition; statistical distributions; stochastic processes}, 16987 doi = {10.1063/1.3054633} 16988} 16989 16990@Article{ giesekus1966, 16991 author = {Hanswalter Giesekus}, 16992 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 16993 journal = {Rheologica Acta}, 16994 publisher = {Springer Berlin / Heidelberg}, 16995 volume = {5}, 16996 number = {1}, 16997 month = mar, 16998 year = {1966}, 16999 doi = {10.1007/BF01973575}, 17000 pages = {29-35} 17001} 17002 17003@Article{ baaijens98, 17004 author = {F.P. Baaijens}, 17005 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 17006 journal = {Journal of Non-Newtonian Fluid Mechanics}, 17007 volume = {79}, 17008 year = {1998}, 17009 pages = {361--385} 17010} 17011 17012@Book{ joseph90, 17013 author = {D.~D. Joseph}, 17014 title = {Fluid Dynamics of Viscoelastic Liquids}, 17015 publisher = {Springer}, 17016 address = {New York, NY}, 17017 year = {1990} 17018} 17019 17020@Article{ oldroyd50, 17021 author = {J.~G. Oldroyd}, 17022 title = {On the Formulation of Rheological Equations of State}, 17023 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 17024 Sciences}, 17025 volume = {200}, 17026 year = {1950}, 17027 pages = {523--541} 17028} 17029 17030@InProceedings{ bynasungroppthakur04, 17031 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 17032 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 17033 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 17034 year = {2004} 17035} 17036 17037@Book{ pozrikidis07, 17038 author = {C. Pozrikidis}, 17039 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 17040 publisher = {Kluwer (Springer)}, 17041 pages = {675}, 17042 year = {2001}, 17043 isbn = {0792373510} 17044} 17045 17046@Misc{ kritzkeyesfsp07, 17047 author = {A. Kritz and D. Keyes}, 17048 title = {{Fusion Simulation Project Workshop Report}}, 17049 month = jul, 17050 year = {2007}, 17051 note = {Available via 17052 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 17053} 17054 17055@Misc{ dahlburg02, 17056 author = {J. {Dahlburg (Chair)}}, 17057 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 17058 year = {2002}, 17059 note = {Available via 17060 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 17061} 17062 17063@Misc{ brown08, 17064 author = {D. {Brown (Chair)}}, 17065 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 17066 to the Future}}, 17067 year = {2008}, 17068 howpublished = {Office of Science, U.S. Department of Energy}, 17069 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 17070} 17071 17072@Misc{ crosscutting10, 17073 author = {D. Brown and P. {Messina (Chairs)}}, 17074 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 17075 Exascale}}, 17076 year = {2010}, 17077 howpublished = {Office of Science, U.S. Department of Energy}, 17078 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 17079} 17080 17081@Misc{ extreme-scale-solvers-workshop12, 17082 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 17083 L.C. McInnes and E. Ng and S. Wild}, 17084 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 17085 Architectures}, 17086 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 17087 note = {{Washington, DC}, March 8-9, 2012}, 17088 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 17089 year = {2012} 17090} 17091 17092@Misc{ monizrosner09, 17093 author = {{E. Moniz and R. Rosner}}, 17094 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 17095 and Simulation at the Extreme Scale}}, 17096 month = may, 17097 year = {2009}, 17098 note = {See 17099 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 17100} 17101 17102@Misc{ blanford08, 17103 author = {{R. Blandord (Chair)}}, 17104 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 17105 Computing at the Extreme Scale}}, 17106 month = dec, 17107 year = {2008}, 17108 note = {See 17109 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 17110} 17111 17112@Misc{ exascale07, 17113 author = {H. Simon and T. Zacharia and R. Stevens}, 17114 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 17115 year = {2007}, 17116 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 17117} 17118 17119@Misc{ ascrbreakthroughs08, 17120 author = {{Panel on Recent Significant Advancements in Computational Science}}, 17121 title = {Breakthroughs}, 17122 year = {2008}, 17123 note = {See 17124 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 17125} 17126 17127@Misc{ petsc-rd100-2009, 17128 author = {{R\&D Magazine}}, 17129 title = {{PETSc} {R}\&{D} 100 Award}, 17130 year = {2009}, 17131 note = {See 17132 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 17133} 17134 17135@Article{ compass-scidac08, 17136 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 17137 R. Ryne}, 17138 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 17139 Computational Science for Future Accelerators and Accelerator Technologies}, 17140 journal = {J. Phys.: Conf. Ser.}, 17141 volume = {125}, 17142 year = {2008}, 17143 pages = {012001}, 17144 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 17145} 17146 17147@Article{ compass-amundson-scidac08, 17148 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 17149 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 17150 Stoltz}, 17151 journal = {J. Phys.: Conf. Ser.}, 17152 volume = {125}, 17153 year = {2008} 17154} 17155 17156@InProceedings{ muszala09, 17157 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 17158 Simulations}, 17159 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 17160 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 17161 {(CBHPC 2009)}}, 17162 year = {2009} 17163} 17164 17165@Article{ gaston09, 17166 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 17167 Equations}, 17168 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 17169 journal = {Nuclear Engineering and Design}, 17170 volume = {239}, 17171 number = {10}, 17172 year = {2009}, 17173 pages = {1768 -- 1778} 17174} 17175 17176@Article{ gaston09b, 17177 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 17178 Engineering}, 17179 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 17180 and C. Permann and W. Taitano}, 17181 journal = {J. Phys.: Conf. Ser.}, 17182 volume = {180}, 17183 year = {2009}, 17184 pages = {012012} 17185} 17186 17187@Article{ newman09, 17188 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 17189 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 17190 author = {Chris Newman and Glen Hansen and Derek Gaston}, 17191 journal = {Journal of Nuclear Materials}, 17192 volume = {392}, 17193 issue = {1}, 17194 year = {2009}, 17195 pages = {6 -- 15} 17196} 17197 17198@Misc{ www:fenics, 17199 author = {{FE}ni{CS}}, 17200 title = {{FE}ni{CS} Project}, 17201 howpublished = {\url{http://www.fenics.org/}}, 17202 year = {2018} 17203} 17204 17205@InProceedings{ zwart08, 17206 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 17207 Systems}, 17208 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 17209 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 17210 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 17211 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 17212 booktitle = {Proceedings of ICCS 2008}, 17213 year = {2008} 17214} 17215 17216@Article{ klocknerwarburtonbridgehesthaven09, 17217 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 17218 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 17219 journal = {J. Comput. Phys.}, 17220 volume = {228}, 17221 number = {21}, 17222 year = {2009}, 17223 issn = {0021-9991}, 17224 pages = {7863--7882}, 17225 doi = {10.1016/j.jcp.2009.06.041}, 17226 publisher = {Academic Press Professional}, 17227 address = {San Diego, CA} 17228} 17229 17230@PhDThesis{ rankin99, 17231 author = {Rankin, W. T.}, 17232 keywords = {FMM, parallel FMM}, 17233 school = {Department of Electrical and Computer Engineering, Duke University}, 17234 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 17235 year = {1999} 17236} 17237 17238@InProceedings{ warrensalmon93, 17239 abstract = {We report on an efficient adaptive N-body method which we have recently designed 17240 and implemented. The algorithm computes the forces on an arbitrary distribution of 17241 bodies in a time which scales as N log N with the particle number. The accuracy of 17242 the force calculations is analytically bounded, and can be adjusted via a user 17243 defined parameter between a few percent relative accuracy, down to machine 17244 arithmetic accuracy. Instead of using pointers to indicate the topology of the 17245 tree, we identify...}, 17246 address = {New York}, 17247 author = {Warren, Michael S. and Salmon, John K.}, 17248 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 17249 citeulike-article-id={580952}, 17250 keywords = {oct-tree}, 17251 pages = {12--21}, 17252 publisher = {ACM}, 17253 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 17254 year = {1993}, 17255 doi = {10.1145/169627.169640}, 17256 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 17257} 17258 17259@Unpublished{ cruzwccm10, 17260 author = {Felipe A. Cruz}, 17261 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 17262 note = {Presentation at WCCM 2010, Sydney Australia}, 17263 year = {2010} 17264} 17265 17266@Article{ mcguffee06, 17267 author = {S.~R. {McGuffee} and A.~H. Elcock}, 17268 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 17269 of salt, {pH}, point mutations, and protein concentration in simulations of 17270 1000-molecule systems}, 17271 journal = {Journal of the American Chemical Society}, 17272 volume = {128}, 17273 pages = {12098--12110}, 17274 year = {2006} 17275} 17276 17277@Article{ nilsencaihoylandlangtangen10, 17278 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 17279 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 17280 in Python}}, 17281 journal = {ArXiv e-prints}, 17282 archiveprefix = {arXiv}, 17283 eprint = {1002.0705}, 17284 primaryclass = {cs.DC}, 17285 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 17286 - Programming Languages}, 17287 year = {2010}, 17288 month = feb, 17289 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 17290 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 17291} 17292 17293@Misc{ mcinnes:siam09:minisymposium, 17294 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 17295 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 17296 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 17297 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 17298 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 17299 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 17300 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 17301 Austin).} 17302} 17303 17304@Misc{ mcinnes:fsp-summary:feb2011, 17305 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 17306 title = {Solvers and Time Integration Breakout Summary}, 17307 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 17308 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 17309} 17310 17311@Misc{ dvi-materials:siamcse11, 17312 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 17313 Materials}, 17314 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 17315 Smith and L. Wang}, 17316 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 17317 and Engineering, March 3, 2011} 17318} 17319 17320@Misc{ jamroz:cemm10, 17321 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 17322 author = {B. Jamroz and S. Kruger and T. Austin}, 17323 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 17324} 17325 17326@Misc{ kruger:feb4-2011, 17327 title = {personal communication}, 17328 author = {S. Kruger}, 17329 note = {February, 2011} 17330} 17331 17332@Article{ elman1996, 17333 author = {H.C. Elman}, 17334 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 17335 viscosity}, 17336 journal = {SIAM J. Sci. Comput.}, 17337 volume = {20}, 17338 year = {1996}, 17339 pages = {1299--1316} 17340} 17341 17342@Article{ kayloghinwathen2002, 17343 author = {D. Kay and D. Loghin and A. Wathen}, 17344 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 17345 journal = {SIAM J. Sci. Comput.}, 17346 volume = {24}, 17347 year = {2002}, 17348 pages = {237--256} 17349} 17350 17351@Article{ elmanhowleshadidshuttleworthtuminaro2006, 17352 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 17353 title = {Block preconditioners based on approximate commutators}, 17354 journal = {SIAM J. Sci. Comput.}, 17355 volume = {27}, 17356 number = {5}, 17357 year = {2006}, 17358 pages = {1651--1668} 17359} 17360 17361@Article{ braesssarazin1997, 17362 author = {Dietrich Braess and Regina Sarazin}, 17363 title = {An efficient smoother for the {Stokes} problem}, 17364 journal = {Applied Numerical Mathematics}, 17365 volume = {23}, 17366 number = {1}, 17367 year = {1997}, 17368 pages = {3--19}, 17369 doi = {10.1016/S0168-9274(96)00059-1} 17370} 17371 17372@Article{ wright2001large, 17373 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 17374 author = {Wright, T.G. and Trefethen, L.N.}, 17375 journal = {SIAM Journal on Scientific Computing}, 17376 volume = {23}, 17377 pages = {591}, 17378 year = {2001} 17379} 17380 17381@Misc{ wright2002eigtool, 17382 title = {Eig{T}ool}, 17383 author = {Wright, T.G. and Trefethen, LN}, 17384 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 17385 year = {2002} 17386} 17387 17388@Misc{ visit-web-site, 17389 key = {{VisIt}}, 17390 title = {{VisIt web site}}, 17391 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 17392 url = {http://wci.llnl.gov/codes/visit/}, 17393 year = {2011} 17394} 17395 17396@Book{ trefethen1996, 17397 title = {Finite difference and spectral methods for ordinary and partial differential 17398 equations}, 17399 author = {Lloyd Nicholas Trefethen}, 17400 year = {1996}, 17401 publisher = {Cornell University-Department of Computer Science and Center for Applied 17402 Mathematics} 17403} 17404 17405@Book{ trefethen2005spectra, 17406 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 17407 author = {Trefethen, L.N. and Embree, M.}, 17408 year = {2005}, 17409 publisher = {Princeton University Press} 17410} 17411 17412@Article{ gomez2010isogeometric, 17413 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 17414 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 17415 journal = {Computer Methods in Applied Mechanics and Engineering}, 17416 volume = {199}, 17417 number = {25-28}, 17418 pages = {1828--1840}, 17419 issn = {0045-7825}, 17420 year = {2010}, 17421 publisher = {Elsevier} 17422} 17423 17424@Article{ gomez2008isogeometric, 17425 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 17426 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 17427 journal = {Computer Methods in Applied Mechanics and Engineering}, 17428 volume = {197}, 17429 number = {49-50}, 17430 pages = {4333--4352}, 17431 year = {2008}, 17432 publisher = {Elsevier} 17433} 17434 17435@Misc{ fastmath:project, 17436 author = {Lori {Diachin (PI)}}, 17437 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 17438 (FASTMath) Institute}}, 17439 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 17440} 17441 17442@Misc{ exascale-software:proposal, 17443 author = {Peter {Beckman (PI)}}, 17444 title = {{Exascale Software Center}}, 17445 note = {proposal to DOE} 17446} 17447 17448@Misc{ imex:project, 17449 author = {Barry {Smith (PI)}}, 17450 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 17451 Multimodel PDEs}}, 17452 note = {DOE ASCR applied math project} 17453} 17454 17455@Misc{ intel-mic:website, 17456 author = {Intel}, 17457 title = {{Many Integrated Core Architecture}}, 17458 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 17459} 17460 17461@Article{ dudson:2009, 17462 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 17463 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 17464 journal = {Computer Physics Communications}, 17465 volume = {180}, 17466 pages = {1467}, 17467 year = {2009} 17468} 17469 17470@Article{ umansky:2009, 17471 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 17472 title = {{Status and verification of edge plasma turbulence code BOUT}}, 17473 journal = {Computer Physics Communications}, 17474 year = {2009}, 17475 volume = {180}, 17476 pages = {887-903} 17477} 17478 17479@Article{ xu:1998, 17480 author = {X.Q. Xu and R.H. Cohen}, 17481 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 17482 journal = {Computer Physics Communications}, 17483 year = {1998}, 17484 volume = {36}, 17485 number = {1-2}, 17486 pages = {158} 17487} 17488 17489@Article{ tron:1999, 17490 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 17491 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 17492 journal = {SIAM Journal on Optimization}, 17493 volume = {9}, 17494 number = {4}, 17495 pages = {1100-1127}, 17496 year = {1999} 17497} 17498 17499@Article{ stubenamg, 17500 author = {K. St\"{u}ben}, 17501 title = {A review of algebraic multigrid}, 17502 journal = {J. Comput. Appl. Math.}, 17503 volume = {128}, 17504 number = {1-2}, 17505 year = {2001}, 17506 issn = {0377-0427}, 17507 pages = {281--309}, 17508 doi = {10.1016/S0377-0427(00)00516-1}, 17509 publisher = {Elsevier Science Publishers B. V.}, 17510 address = {Amsterdam, The Netherlands, The Netherlands} 17511} 17512 17513@Article{ feuchtermg, 17514 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 17515 title = {Bridging the gap between geometric and algebraic multigrid methods}, 17516 journal = {Computing and visualization in science}, 17517 publisher = {Springer}, 17518 volume = {6}, 17519 number = {1}, 17520 year = {2003}, 17521 pages = {1--13} 17522} 17523 17524@Article{ chowmgsmoothness, 17525 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 17526 only attempts to interpolate in the directions of geometrical smoothness. These 17527 directions are determined by analyzing samples of algebraically smooth error, e. 17528 Neighboring grid points i and j are called smoothly coupled if e i and e j are 17529 consistently nearby in value. In addition, these dierences may be used to dene 17530 interpolation weights. These new ideas may be incorporated into the algebraic 17531 multigrid method. Test results show that the new method can have much lower grid 17532 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 17533 author = {Chow, Edmond}, 17534 citeulike-article-id={7675372}, 17535 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17536 journal = {American Journal of Mathematics}, 17537 keywords = {fem, multigrid}, 17538 pages = {197--215}, 17539 posted-at = {2010-08-17 23:29:51}, 17540 priority = {2}, 17541 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 17542 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17543 volume = {65}, 17544 year = {2001} 17545} 17546 17547@Article{ jonesamge, 17548 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 17549 elements) method based on element agglomeration. In the method, coarse grid 17550 elements are formed by agglomerating fine grid elements. Compatible interpolation 17551 operators are constructed which yield coarse grid basis functions with a minimal 17552 energy property. Heuristics based on interpolation quality measures are used to 17553 guide the agglomeration procedure. The performance of the resulting method is 17554 demonstrated in two-level numerical experiments.}}, 17555 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 17556 citeulike-article-id={8598569}, 17557 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17558 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 17559 journal = {SIAM Journal on Scientific Computing}, 17560 keywords = {amg, fem, multigrid}, 17561 number = {1}, 17562 pages = {109--133}, 17563 posted-at = {2011-01-13 18:05:55}, 17564 priority = {2}, 17565 publisher = {SIAM}, 17566 title = {{AMGE Based on Element Agglomeration}}, 17567 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17568 volume = {23}, 17569 year = {2001} 17570} 17571 17572@Article{ saad1993, 17573 author = {Saad, Youcef}, 17574 doi = {10.1137/0914028}, 17575 issn = {10648275}, 17576 journal = {SIAM Journal on Scientific Computing}, 17577 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 17578 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 17579 precondition-,preconditioned conju-,subject classi cations,variable 17580 preconditioners}, 17581 number = {2}, 17582 pages = {461--469}, 17583 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 17584 volume = {14}, 17585 year = {1993} 17586} 17587 17588@Misc{ path:homepage, 17589 author = {S. Dirkse and M. Ferris and T. Munson}, 17590 title = {{{PATH} {W}eb page}}, 17591 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 17592} 17593 17594@Article{ ketcheson2008, 17595 author = {David I Ketcheson}, 17596 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 17597 Low-Storage Implementations}, 17598 volume = {30}, 17599 journal = {SIAM Journal on Scientific Computing}, 17600 year = {2008}, 17601 pages = {2113--2136} 17602} 17603 17604@Article{ elman2009boundary, 17605 title = {{Boundary conditions in approximate commutator preconditioners for the 17606 Navier-Stokes equations}}, 17607 author = {Elman, H.C. and Tuminaro, R.}, 17608 journal = {Electronic Transactions on Numerical Analysis}, 17609 volume = {35}, 17610 pages = {257--280}, 17611 year = {2009} 17612} 17613 17614@Article{ elman2008tcp, 17615 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 17616 incompressible Navier-Stokes equations}}, 17617 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 17618 R.}, 17619 journal = {Journal of Computational Physics}, 17620 volume = {227}, 17621 number = {1}, 17622 pages = {1790--1808}, 17623 year = {2008}, 17624 publisher = {Academic Press}, 17625 url = {http://chess.cs.umd.edu/~elman/papers/tax.pdf} 17626} 17627 17628@Article{ arioli2013, 17629 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 17630 author = {Arioli, Mario}, 17631 journal = {SIAM Journal on Matrix Analysis and Applications}, 17632 volume = {34}, 17633 number = {2}, 17634 pages = {571--592}, 17635 year = {2013}, 17636 publisher = {SIAM} 17637} 17638 17639@Book{ wesseling2009, 17640 title = {Principles of computational fluid dynamics}, 17641 author = {Wesseling, Pieter}, 17642 volume = {29}, 17643 year = {2009}, 17644 publisher = {Springer Science \& Business Media} 17645} 17646 17647@Article{ silvester2001efficient, 17648 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 17649 incompressible flow}}, 17650 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 17651 journal = {Journal of Computational and Applied Mathematics}, 17652 volume = {128}, 17653 number = {1-2}, 17654 pages = {261--279}, 17655 issn = {0377-0427}, 17656 year = {2001}, 17657 publisher = {Elsevier} 17658} 17659 17660@Article{ elman1999bfbt, 17661 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 17662 viscosity}}, 17663 author = {Elman, H.C.}, 17664 journal = {SIAM Journal on Scientific Computing}, 17665 volume = {20}, 17666 number = {4}, 17667 pages = {1299--1316}, 17668 issn = {1064-8275}, 17669 year = {1999}, 17670 publisher = {Citeseer} 17671} 17672 17673@Article{ elman2006bpb, 17674 title = {{Block preconditioners based on approximate commutators}}, 17675 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 17676 journal = {SIAM Journal on Scientific Computing}, 17677 volume = {27}, 17678 number = {5}, 17679 pages = {1651--1668}, 17680 year = {2006}, 17681 publisher = {Philadelphia, PA: SIAM, c1993-} 17682} 17683 17684@Article{ olshanskii2006analysis, 17685 title = {{Analysis of a Stokes interface problem}}, 17686 author = {Olshanskii, M.A. and Reusken, A.}, 17687 journal = {Numerische Mathematik}, 17688 volume = {103}, 17689 number = {1}, 17690 pages = {129--149}, 17691 issn = {0029-599X}, 17692 year = {2006}, 17693 publisher = {Springer} 17694} 17695 17696@Article{ patankar1972cph, 17697 title = {{A calculation procedure for heat, mass and momentum transfer in 17698 three-dimensional parabolic flows}}, 17699 author = {Patankar, S.V. and Spalding, D.B.}, 17700 journal = {Int. J. Heat Mass Transfer}, 17701 volume = {15}, 17702 pages = {1787--1806}, 17703 year = {1972} 17704} 17705 17706@Article{ rannacher1992simple, 17707 title = {{Simple nonconforming quadrilateral Stokes element}}, 17708 author = {Rannacher, R. and Turek, S.}, 17709 journal = {Numerical Methods for Partial Differential Equations}, 17710 volume = {8}, 17711 number = {2}, 17712 pages = {97--111}, 17713 issn = {1098-2426}, 17714 year = {1992}, 17715 publisher = {Wiley Online Library} 17716} 17717 17718@Article{ rannacher2000finite, 17719 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 17720 author = {Rannacher, R.}, 17721 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 17722 pages = {191}, 17723 isbn = {3764364149}, 17724 year = {2000}, 17725 publisher = {Birkhauser} 17726} 17727 17728@Article{ vanka1986block, 17729 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 17730 variables}}, 17731 author = {Vanka, S.P.}, 17732 journal = {Journal of Computational Physics}, 17733 volume = {65}, 17734 number = {1}, 17735 pages = {138--158}, 17736 issn = {0021-9991}, 17737 year = {1986}, 17738 publisher = {Elsevier} 17739} 17740 17741@Article{ eisenstat1983variational, 17742 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 17743 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 17744 journal = {SIAM Journal on Numerical Analysis}, 17745 volume = {20}, 17746 number = {2}, 17747 pages = {345--357}, 17748 year = {1983}, 17749 publisher = {JSTOR} 17750} 17751 17752@InProceedings{ burstedde2008scalable, 17753 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 17754 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 17755 T. and Wilcox, L.C. and Zhong, S.}, 17756 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 17757 pages = {62}, 17758 year = {2008}, 17759 organization = {IEEE Press} 17760} 17761 17762@Article{ burstedde2009parallel, 17763 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 17764 flow problems}, 17765 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 17766 journal = {Computer Methods in Applied Mechanics and Engineering}, 17767 volume = {198}, 17768 number = {21-26}, 17769 pages = {1691--1700}, 17770 year = {2009}, 17771 publisher = {Elsevier} 17772} 17773 17774@Article{ stadler2010dynamics, 17775 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 17776 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 17777 Ghattas, O.}, 17778 journal = {Science}, 17779 volume = {329}, 17780 number = {5995}, 17781 pages = {1033}, 17782 year = {2010}, 17783 publisher = {American Association for the Advancement of Science} 17784} 17785 17786@Article{ tackley2008modelling, 17787 title = {Modelling compressible mantle convection with large viscosity contrasts in a 17788 three-dimensional spherical shell using the yin-yang grid}, 17789 author = {Tackley, P.J.}, 17790 journal = {Physics of the Earth and Planetary Interiors}, 17791 volume = {171}, 17792 number = {1-4}, 17793 pages = {7--18}, 17794 year = {2008}, 17795 publisher = {Elsevier} 17796} 17797 17798@Article{ moresizhonggurnis96, 17799 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 17800 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 17801 viscosity}, 17802 journal = {Physics of the Earth and Planetary Interiors}, 17803 volume = {97}, 17804 pages = {83-–94}, 17805 year = {1996} 17806} 17807 17808@Article{ moresisolomatov95, 17809 author = {Louis N. Moresi and V. S. Solomatov}, 17810 title = {Numerical investigation of {2D} convection with extremely large viscosity 17811 variations}, 17812 journal = {Physics of Fluids}, 17813 volume = {7}, 17814 number = {9}, 17815 pages = {2154-–2162}, 17816 year = {1995} 17817} 17818 17819@Article{ chenmolnar83, 17820 author = {W.-P. Chen and P. Molnar}, 17821 title = {Focal depths of intra-continental and intraplate earthquakes and their 17822 implications for the thermal and mechanical properties of the lithosphere}, 17823 journal = {Journal of Geophysical Research}, 17824 volume = {88}, 17825 pages = {4183–-4214}, 17826 year = {1983} 17827} 17828 17829@Article{ jackson02, 17830 author = {J. Jackson}, 17831 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 17832 journal = {GSA Today}, 17833 volume = {12}, 17834 pages = {4–-10}, 17835 year = {2002} 17836} 17837 17838@Article{ burovwatts06, 17839 author = {E.B. Burov and A.B. Watts}, 17840 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 17841 brulee?}, 17842 journal = {GSA Today}, 17843 volume = {16}, 17844 pages = {4–-10}, 17845 year = {2006} 17846} 17847 17848@InProceedings{ yang:brent:2002, 17849 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 17850 Parallel Distributed Memory Architectures}, 17851 author = {Laurence T. Yang and Richard Brent}, 17852 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 17853 for Parallel Processing}, 17854 year = {2002}, 17855 publisher = {IEEE} 17856} 17857 17858@Article{ demmel2008communication, 17859 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 17860 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 17861 journal = {Arxiv preprint arXiv:0808.2664}, 17862 year = {2008} 17863} 17864 17865@Article{ demmel09, 17866 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 17867 title = {Communication-optimal Iterative Methods}, 17868 journal = {Journal of Physics: Conf. Series}, 17869 volume = {180}, 17870 year = {2009} 17871} 17872 17873@TechReport{ parms04, 17874 author = {Yousef Saad and Masha Sosonkina}, 17875 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 17876 linear systems user's guide}, 17877 number = {UMSI2004-8}, 17878 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 17879 year = {2004} 17880} 17881 17882@Article{ picard1890, 17883 author = {Emile Picard}, 17884 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 17885 m\'ethode des approximations successives}, 17886 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 17887 volume = {4}, 17888 number = {6}, 17889 pages = {145--210}, 17890 year = {1890}, 17891 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 17892} 17893 17894@Book{ rall1969, 17895 author = {Louis B. Rall}, 17896 title = {Computational solution of nonlinear operator equations}, 17897 publisher = {Krieger Pub Co.}, 17898 pages = {225}, 17899 year = {1969} 17900} 17901 17902@Article{ fletcherreeves1964, 17903 author = {R. Fletcher and C. M. Reeves}, 17904 title = {Function Minimization by Conjugate Gradients}, 17905 journal = {Computer Journal}, 17906 volume = {7}, 17907 pages = {149–-154}, 17908 year = {1964} 17909} 17910 17911@InBook{ mcinnesallanetal06, 17912 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 17913 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 17914 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 17915 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 17916 editor = {A.~M.~Bruaset and A.~Tveito}, 17917 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 17918 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 17919 publisher = {Springer}, 17920 year = {2006}, 17921 number = {51}, 17922 series = {Lecture Notes in Computational Science and Engineering}, 17923 pages = {327--381}, 17924 doi = {10.1016/S0167-8191(02)00191-6} 17925} 17926 17927@Article{ cyrshadidtuminaro12, 17928 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 17929 equations}, 17930 journal = {Journal of Computational Physics}, 17931 volume = {231}, 17932 number = {2}, 17933 pages = {345 - 363}, 17934 year = {2012}, 17935 issn = {0021-9991}, 17936 doi = {10.1016/j.jcp.2011.09.001}, 17937 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 17938} 17939 17940@Article{ keyesmcinneswoodwardetal13, 17941 title = {Multiphysics Simulations: Challenges and Opportunities}, 17942 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 17943 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 17944 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 17945 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 17946 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 17947 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 17948 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 17949 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 17950 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 17951 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 17952 journal = {International Journal of High Performance Computing Applications}, 17953 month = feb, 17954 year = {2013}, 17955 volume = {27}, 17956 number = {1}, 17957 pages = {4--83}, 17958 doi = {10.1177/1094342012468181}, 17959 note = {Special issue}, 17960 abstract = {We consider multiphysics applications from algorithmic and architectural 17961 perspectives, where ``algorithmic'' includes both mathematical analysis and 17962 computational complexity and ``architectural'' includes both software and hardware 17963 environments. Many diverse multiphysics applications can be reduced, en route to 17964 their computational simulation, to a common algebraic coupling paradigm. 17965 Mathematical analysis of multiphysics coupling in this form is not always 17966 practical for realistic applications, but model problems representative of 17967 applications discussed herein can provide insight. A variety of software 17968 frameworks for multiphysics applications have been constructed and refined within 17969 disciplinary communities and executed on leading-edge computer systems. We examine 17970 several of these, expose some commonalities among them, and attempt to extrapolate 17971 best practices to future systems. From our study, we summarize challenges and 17972 forecast opportunities.} 17973} 17974 17975@Misc{ rosner10, 17976 author = {Robert {Rosner (Chair)}}, 17977 title = {{The Opportunities and Challenges of Exascale Computing}}, 17978 year = {2010}, 17979 howpublished = {Office of Science, U.S. Department of Energy}, 17980 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 17981} 17982 17983@Misc{ kogge2008exascale, 17984 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 17985 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 17986 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 17987 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 17988 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 17989 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 17990 howpublished = {DARPA}, 17991 year = {2008}, 17992 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 17993} 17994 17995@Misc{ doegrandchallengeworkshops, 17996 key = {Office of Science, U.S. Department of Energy}, 17997 title = {{Scientific Grand Challenges Workshop Series}}, 17998 howpublished = {Office of Science, U.S. Department of Energy, see 17999 \url{http://extremecomputing.labworks.org/workshops.stm}} 18000} 18001 18002@Misc{ lawrence2011, 18003 key = {Lawrence}, 18004 title = {{Ernest Orlando Lawrence Award Winners}}, 18005 howpublished = {U.S. Department of Energy, {\footnotesize 18006 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 18007 year = {2011} 18008} 18009 18010@Article{ murphy2000npi, 18011 title = {{A note on preconditioning for indefinite linear systems}}, 18012 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 18013 journal = {SIAM Journal on Scientific Computing}, 18014 volume = {21}, 18015 number = {6}, 18016 pages = {1969--1972}, 18017 year = {2000}, 18018 publisher = {Philadelphia, PA: SIAM, c1993-} 18019} 18020 18021@Article{ elman2011bouyancy, 18022 title = {Fast iterative solvers for buoyancy driven flow problems}, 18023 journal = {Journal of Computational Physics}, 18024 volume = {230}, 18025 number = {10}, 18026 pages = {3900 - 3914}, 18027 year = {2011}, 18028 note = {}, 18029 issn = {0021-9991}, 18030 doi = {10.1016/j.jcp.2011.02.014}, 18031 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 18032 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 18033 Adaptivity, Preconditioning, Algebraic multigrid} 18034} 18035 18036@Article{ dongarrabeckman11, 18037 author = {J. Dongarra and P. Beckman and et al.}, 18038 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 18039 journal = {Int. J. High Perf. Comput. Applics.}, 18040 volume = {25}, 18041 year = {2011}, 18042 pages = {3--60} 18043} 18044 18045@Article{ mandel1999energy, 18046 title = {Energy optimization of algebraic multigrid bases}, 18047 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 18048 journal = {Computing}, 18049 volume = {62}, 18050 number = {3}, 18051 pages = {205--228}, 18052 year = {1999}, 18053 publisher = {Springer} 18054} 18055 18056@Article{ vanek1996algebraic, 18057 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 18058 problems}, 18059 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 18060 journal = {Computing}, 18061 volume = {56}, 18062 number = {3}, 18063 pages = {179--196}, 18064 year = {1996}, 18065 publisher = {Springer} 18066} 18067 18068@Article{ vanek2001convergence, 18069 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 18070 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 18071 journal = {Numerische Mathematik}, 18072 volume = {88}, 18073 number = {3}, 18074 pages = {559--579}, 18075 year = {2001}, 18076 publisher = {Springer} 18077} 18078 18079@Article{ brannick2007algebraic, 18080 title = {Algebraic multigrid methods based on compatible relaxation and energy 18081 minimization}, 18082 author = {Brannick, J. and Zikatanov, L.}, 18083 journal = {Domain decomposition methods in science and engineering XVI}, 18084 pages = {15--26}, 18085 year = {2007}, 18086 publisher = {Springer} 18087} 18088 18089@Article{ brannickfalgout2010, 18090 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 18091 author = {James J. Brannick and Robert D. Falgout}, 18092 journal = {SIAM Journal on Scientific Computing}, 18093 volume = {32}, 18094 number = {3}, 18095 pages = {1393--1416}, 18096 url = {http://epubs.siam.org/doi/10.1137/090772216}, 18097 doi = {10.1137/090772216}, 18098 issn = {1064-8275}, 18099 year = {2010} 18100} 18101 18102@Article{ xu2004energy, 18103 title = {On an energy minimizing basis for algebraic multigrid methods}, 18104 author = {Xu, J. and Zikatanov, L.}, 18105 journal = {Computing and Visualization in Science}, 18106 volume = {7}, 18107 number = {3}, 18108 pages = {121--127}, 18109 year = {2004}, 18110 publisher = {Springer} 18111} 18112 18113@Article{ dblp:journals/toms/bakerhlt09, 18114 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 18115 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 18116 journal = {ACM Trans. Math. Softw.}, 18117 volume = {36}, 18118 number = {3}, 18119 year = {2009}, 18120 doi = {10.1145/1527286.1527287}, 18121 bibsource = {DBLP, http://dblp.uni-trier.de} 18122} 18123 18124@Article{ dblp:journals/siamsc/yanggbllhn05, 18125 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 18126 Parry Husbands and Esmond G. Ng}, 18127 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 18128 journal = {SIAM J. Scientific Computing}, 18129 volume = {27}, 18130 number = {3}, 18131 year = {2005}, 18132 pages = {873-892}, 18133 doi = {10.1137/040613767}, 18134 bibsource = {DBLP, http://dblp.uni-trier.de} 18135} 18136 18137@TechReport{ ml-guide, 18138 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 18139 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 18140 institution = {Sandia National Laboratories}, 18141 year = {2006}, 18142 number = {SAND2006-2649} 18143} 18144 18145@Article{ brannick06, 18146 title = {An energy-based AMG coarsening strategy}, 18147 volume = {13}, 18148 doi = {10.1002/nla.480}, 18149 number = {2-3}, 18150 journal = {Numerical Linear Algebra with Applications}, 18151 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 18152 and Ruge, J}, 18153 year = {2006}, 18154 pages = {133--148} 18155} 18156 18157@Article{ olson10, 18158 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 18159 title = {A new perspective on strength measures in algebraic multigrid}, 18160 journal = {Numerical Linear Algebra with Applications}, 18161 volume = {17}, 18162 number = {4}, 18163 pages = {713--733}, 18164 year = {2010}, 18165 publisher = {John Wiley \& Sons, Ltd.}, 18166 issn = {1099-1506}, 18167 doi = {10.1002/nla.669} 18168} 18169 18170@Article{ olson11, 18171 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 18172 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 18173 Minimization}, 18174 journal = {SIAM J. Sci. Comput.}, 18175 issue_date = {April 2011}, 18176 volume = {33}, 18177 issue = {2}, 18178 month = apr, 18179 year = {2011}, 18180 issn = {1064-8275}, 18181 pages = {966--991}, 18182 numpages = {26}, 18183 doi = {10.1137/100803031}, 18184 acmid = {2078825}, 18185 publisher = {Society for Industrial and Applied Mathematics}, 18186 address = {Philadelphia, PA}, 18187 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 18188 aggregation} 18189} 18190 18191@Article{ dorit2011, 18192 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 18193 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 18194 journal = {Multiscale Modeling {\&} Simulation}, 18195 volume = {9}, 18196 number = {1}, 18197 year = {2011}, 18198 pages = {407-423}, 18199 doi = {10.1137/100791142} 18200} 18201 18202@Article{ chen2011algebraic, 18203 title = {Algebraic distance on graphs}, 18204 author = {Chen, Jie and Safro, Ilya}, 18205 journal = {SIAM Journal on Scientific Computing}, 18206 volume = {33}, 18207 number = {6}, 18208 pages = {3468--3490}, 18209 year = {2011}, 18210 publisher = {SIAM} 18211} 18212 18213@InProceedings{ adams04, 18214 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 18215 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 18216 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 18217 half a billion degrees of freedom}, 18218 note = {Gordon Bell Award}, 18219 year = {2004} 18220} 18221 18222@Article{ adams03a, 18223 author = {Adams, M.~F.}, 18224 journal = {Numerical Linear Algebra with Applications}, 18225 number = {2-3}, 18226 pages = {141-153}, 18227 title = {Algebraic multigrid methods for constrained linear systems with applications to 18228 contact problems in solid mechanics}, 18229 volume = {11}, 18230 year = {2004} 18231} 18232 18233@Article{ adams-10a, 18234 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 18235 doi = {10.1016/j.jcp.2010.04.024}, 18236 issn = {0021-9991}, 18237 journal = {Journal of Computational Physics}, 18238 keywords = {Implicit magnetohydrodynamics}, 18239 number = {18}, 18240 pages = {6208 - 6219}, 18241 title = {Toward textbook multigrid efficiency for fully implicit resistive 18242 magnetohydrodynamics}, 18243 volume = {229}, 18244 year = {2010} 18245} 18246 18247@InProceedings{ adams98, 18248 address = {Copper Mountain, CO}, 18249 author = {Adams, M.~F.}, 18250 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 18251 title = {A Parallel Maximal Independent Set Algorithm}, 18252 year = {1998} 18253} 18254 18255@InProceedings{ madaypatera89, 18256 author = {Y. Maday and A. T. Patera}, 18257 title = {Spectral element methods for the {Navier-Stokes} equations}, 18258 editor = {A. K. Noor and J. T. Oden}, 18259 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 18260 pages = {71-–143}, 18261 publisher = {ASME}, 18262 address = {New York, NY}, 18263 year = {1989} 18264} 18265 18266@Article{ mishra2012mlmcfvm, 18267 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 18268 conservation laws in multi-dimensions}, 18269 journal = {Journal of Computational Physics}, 18270 volume = {231}, 18271 number = {8}, 18272 pages = {3365--3388}, 18273 year = {2012}, 18274 issn = {0021-9991}, 18275 doi = {10.1016/j.jcp.2012.01.011}, 18276 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 18277 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 18278 Carlo, Parallelization} 18279} 18280 18281@Article{ barth2011mlmcfe, 18282 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 18283 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 18284 Switzerland}, 18285 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 18286 stochastic coefficients}, 18287 journal = {Numerische Mathematik}, 18288 publisher = {Springer Berlin / Heidelberg}, 18289 issn = {0029-599X}, 18290 keyword = {Mathematics and Statistics}, 18291 pages = {123-161}, 18292 volume = {119}, 18293 issue = {1}, 18294 doi = {10.1007/s00211-011-0377-0}, 18295 year = {2011} 18296} 18297 18298@Article{ nguyen2011hybridizable, 18299 title = {Hybridizable discontinuous {G}alerkin methods}, 18300 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 18301 journal = {Spectral and High Order Methods for Partial Differential Equations}, 18302 pages = {63--84}, 18303 year = {2011}, 18304 publisher = {Springer} 18305} 18306 18307@Misc{ snyder-scidac3:proposal, 18308 author = {Philip {Snyder (PI)}}, 18309 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 18310 note = {proposal to DOE SciDAC3}, 18311 month = oct, 18312 year = {2011} 18313} 18314 18315@Misc{ wirth-scidac3:proposal, 18316 author = {Brian {Wirth (PI)}}, 18317 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 18318 through Leadership Class Computing}}, 18319 note = {proposal to DOE SciDAC3}, 18320 month = oct, 18321 year = {2011} 18322} 18323 18324@Misc{ cary-scidac3:proposal, 18325 author = {John {Cary (PI)}}, 18326 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 18327 Stability (IMMPACTS)}}, 18328 note = {proposal to DOE SciDAC3}, 18329 month = oct, 18330 year = {2011} 18331} 18332 18333@Misc{ vashista-scidac3:proposal, 18334 author = {Priya {Vashista (PI)}}, 18335 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 18336 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 18337 Multi-Petaflops Simulations}}, 18338 note = {proposal to DOE SciDAC3}, 18339 month = mar, 18340 year = {2012} 18341} 18342 18343@Article{ elemental2012, 18344 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 18345 Robert {v}an~{d}e~{G}eijn}, 18346 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 18347 journal = {{ACM} Transactions on Mathematical Software}, 18348 volume = {39}, 18349 number = {2}, 18350 year = {2013} 18351} 18352 18353@Misc{ elemental-web-page, 18354 author = {Jack Poulson}, 18355 title = {Elemental: Distributed memory dense linear algebra}, 18356 howpublished = {\url{http://libelemental.org}}, 18357 url = {http://libelemental.org/}, 18358 year = {2015} 18359} 18360 18361@Book{ scalesreport, 18362 title = {A Science-based Case for Large-scale Simulation}, 18363 editor = {D. E. Keyes}, 18364 publisher = {U.S. Department of Energy}, 18365 year = {2004}, 18366 url = {http://www.pnl.gov/scales} 18367} 18368 18369@InProceedings{ cilk95, 18370 address = {Santa Barbara, California}, 18371 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 18372 Leiserson and Keith H. Randall and Yuli Zhou}, 18373 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 18374 Parallel Programming (PPoPP)}, 18375 day = {19--21}, 18376 month = jul, 18377 pages = {207--216}, 18378 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 18379 year = {1995} 18380} 18381 18382@Misc{ valgrind-web-page, 18383 author = {Julian Seward}, 18384 title = {Valgrind}, 18385 url = {http://valgrind.org/}, 18386 howpublished = {\url{http://valgrind.org/}}, 18387 year = {2012} 18388} 18389 18390@Article{ blas79, 18391 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 18392 title = {Basic linear algebra subprograms for Fortran usage}, 18393 journal = {ACM Transactions on Mathematical Software}, 18394 volume = {5}, 18395 pages = {308--323}, 18396 year = {1979} 18397} 18398 18399@TechReport{ lapack90, 18400 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 18401 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 18402 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 18403 institution = {Computer Science Dept., University of Tennessee}, 18404 number = {CS-90-105}, 18405 month = may, 18406 year = {1990} 18407} 18408 18409@TechReport{ nvidiafermi, 18410 author = {NVIDIA}, 18411 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 18412 institution = {NVIDIA}, 18413 year = {2009} 18414} 18415 18416@Misc{ intelmic, 18417 author = {Many Core Group, Cambridge University}, 18418 title = {Intel Many Integrated Core Architecture}, 18419 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 18420 month = dec, 18421 year = {2010} 18422} 18423 18424@Article{ abusufahkucklawrie81, 18425 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 18426 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 18427 Transformations}, 18428 journal = {IEEE Trans. Comput.}, 18429 volume = {30}, 18430 number = {5}, 18431 pages = {341--356}, 18432 year = {1981} 18433} 18434 18435@InProceedings{ guobikshandifraguelagarzaranpadua08, 18436 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 18437 and Padua, David}, 18438 title = {Programming with tiles}, 18439 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 18440 parallel programming}, 18441 series = {PPoPP '08}, 18442 year = {2008}, 18443 isbn = {978-1-59593-795-7}, 18444 location = {Salt Lake City, UT}, 18445 pages = {111--122}, 18446 numpages = {12}, 18447 doi = {10.1145/1345206.1345225}, 18448 acmid = {1345225}, 18449 publisher = {ACM}, 18450 address = {New York, NY} 18451} 18452 18453@Article{ strout04, 18454 journal = {International Journal of High Performance Computing Applications}, 18455 year = {2004}, 18456 title = {Sparse Tiling for Stationary Iterative Methods}, 18457 month = feb, 18458 publisher = {Sage Publications}, 18459 pages = {95-114}, 18460 volume = {18}, 18461 number = {1}, 18462 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 18463} 18464 18465@Misc{ openclstandard, 18466 author = {Khronos Group}, 18467 title = {{OpenCL} 1.2 Specification}, 18468 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 18469 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 18470 year = {2011} 18471} 18472 18473@Misc{ stlguide, 18474 author = {SGI}, 18475 title = {Standard Template Library Programmer's Guide}, 18476 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 18477 url = {http://www.sgi.com/tech/stl/}, 18478 year = {2011} 18479} 18480 18481@Book{ stepanov09, 18482 author = {Alexander Stepanov and Paul McJones}, 18483 title = {Elements of Programming}, 18484 publisher = {Addison-Wesley}, 18485 isbn = {978-0-321-63537-2}, 18486 year = {2009} 18487} 18488 18489@Article{ bangerthhartmannkanschat2007, 18490 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18491 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 18492 journal = {ACM Trans. Math. Softw.}, 18493 year = {2007}, 18494 volume = {33}, 18495 number = {4}, 18496 pages = {24/1--24/27} 18497} 18498 18499@Misc{ dealii-web-page, 18500 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18501 title = {{deal.II}}, 18502 howpublished = {\url{http://www.dealii.org/}}, 18503 url = {http://www.dealii.org/}, 18504 year = {2012} 18505} 18506 18507@InBook{ siek2012, 18508 title = {The C++0x ``Concepts'' Effort}, 18509 author = {Jeremy G. Siek}, 18510 editor = {Jeremy Gibbons}, 18511 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 18512 UK, March 22-26, 2010, Revised Lectures}, 18513 pages = {175--216}, 18514 isbn = {978-3-642-32202-0}, 18515 doi = {10.1007/978-3-642-32202-0_4}, 18516 url = {http://arxiv.org/abs/1201.0027}, 18517 note = {\url{http://arxiv.org/abs/1201.0027}}, 18518 publisher = {Springer Berlin Heidelberg}, 18519 year = {2012} 18520} 18521 18522@Misc{ sharpclaw, 18523 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 18524 author = {Ketcheson, D. I. and Parsani, M.}, 18525 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18526 PDEs,sharpclaw,software}, 18527 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18528 PDEs,sharpclaw,software}, 18529 title = {{SharpClaw software}}, 18530 year = {2011} 18531} 18532 18533@Book{ leveque2002, 18534 title = {Finite volume methods for hyperbolic problems}, 18535 author = {Randall J LeVeque}, 18536 volume = {31}, 18537 year = {2002} 18538} 18539 18540@Misc{ clawpack45, 18541 note = {\url{http://www.clawpack.org}}, 18542 author = {LeVeque, R. J. and Berger, M. J.}, 18543 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 18544 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 18545 title = {{Clawpack Software version 4.5}}, 18546 url = {www.clawpack.org}, 18547 year = {2011} 18548} 18549 18550@Article{ nilsen2010, 18551 archiveprefix = {arXiv}, 18552 arxivid = {arXiv:1002.0705v1}, 18553 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 18554 eprint = {arXiv:1002.0705v1}, 18555 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 18556 parallelization of scientific codes by a function-centric approach in 18557 Python.pdf:pdf}, 18558 journal = {Computational Science \& Discovery}, 18559 keywords = {parallel,programming,python,software}, 18560 mendeley-tags = {parallel,programming,python,software}, 18561 pages = {015003}, 18562 publisher = {IOP Publishing}, 18563 title = {{Simplifying the parallelization of scientific codes by a function-centric 18564 approach in Python}}, 18565 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 18566 volume = {3}, 18567 year = {2010} 18568} 18569 18570@Book{ langtangen09, 18571 author = {Hans Petter Langtangen}, 18572 title = {Python Scripting for Computational Science}, 18573 publisher = {Springer}, 18574 series = {Texts in Computational Science and Engineering}, 18575 pages = {784}, 18576 isbn = {3540739157}, 18577 year = {2009} 18578} 18579 18580@Book{ numpyguide, 18581 author = {Travis E. Oliphant}, 18582 title = {Guide to {N}umpy}, 18583 publisher = {Trelgol}, 18584 year = {2008} 18585} 18586 18587@Misc{ pycuda, 18588 author = {Andreas Kl\"ockner}, 18589 title = {{PyCUDA}}, 18590 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 18591 year = {2011} 18592} 18593 18594@Misc{ pyopencl, 18595 author = {Andreas Kl\"ockner}, 18596 title = {{PyOpenCL}}, 18597 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 18598 year = {2011} 18599} 18600 18601@Article{ klockner2012, 18602 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 18603 Paul Ivanov and Ahmed Fasih}, 18604 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 18605 generation}, 18606 journal = {Parallel Computing}, 18607 volume = {38}, 18608 number = {3}, 18609 pages = {157--174}, 18610 year = {2012}, 18611 issn = {0167-8191}, 18612 doi = {10.1016/j.parco.2011.09.001} 18613} 18614 18615%%%%%% Matt Stuff %%%%%% 18616@Article{ morrabozdagknepleyrassvesselinov, 18617 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 18618 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 18619 Velimir Vesselinov}, 18620 journal = {Eos}, 18621 volume = {102}, 18622 doi = {10.1029/2021EO159258}, 18623 month = {Jun}, 18624 year = {2021} 18625} 18626 18627@Misc{ knepley:icerm-workshop:2012, 18628 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 18629 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 18630 Models for Large-scale Simulations}, 18631 note = {Workshop sponsored by the Institute for Computational and Experimental Research 18632 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 18633 \url{http://icerm.brown.edu/tw12-1-exascale}}, 18634 year = {2012} 18635} 18636 18637@TechReport{ kirbyknepleyscott04, 18638 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18639 title = {Optimal Evaluation of Finite Element Matrices}, 18640 type = {Technical Report}, 18641 number = {TR-2004-04}, 18642 institution = {University of Chicago}, 18643 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 18644 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 18645 pages = {14}, 18646 month = may, 18647 year = {2004} 18648} 18649 18650@TechReport{ kirbyknepleyscott10, 18651 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18652 title = {Languages and Compilers for Variational Forms}, 18653 type = {Technical Report}, 18654 number = {TR-2010-09}, 18655 institution = {University of Chicago}, 18656 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 18657 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 18658 month = oct, 18659 year = {2010} 18660} 18661 18662@TechReport{ kirbyknepleyscott10b, 18663 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18664 title = {Evaluation of the Action of Finite Element Operators}, 18665 type = {Technical Report}, 18666 number = {TR-2010-08}, 18667 institution = {University of Chicago}, 18668 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 18669 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 18670 month = oct, 18671 year = {2010} 18672} 18673 18674@TechReport{ bruneknepleyscott11, 18675 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18676 title = {Exponential grids in high-dimensional space}, 18677 type = {Technical Report}, 18678 number = {TR-2011-07}, 18679 institution = {University of Chicago}, 18680 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 18681 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 18682 month = dec, 18683 year = {2011} 18684} 18685 18686@TechReport{ zheng11, 18687 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 18688 Zhang and Yaolin Shi}, 18689 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 18690 strongly variable viscosity based on {Matlab} and {CUDA}}, 18691 type = {Research Report}, 18692 number = {UMSI 2011/33}, 18693 institution = {University of Minnesota Supercomputing Institute}, 18694 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 18695 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 18696 month = mar, 18697 year = {2011} 18698} 18699 18700@InProceedings{ zheng2010, 18701 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 18702 Zhang and Yaolin Shi}, 18703 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 18704 booktitle = {Eos Transactions of the AGU}, 18705 organization = {American Geophysical Union}, 18706 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 18707 year = {2010} 18708} 18709 18710@InCollection{ terrelkirbyknepleyscott12, 18711 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 18712 and Garth N. Wells}, 18713 title = {Finite elements for incompressible fluids}, 18714 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18715 booktitle = {Automated solutions of differential equations by the finite element method}, 18716 series = {Lecture Notes in Computational Science and Engineering}, 18717 volume = {84}, 18718 pages = {163--169}, 18719 publisher = {Springer-Verlag}, 18720 year = {2012} 18721} 18722 18723@InCollection{ mardalhaga12, 18724 author = {Kent-Andre Mardal and Joachim Berdal Haga}, 18725 title = {Block preconditioning of systems of PDEs}, 18726 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18727 booktitle = {Automated solutions of differential equations by the finite element method}, 18728 series = {Lecture Notes in Computational Science and Engineering}, 18729 volume = {84}, 18730 pages = {643--655}, 18731 publisher = {Springer-Verlag}, 18732 year = {2012} 18733} 18734 18735@InCollection{ kirbyknepleyloggscottterrel12, 18736 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 18737 Andy R. Terrel}, 18738 title = {Discrete optimization of finite element matrix evaluation}, 18739 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18740 booktitle = {Automated solutions of differential equations by the finite element method}, 18741 series = {Lecture Notes in Computational Science and Engineering}, 18742 volume = {84}, 18743 pages = {385--397}, 18744 publisher = {Springer-Verlag}, 18745 year = {2012} 18746} 18747 18748@InCollection{ kirby12, 18749 author = {Robert C. Kirby}, 18750 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 18751 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18752 booktitle = {Automated solutions of differential equations by the finite element method}, 18753 series = {Lecture Notes in Computational Science and Engineering}, 18754 volume = {84}, 18755 publisher = {Springer-Verlag}, 18756 year = {2012} 18757} 18758 18759@Article{ brownconveryhotesknepleypetropolous1993, 18760 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 18761 Labros Petropolous}, 18762 title = {Closed strings with low harmonics and kinks}, 18763 journal = {Physical Review D}, 18764 volume = {48}, 18765 number = {6}, 18766 year = {1993} 18767} 18768 18769@Article{ minimax1996, 18770 title = {MiniMax: What has been learned thus far}, 18771 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 18772 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 18773 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 18774 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 18775 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 18776 journal = {Nuovo Cimento}, 18777 volume = {19}, 18778 number = {1}, 18779 pages = {1045--1049}, 18780 year = {1996} 18781} 18782 18783@Article{ minimax1997, 18784 author = {Minimax Collaboration}, 18785 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 18786 Production}, 18787 journal = {Physical Review D}, 18788 volume = {55}, 18789 number = {9}, 18790 year = {1997} 18791} 18792 18793@Article{ minimax2000, 18794 author = {Minimax Collaboration}, 18795 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 18796 journal = {Physical Review D}, 18797 volume = {61}, 18798 number = {3}, 18799 year = {2000} 18800} 18801 18802@Article{ kirbyknepleyloggscott05, 18803 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 18804 title = {Optimizing the evaluation of finite element matrices}, 18805 journal = {SIAM Journal on Scientific Computing}, 18806 volume = {27}, 18807 number = {3}, 18808 pages = {741--758}, 18809 year = {2005} 18810} 18811 18812@Article{ bardhanknepleyanitescu2008, 18813 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 18814 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 18815 of Molecular Solvation}, 18816 journal = {Journal of Chemical Physics}, 18817 volume = {130}, 18818 number = {10}, 18819 pages = {104108}, 18820 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 18821 Research}, 18822 doi = {10.1063/1.3081148}, 18823 year = {2008} 18824} 18825 18826%Poster at Biophysical Society Fall Meeting 18827@Article{ bardhanknepley2017, 18828 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18829 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 18830 Hydration-Shell {Poisson}-{Boltzmann} Model}, 18831 journal = {Biophysical Journal}, 18832 volume = {110}, 18833 number = {3}, 18834 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 18835 doi = {10.1016/j.bpj.2015.11.1766}, 18836 year = {2017} 18837} 18838 18839@Article{ tabrizirahimigoossensknepleybardhan2018, 18840 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 18841 Interface Condition (SLIC) Continuum Dielectric Model}, 18842 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 18843 Matthew G. Knepley and Jaydeep P. Bardhan}, 18844 journal = {International Journal of Quantum Chemistry}, 18845 note = {Accepted}, 18846 year = {2018} 18847} 18848 18849@Article{ knepley2010, 18850 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 18851 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 18852 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 18853 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 18854 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 18855 title = {{Reproducible Research: addressing the need for data and code sharing in 18856 computational science}}, 18857 journal = {Computing in Science and Engineering}, 18858 volume = {12}, 18859 number = {5}, 18860 pages = {8--13}, 18861 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 18862 year = {2010} 18863} 18864 18865@Article{ ketchesonahmadiaknepley2011, 18866 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 18867 Hyperbolic PDE Codes}, 18868 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 18869 journal = {SIAM News}, 18870 volume = {44}, 18871 number = {7}, 18872 month = sep, 18873 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 18874 year = {2011} 18875} 18876 18877@Article{ yokotabardhanknepleybarbahamada2011, 18878 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 18879 Tsuyoshi Hamada}, 18880 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 18881 a billion unknowns}, 18882 journal = {Computer Physics Communications}, 18883 volume = {182}, 18884 number = {6}, 18885 pages = {1272--1283}, 18886 year = {2011}, 18887 issn = {0010-4655}, 18888 doi = {10.1016/j.cpc.2011.02.013}, 18889 url = {http://arxiv.org/abs/1007.4591} 18890} 18891 18892@Article{ bardhanknepley2011, 18893 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18894 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 18895 Results for Spherical Inclusions}, 18896 journal = {Journal of Chemical Physics}, 18897 volume = {135}, 18898 number = {12}, 18899 pages = {124107--124117}, 18900 url = {http://arxiv.org/abs/1109.0651}, 18901 note = {\url{http://arxiv.org/abs/1109.0651}}, 18902 year = {2011} 18903} 18904 18905@Article{ bruneknepleyscott2013, 18906 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18907 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 18908 Graded Meshes}, 18909 journal = {SIAM Journal on Scientific Computing}, 18910 url = {http://arxiv.org/abs/1104.0261}, 18911 note = {\url{http://arxiv.org/abs/1104.0261}}, 18912 volume = {35}, 18913 number = {1}, 18914 pages = {A173--A191}, 18915 year = {2013} 18916} 18917 18918@Article{ bardhanknepley2012a, 18919 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18920 title = {Computational science and re-discovery: open-source implementations of 18921 ellipsoidal harmonics for problems in potential theory}, 18922 journal = {Computational Science \& Discovery}, 18923 volume = {5}, 18924 pages = {014006}, 18925 note = {\url{http://arxiv.org/abs/1204.0267}}, 18926 doi = {10.1088/1749-4699/5/1/014006}, 18927 year = {2012} 18928} 18929 18930@Article{ kreienkampetal2013, 18931 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 18932 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 18933 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 18934 contributions of molecular binding}, 18935 journal = {Molecular Based Mathematical Biology}, 18936 volume = {1}, 18937 pages = {124--150}, 18938 doi = {10.2478/mlbmb-2013-0007}, 18939 issn = {2299-3266}, 18940 month = jun, 18941 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 18942 year = {2013} 18943} 18944 18945@Article{ bardhanknepleybrune2015, 18946 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 18947 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 18948 Boundary-Integral Operators}, 18949 journal = {Molecular Based Mathematical Biology}, 18950 volume = {3}, 18951 number = {1}, 18952 pages = {1--22}, 18953 doi = {10.1515/mlbmb-2015-0001}, 18954 year = {2015} 18955} 18956 18957@Article{ bardhanknepley14, 18958 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18959 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 18960 Conditions}, 18961 journal = {Journal of Chemical Physics}, 18962 volume = {141}, 18963 number = {13}, 18964 pages = {131103}, 18965 doi = {10.1063/1.4897324}, 18966 year = {2014} 18967} 18968 18969@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 18970 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 18971 Electrostatics}, 18972 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 18973 Matthew G. Knepley}, 18974 booktitle = {Proceedings of PIERS}, 18975 pages = {1215--1221}, 18976 month = jul, 18977 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 18978 year = {2015} 18979} 18980 18981@Article{ tabriziknepleybardhan2016, 18982 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 18983 condition at the solute-solvent interface}, 18984 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 18985 journal = {Molecular Physics}, 18986 volume = {114}, 18987 number = {16-17}, 18988 pages = {2558--2567}, 18989 doi = {10.1080/00268976.2016.1198503}, 18990 year = {2016} 18991} 18992 18993% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 18994@Article{ tabrizigoossensrahimiknepleybardhan2017, 18995 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 18996 Mixtures Using a Solvation-Layer Interface Condition}, 18997 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 18998 Matthew G. Knepley and Jaydeep P. Bardhan}, 18999 journal = {Journal of Chemical Physics}, 19000 volume = {146}, 19001 number = {9}, 19002 pages = {094103}, 19003 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 19004 eprint = {https://arxiv.org/abs/1611.02150}, 19005 doi = {10.1063/1.4977037}, 19006 note = {PMCID: PMC5336475}, 19007 year = {2017} 19008} 19009 19010@Article{ tabrizigoossenscooperknepleybardhan2017, 19011 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 19012 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 19013 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 19014 Matthew G. Knepley and Jaydeep P. Bardhan}, 19015 number = {6}, 19016 pages = {2897--2914}, 19017 journal = {Journal of Chemical Theory and Computation}, 19018 year = {2017} 19019} 19020 19021@InProceedings{ mcclanahan2011, 19022 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 19023 K and Vuduc, Richard}, 19024 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 19025 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 19026 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 19027 year = {2011} 19028} 19029 19030@Article{ ghyselsashbymeerbergenvanroose2013, 19031 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 19032 title = {Hiding global communication latency in the {GMRES} algorithm on massively 19033 parallel machines}, 19034 journal = {SIAM Journal on Scientific Computing}, 19035 volume = {35}, 19036 number = {1}, 19037 pages = {C48--C71}, 19038 year = {2013} 19039} 19040 19041@Article{ ghyselsvanroose2014, 19042 author = {P. Ghysels and W. Vanroose}, 19043 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 19044 Algorithm}, 19045 journal = {Parallel Computing}, 19046 volume = {40}, 19047 number = {7}, 19048 pages = {224--238}, 19049 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 19050 doi = {10.1016/j.parco.2013.06.001}, 19051 year = {2014} 19052} 19053 19054@InProceedings{ strzodkagoddeke06, 19055 author = {R. Strzodka and D. G\"oddeke}, 19056 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 19057 from Low Precision Components}, 19058 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 19059 Computing Machines}, 19060 note = {FCCM ’06}, 19061 pages = {259--270}, 19062 year = {2006}, 19063 organization = {IEEE Computer Society} 19064} 19065 19066@InCollection{ jacquesnicolasvollaire12, 19067 author = {T. Jacques and L. Nicolas and C. Vollaire}, 19068 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 19069 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 19070 booktitle = {High-Performance Computing and Networking}, 19071 series = {Lecture Notes in Computer Science}, 19072 volume = {1593}, 19073 pages = {1025--1031}, 19074 publisher = {Springer}, 19075 year = {1999} 19076} 19077 19078@InProceedings{ hoeflerlumsdainerehm07, 19079 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 19080 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 19081 for MPI}}, 19082 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 19083 Networking, Storage and Analysis, SC07}, 19084 location = {Reno, NV}, 19085 publisher = {IEEE Computer Society/ACM}, 19086 source = {http://www.unixer.de/~htor/publications/}, 19087 month = nov, 19088 year = {2007} 19089} 19090 19091@InProceedings{ hoeflersiebretlumsdaine10, 19092 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 19093 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 19094 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 19095 Parallel Programming (PPoPP'10)}, 19096 month = jan, 19097 location = {Bangalore, India}, 19098 publisher = {ACM}, 19099 isbn = {978-1-60558-708-0}, 19100 source = {http://www.unixer.de/~htor/publications/}, 19101 pages = {159--168}, 19102 year = {2010} 19103} 19104 19105@Article{ ruppweinbubjungelgrasser15, 19106 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 19107 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 19108 journal = {ACM Transactions on Mathematical Software (TOMS)}, 19109 volume = {43}, 19110 number = {2}, 19111 pages = {11}, 19112 year = {2016}, 19113 publisher = {ACM} 19114} 19115 19116@Article{ bai_hu_reichel_1994, 19117 title = {A {Newton} basis {GMRES} implementation}, 19118 volume = {14}, 19119 url = {}, 19120 number = {}, 19121 journal = {IMA Journal of Numerical Analysis}, 19122 author = {Z. Bai and D. Hu and L. Reichel}, 19123 year = {1994}, 19124 pages = {563--581} 19125} 19126 19127@Article{ chronopoulos_gear_1989, 19128 title = {{S-step} iterative methods for symmetric linear systems}, 19129 volume = {25}, 19130 url = {}, 19131 number = {}, 19132 journal = {Journal of Computational and Applied Mathematics}, 19133 author = {A. T. Chronopoulos and C. W. Gear}, 19134 year = {1989}, 19135 pages = {153--168} 19136} 19137 19138@Article{ chronopoulos_1996, 19139 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 19140 author = {A. T. Chronopoulos and C. D. Swanson}, 19141 journal = {Parallel Computing}, 19142 volume = {22}, 19143 number = {5}, 19144 year = {1996}, 19145 pages = {623--641} 19146} 19147 19148@Article{ chronopoulos_2010, 19149 author = {A. T. Chronopoulos and A. Kucherov}, 19150 title = {Block {S-step} {Krylov} Iterative Methods}, 19151 journal = {Numerical Linear Algebra with Applications}, 19152 volume = {17}, 19153 number = {1}, 19154 pages = {3--15}, 19155 year = {2010} 19156} 19157 19158@Article{ sturler_vorst_1995, 19159 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 19160 distributed memory computers}, 19161 volume = {18}, 19162 url = {}, 19163 number = {}, 19164 journal = {Applied Numerical Mathematics}, 19165 author = {E. De Sturler and H. A. van der Vorst}, 19166 year = {1995}, 19167 pages = {441--459} 19168} 19169 19170@Article{ joubert_carey_1992, 19171 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 19172 I: Theory}, 19173 volume = {44}, 19174 url = {}, 19175 number = {}, 19176 journal = {International journal of computer mathematics}, 19177 author = {W. D. Joubert and G. F. Carey}, 19178 year = {1992}, 19179 pages = {243--267} 19180} 19181 19182@Article{ elman_saadsaylor_1986, 19183 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 19184 of linear equations}, 19185 volume = {7}, 19186 url = {}, 19187 number = {3}, 19188 journal = {SIAM Journal on Scientific and Statistical Computing}, 19189 author = {Howard Elman and Y. Saad and P. E. Saylor}, 19190 year = {1986}, 19191 pages = {840--855} 19192} 19193 19194@Article{ golub95innerand, 19195 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 19196 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 19197 journal = {SIAM J. Numer. Anal}, 19198 year = {1995}, 19199 volume = {35}, 19200 pages = {300--319} 19201} 19202 19203@Article{ golub_varga_1961, 19204 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 19205 and second-order {Richardson} iterative methods, parts {I} and {II}}, 19206 volume = {3}, 19207 url = {}, 19208 number = {}, 19209 journal = {Numer. Math.}, 19210 author = {Gene Golub and R.S. Varga}, 19211 year = {1961}, 19212 pages = {147--168} 19213} 19214 19215@Article{ el_maliki_guenette_fortin_2011, 19216 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 19217 element problems}, 19218 volume = {18}, 19219 doi = {10.1002/nla.757}, 19220 number = {5}, 19221 journal = {Numerical Linear Algebra with Applications}, 19222 author = {A. {El maliki} and R. Guenette and M. Fortin}, 19223 year = {2011}, 19224 pages = {789-803} 19225} 19226 19227@Article{ adavani2008multigrid, 19228 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 19229 Constraints}, 19230 author = {Adavani, S.S. and Biros, G.}, 19231 journal = {SIAM Journal on Scientific Computing}, 19232 volume = {31}, 19233 number = {1}, 19234 pages = {369--397}, 19235 year = {2008}, 19236 publisher = {Society for Industrial and Applied Mathematics} 19237} 19238 19239@Article{ horton1995space, 19240 title = {A space-time multigrid method for parabolic {PDE}s}, 19241 author = {Horton, G. and Vandewalle, S.}, 19242 journal = {SIAM Journal on Scientific Computing}, 19243 volume = {16}, 19244 number = {4}, 19245 pages = {848--864}, 19246 year = {1995} 19247} 19248 19249@Article{ lewis2005model, 19250 title = {Model problems for the multigrid optimization of systems governed by differential 19251 equations}, 19252 author = {Lewis, R.M. and Nash, S.G.}, 19253 journal = {SIAM Journal on Scientific Computing}, 19254 volume = {26}, 19255 number = {6}, 19256 pages = {1811--1837}, 19257 year = {2005}, 19258 publisher = {Philadelphia, PA: SIAM, c1993-} 19259} 19260 19261@Article{ nash2000mgopt, 19262 title = {A multigrid approach to discretized optimization problems}, 19263 author = {Nash, S.G.}, 19264 journal = {Optimization Methods and Software}, 19265 volume = {14}, 19266 number = {1-2}, 19267 pages = {99--116}, 19268 year = {2000}, 19269 publisher = {Taylor \& Francis} 19270} 19271 19272@Article{ borzi2009multigrid, 19273 title = {Multigrid Methods for {PDE} Optimization}, 19274 author = {Borz{\`i}, A. and Schulz, V.}, 19275 journal = {SIAM Review}, 19276 volume = {51}, 19277 pages = {361}, 19278 year = {2009} 19279} 19280 19281@Article{ borzi2005multigrid, 19282 title = {A multigrid scheme for elliptic constrained optimal control problems}, 19283 author = {Borz{\`i}, A. and Kunisch, K.}, 19284 journal = {Computational Optimization and Applications}, 19285 volume = {31}, 19286 number = {3}, 19287 pages = {309--333}, 19288 year = {2005}, 19289 publisher = {Springer} 19290} 19291 19292@Article{ borzi2003multigrid, 19293 title = {Multigrid methods for parabolic distributed optimal control problems}, 19294 author = {Borz{\`i}, A.}, 19295 journal = {Journal of Computational and Applied Mathematics}, 19296 volume = {157}, 19297 number = {2}, 19298 pages = {365--382}, 19299 year = {2003}, 19300 publisher = {Elsevier} 19301} 19302 19303@Article{ ito2002receding, 19304 title = {Receding horizon optimal control for infinite dimensional systems}, 19305 author = {Ito, K. and Kunisch, K.}, 19306 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 19307 volume = {8}, 19308 number = {1}, 19309 pages = {741--760}, 19310 year = {2002}, 19311 publisher = {Cambridge University Press} 19312} 19313 19314@Article{ schulz1998solving, 19315 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 19316 author = {Schulz, V.H.}, 19317 journal = {Computing and Visualization in Science}, 19318 volume = {1}, 19319 number = {2}, 19320 pages = {83--96}, 19321 year = {1998}, 19322 publisher = {Springer} 19323} 19324 19325@Article{ hazra2005aerodynamic, 19326 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 19327 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 19328 journal = {Journal of Computational Physics}, 19329 volume = {204}, 19330 number = {1}, 19331 pages = {46--64}, 19332 year = {2005}, 19333 publisher = {Elsevier} 19334} 19335 19336@Article{ mandel1985multilevel, 19337 title = {On multilevel iterative methods for integral equations of the second kind and 19338 related problems}, 19339 author = {Mandel, J.}, 19340 journal = {Numerische Mathematik}, 19341 volume = {46}, 19342 number = {1}, 19343 pages = {147--157}, 19344 year = {1985}, 19345 publisher = {Springer} 19346} 19347 19348@Article{ king1992multilevel, 19349 title = {Multilevel algorithms for ill-posed problems}, 19350 author = {King, J.T.}, 19351 journal = {Numerische Mathematik}, 19352 volume = {61}, 19353 number = {1}, 19354 pages = {311--334}, 19355 year = {1992}, 19356 publisher = {Springer} 19357} 19358 19359@Article{ kaltenbacher2001regularizing, 19360 title = {On the regularizing properties of a full multigrid method for ill-posed 19361 problems}, 19362 author = {Kaltenbacher, B.}, 19363 journal = {Inverse Problems}, 19364 volume = {17}, 19365 pages = {767}, 19366 year = {2001}, 19367 publisher = {IOP Publishing} 19368} 19369 19370@Article{ kaltenbacher2002multi, 19371 title = {A multi-grid method with a priori and a posteriori level choice for the 19372 regularization of nonlinear ill-posed problems}, 19373 author = {Kaltenbacher, B. and Schicho, J.}, 19374 journal = {Numerische Mathematik}, 19375 volume = {93}, 19376 number = {1}, 19377 pages = {77--107}, 19378 year = {2002}, 19379 publisher = {Springer} 19380} 19381 19382@Article{ burger2006regularizing, 19383 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 19384 author = {Burger, M. and Kaltenbacher, B.}, 19385 journal = {SIAM Journal on Numerical Analysis}, 19386 volume = {44}, 19387 pages = {153}, 19388 year = {2006} 19389} 19390 19391@Article{ draganescu2008optimal, 19392 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 19393 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 19394 journal = {Mathematics of Computation}, 19395 volume = {77}, 19396 number = {264}, 19397 pages = {2001--2038}, 19398 year = {2008} 19399} 19400 19401@Article{ bastian1998additive, 19402 title = {Additive and multiplicative multi-grid---a comparison}, 19403 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 19404 journal = {Computing}, 19405 volume = {60}, 19406 number = {4}, 19407 pages = {345--364}, 19408 year = {1998}, 19409 publisher = {Springer} 19410} 19411 19412@Article{ fournier2001multiplicative, 19413 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 19414 compressible flow computations on unstructured meshes}, 19415 author = {Fournier, L. and Lanteri, S.}, 19416 journal = {Applied Numerical Mathematics}, 19417 volume = {36}, 19418 number = {4}, 19419 pages = {401--426}, 19420 year = {2001}, 19421 publisher = {Elsevier} 19422} 19423 19424@Article{ chow2006survey, 19425 title = {A survey of parallelization techniques for multigrid solvers}, 19426 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 19427 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 19428 Simon, eds}, 19429 volume = {20}, 19430 pages = {179--201}, 19431 year = {2006} 19432} 19433 19434@InBook{ brandt2001multiscale, 19435 title = {Multiscale scientific computation: {R}eview 2001}, 19436 author = {Brandt, A.}, 19437 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 19438 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 19439 series = {Lecture Notes in Computational Science and Engineering}, 19440 year = {2001}, 19441 volume = {20}, 19442 pages = {3--96}, 19443 publisher = {Springer Verlag} 19444} 19445 19446@InCollection{ brandt2003multigrid, 19447 title = {Multigrid solvers and multilevel optimization strategies}, 19448 author = {Brandt, A. and Ron, D.}, 19449 booktitle = {Multilevel Optimization and VLSICAD}, 19450 editors = {J. Cong and J.R. Shinnerl}, 19451 pages = {1--69}, 19452 publisher = {Kluwer Academic Publishers}, 19453 year = {2003} 19454} 19455 19456@InBook{ brandt2009principles, 19457 title = {Principles of systematic upscaling}, 19458 author = {Brandt, A.}, 19459 booktitle = {Bridging the Scales in Science and Engineering}, 19460 editors = {J. Fish}, 19461 publisher = {Oxford University Press}, 19462 pages = {193--215}, 19463 year = {2009} 19464} 19465 19466@Article{ livne2004coarsening, 19467 title = {Coarsening by compatible relaxation}, 19468 author = {Livne, O.E.}, 19469 journal = {Numerical Linear Algebra with Applications}, 19470 volume = {11}, 19471 number = {2-3}, 19472 pages = {205--227}, 19473 year = {2004}, 19474 publisher = {Wiley Online Library} 19475} 19476 19477@InProceedings{ brandt1986stochastic, 19478 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 19479 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 19480 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 19481 Methods, held at Cologne, October 1-4, 1985}, 19482 volume = {1228}, 19483 pages = {65--98}, 19484 year = {1986}, 19485 organization = {Springer} 19486} 19487 19488@Article{ halko2011finding, 19489 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 19490 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 19491 Approximate Matrix Decompositions}, 19492 journal = {SIAM Review}, 19493 volume = {53}, 19494 number = {2}, 19495 year = {2011}, 19496 pages = {217-288}, 19497 doi = {10.1137/090771806} 19498} 19499 19500@InProceedings{ mhdy09, 19501 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 19502 booktitle = {Proceedings of SC09}, 19503 organization = {ACM}, 19504 title = {Minimizing communication in sparse matrix solvers}, 19505 doi = {10.1145/1654059.1654096}, 19506 year = {2009} 19507} 19508 19509@InProceedings{ vanrosendale83, 19510 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 19511 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 19512 author = {J. van Rosendale}, 19513 year = {1983}, 19514 publisher = {IEEE Computer Society} 19515} 19516 19517@PhDThesis{ vuduc95, 19518 title = {Quantitative performance modeling of scientific computations and creating 19519 locality in numerical algorithms}, 19520 author = {R. Vuduc}, 19521 journal = {Massachusetts Institute of Technology}, 19522 school = {Massachusetts Institute of Technology}, 19523 year = {1995} 19524} 19525 19526@Article{ simoncini2003flexible, 19527 title = {Flexible inner-outer {Krylov} subspace methods}, 19528 author = {Simoncini, V. and Szyld, D.B.}, 19529 journal = {SIAM Journal on Numerical Analysis}, 19530 pages = {2219--2239}, 19531 year = {2003}, 19532 publisher = {JSTOR} 19533} 19534 19535@Article{ parks2006recycling, 19536 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 19537 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 19538 journal = {SIAM Journal on Scientific Computing}, 19539 volume = {28}, 19540 number = {5}, 19541 pages = {1651--1674}, 19542 year = {2006}, 19543 publisher = {Society for Industrial and Applied Mathematics} 19544} 19545 19546@Article{ freund2003model, 19547 title = {Model reduction methods based on Krylov subspaces}, 19548 author = {Freund, R.W.}, 19549 journal = {Acta Numerica}, 19550 volume = {12}, 19551 number = {1}, 19552 pages = {267--319}, 19553 year = {2003}, 19554 publisher = {Cambridge Univ Press} 19555} 19556 19557@InBook{ gutknecht2006block, 19558 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 19559 an introduction}, 19560 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 19561 author = {Gutknecht, M.H.}, 19562 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 19563 publisher = {Anamaya Publishers}, 19564 location = {New Delhi}, 19565 pages = {420-447}, 19566 year = {2006} 19567} 19568 19569@Article{ moulton1998black, 19570 title = {The black box multigrid numerical homogenization algorithm}, 19571 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 19572 journal = {Journal of Computational Physics}, 19573 volume = {142}, 19574 number = {1}, 19575 pages = {80--108}, 19576 year = {1998}, 19577 publisher = {Elsevier} 19578} 19579 19580@Article{ neuss2001homogenization, 19581 title = {Homogenization and multigrid}, 19582 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 19583 journal = {Computing}, 19584 volume = {66}, 19585 number = {1}, 19586 pages = {1--26}, 19587 year = {2001}, 19588 publisher = {Springer} 19589} 19590 19591@Article{ bai2002krylov, 19592 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 19593 systems}, 19594 author = {Bai, Z.}, 19595 journal = {Applied Numerical Mathematics}, 19596 volume = {43}, 19597 number = {1}, 19598 pages = {9--44}, 19599 year = {2002}, 19600 publisher = {Elsevier} 19601} 19602 19603@InProceedings{ dong2003piecewise, 19604 title = {Piecewise polynomial nonlinear model reduction}, 19605 author = {Dong, N. and Roychowdhury, J.}, 19606 booktitle = {Design Automation Conference, 2003. Proceedings}, 19607 pages = {484--489}, 19608 year = {2003}, 19609 organization = {IEEE} 19610} 19611 19612@Article{ bond2009stable, 19613 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 19614 approximation and projection}, 19615 author = {Bond, B.N. and Daniel, L.}, 19616 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 19617 volume = {28}, 19618 number = {10}, 19619 pages = {1467--1480}, 19620 year = {2009}, 19621 publisher = {IEEE} 19622} 19623 19624@Article{ xin2000front, 19625 title = {Front Propagation in Heterogeneous Media}, 19626 author = {Xin, J.}, 19627 journal = {SIAM Review}, 19628 volume = {42}, 19629 number = {2}, 19630 pages = {161--230}, 19631 year = {2000}, 19632 publisher = {Society for Industrial and Applied Mathematics} 19633} 19634 19635@Article{ owhadi2011localized, 19636 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 19637 Nonseparated Scales and High Contrast}, 19638 author = {Owhadi, H. and Zhang, L.}, 19639 journal = {Multiscale Modeling and Simulation}, 19640 volume = {9}, 19641 pages = {1373}, 19642 year = {2011} 19643} 19644 19645@Article{ berlyand2010flux, 19646 title = {Flux norm approach to finite dimensional homogenization approximations with 19647 non-separated scales and high contrast}, 19648 author = {Berlyand, L. and Owhadi, H.}, 19649 journal = {Archive for rational mechanics and analysis}, 19650 volume = {198}, 19651 number = {2}, 19652 pages = {677--721}, 19653 year = {2010}, 19654 publisher = {Springer} 19655} 19656 19657@Article{ babuska2011optimal, 19658 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 19659 Application to Multiscale Problems}, 19660 author = {Babuska, I. and Lipton, R.}, 19661 journal = {Multiscale Modeling \& Simulation}, 19662 volume = {9}, 19663 pages = {373}, 19664 year = {2011} 19665} 19666 19667@Article{ boettinger2002phase, 19668 title = {Phase-Field Simulation of Solidification}, 19669 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 19670 journal = {Annual review of materials research}, 19671 volume = {32}, 19672 number = {1}, 19673 pages = {163--194}, 19674 year = {2002}, 19675 publisher = {Annual Reviews} 19676} 19677 19678@Article{ karma1998quantitative, 19679 title = {Quantitative phase-field modeling of dendritic growth in two and three 19680 dimensions}, 19681 author = {Karma, A. and Rappel, W.J.}, 19682 journal = {Physical Review E}, 19683 volume = {57}, 19684 number = {4}, 19685 pages = {4323}, 19686 year = {1998}, 19687 publisher = {APS} 19688} 19689 19690@Article{ chen2002phase, 19691 title = {Phase-field models for microstructure evolution}, 19692 author = {Chen, L.Q.}, 19693 journal = {Annual review of materials research}, 19694 volume = {32}, 19695 number = {1}, 19696 pages = {113--140}, 19697 year = {2002}, 19698 publisher = {Annual Reviews} 19699} 19700 19701@Article{ galbally2010reductionuq, 19702 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 19703 problems}, 19704 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 19705 journal = {International journal for numerical methods in engineering}, 19706 volume = {81}, 19707 number = {12}, 19708 pages = {1581--1608}, 19709 year = {2010}, 19710 publisher = {Wiley Online Library} 19711} 19712 19713@Article{ griebel1995abstract, 19714 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 19715 author = {Griebel, M. and Oswald, P.}, 19716 journal = {Numerische Mathematik}, 19717 volume = {70}, 19718 number = {2}, 19719 pages = {163--180}, 19720 year = {1995}, 19721 publisher = {Springer} 19722} 19723 19724@InProceedings{ voutchkov2006multiobjective, 19725 title = {Multiobjective optimization using surrogates}, 19726 author = {Voutchkov, I. and Keane, A.J.}, 19727 booktitle = {Adaptive Computing in Design and Manufacture}, 19728 pages = {167--175}, 19729 year = {2006}, 19730 publisher = {The MC Escher Company} 19731} 19732 19733@Article{ leary2001constraint, 19734 title = {A constraint mapping approach to the structural optimization of an expensive 19735 model using surrogates}, 19736 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 19737 journal = {Optimization and Engineering}, 19738 volume = {2}, 19739 number = {4}, 19740 pages = {385--398}, 19741 year = {2001}, 19742 publisher = {Springer} 19743} 19744 19745@InProceedings{ legresley2000airfoil, 19746 title = {Airfoil design optimization using reduced order models based on proper orthogonal 19747 decomposition}, 19748 author = {LeGresley, P.A. and Alonso, J.J.}, 19749 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 19750 year = {2000} 19751} 19752 19753@Book{ myers2009response, 19754 title = {Response surface methodology: process and product optimization using designed 19755 experiments}, 19756 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 19757 volume = {705}, 19758 year = {2009}, 19759 publisher = {John Wiley \& Sons} 19760} 19761 19762@Article{ carlberg2012gnat, 19763 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 19764 application to computational fluid dynamics and turbulent flows}, 19765 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 19766 journal = {arXiv}, 19767 volume = {1207.1349}, 19768 year = {2012} 19769} 19770 19771@Article{ biros2008multilevel, 19772 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 19773 author = {Biros, G. and Dogan, G.}, 19774 journal = {Inverse Problems}, 19775 volume = {24}, 19776 pages = {034010}, 19777 year = {2008}, 19778 publisher = {IOP Publishing} 19779} 19780 19781@Article{ rees2010optimal, 19782 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 19783 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 19784 journal = {SIAM Journal on Scientific Computing}, 19785 volume = {32}, 19786 pages = {271}, 19787 year = {2010} 19788} 19789 19790@Article{ rees2010block, 19791 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 19792 author = {Rees, T. and Stoll, M.}, 19793 journal = {Numerical Linear Algebra with Applications}, 19794 volume = {17}, 19795 number = {6}, 19796 pages = {977--996}, 19797 year = {2010}, 19798 publisher = {Wiley Online Library} 19799} 19800 19801@Article{ rees2011preconditioning, 19802 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 19803 Equations}, 19804 author = {Rees, T. and Wathen, A.J.}, 19805 journal = {SIAM Journal on Scientific Computing}, 19806 volume = {33}, 19807 number = {5}, 19808 pages = {2903--2926}, 19809 year = {2011}, 19810 publisher = {Society for Industrial and Applied Mathematics} 19811} 19812 19813@Article{ vogel2007fbicg, 19814 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19815 author = {Vogel,J.A.}, 19816 journal = {Applied Mathematics and Computation}, 19817 volume = {188}, 19818 number = {1}, 19819 pages = {226–-233}, 19820 year = {2007}, 19821 publisher = {Elsevier} 19822} 19823 19824@Unpublished{ leehammond2010, 19825 author = {B. Lee and G.E. Hammond}, 19826 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 19827 Equation}, 19828 key = {multigrid}, 19829 note = {manuscript, 2010} 19830} 19831 19832@Article{ vandeneshop2004inexact, 19833 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 19834 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 19835 journal = {SIAM Journal on Matrix Analysis and Applications}, 19836 volume = {26}, 19837 number = {1}, 19838 pages = {125--153}, 19839 year = {2004} 19840} 19841 19842@Article{ fbicg.fbcgs, 19843 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19844 author = {Judith A. Vogel}, 19845 journal = {Applied Mathematics and Computation}, 19846 volume = {188}, 19847 number = {1}, 19848 pages = {226--233}, 19849 year = {2007} 19850} 19851 19852@Article{ simoncini2003inexact, 19853 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 19854 Computing}, 19855 author = {Valeria Simoncini and Daniel B. Szyld}, 19856 journal = {SIAM Journal on Scientific Computing}, 19857 volume = {25}, 19858 number = {2}, 19859 pages = {454--477}, 19860 year = {2003} 19861} 19862 19863@Article{ fqmr, 19864 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 19865 author = {Daniel B. Szyld and Judith A. Vogel}, 19866 journal = {SIAM Journal on Scientific Computing}, 19867 volume = {23}, 19868 number = {2}, 19869 pages = {363--380}, 19870 year = {2001} 19871} 19872 19873@Article{ ipcg, 19874 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 19875 author = {Gene H. Golub and Qiang Ye}, 19876 journal = {SIAM Journal on Scientific Computing}, 19877 volume = {21}, 19878 number = {4}, 19879 pages = {1305--1320}, 19880 year = {1999} 19881} 19882 19883@Article{ idr.sonneveld, 19884 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 19885 Systems of Linear Equations}, 19886 author = {Peter Sonneveld and Martin B. van Gijzen}, 19887 journal = {SIAM Journal on Scientific Computing}, 19888 volume = {31}, 19889 number = {2}, 19890 pages = {1035--1062}, 19891 year = {2008} 19892} 19893 19894@Article{ flexiblecg, 19895 title = {Flexible Conjugate Gradients}, 19896 author = {Yvan Notay}, 19897 journal = {SIAM Journal on Scientific Computing}, 19898 volume = {22}, 19899 number = {4}, 19900 pages = {1444--1460}, 19901 year = {2000} 19902} 19903 19904@Article{ generalizedcg, 19905 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 19906 Variable-Step Preconditioning}, 19907 author = {O. Axelsson and P. S. Vassilevski}, 19908 journal = {SIAM Journal on Matrix Analysis and Applications}, 19909 volume = {12}, 19910 number = {4}, 19911 pages = {625--644}, 19912 year = {1991} 19913} 19914 19915@Article{ bicg, 19916 title = {{Conjugate Gradient} methods for indefinite systems}, 19917 author = {R. Fletcher}, 19918 journal = {Lecture Notes in Mathematics}, 19919 volume = {506}, 19920 pages = {73--89}, 19921 year = {1976} 19922} 19923 19924@Article{ idr.bcgs, 19925 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 19926 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 19927 journal = {Applied Numerical Mathematics}, 19928 volume = {60}, 19929 pages = {1100--1114}, 19930 year = {2010} 19931} 19932 19933@Article{ idr.bcgsl, 19934 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 19935 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 19936 journal = {SIAM J. Sci. Comput.}, 19937 volume = {32}, 19938 number = {5}, 19939 pages = {2687--2709}, 19940 year = {2010} 19941} 19942 19943@Article{ idr.min.sync, 19944 title = {Minimizing synchronization in {IDR(s)}}, 19945 author = {T.P. Collignon and M.B. van Gijzen}, 19946 journal = {Numerical Linear Algebra with Applications}, 19947 volume = {18}, 19948 number = {5}, 19949 pages = {805--825}, 19950 year = {2011} 19951} 19952 19953@TechReport{ flexible.idr, 19954 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 19955 Sparse Linear Systems}, 19956 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 19957 institution = {Delft University of Technology}, 19958 number = {11-06}, 19959 year = {2011} 19960} 19961 19962@Article{ vangenuchten1980, 19963 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 19964 Soils}, 19965 author = {M. Th. van Genuchten}, 19966 journal = {Soil Science Society of America Journal}, 19967 volume = {44}, 19968 pages = {892--898}, 19969 year = {1980} 19970} 19971 19972@Article{ gmresr94, 19973 title = {{GMRESR}: a family of nested {GMRES} methods}, 19974 author = {H. A. Van der Vorst and C. Vuik}, 19975 journal = {Numerical Linear Algebra with Applications}, 19976 volume = {1}, 19977 number = {4}, 19978 pages = {369--386}, 19979 year = {1994} 19980} 19981 19982@Article{ knepley10, 19983 author = {Matthew G. Knepley}, 19984 title = {Removing the Barrier to Scalability in Parallel FMM}, 19985 journal = {CoRR}, 19986 volume = {abs/1008.2410}, 19987 note = {\url{http://arxiv.org/abs/1008.2410}}, 19988 year = {2010} 19989} 19990 19991@Article{ teng1998, 19992 author = {Shang-Hua Teng}, 19993 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 19994 N-Body Simulation}, 19995 journal = {SIAM J. Sci. Comput.}, 19996 volume = {19}, 19997 number = {2}, 19998 month = mar, 19999 pages = {635--656}, 20000 year = {1998}, 20001 issn = {1064-8275}, 20002 numpages = {22}, 20003 doi = {10.1137/S1064827595288942}, 20004 acmid = {289842}, 20005 issue_date = {March 1998}, 20006 publisher = {Society for Industrial and Applied Mathematics}, 20007 address = {Philadelphia, PA}, 20008 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 20009 parallel processing, partitioning, scientific computing, the fast multipole 20010 method, tree-codes} 20011} 20012 20013@InProceedings{ skinnerkramer05, 20014 author = {David Skinner and William Kramer}, 20015 title = {Understanding the causes of performance variability in HPC workloads}, 20016 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 20017 International}, 20018 organization = {IEEE}, 20019 pages = {137--149}, 20020 year = {2005} 20021} 20022 20023@Article{ notay_2000, 20024 author = {Yvan Notay}, 20025 title = {Flexible {Conjugate Gradients}}, 20026 journal = {SIAM Journal on Scientific Computing}, 20027 volume = {22}, 20028 number = {4}, 20029 year = {2000}, 20030 pages = {1444--1460} 20031} 20032 20033@Article{ bereux1996, 20034 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 20035 computations}, 20036 author = {Fran{\c{c}}ois B{\'e}reux}, 20037 journal = {Computer Methods in Applied Mechanics and Engineering}, 20038 volume = {133}, 20039 number = {1-2}, 20040 pages = {93--124}, 20041 year = {1996} 20042} 20043 20044@Article{ pawlowski2006globalization, 20045 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 20046 fully coupled solution of the {N}avier-{S}tokes equations}, 20047 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 20048 journal = {SIAM Review}, 20049 volume = {48}, 20050 number = {4}, 20051 pages = {700--721}, 20052 year = {2006}, 20053 publisher = {SIAM} 20054} 20055 20056@Article{ roppshadid2009, 20057 title = {Stability of operator splitting methods for systems with indefinite operators: 20058 Advection--diffusion--reaction systems}, 20059 author = {David L Ropp and John N Shadid}, 20060 journal = {Journal of Computational Physics}, 20061 volume = {228}, 20062 number = {9}, 20063 pages = {3508--3516}, 20064 year = {2009} 20065} 20066 20067@Article{ brown1985experiments, 20068 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 20069 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 20070 journal = {SIAM Journal on Scientific and Statistical Computing}, 20071 volume = {6}, 20072 number = {2}, 20073 pages = {297--313}, 20074 year = {1985}, 20075 publisher = {SIAM} 20076} 20077 20078@Article{ bicgsl_1993, 20079 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 20080 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 20081 Spectrum}, 20082 journal = {Electronic Transactions on Numerical Analysis}, 20083 volume = {1}, 20084 year = {1993}, 20085 pages = {11--32} 20086} 20087 20088@Book{ brandt2011revised, 20089 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 20090 Edition}, 20091 author = {Achi Brandt and Oren Livne}, 20092 year = {2011}, 20093 publisher = {SIAM} 20094} 20095 20096@Article{ axelsson1990algebraic, 20097 title = {Algebraic multilevel preconditioning methods, {II}}, 20098 author = {Axelsson, O. and Vassilevski, P.S.}, 20099 journal = {SIAM Journal on Numerical Analysis}, 20100 volume = {27}, 20101 number = {6}, 20102 pages = {1569--1590}, 20103 year = {1990}, 20104 publisher = {SIAM} 20105} 20106 20107@Article{ zulehner2002analysis, 20108 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 20109 author = {Zulehner, W.}, 20110 journal = {Mathematics of computation}, 20111 volume = {71}, 20112 number = {238}, 20113 pages = {479--506}, 20114 year = {2002} 20115} 20116 20117@Article{ pralet2010, 20118 author = {L. Giraud and A. Haidar and S. Pralet}, 20119 title = {Using multiple levels of parallelism to enhance the performance of domain 20120 decomposition solvers}, 20121 journal = {Parallel Computing}, 20122 volume = {36}, 20123 number = {5-6}, 20124 pages = {285--296}, 20125 year = {2010} 20126} 20127 20128@Book{ brennerscottfem, 20129 title = {The Mathematical Theory of Finite Element Methods}, 20130 author = {Susanne C. Brenner and L. Ridgway Scott}, 20131 edition = {3rd Edition}, 20132 series = {Texts in Applied Mathematics}, 20133 year = {2008}, 20134 publisher = {Springer-Verlag} 20135} 20136 20137@Book{ ortega1987iterative, 20138 title = {Iterative solution of nonlinear equations in several variables}, 20139 author = {Ortega, James M and Rheinboldt, Werner C}, 20140 volume = {30}, 20141 publisher = {Society for Industrial and Applied Mathematics}, 20142 year = {1987} 20143} 20144 20145@InBook{ rheinboldtch6, 20146 author = {Werner C. Rheinboldt}, 20147 title = {6. Combinations of Processes}, 20148 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 20149 chapter = {6}, 20150 pages = {59--74}, 20151 doi = {10.1137/1.9781611970012.ch6}, 20152 year = {1998} 20153} 20154 20155@Article{ allgowerbohmerpotrarheinboldt86, 20156 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 20157 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 20158 journal = {SIAM Journal on Numerical Analysis}, 20159 volume = {23}, 20160 number = {1}, 20161 pages = {160-169}, 20162 year = {1986}, 20163 doi = {10.1137/0723011} 20164} 20165 20166@Article{ rheinboldt76, 20167 author = {Werner C. Rheinboldt}, 20168 title = {On measures of ill-conditioning for nonlinear equations}, 20169 journal = {Mathematics of Computation}, 20170 volume = {30}, 20171 number = {133}, 20172 pages = {104--111}, 20173 year = {1976} 20174} 20175 20176@Article{ little61, 20177 author = {John D. C. Little}, 20178 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 20179 journal = {Operations Research}, 20180 volume = {9}, 20181 number = {3}, 20182 pages = {383--387}, 20183 note = {\url{http://www.jstor.org/stable/167570}}, 20184 year = {1961} 20185} 20186 20187@Misc{ top500, 20188 author = {{TOP500 Supercomputer Sites}}, 20189 url = {http://www.top500.org}, 20190 year = {2013} 20191} 20192 20193@Misc{ hassediagram, 20194 author = {Wikipedia}, 20195 title = {Hasse Diagram}, 20196 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 20197 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 20198 year = {2015} 20199} 20200 20201@Misc{ groupoid, 20202 author = {Wikipedia}, 20203 title = {Groupoid}, 20204 url = {https://en.wikipedia.org/wiki/Groupoid}, 20205 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 20206 year = {2015} 20207} 20208 20209@Misc{ cwcomplex, 20210 author = {Wikipedia}, 20211 title = {{CW} complex}, 20212 url = {http://en.wikipedia.org/wiki/CW_complex}, 20213 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 20214 year = {2015} 20215} 20216 20217@Misc{ linearalgebra, 20218 author = {Wikipedia}, 20219 title = {Linear Algebra}, 20220 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 20221 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 20222 year = {2015} 20223} 20224 20225@Misc{ amdahlslaw, 20226 author = {Wikipedia}, 20227 title = {Amdahl's Law}, 20228 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 20229 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 20230 year = {2015} 20231} 20232 20233@Misc{ gustafsonslaw, 20234 author = {Wikipedia}, 20235 title = {Gustafson's Law}, 20236 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 20237 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 20238 year = {2015} 20239} 20240 20241@InProceedings{ amdahl1967, 20242 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 20243 Capabilities}, 20244 author = {Gene M. Amdahl}, 20245 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 20246 series = {AFIPS '67 (Spring)}, 20247 location = {Atlantic City, New Jersey}, 20248 pages = {483--485}, 20249 numpages = {3}, 20250 doi = {10.1145/1465482.1465560}, 20251 acmid = {1465560}, 20252 publisher = {ACM}, 20253 address = {New York, NY, USA}, 20254 year = {1967} 20255} 20256 20257@Article{ gustafson1988, 20258 title = {Reevaluating {Amdahl}'s Law}, 20259 author = {Gustafson, John L.}, 20260 journal = {Communications of the ACM}, 20261 volume = {31}, 20262 number = {5}, 20263 month = may, 20264 issn = {0001-0782}, 20265 pages = {532--533}, 20266 doi = {10.1145/42411.42415}, 20267 acmid = {42415}, 20268 year = {1988} 20269} 20270 20271@Book{ eijkhout2014, 20272 title = {Introduction to High Performance Scientific Computing}, 20273 author = {Victor Eijkhout}, 20274 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 20275 publisher = {TACC}, 20276 year = {2014} 20277} 20278 20279@Article{ korelc2002multilanguage, 20280 title = {Multi-language and multi-environment generation of nonlinear finite element 20281 codes}, 20282 author = {Korelc, J.}, 20283 journal = {Engineering with Computers}, 20284 volume = {18}, 20285 number = {4}, 20286 pages = {312--327}, 20287 year = {2002}, 20288 publisher = {Springer} 20289} 20290 20291@TechReport{ taylor2011feap, 20292 title = {{FEAP}: A Finite Element Analysis Program}, 20293 subtitle = {Version 8.3 User Manual}, 20294 author = {R. L. Taylor}, 20295 year = {2011}, 20296 institution = {University of California, Berkeley} 20297} 20298 20299@Article{ bergeraftosmismurman2005, 20300 title = {Analysis of slope limiters on irregular grids}, 20301 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 20302 journal = {AIAA paper}, 20303 volume = {490}, 20304 pages = {2005}, 20305 year = {2005} 20306} 20307 20308@InProceedings{ ferreirabridgesbrightwell08, 20309 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 20310 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 20311 Noise Injection}, 20312 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 20313 series = {SC '08}, 20314 year = {2008}, 20315 isbn = {978-1-4244-2835-9}, 20316 location = {Austin, Texas}, 20317 pages = {19:1--19:12}, 20318 articleno = {19}, 20319 numpages = {12}, 20320 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 20321 acmid = {1413390}, 20322 publisher = {IEEE Press}, 20323 address = {Piscataway, NJ} 20324} 20325 20326@Article{ banach22, 20327 author = {Stefan Banach}, 20328 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 20329 \'equations int\'egrales}, 20330 journal = {Fund. Math.}, 20331 volume = {3}, 20332 pages = {133--181}, 20333 year = {1922} 20334} 20335 20336@Article{ bangerthbursteddeheisterkronbichler2012, 20337 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 20338 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 20339 Element Codes}, 20340 journal = {ACM Trans. Math. Softw.}, 20341 issue_date = {December 2011}, 20342 volume = {38}, 20343 number = {2}, 20344 month = jan, 20345 year = {2012}, 20346 issn = {0098-3500}, 20347 pages = {14:1--14:28}, 20348 articleno = {14}, 20349 numpages = {28}, 20350 doi = {10.1145/2049673.2049678}, 20351 acmid = {2049678}, 20352 publisher = {ACM}, 20353 address = {New York, NY, USA}, 20354 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 20355 design} 20356} 20357 20358@Article{ eisenstatwalker1994, 20359 author = {Stanley Eisenstat and Homer Walker}, 20360 title = {Globally Convergent Inexact {N}ewton Methods}, 20361 journal = {SIAM Journal on Optimization}, 20362 volume = {4}, 20363 number = {2}, 20364 pages = {393--422}, 20365 year = {1994}, 20366 doi = {10.1137/0804022} 20367} 20368 20369@Book{ blumcuckershubsmale98, 20370 title = {Complexity and Real Computation}, 20371 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 20372 year = {1998}, 20373 publisher = {Springer} 20374} 20375 20376@Article{ caili2011, 20377 author = {Cai, X.-C. and Li, X.}, 20378 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 20379 Elimination for Problems with High Local Nonlinearity}, 20380 journal = {SIAM Journal on Scientific Computing}, 20381 volume = {33}, 20382 number = {2}, 20383 pages = {746-762}, 20384 year = {2011}, 20385 doi = {10.1137/080736272} 20386} 20387 20388@Article{ cai2009, 20389 author = {X.-C. Cai}, 20390 title = { Nonlinear overlapping domain decomposition methods}, 20391 journal = {Lecture Notes in Computational Science}, 20392 volume = {70}, 20393 pages = {217-224}, 20394 year = {2009} 20395} 20396 20397@Article{ lanzkronrosewilkes1996, 20398 title = {An analysis of approximate nonlinear elimination}, 20399 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 20400 journal = {SIAM Journal on Scientific Computing}, 20401 volume = {17}, 20402 number = {2}, 20403 pages = {538--559}, 20404 year = {1996}, 20405 publisher = {SIAM} 20406} 20407 20408@TechReport{ gropp1993sowing, 20409 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 20410 author = {Gropp, W}, 20411 year = {1995}, 20412 number = {ANL/MCS-TM-208}, 20413 institution = {Argonne National Laboratory} 20414} 20415 20416@TechReport{ gropp1993sowing2, 20417 title = {Users Manual for doctext: Producing Documentation from Source Code}, 20418 author = {Gropp, W}, 20419 year = {1995}, 20420 number = {ANL/MCS-TM-206}, 20421 institution = {Argonne National Laboratory} 20422} 20423 20424@TechReport{ gropp1993simplified, 20425 title = {Simplified Linear Equation Solvers users manual}, 20426 author = {Gropp, W and Smith, B}, 20427 year = {1993}, 20428 number = {ANL--93/8}, 20429 institution = {Argonne National Laboratory} 20430} 20431 20432@Misc{ simplifiedbsd, 20433 author = {{University of California, Berkeley}}, 20434 title = {Simplified {Berkeley} Software Distribution License}, 20435 note = {see 20436 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 20437} 20438 20439@Book{ chaconstraub14, 20440 author = {Scott Chacon and Ben Straub}, 20441 title = {Pro Git}, 20442 publisher = {Apress}, 20443 year = {2014}, 20444 pages = {456}, 20445 note = {Available online at \url{http://git-scm.com/book/}} 20446} 20447 20448@Misc{ bitbucket, 20449 author = {Atlassian}, 20450 title = {Bitbucket}, 20451 note = {Platform available from \url{http://bitbucket.org}} 20452} 20453 20454@Misc{ gitworkflows, 20455 author = {GitWorkflows}, 20456 note = {Available at 20457 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 20458} 20459 20460@Misc{ figshare, 20461 author = {FigShare}, 20462 note = {Available at \url{http://palgrave.figshare.com/}} 20463} 20464 20465@InProceedings{ beazley1996swig, 20466 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 20467 {C++}}, 20468 author = {Beazley, David M}, 20469 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 20470 pages = {129--139}, 20471 year = {1996} 20472} 20473 20474@Misc{ softwareproductivityworkshopreport14, 20475 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 20476 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 20477 title = {Software Productivity for Extreme-Scale Science}, 20478 note = {Report on DOE Workshop, January 13-14, 2014}, 20479 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 20480 year = {2014} 20481} 20482 20483@Misc{ softwareproductivitywhitepaper13, 20484 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 20485 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 20486 Tang}, 20487 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 20488 Capability of Extreme-Scale Computing}, 20489 note = {whitepaper submitted to DOE, available via 20490 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 20491 year = {2013} 20492} 20493 20494@Misc{ ideas:project, 20495 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 20496 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 20497 howpublished = {\url{http://ideas-productivity.org}}, 20498 year = {2015} 20499} 20500 20501@TechReport{ keyesmcinneswoodwardetal2012, 20502 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 20503 and B. Sheehan}, 20504 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 20505 institution = {Argonne National Laboratory}, 20506 number = {ANL/MCS-TM-330}, 20507 month = oct, 20508 year = {2012} 20509} 20510 20511@Misc{ sawsfs-web-page, 20512 author = {Surtai Han and Barry Smith and Hong Zhang}, 20513 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 20514 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 20515 year = {2015} 20516} 20517 20518@Misc{ sawshk-web-page, 20519 author = {Surtai Han and Barry Smith and Hong Zhang}, 20520 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 20521 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 20522 year = {2015} 20523} 20524 20525@Misc{ sawsnestk-web-page, 20526 author = {Surtai Han and Barry Smith and Hong Zhang}, 20527 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 20528 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 20529 year = {2015} 20530} 20531 20532@Misc{ m2acs:project, 20533 author = {M. {Anitescu et al.}}, 20534 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 20535 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 20536 year = {2015} 20537} 20538 20539@Misc{ hssmn13, 20540 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 20541 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 20542 Developing Mathematical Libraries and Simulation Codes}, 20543 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 20544 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 20545 year = {2013} 20546} 20547 20548@Misc{ atpesc:website, 20549 key = {{Argonne Training Program for Extreme-Scale Computing}}, 20550 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 20551 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 20552 year = {2018} 20553} 20554 20555@Article{ barraultmadaynguyenpatera2004, 20556 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 20557 title = {An empirical interpolation method: application to efficient reduced-basis 20558 discretization of partial differential equations}, 20559 journal = {Comptes Rendus Mathematique}, 20560 volume = {339}, 20561 number = {9}, 20562 pages = {667--672}, 20563 year = {2004}, 20564 issn = {1631-073X}, 20565 doi = {10.1016/j.crma.2004.08.006} 20566} 20567 20568@Article{ simongogotsi08, 20569 title = {Materials for electrochemical capacitors}, 20570 author = {Patrice Simon and Yury Gogotsi}, 20571 journal = {Nature Materials}, 20572 volume = {7}, 20573 number = {11}, 20574 pages = {845--854}, 20575 year = {2008}, 20576 doi = {10.1038/nmat2297} 20577} 20578 20579@Article{ vladsinghrollandmelinteajayangohy14, 20580 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 20581 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 20582 Gohy}, 20583 journal = {Scientific Reports}, 20584 volume = {4}, 20585 year = {2014}, 20586 doi = {10.1038/srep04315} 20587} 20588 20589@Article{ lichengshashurinkeidar12, 20590 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 20591 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 20592 journal = {Graphene}, 20593 volume = {1}, 20594 number = {1}, 20595 pages = {1--13}, 20596 year = {2012}, 20597 doi = {10.4236/graphene.2012.11001} 20598} 20599 20600@Article{ miller07, 20601 title = {A Brief History of Supercapacitors}, 20602 author = {John R. Miller}, 20603 journal = {Battery and Energy Storage Technology}, 20604 pages = {61--78}, 20605 year = {2007} 20606} 20607 20608@Book{ deshpande14, 20609 title = {Ultracapacitors: Future of Energy Storage}, 20610 author = {R. P. Deshpande}, 20611 publisher = {McGraw Hill Education}, 20612 isbn = {978-9339214050}, 20613 pages = {452}, 20614 year = {2014} 20615} 20616 20617@Article{ hojowboggs10, 20618 title = {Historical introduction to capacitor technology}, 20619 author = {J. Ho and T.R. Jow and S. Boggs}, 20620 journal = {IEEE Electrical Insulation Magazine}, 20621 month = jan, 20622 volume = {26}, 20623 number = {1}, 20624 pages = {20--25}, 20625 year = {2010}, 20626 doi = {10.1109/MEI.2010.5383924}, 20627 issn = {0883-7554} 20628} 20629 20630@Article{ gillespie14, 20631 title = {A review of steric interactions of ions: Why some theories succeed and others 20632 fail to acount for ion size}, 20633 author = {Dirk Gillespie}, 20634 journal = {Microfluidics and Nanofluidics}, 20635 volume = {18}, 20636 number = {5-6}, 20637 pages = {717--738}, 20638 year = {2015} 20639} 20640 20641@Article{ gillespievaliskoboda05, 20642 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 20643 title = {Density functional theory of the electrical double layer: the RFD functional}, 20644 journal = {J. Phys.: Condens. Matter}, 20645 volume = {17}, 20646 pages = {6609--6626}, 20647 year = {2005} 20648} 20649 20650@Article{ valiskobodagillespie07, 20651 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 20652 title = {Selective adsorption of ions with different diameter and valence at 20653 highly-charged interfaces}, 20654 journal = {J. Phys. Chem. C}, 20655 volume = {111}, 20656 pages = {15575--15585}, 20657 year = {2007} 20658} 20659 20660@Article{ gillespie08, 20661 author = {Dirk Gillespie}, 20662 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 20663 case study}, 20664 journal = {Biophys. J.}, 20665 volume = {94}, 20666 pages = {1169--1184}, 20667 year = {2008} 20668} 20669 20670@Article{ liwuwang15, 20671 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 20672 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 20673 journal = {Biophysical Journal}, 20674 volume = {94}, 20675 number = {3}, 20676 pages = {737--746}, 20677 doi = {10.1529/biophysj.107.112508}, 20678 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 20679 year = {2015} 20680} 20681 20682@Article{ gillespie12, 20683 title = {High energy conversion efficiency in nanofluidic channels}, 20684 author = {Dirk Gillespie}, 20685 journal = {Nano Letters}, 20686 volume = {12}, 20687 pages = {1410--1416}, 20688 year = {2012} 20689} 20690 20691@Article{ dieterich79, 20692 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 20693 author = {James H. Dieterich}, 20694 journal = {Journal of Geophysical Research: Solid Earth}, 20695 volume = {84}, 20696 number = {B5}, 20697 pages = {2161--2168}, 20698 year = {1979}, 20699 publisher = {Wiley Online Library} 20700} 20701 20702@Article{ bodakovacsgillespiekristof14, 20703 title = {Selective transport through a model calcium channel studied by Local Equilibrium 20704 Monte Carlo simulations coupled to the Nernst--Planck equation}, 20705 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 20706 Krist{\'o}f}, 20707 journal = {Journal of Molecular Liquids}, 20708 volume = {189}, 20709 pages = {100--112}, 20710 year = {2014}, 20711 publisher = {Elsevier} 20712} 20713 20714@Article{ brandt05, 20715 title = {Multiscale solvers and systematic upscaling in computational physics}, 20716 author = {Brandt, A}, 20717 journal = {Computer Physics Communications}, 20718 volume = {169}, 20719 number = {1}, 20720 pages = {438--441}, 20721 year = {2005}, 20722 publisher = {Elsevier} 20723} 20724 20725@Article{ rosenfeld89, 20726 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 20727 density-functional theory of freezing}, 20728 author = {Yaakov Rosenfeld}, 20729 journal = {Physical review letters}, 20730 volume = {63}, 20731 number = {9}, 20732 pages = {980}, 20733 year = {1989}, 20734 publisher = {APS} 20735} 20736 20737@Article{ schindlermitchellmccabecummingslevan13, 20738 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 20739 Approach}, 20740 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 20741 M Douglas LeVan}, 20742 journal = {The Journal of Physical Chemistry C}, 20743 volume = {117}, 20744 number = {41}, 20745 pages = {21337--21350}, 20746 year = {2013}, 20747 publisher = {ACS Publications} 20748} 20749 20750@Misc{ tramonto, 20751 author = {Laura Frink and et. al.}, 20752 title = {TRAMONTO 3.0 web site}, 20753 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 20754 year = {2014} 20755} 20756 20757@InCollection{ zhongyuenmoresiknepley15, 20758 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 20759 title = {Numerical Methods for Mantle Convection}, 20760 booktitle = {Treatise on Geophysics}, 20761 publisher = {Elsevier}, 20762 volume = {7}, 20763 editor = {Gerald Schubert}, 20764 edition = {second}, 20765 year = {2015} 20766} 20767 20768@Article{ richarson1911, 20769 author = {Lewis Fry Richardson}, 20770 title = {The approximate arithmetical solution by finite differences of physical problems 20771 including differential equations, with an application to the stresses in a masonry 20772 dam}, 20773 journal = {Philosophical Transactions of the Royal Society A}, 20774 volume = {210}, 20775 number = {459--470}, 20776 pages = {307--357}, 20777 doi = {10.1098/rsta.1911.0009}, 20778 year = {1911} 20779} 20780 20781@Article{ kirkwood34, 20782 author = {John G. Kirkwood}, 20783 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 20784 Application to Zwitterions}, 20785 journal = {The Journal of Chemical Physics}, 20786 volume = {2}, 20787 number = {7}, 20788 year = {1934} 20789} 20790 20791@TechReport{ schoof1994exodus, 20792 title = {{EXODUS II}: a finite element data model}, 20793 author = {Larry A Schoof and Victor R Yarberry}, 20794 institution = {Sandia National Laboratories}, 20795 number = {SAND92-2137}, 20796 address = {Albuquerque, NM}, 20797 year = {1994} 20798} 20799 20800@Misc{ poirier1998cgns, 20801 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 20802 and Fancis Y Enomoto}, 20803 title = {The CGNS system}, 20804 note = {AIAA Paper 98-3007}, 20805 year = {1998} 20806} 20807 20808@Article{ deyobarashephard2001, 20809 title = {Towards curvilinear meshing in 3D: the case of quadratic simplices}, 20810 author = {Saikat Dey and Robert M O'Bara and Mark S Shephard}, 20811 journal = {Computer-Aided Design}, 20812 volume = {33}, 20813 number = {3}, 20814 pages = {199--209}, 20815 year = {2001}, 20816} 20817 20818@InProceedings{ gomezhaimesgalbraith2022, 20819 title = {On Analysis Driven Shape Design Using B-Splines}, 20820 author = {Marlena Gomez and Robert Haimes and Marshall C Galbraith}, 20821 booktitle = {AIAA SciTech 2022 Forum}, 20822 pages = {1736}, 20823 year = {2022} 20824} 20825 20826@InProceedings{ cloughoberaizakrajsek2019, 20827 title = {Automated Wing Internal Structure Placement Guided by Finite Element Analysis}, 20828 author = {Justin L Clough and Assad A Oberai and Andrew J Zakrajsek}, 20829 booktitle = {AIAA Aviation 2019 Forum}, 20830 pages = {3369}, 20831 year = {2019} 20832} 20833 20834@InProceedings{ joegandhidannenhofferdalir2019, 20835 title = {Rapid generation of parametric aircraft structural models}, 20836 author = {John Joe and Viraj Gandhi and John Dannenhoffer and Hamid Dalir}, 20837 booktitle = {AIAA SciTech 2019 Forum}, 20838 pages = {2229}, 20839 year = {2019} 20840} 20841 20842@InProceedings{ haimesdannenhoffer2013, 20843 title = {The engineering sketch pad: A solid-modeling, feature-based, web-enabled system for building parametric geometry}, 20844 author = {Robert Haimes and John Dannenhoffer}, 20845 booktitle = {21st AIAA Computational Fluid Dynamics Conference}, 20846 pages = {3073}, 20847 year = {2013} 20848} 20849 20850@Article{ geuzaine2009gmsh, 20851 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 20852 facilities}, 20853 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 20854 journal = {International Journal for Numerical Methods in Engineering}, 20855 volume = {79}, 20856 number = {11}, 20857 pages = {1309--1331}, 20858 year = {2009}, 20859 publisher = {Wiley Online Library} 20860} 20861 20862@Article{ si2015, 20863 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 20864 author = {Hang Si}, 20865 journal = {ACM Trans. on Mathematical Software}, 20866 volume = {41}, 20867 number = {2}, 20868 month = feb, 20869 doi = {10.1145/2629697}, 20870 year = {2015} 20871} 20872 20873@TechReport{ blackerbohnhoffedwards1994, 20874 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 20875 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 20876 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 20877 year = {1994} 20878} 20879 20880@Article{ bjorck1994, 20881 title = {Numerics of Gram-Schmidt orthogonalization}, 20882 author = {{\AA}ke Bj{\"o}rck}, 20883 journal = {Linear Algebra and Its Applications}, 20884 volume = {197}, 20885 pages = {297--316}, 20886 year = {1994}, 20887 publisher = {Elsevier} 20888} 20889 20890@PhDThesis{ yood05, 20891 author = {Charles Nelson Yood}, 20892 title = {Argonne National Laboratory and the Emergence of Computer and Computational 20893 Science, 1946--1992}, 20894 school = {The Pennsylvania State University}, 20895 month = aug, 20896 year = {2005} 20897} 20898 20899@Article{ fearnleysander79, 20900 title = {Hermann Grassmann and the Creation of Linear Algebra}, 20901 author = {Desmond Fearnley-Sander}, 20902 journal = {The American Mathematical Monthly}, 20903 volume = {86}, 20904 pages = {809--817}, 20905 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 20906 year = {1979} 20907} 20908 20909@InCollection{ knepley2012, 20910 author = {Matthew G. Knepley}, 20911 title = {Programming Languages for Scientific Computing}, 20912 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20913 publisher = {Springer}, 20914 year = {2012}, 20915 editor = {Bj\"orn Engquist}, 20916 doi = {10.1007/978-3-540-70529-1}, 20917 url = {http://arxiv.org/abs/1209.1711} 20918} 20919 20920@InBook{ knepley2015, 20921 title = {Programming Languages for Scientific Computing}, 20922 author = {Matthew G. Knepley}, 20923 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20924 editor = {Bj{\"o}rn Engquist}, 20925 publisher = {Springer Berlin Heidelberg}, 20926 address = {Berlin, Heidelberg}, 20927 pages = {1173--1181}, 20928 isbn = {978-3-540-70529-1}, 20929 doi = {10.1007/978-3-540-70529-1_250}, 20930 year = {2015} 20931} 20932 20933@Book{ hughes2000, 20934 author = {Thomas J. R. Hughes}, 20935 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 20936 series = {Dover Civil and Mechanical Engineering}, 20937 pages = {704}, 20938 year = {2000}, 20939 isbn = {978-0486411811}, 20940 publisher = {Dover} 20941} 20942 20943@Article{ roache2002, 20944 title = {Code verification by the method of manufactured solutions}, 20945 author = {Patrick J. Roache}, 20946 journal = {Journal of Fluids Engineering}, 20947 volume = {124}, 20948 number = {1}, 20949 pages = {4--10}, 20950 year = {2002}, 20951 publisher = {American Society of Mechanical Engineers} 20952} 20953 20954@InCollection{ rokosgorman13, 20955 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 20956 author = {Georgios Rokos and Gerard Gorman}, 20957 booktitle = {Facing the Multicore-Challenge III}, 20958 series = {Lecture Notes in Computer Science}, 20959 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 20960 publisher = {Springer Berlin Heidelberg}, 20961 volume = {7686}, 20962 pages = {143-144}, 20963 doi = {10.1007/978-3-642-35893-7_22}, 20964 isbn = {978-3-642-35892-0}, 20965 year = {2013} 20966} 20967 20968@Misc{ hdf5:homepage, 20969 author = {{The HDF Group}}, 20970 title = {The {HDF5} Homepage}, 20971 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 20972 year = {2015} 20973} 20974 20975@Misc{ paraview:homepage, 20976 author = {Kitware}, 20977 title = {The {ParaView} Homepage}, 20978 howpublished = {\url{http://www.paraview.org/}}, 20979 year = {2015} 20980} 20981 20982@Misc{ xdmf:homepage, 20983 author = {Kitware}, 20984 title = {The Extensible Data Model and Format ({XDMF})}, 20985 howpublished = {\url{http://www.xdmf.org/}}, 20986 year = {2015} 20987} 20988 20989@Article{ cullerkarp1993, 20990 title = {LogP: Towards a realistic model of parallel computation}, 20991 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 20992 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 20993 journal = {SIGPLAN Notices}, 20994 volume = {28}, 20995 number = {7}, 20996 pages = {1--12}, 20997 year = {1993}, 20998 publisher = {ACM} 20999} 21000 21001@Article{ aggarwalvitter1988, 21002 title = {The input/output complexity of sorting and related problems}, 21003 author = {Alok Aggarwal and Jeffrey Vitter}, 21004 journal = {Communications of the ACM}, 21005 volume = {31}, 21006 number = {9}, 21007 pages = {1116--1127}, 21008 year = {1988}, 21009 publisher = {ACM} 21010} 21011 21012@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 21013 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 21014 Chandramowlishwaran and Richard Vuduc}, 21015 title = {Balance principles for algorithm-architecture co-design}, 21016 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 21017 month = may, 21018 address = {Berkeley, CA, USA}, 21019 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 21020 year = {2011} 21021} 21022 21023@Article{ williamswatermanpatterson2009, 21024 title = {Roofline: an insightful visual performance model for multicore architectures}, 21025 author = {Samuel Williams and Andrew Waterman and David Patterson}, 21026 journal = {Communications of the ACM}, 21027 volume = {52}, 21028 number = {4}, 21029 pages = {65--76}, 21030 year = {2009}, 21031 publisher = {ACM} 21032} 21033 21034@Misc{ roofline-web-page, 21035 author = {Samuel Williams and {et. al.}}, 21036 title = {{R}oofline {P}erformance {M}odel}, 21037 key = {Roofline}, 21038 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 21039 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 21040} 21041 21042@Misc{ roofline-talk2008, 21043 author = {Samuel Williams and David Patterson}, 21044 title = {{R}oofline {P}erformance {M}odel}, 21045 key = {Roofline}, 21046 year = {2008}, 21047 note = {ParLab Summer Retreat}, 21048 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 21049 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 21050} 21051 21052@Article{ lee2006, 21053 title = {The problem with threads}, 21054 author = {Edward A Lee}, 21055 journal = {Computer}, 21056 volume = {39}, 21057 number = {5}, 21058 pages = {33--42}, 21059 year = {2006}, 21060 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 21061 publisher = {IEEE Computer Society Press} 21062} 21063 21064@Article{ hoefler2012, 21065 title = {{Optimization principles for collective neighborhood communications}}, 21066 author = {Torsten Hoefler and Timo Schneider}, 21067 journal = {International Conference for High Performance Computing, Networking, Storage and 21068 Analysis, SC}, 21069 doi = {10.1109/SC.2012.86}, 21070 isbn = {9781467308069}, 21071 issn = {21674329}, 21072 year = {2012} 21073} 21074 21075@Book{ grahamknuthpatashnik1989, 21076 title = {Concrete Mathematics}, 21077 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 21078 publisher = {Addison-Wesley}, 21079 year = {1989} 21080} 21081 21082@Book{ jackson1962, 21083 title = {Classical Electrodynamics}, 21084 author = {John David Jackson}, 21085 publisher = {John Wiley \& Sons}, 21086 year = {1962} 21087} 21088 21089@Article{ leveque2013, 21090 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 21091 author = {Randall J. LeVeque}, 21092 journal = {SIAM News}, 21093 volume = {46}, 21094 number = {3}, 21095 month = apr, 21096 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 21097 year = {2013} 21098} 21099 21100@InProceedings{ wang2014, 21101 title = {Fjos: Practical, predictable, and efficient system support for fork/join 21102 parallelism}, 21103 author = {Qi Wang and Gabriel Parmer}, 21104 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 21105 20th}, 21106 pages = {25--36}, 21107 year = {2014}, 21108 organization = {IEEE} 21109} 21110 21111@Article{ fangsaad2009, 21112 author = {Haw-ren Fang and Yousef Saad}, 21113 title = {Two classes of multisecant methods for nonlinear acceleration}, 21114 journal = {Numerical Linear Algebra with Applications}, 21115 volume = {16}, 21116 number = {3}, 21117 pages = {197--221}, 21118 year = {2009}, 21119 doi = {10.1002/nla.617} 21120} 21121 21122@Misc{ hpcchallenge, 21123 title = {HPC Challenge}, 21124 author = {Jack Dongarra and Piotr Luszczek and others}, 21125 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 21126 year = {2015} 21127} 21128 21129@InProceedings{ hoeflerschneiderlumsdaine2008, 21130 title = {Accurately measuring collective operations at massive scale}, 21131 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 21132 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 21133 Processing (IPDPS)}, 21134 pages = {1--8}, 21135 year = {2008}, 21136 doi = {10.1109/IPDPS.2008.4536494}, 21137 organization = {IEEE} 21138} 21139 21140@Book{ potraptak1984, 21141 title = {Nondiscrete Induction and Iterative Processes}, 21142 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 21143 series = {Research Notes in Mathematics}, 21144 year = {1984}, 21145 publisher = {Pitman} 21146} 21147 21148@Book{ pilz1977, 21149 title = {Near-rings: the theory and its applications}, 21150 author = {G{\"u}nter Pilz}, 21151 year = {1977}, 21152 publisher = {New York} 21153} 21154 21155@Article{ birkenjameson2009, 21156 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 21157 author = {Philipp Birken and Antony Jameson}, 21158 journal = {International Journal for Numerical Methods in Fluids}, 21159 volume = {62}, 21160 number = {5}, 21161 pages = {565--573}, 21162 publisher = {John Wiley \& Sons, Ltd.}, 21163 doi = {10.1002/fld.2030}, 21164 issn = {1097-0363}, 21165 year = {2010} 21166} 21167 21168@Article{ anderson1965, 21169 title = {Iterative procedures for nonlinear integral equations}, 21170 author = {Donald G Anderson}, 21171 journal = {Journal of the ACM (JACM)}, 21172 volume = {12}, 21173 number = {4}, 21174 pages = {547--560}, 21175 year = {1965}, 21176 publisher = {ACM} 21177} 21178 21179@Article{ ptak1966, 21180 title = {Some metric aspects of the open mapping and closed graph theorems}, 21181 author = {Vlastimil Pt{\'a}k}, 21182 journal = {Mathematische Annalen}, 21183 volume = {163}, 21184 number = {2}, 21185 pages = {95--104}, 21186 year = {1966}, 21187 publisher = {Springer} 21188} 21189 21190@Article{ ptak1974, 21191 title = {A quantitative refinement of the closed graph theorem}, 21192 author = {Vlastimil Pt{\'a}k}, 21193 journal = {Czechoslovak Mathematical Journal}, 21194 volume = {24}, 21195 number = {3}, 21196 pages = {503--506}, 21197 year = {1974}, 21198 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 21199} 21200 21201@Article{ ptak1975, 21202 title = {The rate of convergence of {Newton's} process}, 21203 author = {Vlastimil Pt{\'a}k}, 21204 journal = {Numerische Mathematik}, 21205 volume = {25}, 21206 number = {3}, 21207 pages = {279--285}, 21208 year = {1975}, 21209 publisher = {Springer} 21210} 21211 21212@Article{ ptak1976, 21213 title = {Nondiscrete mathematical induction and iterative existence proofs}, 21214 author = {Vlastimil Pt{\'a}k}, 21215 journal = {Linear algebra and its applications}, 21216 volume = {13}, 21217 number = {3}, 21218 pages = {223--238}, 21219 year = {1976}, 21220 publisher = {Elsevier} 21221} 21222 21223@Article{ ptak1977, 21224 title = {What should be a rate of convergence?}, 21225 author = {Vlastimil Pt{\'a}k}, 21226 journal = {RAIRO-Analyse num{\'e}rique}, 21227 volume = {11}, 21228 number = {3}, 21229 pages = {279--286}, 21230 year = {1977} 21231} 21232 21233@Article{ potraptak1980, 21234 title = {Sharp error bounds for {Newton's} process}, 21235 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 21236 journal = {Numerische Mathematik}, 21237 volume = {34}, 21238 number = {1}, 21239 pages = {63--72}, 21240 year = {1980}, 21241 publisher = {Springer} 21242} 21243 21244@Article{ liesen2014, 21245 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 21246 author = {J{\"o}rg Liesen}, 21247 journal = {IMA Journal of Numerical Analysis}, 21248 doi = {10.1093/imanum/drv037}, 21249 archiveprefix = {arXiv}, 21250 eprint = {1405.2683}, 21251 primaryclass = {math-na}, 21252 year = {2015} 21253} 21254 21255@Book{ traub1964, 21256 title = {Iterative Methods for the Solution of Equations}, 21257 author = {Joseph F Traub}, 21258 year = {1964}, 21259 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 21260} 21261 21262@InProceedings{ shalfvecpar2010, 21263 title = {Exascale Computing Technology Challenges}, 21264 author = {John Shalf and Sudip Dosanjh and John Morrison}, 21265 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 21266 pages = {1–-25}, 21267 year = {2010} 21268} 21269 21270@Article{ frechet1907, 21271 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 21272 author = {Maurice Ren\'e Fr\'echet}, 21273 journal = {C. R. Acad. Sci. Paris}, 21274 volume = {144}, 21275 pages = {1414--1416}, 21276 year = {1907} 21277} 21278 21279@Article{ riesz1907, 21280 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 21281 author = {Frigyes Riesz}, 21282 journal = {C. R. Acad. Sci. Paris}, 21283 volume = {144}, 21284 pages = {1409--1411}, 21285 year = {1907} 21286} 21287 21288@Article{ riesz1909, 21289 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 21290 author = {Frigyes Riesz}, 21291 journal = {C. R. Acad. Sci. Paris}, 21292 volume = {149}, 21293 pages = {974--977}, 21294 year = {1909} 21295} 21296 21297@Misc{ rieszmarkovkakutanirepresentationtheorem, 21298 author = {Wikipedia}, 21299 title = {Riesz-Markov-Kakutani Representation Theorem}, 21300 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 21301 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 21302 year = {2015} 21303} 21304 21305@Article{ markov1938, 21306 title = {On mean values and exterior densities}, 21307 author = {Andrey Markov}, 21308 journal = {Rec. Math. Moscou}, 21309 volume = {4}, 21310 pages = {165--190}, 21311 year = {1938} 21312} 21313 21314@Article{ kakutani1941, 21315 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 21316 space of continuous functions.)}, 21317 author = {Shizuo Kakutani}, 21318 journal = {Ann. of Math.}, 21319 volume = {2}, 21320 number = {42}, 21321 pages = {994--1024}, 21322 doi = {10.2307/1968778}, 21323 year = {1941} 21324} 21325 21326@Article{ michoskimeyersonisaacwaelbroeck2014, 21327 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 21328 tokamaks}, 21329 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 21330 journal = {Journal of Computational Physics}, 21331 volume = {274}, 21332 pages = {898--919}, 21333 year = {2014}, 21334 publisher = {Elsevier} 21335} 21336 21337@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 21338 title = {Extreme-scale AMR}, 21339 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 21340 Stadler and Tim Warburton and Lucas Wilcox}, 21341 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 21342 Computing, Networking, Storage and Analysis}, 21343 pages = {1--12}, 21344 year = {2010}, 21345 organization = {IEEE Computer Society}, 21346 doi = {10.1109/SC.2010.25} 21347} 21348 21349@InProceedings{ isaacbursteddeghattas2012, 21350 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 21351 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 21352 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 21353 International}, 21354 pages = {426--437}, 21355 year = {2012}, 21356 organization = {IEEE}, 21357 doi = {10.1109/IPDPS.2012.47} 21358} 21359 21360@Article{ isaacpetrastadlerghattas2015, 21361 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 21362 through inference to prediction for large-scale problems, with application to flow 21363 of the {Antarctic} ice sheet}, 21364 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 21365 journal = {Journal of Computational Physics}, 21366 volume = {296}, 21367 pages = {348--368}, 21368 year = {2015}, 21369 publisher = {Elsevier}, 21370 doi = {10.1016/j.jcp.2015.04.047} 21371} 21372 21373@Article{ isaacbursteddewilcoxghattas2015, 21374 title = {Recursive Algorithms for Distributed Forests of Octrees}, 21375 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 21376 journal = {SIAM Journal on Scientific Computing}, 21377 volume = {37}, 21378 number = {5}, 21379 pages = {C497-C531}, 21380 eprint = {1406.0089}, 21381 eprinttype = {arXiv}, 21382 year = {2015}, 21383 doi = {10.1137/140970963} 21384} 21385 21386@Article{ isaacstadlerghattas2015, 21387 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 21388 elements on nonconforming and anisotropic meshes, with application to ice sheet 21389 dynamics}, 21390 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 21391 journal = {SIAM Journal on Scientific Computing}, 21392 number = {6}, 21393 pages = {804--833}, 21394 volume = {37}, 21395 year = {2015}, 21396 doi = {10.1137/140974407} 21397} 21398 21399@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 21400 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 21401 earth's mantle}, 21402 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 21403 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 21404 Alessandro Curioni and Omar Ghattas}, 21405 booktitle = {Proceedings of the International Conference for High Performance Computing, 21406 Networking, Storage and Analysis}, 21407 pages = {5}, 21408 year = {2015}, 21409 organization = {ACM}, 21410 doi = {10.1145/2807591.2807675} 21411} 21412 21413@Article{ bunchhopcroft1974, 21414 title = {Triangular factorization and inversion by fast matrix multiplication}, 21415 author = {James R Bunch and John E Hopcroft}, 21416 journal = {Mathematics of Computation}, 21417 volume = {28}, 21418 number = {125}, 21419 pages = {231--236}, 21420 doi = {10.2307/2005828}, 21421 year = {1974} 21422} 21423 21424@Article{ nemirovsky1991, 21425 title = {On optimality of Krylov's information when solving linear operator equations}, 21426 author = {A.S Nemirovsky}, 21427 journal = {Journal of Complexity}, 21428 volume = {7}, 21429 number = {2}, 21430 pages = {121--130}, 21431 doi = {10.1016/0885-064X(91)90001-E}, 21432 year = {1991} 21433} 21434 21435@Misc{siamcseprize, 21436 author = {{PETSc Team}}, 21437 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21438 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21439 url = {https://www.siam.org/prizes/sponsored/cse.php}, 21440 year = {2015} 21441} 21442 21443@Article{ rathgeber2017, 21444 title = {Firedrake: automating the finite element method by composing abstractions}, 21445 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 21446 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 21447 Graham R and Kelly, Paul HJ}, 21448 archiveprefix = {arXiv}, 21449 journal = {ACM Transaction on Mathematical Software}, 21450 eprint = {1501.01809}, 21451 volume = {43}, 21452 issue = {3}, 21453 number = {24}, 21454 year = {2017}, 21455 url = {http://arxiv.org/abs/1501.01809} 21456} 21457 21458@Article{ kirby2006b, 21459 title = {Topological optimization of the evaluation of finite element matrices}, 21460 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 21461 journal = {SIAM Journal on Scientific Computing}, 21462 volume = {28}, 21463 number = {1}, 21464 pages = {224--240}, 21465 year = {2006}, 21466 publisher = {SIAM} 21467} 21468 21469@Article{ luporini2015, 21470 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 21471 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 21472 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 21473 Assembly}, 21474 journal = {ACM Trans. Archit. Code Optim.}, 21475 issue_date = {January 2015}, 21476 volume = {11}, 21477 number = {4}, 21478 month = jan, 21479 year = {2015}, 21480 issn = {1544-3566}, 21481 pages = {57:1--57:25}, 21482 articleno = {57}, 21483 numpages = {25}, 21484 doi = {10.1145/2687415}, 21485 acmid = {2687415}, 21486 publisher = {ACM}, 21487 address = {New York, NY, USA}, 21488 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 21489 optimizations} 21490} 21491 21492@Article{ markall2012, 21493 title = {Finite element assembly strategies on multi- and many-core architectures}, 21494 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 21495 C. D. and Sherwin, S. J.}, 21496 journal = {International Journal for Numerical Methods in Fluids}, 21497 year = {2013}, 21498 volume = {71}, 21499 pages = {80--97}, 21500 doi = {10.1002/fld.3648} 21501} 21502 21503@Article{ markall2010, 21504 title = {Towards generating optimised finite element solvers for GPUs from high-level 21505 specifications}, 21506 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 21507 journal = {Procedia Computer Science}, 21508 volume = {1}, 21509 number = {1}, 21510 pages = {1815--1823}, 21511 year = {2010}, 21512 note = {{ICCS} 2010}, 21513 doi = {10.1016/j.procs.2010.04.203} 21514} 21515 21516@Article{ longkirbywaanders2010, 21517 title = {Unified embedded parallel finite element computations via software-based 21518 Fr{\'e}chet differentiation}, 21519 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 21520 journal = {SIAM Journal on Scientific Computing}, 21521 volume = {32}, 21522 number = {6}, 21523 pages = {3323--3351}, 21524 year = {2010}, 21525 publisher = {SIAM} 21526} 21527 21528@Article{ kirby2010, 21529 title = {From functional analysis to iterative methods}, 21530 author = {Robert C Kirby}, 21531 journal = {SIAM review}, 21532 volume = {52}, 21533 number = {2}, 21534 pages = {269--293}, 21535 year = {2010}, 21536 publisher = {SIAM} 21537} 21538 21539@Article{ kirby2014, 21540 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 21541 author = {Robert C Kirby}, 21542 journal = {SIAM Journal on Scientific Computing}, 21543 volume = {36}, 21544 number = {2}, 21545 pages = {A846--A868}, 21546 year = {2014}, 21547 publisher = {SIAM} 21548} 21549 21550@Article{ kirby2011, 21551 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 21552 author = {Robert C Kirby}, 21553 journal = {Numerische Mathematik}, 21554 volume = {117}, 21555 number = {4}, 21556 pages = {631--652}, 21557 year = {2011}, 21558 publisher = {Springer} 21559} 21560 21561@Article{ arnoldfalkwinther2006, 21562 title = {Finite element exterior calculus, homological techniques, and applications}, 21563 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 21564 journal = {Acta numerica}, 21565 volume = {15}, 21566 pages = {1--155}, 21567 year = {2006}, 21568 publisher = {Cambridge Univ Press} 21569} 21570 21571@Article{ arnoldlogg2014, 21572 title = {Periodic table of the finite elements}, 21573 author = {Douglas Arnold and Anders Logg}, 21574 month = nov, 21575 journal = {SIAM News}, 21576 year = {2014} 21577} 21578 21579@Article{ janssonhoffmanjansson2012, 21580 title = {Framework for massively parallel adaptive finite element computational fluid 21581 dynamics on tetrahedral meshes}, 21582 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 21583 journal = {SIAM Journal on Scientific Computing}, 21584 volume = {34}, 21585 number = {1}, 21586 pages = {C24--C41}, 21587 year = {2012}, 21588 publisher = {SIAM} 21589} 21590 21591@Article{ rogneshamcottermcrae2013, 21592 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 21593 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 21594 journal = {Geoscientific Model Development}, 21595 volume = {6}, 21596 number = {6}, 21597 pages = {2099--2119}, 21598 year = {2013}, 21599 publisher = {Copernicus GmbH} 21600} 21601 21602@Book{ loggmardalwells2012, 21603 title = {Automated solution of differential equations by the finite element method: The 21604 {FEniCS} book}, 21605 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 21606 volume = {84}, 21607 year = {2012}, 21608 publisher = {Springer Science \& Business Media} 21609} 21610 21611@Article{ cotterkirby2014, 21612 title = {Mixed finite elements for global tide models}, 21613 author = {Colin J Cotter and Robert C Kirby}, 21614 archiveprefix = {arXiv}, 21615 journal = {Submitted}, 21616 eprint = {1410.0045}, 21617 year = {2014}, 21618 url = {http://arxiv.org/abs/1410.0045} 21619} 21620 21621@Article{ kirbykieu2015, 21622 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 21623 author = {Robert C Kirby and Thinh Tri Kieu}, 21624 journal = {Numerische Mathematik}, 21625 volume = {130}, 21626 number = {2}, 21627 pages = {257--291}, 21628 year = {2015}, 21629 publisher = {Springer} 21630} 21631 21632@Article{ brennankirby2015, 21633 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 21634 model}, 21635 author = {Brian Brennan and Robert C Kirby}, 21636 journal = {Submitted to Computers and Mathematics with Applications}, 21637 year = {2015} 21638} 21639 21640@Article{ howlekirbydillon2013, 21641 title = {Block preconditioners for coupled physics problems}, 21642 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 21643 journal = {SIAM Journal on Scientific Computing}, 21644 volume = {35}, 21645 number = {5}, 21646 pages = {S368--S385}, 21647 year = {2013}, 21648 publisher = {SIAM} 21649} 21650 21651@Book{ malekstrakos2014, 21652 title = {Preconditioning and the conjugate gradient method in the context of solving 21653 PDEs}, 21654 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 21655 volume = {1}, 21656 year = {2014}, 21657 publisher = {SIAM} 21658} 21659 21660@Article{ desturler1995, 21661 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 21662 distributed memory computers}, 21663 author = {E. de Sturler and H.A. van der Vorst}, 21664 journal = {Applied Numerical Mathematics}, 21665 volume = {18}, 21666 number = {4}, 21667 pages = {441--459}, 21668 year = {1995}, 21669 doi = {10.1016/0168-9274(95)00079-A} 21670} 21671 21672@Article{ velicmaymoresi2009, 21673 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 21674 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 21675 journal = {Journal of Mathematical Modelling and Algorithms}, 21676 volume = {8}, 21677 number = {3}, 21678 pages = {343--355}, 21679 year = {2009}, 21680 publisher = {Springer} 21681} 21682 21683@Article{ may2012, 21684 title = {Volume reconstruction of point cloud data sets derived from computational 21685 geodynamic simulations}, 21686 author = {May, DA}, 21687 journal = {Geochemistry, Geophysics, Geosystems}, 21688 volume = {13}, 21689 number = {5}, 21690 year = {2012}, 21691 publisher = {Wiley Online Library} 21692} 21693 21694@Article{ quenettehodkinson2010, 21695 title = {StgDomain--scalable parallel domain software components for particle-in-cell 21696 finite element methods}, 21697 author = {Quenette, Steve and Hodkinson, Luke}, 21698 journal = {Concurrency and Computation: Practice and Experience}, 21699 volume = {22}, 21700 number = {12}, 21701 pages = {1593--1603}, 21702 year = {2010}, 21703 publisher = {Wiley Online Library} 21704} 21705 21706@Book{ velic2005, 21707 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 21708 author = {Velic, Mirko}, 21709 year = {2005}, 21710 publisher = {Monash University} 21711} 21712 21713@Article{ velicknepleymay2016, 21714 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 21715 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 21716 note = {in preparation}, 21717 year = {2016} 21718} 21719 21720@Article{ traubwozniakowski1979, 21721 title = {Convergence and complexity of Newton iteration for operator equations}, 21722 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 21723 journal = {Journal of the ACM (JACM)}, 21724 volume = {26}, 21725 number = {2}, 21726 pages = {250--258}, 21727 year = {1979}, 21728 publisher = {ACM} 21729} 21730 21731@Article{ sterck2013, 21732 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 21733 author = {Hans De Sterck}, 21734 journal = {Numerical Linear Algebra with Applications}, 21735 volume = {20}, 21736 number = {3}, 21737 pages = {453--471}, 21738 year = {2013} 21739} 21740 21741@Article{ sterckwinlaw2015, 21742 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 21743 tensor approximation}, 21744 author = {Hans De Sterck and Manda Winlaw}, 21745 journal = {Numerical Linear Algebra with Applications}, 21746 volume = {22}, 21747 number = {3}, 21748 pages = {410--432}, 21749 year = {2015} 21750} 21751 21752@Article{ sterckhowse2015, 21753 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 21754 approximate {Tucker} tensor decompositions}, 21755 author = {Hans De Sterck and Alexander Howse}, 21756 journal = {SIAM Journal on Scientific Computing}, 21757 note = {submitted}, 21758 year = {2015} 21759} 21760 21761@Book{ ladevezesimmonds1999, 21762 title = {Nonlinear computational structural mechanics: {N}ew approaches and 21763 non-incremental methods of calculation}, 21764 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 21765 series = {{M}echanical {E}ngineering {S}eries}, 21766 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 21767 isbn = {9780387985947}, 21768 lccn = {98029990}, 21769 year = {1999}, 21770 publisher = {Springer} 21771} 21772 21773@InProceedings{ walkerwoodwardyang2010, 21774 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 21775 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 21776 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 21777 year = {2010} 21778} 21779 21780@Article{ lottwalkerwoodwardyang2012, 21781 title = {An accelerated {P}icard method for nonlinear systems related to variably 21782 saturated flow}, 21783 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 21784 journal = {Advances in Water Resources}, 21785 volume = {38}, 21786 number = {0}, 21787 pages = {92--101}, 21788 doi = {10.1016/j.advwatres.2011.12.013}, 21789 year = {2012} 21790} 21791 21792@TechReport{ mohrrude1998, 21793 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 21794 author = {Marcus Mohr and Ulrich R\"ude}, 21795 type = {Technical Report}, 21796 number = {394}, 21797 institution = {University of Augsburg}, 21798 year = {1998} 21799} 21800 21801@InProceedings{ mohr2000, 21802 title = {Low Communication Parallel Multigrid}, 21803 author = {Mohr, Marcus}, 21804 booktitle = {Euro-Par 2000 Parallel Processing}, 21805 pages = {806--814}, 21806 year = {2000}, 21807 organization = {Springer} 21808} 21809 21810@Article{ brandtdiskin1994, 21811 title = {Multigrid solvers on decomposed domains}, 21812 author = {Achi Brandt and Boris Diskin}, 21813 journal = {Contemporary Mathematics}, 21814 volume = {157}, 21815 year = {1994}, 21816 publisher = {AMERICAN MATHEMATICAL SOCIETY} 21817} 21818 21819@InProceedings{ prabhuetal2011, 21820 title = {A Survey of the Practice of Computational Science}, 21821 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 21822 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 21823 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 21824 David I.}, 21825 booktitle = {State of the Practice Reports}, 21826 series = {SC '11}, 21827 year = {2011}, 21828 isbn = {978-1-4503-1139-7}, 21829 location = {Seattle, Washington}, 21830 pages = {19:1--19:12}, 21831 articleno = {19}, 21832 numpages = {12}, 21833 doi = {10.1145/2063348.2063374}, 21834 acmid = {2063374}, 21835 publisher = {ACM}, 21836 address = {New York, NY, USA} 21837} 21838 21839@PhDThesis{ dinarthesis1979, 21840 title = {Fast methods for the numerical solution of boundary value problems}, 21841 author = {N. Dinar}, 21842 school = {Weizmann Institute of Science}, 21843 year = {1979} 21844} 21845 21846@Article{ thomasdiskinbrandt2001, 21847 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 21848 high Reynolds number wakes and boundary layers}, 21849 author = {James L Thomas and Boris Diskin and Achi Brandt}, 21850 journal = {Computers \& fluids}, 21851 volume = {30}, 21852 number = {7}, 21853 pages = {853--874}, 21854 year = {2001}, 21855 publisher = {Elsevier} 21856} 21857 21858@Article{ greenbaumptakstrakos1996, 21859 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 21860 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 21861 journal = {SIAM Journal on Matrix Analysis and Applications}, 21862 volume = {17}, 21863 number = {3}, 21864 pages = {465--469}, 21865 year = {1996}, 21866 publisher = {SIAM} 21867} 21868 21869@Article{ nangiapatankarbhalla2019, 21870 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 21871 density ratio multiphase flows}, 21872 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 21873 journal = {Journal of Computational Physics}, 21874 volume = {398}, 21875 pages = {108804}, 21876 year = {2019} 21877} 21878 21879@Article{ bhallanangiadafnakisbraccomattiazzo2019, 21880 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 21881 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 21882 library}, 21883 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 21884 Bracco and Giuliana Mattiazzo}, 21885 journal = {Applied Ocean Research}, 21886 note = {In press}, 21887 year = {2019} 21888} 21889 21890@Article{ bhallagriffithpatankardonev2013, 21891 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 21892 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 21893 Alexander Donev}, 21894 journal = {Journal of Chemical Physics}, 21895 volume = {139}, 21896 number = {21}, 21897 pages = {214112}, 21898 year = {2013} 21899} 21900 21901@Article{ bhallabalegriffithpatankar2014, 21902 title = {Fully resolved immersed electrohydrodynamics for particle motion, 21903 electrolocation, and self-propulsion}, 21904 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 21905 Patankar}, 21906 journal = {Journal of Computational Physics}, 21907 volume = {256}, 21908 pages = {88--108}, 21909 year = {2014} 21910} 21911 21912@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 21913 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 21914 multiblob approach}, 21915 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 21916 and Boyce E. Griffith and Alexander Donev}, 21917 journal = {Communications in Applied Mathematics and Computational Science}, 21918 volume = {11}, 21919 number = {2}, 21920 pages = {217--296}, 21921 year = {2016} 21922} 21923 21924@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 21925 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 21926 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 21927 P.J. Kahrilas and Neelesh A. Patankar}, 21928 journal = {Journal of Computational Physics}, 21929 volume = {298}, 21930 pages = {446--465}, 21931 year = {2015} 21932} 21933 21934@Article{ balenevelnbhallamaciverpatankar2015, 21935 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 21936 and vertebrates}, 21937 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 21938 A. Patankar}, 21939 journal = {PLoS Biology}, 21940 volume = {13}, 21941 number = {4}, 21942 pages = {1--22}, 21943 year = {2015} 21944} 21945 21946@Article{ balehaobhallapatankar2014, 21947 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 21948 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 21949 journal = {Proceedings of the National Academy of Sciences}, 21950 volume = {111}, 21951 number = {21}, 21952 pages = {7517--7521}, 21953 year = {2014} 21954} 21955 21956@Article{ bhallabalegriffithpatankar2013, 21957 title = {A unified mathematical framework and an adaptive numerical method for 21958 fluid--structure interaction with rigid, deforming, and elastic bodies}, 21959 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 21960 Patankar}, 21961 journal = {Journal of Computational Physics}, 21962 volume = {250}, 21963 pages = {446--476}, 21964 year = {2013}, 21965 publisher = {Elsevier} 21966} 21967 21968@Article{ takeikatz2013, 21969 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 21970 Governing equations and linearized analysis}, 21971 author = {Yasuko Takei and Richard F. Katz}, 21972 journal = {Journal of Fluid Mechanics}, 21973 volume = {734}, 21974 issn = {1469-7645}, 21975 pages = {424--455}, 21976 numpages = {32}, 21977 doi = {10.1017/jfm.2013.482}, 21978 month = nov, 21979 year = {2013} 21980} 21981 21982@Misc{ stewart2011, 21983 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 21984 author = {G. W. Stewart}, 21985 note = {Translated with commentary by G. W. Stewart}, 21986 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 21987 year = {2011} 21988} 21989 21990@Article{ douglisnirenberg1955, 21991 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 21992 author = {Avron Douglis and Louis Nirenberg}, 21993 journal = {Communications on Pure and Applied Mathematics}, 21994 volume = {8}, 21995 pages = {503--538}, 21996 year = {1955} 21997} 21998 21999@Article{ gorelickgalunsharonbasribrandt2006, 22000 title = {Shape Representation and Classification Using the Poisson Equation}, 22001 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 22002 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 22003 volume = {28}, 22004 number = {12}, 22005 pages = {1991--2005}, 22006 year = {2006} 22007} 22008 22009@Article{ salsbury2006, 22010 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 22011 solvation energies}, 22012 author = {Freddie R. Salsbury Jr.}, 22013 journal = {Molecular Physics}, 22014 volume = {104}, 22015 number = {08}, 22016 pages = {1299--1309}, 22017 year = {2006} 22018} 22019 22020@Article{ sigalov2006, 22021 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 22022 approximation}, 22023 author = {G. Sigalov and A. Fenley and A. Onufriev}, 22024 journal = {Journal of Chemical Physics}, 22025 volume = {124}, 22026 number = {124902}, 22027 year = {2006} 22028} 22029 22030@Article{ dennard1974, 22031 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 22032 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 22033 Andre R LeBlanc}, 22034 journal = {IEEE Journal of Solid-State Circuits}, 22035 volume = {9}, 22036 number = {5}, 22037 pages = {256--268}, 22038 year = {1974} 22039} 22040 22041@Article{ zeegeijn2015, 22042 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 22043 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 22044 journal = {ACM Transactions on Mathematical Software}, 22045 volume = {41}, 22046 number = {3}, 22047 pages = {14:1--14:33}, 22048 month = jun, 22049 year = {2015}, 22050 issue_date = {jun}, 22051 doi = {10.1145/2764454} 22052} 22053 22054@Article{ campbell1976, 22055 title = {Assessing the Impact of Planned Social Change}, 22056 author = {Donald T. Campbell}, 22057 journal = {Occasional Paper Series, The Public Affairs Center}, 22058 number = {8}, 22059 publisher = {Dartmouth College}, 22060 year = {1976} 22061} 22062 22063@Article{ smaldinomcelreath2016, 22064 title = {The natural selection of bad science}, 22065 author = {Paul E. Smaldino and Richard McElreath}, 22066 journal = {Royal Society Open Science}, 22067 volume = {3}, 22068 number = {9}, 22069 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 22070 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 22071 doi = {10.1098/rsos.160384}, 22072 year = {2016}, 22073 publisher = {The Royal Society} 22074} 22075 22076@Article{ harlowwelch1965, 22077 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 22078 free surface}, 22079 author = {Francis H Harlow and J Eddie Welch}, 22080 journal = {Physics of fluids}, 22081 volume = {8}, 22082 number = {12}, 22083 pages = {2182--2189}, 22084 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 22085 year = {1965} 22086} 22087 22088@Article{ diskinthomasmineck2005, 22089 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 22090 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 22091 journal = {SIAM Journal on Scientific Computing}, 22092 volume = {27}, 22093 number = {1}, 22094 pages = {108--129}, 22095 doi = {10.1137/030601521}, 22096 issn = {1064-8275}, 22097 year = {2005} 22098} 22099 22100@TechReport{ scott2012, 22101 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 22102 Computer Science}, 22103 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 22104 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 22105 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 22106 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 22107 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 22108 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 22109 Yuen}, 22110 institution = {University of Chicago}, 22111 number = {2012-02}, 22112 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 22113 year = {2012} 22114} 22115 22116@Article{ roth2010, 22117 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 22118 author = {Roland Roth}, 22119 journal = {J. Phys. Cond. Mat.}, 22120 volume = {22}, 22121 pages = {063102}, 22122 year = {2010} 22123} 22124 22125@Article{ wu2008, 22126 title = {Density functional theory for liquid structure and thermodynamics}, 22127 author = {J. Z. Wu}, 22128 journal = {Struct. Bond.}, 22129 doi = {10.1007/430_2008_3}, 22130 year = {2008} 22131} 22132 22133@Article{ goel2008, 22134 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 22135 by {Monte Carlo} simulations and density functional theory}, 22136 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 22137 journal = {J. Chem. Phys.}, 22138 volume = {129}, 22139 pages = {154707}, 22140 year = {2008} 22141} 22142 22143@Article{ marchxiaoyubiros2015, 22144 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 22145 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 22146 journal = {SIAM Journal on Scientific Computing (to appear)}, 22147 year = {2015} 22148} 22149 22150@InProceedings{ yangduraiswamigumerovdavis2003, 22151 title = {Improved fast gauss transform and efficient kernel density estimation}, 22152 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 22153 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 22154 pages = {664--671}, 22155 year = {2003}, 22156 organization = {IEEE} 22157} 22158 22159@Article{ fornberglarssonflyer2011, 22160 title = {Stable computations with Gaussian radial basis functions}, 22161 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 22162 journal = {SIAM Journal on Scientific Computing}, 22163 volume = {33}, 22164 number = {2}, 22165 pages = {869--892}, 22166 year = {2011}, 22167 publisher = {SIAM} 22168} 22169 22170@InProceedings{ srinivasanqiduraiswami2010, 22171 title = {GPUML: Graphical processors for speeding up kernel machines}, 22172 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 22173 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 22174 Implementations, and Applications}, 22175 year = {2010} 22176} 22177 22178@Article{ jadamecbillen2010, 22179 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 22180 a slab edge}, 22181 author = {Margarete A Jadamec and Magali I Billen}, 22182 journal = {Nature}, 22183 volume = {465}, 22184 number = {7296}, 22185 pages = {338--341}, 22186 year = {2010} 22187} 22188 22189@Article{ jadamecbillen2012, 22190 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 22191 numerical models of the Alaska slab edge}, 22192 author = {Margarete A Jadamec and Magali I Billen}, 22193 journal = {Journal of Geophysical Research: Solid Earth}, 22194 volume = {117}, 22195 number = {B2}, 22196 year = {2012} 22197} 22198 22199@Article{ jadamec2015, 22200 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 22201 author = {Margarete A Jadamec}, 22202 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 22203 volume = {211}, 22204 pages = {135}, 22205 year = {2015} 22206} 22207 22208@Article{ durancejadamecfalloonnicholls2012, 22209 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 22210 olivine-hosted melt inclusions and geochemical modelling with insights from 22211 geodynamic models}, 22212 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 22213 journal = {Australian Journal of Earth Sciences}, 22214 volume = {59}, 22215 number = {6}, 22216 pages = {913--931}, 22217 year = {2012} 22218} 22219 22220@Article{ sharplesmoresijadamecrevote2015, 22221 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 22222 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 22223 journal = {Journal of Geophysical Research: Solid Earth}, 22224 volume = {120}, 22225 number = {6}, 22226 pages = {4379--4404}, 22227 year = {2015} 22228} 22229 22230@Article{ hayniejadamec2017, 22231 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 22232 geodynamic models}, 22233 author = {Kirstie L Haynie and Margarete A Jadamec}, 22234 journal = {Tectonics}, 22235 note = {in review}, 22236 year = {2017} 22237} 22238 22239@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 22240 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 22241 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 22242 Lithgow-Bertelloni and Wenbo Xu}, 22243 journal = {Geophysical Journal International}, 22244 volume = {179}, 22245 number = {2}, 22246 pages = {1169--1185}, 22247 year = {2009} 22248} 22249 22250@Article{ zhong2006, 22251 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 22252 plume excess temperature, and upper mantle temperature}, 22253 author = {Shijie Zhong}, 22254 journal = {Journal of Geophysical Research: Solid Earth}, 22255 volume = {111}, 22256 number = {B4}, 22257 year = {2006} 22258} 22259 22260@Article{ billenhirth2007, 22261 title = {Rheologic controls on slab dynamics}, 22262 author = {Magali I Billen and Greg Hirth}, 22263 journal = {Geochemistry, Geophysics, Geosystems}, 22264 volume = {8}, 22265 number = {8}, 22266 year = {2007} 22267} 22268 22269@Article{ hirthkohlstedt2003, 22270 title = {Rheology of the upper mantle and the mantle wedge: A view from the 22271 experimentalists}, 22272 author = {Greg Hirth and David Kohlstedt}, 22273 journal = {Inside the subduction Factory}, 22274 pages = {83--105}, 22275 year = {2003} 22276} 22277 22278@Article{ longsilver2008, 22279 title = {The subduction zone flow field from seismic anisotropy: A global view}, 22280 author = {Maureen D Long and Paul G Silver}, 22281 journal = {science}, 22282 volume = {319}, 22283 number = {5861}, 22284 pages = {315--318}, 22285 year = {2008} 22286} 22287 22288@Article{ karatowu1993, 22289 title = {Rheology of the upper mantle: A synthesis}, 22290 author = {Shun-ichiro Karato and Patrick Wu}, 22291 journal = {Science}, 22292 volume = {260}, 22293 number = {5109}, 22294 pages = {771--778}, 22295 year = {1993} 22296} 22297 22298@Article{ long2013mantle, 22299 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 22300 for wedge processes}, 22301 author = {Long, Maureen D and Wirth, Erin A}, 22302 journal = {Journal of Geophysical Research: Solid Earth}, 22303 volume = {118}, 22304 number = {2}, 22305 pages = {583--606}, 22306 year = {2013}, 22307 publisher = {Wiley Online Library} 22308} 22309 22310@Article{ hoernle2008arc, 22311 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 22312 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 22313 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 22314 Alvarado, Guillermo and Protti, Marino and others}, 22315 journal = {Nature}, 22316 volume = {451}, 22317 number = {7182}, 22318 pages = {1094--1097}, 22319 year = {2008}, 22320 publisher = {Nature Publishing Group} 22321} 22322 22323@Article{ savage1999, 22324 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 22325 splitting?}, 22326 author = {MK Savage}, 22327 journal = {Reviews of Geophysics}, 22328 volume = {37}, 22329 number = {1}, 22330 pages = {65--106}, 22331 year = {1999} 22332} 22333 22334@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 22335 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 22336 of airborne contaminants}, 22337 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 22338 Omar Ghattas and Bart Van Bloemen Waanders}, 22339 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 22340 pages = {43}, 22341 year = {2005}, 22342 organization = {IEEE Computer Society} 22343} 22344 22345@Article{ draganescusoane2013, 22346 title = {Multigrid solution of a distributed optimal control problem constrained by the 22347 {Stokes} equations}, 22348 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 22349 journal = {Applied Mathematics and Computation}, 22350 volume = {219}, 22351 number = {10}, 22352 pages = {5622--5634}, 22353 year = {2013} 22354} 22355 22356@Article{ zhonggurnis1995, 22357 title = {Mantle convection with plates and mobile, faulted plate margins}, 22358 author = {Shijie Zhong and Michael Gurnis}, 22359 journal = {Science}, 22360 volume = {267}, 22361 number = {5199}, 22362 pages = {838}, 22363 year = {1995} 22364} 22365 22366@Article{ studerbobinchahidmousavicandesdahan2012, 22367 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 22368 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 22369 and Emmanuel Candes and Maxime Dahan}, 22370 journal = {Proceedings of the National Academy of Sciences}, 22371 volume = {109}, 22372 number = {26}, 22373 pages = {E1679--E1687}, 22374 year = {2012} 22375} 22376 22377@Article{ borsukhigdonstowreckhow2001, 22378 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 22379 matter loading in estuaries and coastal zones}, 22380 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 22381 journal = {Ecological Modelling}, 22382 volume = {143}, 22383 number = {3}, 22384 pages = {165--181}, 22385 year = {2001} 22386} 22387 22388@Article{ liebermanwillcox2012, 22389 title = {Goal-oriented inference: Approach, linear theory, and application to advection 22390 diffusion}, 22391 author = {Chad Lieberman and Karen Willcox}, 22392 journal = {SIAM Journal on Scientific Computing}, 22393 volume = {34}, 22394 number = {4}, 22395 pages = {A1880--A1904}, 22396 year = {2012} 22397} 22398 22399@Article{ chaillatbiros2012, 22400 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 22401 frequencies and multiple sources for the scalar {Helmholtz} equation}, 22402 author = {St{\'e}phanie Chaillat and George Biros}, 22403 journal = {Journal of Computational Physics}, 22404 volume = {231}, 22405 number = {12}, 22406 pages = {4403--4421}, 22407 year = {2012} 22408} 22409 22410@Article{ farhattezaurdjellouli2002, 22411 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 22412 problems by a regularized {Newton} method}, 22413 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 22414 journal = {Inverse problems}, 22415 volume = {18}, 22416 number = {5}, 22417 pages = {1229}, 22418 year = {2002} 22419} 22420 22421@Article{ orozcoghattas1992, 22422 title = {Massively parallel aerodynamic shape optimization}, 22423 author = {Orozco, Carlos E and Ghattas, ON}, 22424 journal = {Computing Systems in Engineering}, 22425 volume = {3}, 22426 number = {1-4}, 22427 pages = {311--320}, 22428 year = {1992} 22429} 22430 22431@Article{ reutheralonsorimlingerjameson1999, 22432 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 22433 adjoint formulation on distributed memory parallel computers}, 22434 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 22435 journal = {Computers \& fluids}, 22436 volume = {28}, 22437 number = {4}, 22438 pages = {675--700}, 22439 year = {1999} 22440} 22441 22442@Article{ rudistadlerghattas2016, 22443 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 22444 Heterogeneous Viscosity}, 22445 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 22446 journal = {ArXiv e-prints}, 22447 archiveprefix = {arXiv}, 22448 primaryclass = {math.NA}, 22449 eprint = {1607.03936}, 22450 month = jul, 22451 year = {2016} 22452} 22453 22454@Article{ borzikunisch2006, 22455 title = {A globalization strategy for the multigrid solution of elliptic optimal control 22456 problems}, 22457 author = {Borzi, A and Kunisch, K}, 22458 journal = {Optimisation Methods and Software}, 22459 volume = {21}, 22460 number = {3}, 22461 pages = {445--459}, 22462 year = {2006} 22463} 22464 22465@Article{ nash2000, 22466 title = {A multigrid approach to discretized optimization problems}, 22467 author = {Stephen G Nash}, 22468 journal = {Optimization Methods and Software}, 22469 volume = {14}, 22470 number = {1-2}, 22471 pages = {99--116}, 22472 year = {2000} 22473} 22474 22475@Article{ jameson1983, 22476 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 22477 method}, 22478 author = {Antony Jameson}, 22479 journal = {Applied mathematics and computation}, 22480 volume = {13}, 22481 number = {3-4}, 22482 pages = {327--355}, 22483 year = {1983} 22484} 22485 22486@Article{ billen2008, 22487 title = {Modeling the dynamics of subducting slabs}, 22488 author = {Magali I Billen}, 22489 journal = {Annu. Rev. Earth Planet. Sci.}, 22490 volume = {36}, 22491 pages = {325--356}, 22492 year = {2008} 22493} 22494 22495@Article{ gerya2011, 22496 title = {Future directions in subduction modeling}, 22497 author = {Taras Gerya}, 22498 journal = {Journal of Geodynamics}, 22499 volume = {52}, 22500 number = {5}, 22501 pages = {344--378}, 22502 year = {2011} 22503} 22504 22505@Article{ tackley2000, 22506 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 22507 theory}, 22508 author = {Paul J Tackley}, 22509 journal = {Science}, 22510 volume = {288}, 22511 number = {5473}, 22512 pages = {2002--2007}, 22513 year = {2000} 22514} 22515 22516@Article{ caseydewey1984, 22517 title = {Initiation of subduction zones along transform and accreting plate boundaries, 22518 triple-junction evolution, and forearc spreading centres—implications for 22519 ophiolitic geology and obduction}, 22520 author = {JF Casey and JF Dewey}, 22521 journal = {Geological Society, London, Special Publications}, 22522 volume = {13}, 22523 number = {1}, 22524 pages = {269--290}, 22525 year = {1984} 22526} 22527 22528@Article{ doughertyclayton2014, 22529 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 22530 in the {South Cocos} plate}, 22531 author = {Sara L Dougherty and Robert W Clayton}, 22532 journal = {Journal of Geophysical Research: Solid Earth}, 22533 volume = {119}, 22534 number = {4}, 22535 pages = {3424--3447}, 22536 year = {2014} 22537} 22538 22539@Article{ syracusemaceiraprietozhangammon2016, 22540 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 22541 velocity from the joint inversion of seismic and gravity data}, 22542 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 22543 Charles J Ammon}, 22544 journal = {Earth and Planetary Science Letters}, 22545 volume = {444}, 22546 pages = {139--149}, 22547 year = {2016} 22548} 22549 22550@Article{ bowergurnisflament2015, 22551 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 22552 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 22553 journal = {Physics of the Earth and Planetary Interiors}, 22554 volume = {238}, 22555 pages = {8--22}, 22556 year = {2015} 22557} 22558 22559@Book{ ciarlet1976, 22560 title = {Numerical analysis of the finite element method}, 22561 author = {Philippe G Ciarlet}, 22562 volume = {59}, 22563 year = {1976}, 22564 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 22565} 22566 22567@InProceedings{ liumellorcrummey2013, 22568 title = {A data-centric profiler for parallel programs}, 22569 author = {Xu Liu and John Mellor-Crummey}, 22570 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 22571 Storage and Analysis (SC)}, 22572 pages = {1--12}, 22573 year = {2013}, 22574 organization = {IEEE} 22575} 22576 22577@InCollection{ ernstgander2012, 22578 title = {Why it is difficult to solve Helmholtz problems with classical iterative 22579 methods}, 22580 author = {Oliver G Ernst and Martin J Gander}, 22581 booktitle = {Numerical analysis of multiscale problems}, 22582 pages = {325--363}, 22583 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 22584 year = {2012} 22585} 22586 22587@Article{ warburtonkarniadakis1999, 22588 title = {A discontinuous {G}alerkin method for the viscous {MHD} equations}, 22589 author = {Timothy C Warburton and George E Karniadakis}, 22590 journal = {Journal of Computational Physics}, 22591 volume = {152}, 22592 number = {2}, 22593 pages = {608--641}, 22594 year = {1999} 22595} 22596 22597@Article{ salahsoulaimanihabashi2001, 22598 title = {A finite element method for magnetohydrodynamics}, 22599 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 22600 journal = {Computer Methods in Applied Mechanics and Engineering}, 22601 volume = {43}, 22602 number = {190}, 22603 pages = {5867--5892}, 22604 year = {2001} 22605} 22606 22607@Article{ nesliturktezersezgin2005, 22608 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 22609 author = {Ali I Nesliturk and M Tezer-Sezgin}, 22610 journal = {Computer methods in applied mechanics and engineering}, 22611 volume = {194}, 22612 number = {9}, 22613 pages = {1201--1224}, 22614 year = {2005} 22615} 22616 22617@Article{ strakschellart2016, 22618 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 22619 Upwellings: Insights from Analog Models}, 22620 author = {Vincent Strak and Wouter P Schellart}, 22621 journal = {Journal of Geophysical Research: Solid Earth}, 22622 year = {2016} 22623} 22624 22625@InBook{ kirbyloggrognesterrel2012, 22626 title = {Common and unusual finite elements}, 22627 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 22628 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22629 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22630 {FEniCS} Book}, 22631 publisher = {Springer Berlin Heidelberg}, 22632 address = {Berlin, Heidelberg}, 22633 pages = {95--119}, 22634 isbn = {978-3-642-23099-8}, 22635 doi = {10.1007/978-3-642-23099-8_3}, 22636 year = {2012} 22637} 22638 22639@InBook{ kirbymardal2012, 22640 author = {Robert C. Kirby and Kent-Andre Mardal}, 22641 title = {Constructing general reference finite elements}, 22642 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22643 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22644 {FEniCS} Book}, 22645 publisher = {Springer Berlin Heidelberg}, 22646 address = {Berlin, Heidelberg}, 22647 pages = {121--132}, 22648 isbn = {978-3-642-23099-8}, 22649 doi = {10.1007/978-3-642-23099-8_4}, 22650 year = {2012} 22651} 22652 22653@Book{ wriggers2008, 22654 title = {Nonlinear finite element methods}, 22655 author = {Peter Wriggers}, 22656 publisher = {Springer Science \& Business Media}, 22657 year = {2008} 22658} 22659 22660@Book{ zienkiewicztaylor1977, 22661 title = {The finite element method}, 22662 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 22663 publisher = {McGraw-hill London}, 22664 volume = {3}, 22665 year = {1977} 22666} 22667 22668@Article{ rogneskirbylogg2009, 22669 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 22670 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 22671 journal = {SIAM Journal on Scientific Computing}, 22672 volume = {31}, 22673 number = {6}, 22674 pages = {4130--4151}, 22675 year = {2009} 22676} 22677 22678@Book{ kelley03, 22679 title = {Solving nonlinear equations with Newton's method}, 22680 author = {Carl T. Kelley}, 22681 publisher = {SIAM}, 22682 year = {2003} 22683} 22684 22685@Article{ turing1937, 22686 title = {The Chemical Basis of Morphogenesis}, 22687 author = {A. M. Turing}, 22688 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 22689 volume = {237}, 22690 number = {641}, 22691 pages = {37--72}, 22692 doi = {10.1098/rstb.1952.0012}, 22693 issn = {0080-4622}, 22694 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 22695 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 22696 year = {1952} 22697} 22698 22699@Article{ fabienknepleymillsriviere2017, 22700 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 22701 multigrid method}, 22702 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 22703 Rivi\`ere}, 22704 journal = {SIAM Journal on Scientific Computing}, 22705 url = {https://arxiv.org/abs/1705.09907}, 22706 volume = {41}, 22707 number = {2}, 22708 pages = {C73--C96}, 22709 doi = {10.1137/17M1128903}, 22710 year = {2018} 22711} 22712 22713@Article{ fabienknepleyriviere2018, 22714 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 22715 porous media}, 22716 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 22717 journal = {International Journal for Numerical Methods in Engineering}, 22718 volume = {116}, 22719 number = {3}, 22720 pages = {161--177}, 22721 doi = {10.1002/nme.5919}, 22722 year = {2018} 22723} 22724 22725@Article{ fabienknepleyriviere2020, 22726 title = {A high order hybridizable discontinuous Galerkin method for incompressible 22727 miscible displacement in heterogeneous media}, 22728 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22729 journal = {Results in Applied Mathematics}, 22730 url = {https://arxiv.org/abs/1809.00747}, 22731 volume = {8}, 22732 pages = {100089}, 22733 doi = {10.1016/j.rinam.2019.100089}, 22734 year = {2020} 22735} 22736 22737@Article{ fabienknepleyriviere2019b, 22738 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 22739 second order elliptic problems}, 22740 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22741 journal = {Journal of Numerical Mathematics}, 22742 volume = {28}, 22743 number = {3}, 22744 pages = {161--174}, 22745 doi = {10.1515/jnma-2019-0027}, 22746 year = {2019} 22747} 22748 22749@Article{ fabien2019, 22750 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 22751 Elasticity}, 22752 author = {Maurice S. Fabien}, 22753 journal = {Communications in Computational Physics}, 22754 volume = {27}, 22755 number = {2}, 22756 pages = {513--545}, 22757 issn = {1991-7120}, 22758 doi = {10.4208/cicp.OA-2018-0235}, 22759 year = {2019} 22760} 22761 22762@Unpublished{ awanoufabienguzmanstern2020, 22763 title = {Hybridization and postprocessing in finite element exterior calculus}, 22764 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 22765 eprint = {2008.00149}, 22766 note = {preprint}, 22767 primaryclass = {math.NA}, 22768 year = {2020} 22769} 22770 22771@Article{ fabienguzmanneilanzytoon2022, 22772 title = {Low-order divergence-free approximations for the Stokes problem on Worsey--Farin and Powell--Sabin splits}, 22773 author = {Maurice Fabien and Johnny Guzm{\'a}n and Michael Neilan and Ahmed Zytoon}, 22774 journal = {Computer Methods in Applied Mechanics and Engineering}, 22775 volume = {390}, 22776 pages = {114444}, 22777 year = {2022}, 22778} 22779 22780@Article{ chaabanegiraultrivierethompson2018, 22781 title = {A stable enriched {G}alerkin element for the {S}tokes problem}, 22782 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 22783 journal = {Applied Numerical Mathematics}, 22784 volume = {132}, 22785 pages = {1--21}, 22786 issn = {0168-9274}, 22787 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 22788 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 22789 year = {2018} 22790} 22791 22792@Article{ thompsonriviereknepley2018, 22793 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 22794 Resuscitation In The Small Intestine}, 22795 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 22796 journal = {Mathematical Medicine and Biology}, 22797 volume = {36}, 22798 number = {4}, 22799 pages = {513--548}, 22800 doi = {10.1093/imammb/dqz00}, 22801 year = {2019} 22802} 22803 22804@Article{ kevrekidisthompsongoriely2020, 22805 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 22806 Diseases}, 22807 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 22808 journal = {Physics Letters A}, 22809 volume = {384}, 22810 number = {36}, 22811 pages = {126935}, 22812 year = {2020} 22813} 22814 22815@Article{ mardalrognesthompson2021, 22816 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 22817 {Stokes-Biot} Stability Revisited}, 22818 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 22819 journal = {BIT Numerical Mathematics}, 22820 pages = {1--36}, 22821 year = {2021} 22822} 22823 22824@Article{ piersantileethompsonmardalrognes2021, 22825 title = {Parameter robust preconditioning by congruence for multiple-network 22826 poroelasticity}, 22827 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 22828 Rognes, Marie E}, 22829 journal = {SIAM Journal on Scientific Computing}, 22830 volume = {43}, 22831 number = {4}, 22832 pages = {B984--B1007}, 22833 year = {2021}, 22834 publisher = {SIAM} 22835} 22836 22837@Article{ walkerknepleyaagaardwilliams2023, 22838 title = {Multiphysics Modeling in {PyLith}: Poroelasticity}, 22839 author = {Robert L. Walker and Matthew G. Knepley and Brad T. Aagaard and Charles A. Williams}, 22840 journal = {Geophysical Journal International}, 22841 volume = {235}, 22842 number = {3}, 22843 pages = {2442--2475}, 22844 doi = {10.1093/gji/ggad370}, 22845 year = {2023} 22846} 22847 22848@Article{ bhavsar2024influence, 22849 title = {Influence of initial slab dip, inter-plate coupling, and nonlinear rheology on dynamic weakening at the lithosphere-asthenosphere boundary}, 22850 author = {Vivek Bhavsar and Margarete A. Jadamec and Matthew G. Knepley}, 22851 journal = {Journal of Geophysical Research: Solid Earth}, 22852 note = {Submitted}, 22853 year = {2024}, 22854} 22855 22856@InProceedings{ actorfuentesriviere2020b, 22857 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 22858 Level Set Equation and Deep Learning for Image Segmentation}, 22859 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22860 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 22861 year = {2020} 22862} 22863 22864@Article{ actorfuentesriviere2020, 22865 title = {Robust Regularized Networks in the Presence of Noise}, 22866 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22867 journal = {Medical Image Analysis}, 22868 note = {In revision}, 22869 year = {2020} 22870} 22871 22872@Book{ byerly1893, 22873 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 22874 ellipsoidal harmonics, with applications to problems in mathematical physics}, 22875 author = {William Elwood Byerly}, 22876 publisher = {Dover}, 22877 year = {1893} 22878} 22879 22880@Book{ hobson1931, 22881 title = {The theory of spherical and ellipsoidal harmonics}, 22882 author = {Ernest William Hobson}, 22883 year = {1931}, 22884 publisher = {CUP Archive} 22885} 22886 22887@Book{ dassios2012, 22888 title = {Ellipsoidal harmonics: theory and applications}, 22889 author = {George Dassios}, 22890 volume = {146}, 22891 year = {2012}, 22892 publisher = {Cambridge University Press} 22893} 22894 22895@Book{ miller1977, 22896 title = {Symmetry and separation of variables}, 22897 author = {Miller, Jr, Willard}, 22898 year = {1977}, 22899 address = {Reading, MA}, 22900 publisher = {Addison-Wesley Publishing Co., Inc.} 22901} 22902 22903@TechReport{ epanet-users-manual, 22904 author = {Lewis A. Rossman}, 22905 title = {{EPANET 2} Users Manual}, 22906 institution = {Water Supply and Water Resources Division, National Risk Management Research 22907 Laboratory, Cincinnati, OH 45268}, 22908 year = {2000} 22909} 22910 22911@Article{ klocknerbarnettgreengardoneil2013, 22912 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 22913 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 22914 O'Neil}, 22915 journal = {Journal of Computational Physics}, 22916 volume = {252}, 22917 pages = {332--349}, 22918 year = {2013} 22919} 22920 22921@Article{ turcksinkronbichlerbangerth2016, 22922 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 22923 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 22924 journal = {ACM Transactions on Mathematical Software)}, 22925 volume = {43}, 22926 number = {1}, 22927 pages = {2}, 22928 year = {2016} 22929} 22930 22931@Article{ vitushkin1954, 22932 title = {On {Hilbert's} thirteenth problem}, 22933 author = {A. G. Vitushkin}, 22934 journal = {Dokl. Akad. Nauk SSSR}, 22935 volume = {95}, 22936 pages = {701--704}, 22937 year = {1954} 22938} 22939 22940@Article{ kolmogorov1957, 22941 title = {On the representation of continuous functions of several variables as 22942 superpositions of continuous functions of one variable and addition}, 22943 author = {Andrei N. Kolmogorov}, 22944 journal = {Dokl. Akad. Nauk SSSR}, 22945 pages = {953--956}, 22946 volume = {114:5}, 22947 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 22948 year = {1957} 22949} 22950 22951@Article{ fridman1967, 22952 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 22953 Theorem}}, 22954 author = {B. L. Fridman}, 22955 journal = {Dokl. Akad. Nauk SSR}, 22956 volume = {177:5}, 22957 pages = {1019--1022}, 22958 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 22959 year = {1967} 22960} 22961 22962@Article{ sprecher1972, 22963 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 22964 author = {David Sprecher}, 22965 journal = {Journal of Mathematical Analysis and Applications}, 22966 volume = {38}, 22967 pages = {208--213}, 22968 year = {1972} 22969} 22970 22971@Article{ diaconisshahshahani1984, 22972 title = {On nonlinear functions of linear combinations}, 22973 author = {Persi Diaconis and Mehrdad Shahshahani}, 22974 journal = {SIAM Journal on Scientific and Statistical Computing}, 22975 volume = {5}, 22976 number = {1}, 22977 pages = {175--191}, 22978 year = {1984}, 22979 publisher = {SIAM} 22980} 22981 22982@InProceedings{ hechtnielsen1987, 22983 title = {Kolmogorov's mapping neural network existence theorem}, 22984 author = {R. Hecht-Nielsen}, 22985 booktitle = {Proceedings of the International Conference on Neural Networks}, 22986 volume = {III}, 22987 pages = {11--14}, 22988 publisher = {IEEE Press}, 22989 year = {1987} 22990} 22991 22992@InProceedings{ hechtnielsen1989, 22993 title = {Theory of the back-propagation neural network}, 22994 author = {R. Hecht-Nielsen}, 22995 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 22996 volume = {I}, 22997 pages = {593--608}, 22998 publisher = {IEEE Press}, 22999 year = {1989} 23000} 23001 23002@Article{ girosipoggio1989, 23003 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 23004 author = {Federico Girosi and Tomaso Poggio}, 23005 journal = {Neural Computation}, 23006 volume = {1}, 23007 number = {4}, 23008 pages = {465--469}, 23009 year = {1989}, 23010 publisher = {MIT Press} 23011} 23012 23013@InBook{ koppen2002, 23014 title = {On the Training of a Kolmogorov Network}, 23015 author = {Mario K\"oppen}, 23016 pages = {474--9}, 23017 publisher = {ICANN 2002, LNCS 2415}, 23018 year = {2002} 23019} 23020 23021@PhDThesis{ bryant2008, 23022 title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in 23023 applications with low and high dimensional data}, 23024 author = {Donald W Bryant}, 23025 school = {University of Central Florida}, 23026 year = {2008} 23027} 23028 23029@InCollection{ griebel2006, 23030 title = {Sparse Grids for Higher Dimensional Problems}, 23031 author = {Michael Griebel}, 23032 booktitle = {Foundations of Computational Mathematics}, 23033 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 23034 publisher = {Cambridge University Press}, 23035 pages = {106--161}, 23036 doi = {10.1017/CBO9780511721571.004}, 23037 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 23038 month = jun, 23039 day = {29}, 23040 year = {2006} 23041} 23042 23043@Article{ braungriebel2009, 23044 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 23045 author = {Jurgen Bra\"un and Michael Griebel}, 23046 journal = {Constructive Approximation}, 23047 pages = {653--675}, 23048 volume = {30}, 23049 year = {2009} 23050} 23051 23052@InProceedings{ lenifougerolletruchetet2009, 23053 title = {Kolmogorov superposition theorem and its application to wavelet image 23054 decompositions}, 23055 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 23056 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 23057 of the SPIE}, 23058 pages = {724804--724804}, 23059 doi = {10.1117/12.805916}, 23060 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 23061 year = {2009} 23062} 23063 23064@Article{ oseledets2011, 23065 title = {Tensor-train decomposition}, 23066 author = {Ivan V Oseledets}, 23067 journal = {SIAM Journal on Scientific Computing}, 23068 volume = {33}, 23069 number = {5}, 23070 pages = {2295--2317}, 23071 year = {2011} 23072} 23073 23074@PhDThesis{ liu2015, 23075 title = {Kolmogorov superposition theorem and its applications}, 23076 author = {Xing Liu}, 23077 school = {Imperial College London}, 23078 year = {2015} 23079} 23080 23081@Article{ lecunbengiohinton2015, 23082 title = {Deep learning}, 23083 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 23084 journal = {Nature}, 23085 volume = {521}, 23086 number = {7553}, 23087 pages = {436--444}, 23088 year = {2015} 23089} 23090 23091@Book{ trefethen2013, 23092 title = {Approximation theory and approximation practice}, 23093 author = {Lloyd N Trefethen}, 23094 publisher = {SIAM}, 23095 year = {2013} 23096} 23097 23098@Article{ butlergrahammattiswalsh2017, 23099 title = {A measure-theoretic interpretation of sample based numerical integration with 23100 applications to inverse and prediction problems under uncertainty}, 23101 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 23102 journal = {SIAM Journal on Scientific Computing}, 23103 volume = {39}, 23104 number = {5}, 23105 pages = {A2072--A2098}, 23106 year = {2017} 23107} 23108 23109@Article{ logg2009, 23110 title = {Efficient representation of computational meshes}, 23111 author = {Anders Logg}, 23112 journal = {International Journal of Computational Science and Engineering}, 23113 volume = {4}, 23114 number = {4}, 23115 pages = {283--295}, 23116 year = {2009} 23117} 23118 23119@Article{ agelekandersonbangerthbarth2017, 23120 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 23121 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 23122 journal = {ACM Transactions on Mathematical Software (TOMS)}, 23123 volume = {44}, 23124 number = {1}, 23125 pages = {5}, 23126 year = {2017} 23127} 23128 23129@Article{ actorknepley2018, 23130 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 23131 Superposition Theorem}}, 23132 author = {Jonas Actor and Matthew G. Knepley}, 23133 eprint = {1712.08286}, 23134 archiveprefix = {arXiv}, 23135 primaryclass = {math.na}, 23136 note = {\url{http://arxiv.org/abs/1712.08286}}, 23137 year = {2018} 23138} 23139 23140@Book{ driscollhaletrefethen2014, 23141 title = {Chebfun guide}, 23142 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 23143 publisher = {Pafnuty Publications, Oxford}, 23144 year = {2014} 23145} 23146 23147@Article{ johntobiska2000, 23148 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 23149 solution of the incompressible Navier-Stokes equations}, 23150 author = {Volker John and Lutz Tobiska}, 23151 journal = {International Journal for Numerical Methods in Fluids}, 23152 volume = {33}, 23153 number = {4}, 23154 pages = {453--473}, 23155 year = {2000} 23156} 23157 23158@Article{ vanka1986, 23159 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 23160 author = {S. P. Vanka}, 23161 journal = {Computer Methods in Applied Mechanics and Engineering}, 23162 volume = {59}, 23163 number = {1}, 23164 pages = {29--48}, 23165 year = {1986} 23166} 23167 23168@Article{ bartelgunther2018, 23169 author = {Andreas Bartel and Michael G\"unther}, 23170 title = {{PDAEs} in refined electrical network modeling}, 23171 journal = {SIAM Review}, 23172 volume = {60}, 23173 number = {1}, 23174 pages = {56--91}, 23175 doi = {10.1137/17M1113643}, 23176 year = {2018} 23177} 23178 23179@Article{ matpower, 23180 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 23181 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 23182 systems research and education}, 23183 journal = {IEEE Transactions on Power Systems}, 23184 volume = {26}, 23185 number = {1}, 23186 pages = {12--19}, 23187 year = {2011}, 23188 doi = {10.1109/TPWRS.2010.2051168} 23189} 23190 23191@Article{ betrieyan2018, 23192 author = {G. Betrie and E. Yan}, 23193 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 23194 Energy and Water Nexus}, 23195 journal = {Applied Energy, Submitted}, 23196 volume = {}, 23197 number = {}, 23198 pages = {}, 23199 doi = {}, 23200 year = {2018} 23201} 23202 23203@Article{ faeth2012, 23204 author = {P. Faeth}, 23205 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 23206 journal = {Environment: Science and Policy for Sustainable Development}, 23207 volume = {54(1)}, 23208 number = {1}, 23209 pages = {4--19}, 23210 year = {2012}, 23211 doi = {10.1080/00139157.2012.639595} 23212} 23213 23214@InProceedings{ hagberg2008, 23215 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 23216 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 23217 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 23218 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 23219 year = {2008}, 23220 pages = {11--15} 23221} 23222 23223@Misc{ simulink-web-page, 23224 author = {Mathworks}, 23225 title = {{SIMULINK} web page}, 23226 note = {\url{https://www.mathworks.com/products/simulink.html}}, 23227 year = {2017} 23228} 23229 23230@Misc{ labview-web-page, 23231 author = {National Instruments}, 23232 title = {{LabVIEW} web page}, 23233 note = {\url{http://www.ni.com/labview/}}, 23234 key = {labview}, 23235 year = {2017} 23236} 23237 23238@Misc{ modelica-web-page, 23239 author = {Modelica Association}, 23240 title = {Modelica web page}, 23241 note = {\url{https://www.modelica.org/}}, 23242 year = {2017} 23243} 23244 23245@InProceedings{ yangsc16, 23246 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 23247 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 23248 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 23249 Computing, Networking, Storage and Analysis}, 23250 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 23251 Dynamics}, 23252 note = {Gordon Bell Award}, 23253 year = {2016} 23254} 23255 23256@InProceedings{ bekassc15, 23257 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 23258 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 23259 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 23260 Computing, Networking, Storage and Analysis}, 23261 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 23262 Earth's Mantle}, 23263 note = {Gordon Bell Award}, 23264 year = {2015} 23265} 23266 23267@Misc{ improving-software-whitepaper2017, 23268 author = {M. Heroux and L.C. McInnes}, 23269 title = {Improving and accelerating scientific discovery through better software}, 23270 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 23271 doi = {10.6084/m9.figshare.5339692}, 23272 year = {2017} 23273} 23274 23275@Misc{ doe:40thanniversarycollection, 23276 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 23277 changed the face of science}, 23278 key = {Department of Energy, Office of Science}, 23279 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 23280 year = {2017} 23281} 23282 23283@Misc{ siam:fellowsprogram, 23284 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 23285 key = {SIAM}, 23286 howpublished = {\url{http://www.siam.org/prizes/fellows}} 23287} 23288 23289@Misc{ r-and-d100:awards2009, 23290 title = {{R\&D100 Award Winners 2009}}, 23291 key = {{R\&D100 Award Winners 2009}}, 23292 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 23293} 23294 23295@Misc{ xsdk:website, 23296 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 23297 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 23298 howpublished = {\url{https://xsdk.info}} 23299} 23300 23301@Misc{ xsdk-community-installation-policies2017, 23302 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 23303 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 23304 note = {version 0.3, November 7, 2017}, 23305 doi = {10.6084/m9.figshare.4495133}, 23306 year = {2017} 23307} 23308 23309@Misc{ xsdk-community-package-policies2017, 23310 title = {{xSDK} Community Package Policies}, 23311 author = {B. Smith and R. Bartlett and {xSDK developers}}, 23312 note = {version 0.3, November 7, 2017}, 23313 doi = {10.6084/m9.figshare.4495136}, 23314 year = {2017} 23315} 23316 23317@Misc{ ideas-what-are-interoperable-libraries, 23318 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 23319 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 23320 Ulrike Yang and {all xSDK developers}}, 23321 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 23322 \url{https://ideas-productivity.org/resources/howtos/}}, 23323 year = {2016} 23324} 23325 23326@Misc{ ideas-productivity:website, 23327 title = {{IDEAS Scientific Software Productivity Project}}, 23328 key = {IDEAS Scientific Software Productivity Project}, 23329 howpublished = {\url{https://ideas-productivity.org}} 23330} 23331 23332@Misc{ ecp:website, 23333 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 23334 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 23335 note = {\url{https://exascaleproject.org}}, 23336 year = {2018} 23337} 23338 23339@Misc{ siam-cse-jan2018, 23340 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 23341 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 23342 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 23343 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 23344 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 23345 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 23346 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 23347 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 23348 title = {Research and Education in Computational Science and Engineering}, 23349 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 23350 Review}}, 23351 year = {2018} 23352} 23353 23354@Misc{ doe-appliedmathpimeeting2017, 23355 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 23356 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 23357 Willcox and Steven Lee}, 23358 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 23359 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 23360 year = {2017} 23361} 23362 23363@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 23364 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 23365 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 23366 Sciences}}, 23367 note = {available via 23368 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 23369 year = {2015} 23370} 23371 23372@Misc{ sisc-specialissueintro, 23373 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 23374 Software'} and {'Big Data in CSE'}}, 23375 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 23376 month = nov, 23377 year = {2016}, 23378 journal = {SIAM J. Sci. Comput.}, 23379 doi = {10.1137/16N974188} 23380} 23381 23382@Article{ xsdk-foundations2017, 23383 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 23384 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 23385 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 23386 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 23387 journal = {Supercomputing Frontiers and Innovations}, 23388 month = feb, 23389 year = {2017}, 23390 note = {available via \url{https://arxiv.org/abs/1702.08425}} 23391} 23392 23393@Misc{ openfoam:website, 23394 title = {{OpenFOAM}}, 23395 author = {OpenFOAM Team}, 23396 key = {OpenFOAM}, 23397 howpublished = {\url{https://openfoam.com}} 23398} 23399 23400@Misc{ mfem:website, 23401 title = {{MFEM}}, 23402 author = {Tzanio Kolev and MFEM Team}, 23403 key = {MFEM}, 23404 howpublished = {\url{https://mfem.org}} 23405} 23406 23407@Misc{ deal.ii:website, 23408 title = {{{deal.II}: An open-source finite element library}}, 23409 author = {Wolfgang Bangerth and Deal.II Team}, 23410 howpublished = {\url{http://www.dealii.org}}, 23411 year = {2018} 23412} 23413 23414@Misc{ ibamr:website, 23415 title = {{{IBAMR}: Immersed Boundary Method Adaptive Mesh Refinement Software Infrastructure}}, 23416 author = {Boyce Griffith and IBAMR Team}, 23417 howpublished = {\url{https://ibamr.github.io/}}, 23418 year = {2023} 23419} 23420 23421@Misc{ fission-gas-scidac:website, 23422 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 23423 author = {A. David {Andersson (PI)}}, 23424 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 23425 year = {2018} 23426} 23427 23428@Misc{ tokamak-disruption-scidac:project, 23429 title = {{Tokamak Disruption Simulation}}, 23430 author = {Xianzhu {Tang (PI)}}, 23431 howpublished = {SciDAC project}, 23432 year = {2018} 23433} 23434 23435@InProceedings{ duplyakin2018memory, 23436 title = {Evaluating Active Learning with Cost and Memory Awareness}, 23437 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 23438 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 23439 pages = {214--223}, 23440 year = {2018}, 23441 organization = {IEEE}, 23442 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 23443} 23444 23445@InProceedings{ duplyakin2016active, 23446 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 23447 title = {Active Learning in Performance Analysis}, 23448 booktitle = {Proceedings of the IEEE Cluster Conference}, 23449 year = {2016}, 23450 month = sep, 23451 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 23452 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 23453} 23454 23455@Misc{ xgc1:website, 23456 title = {{XGC1 project website}}, 23457 author = {C. S. Chang and others}, 23458 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 23459 year = {2018} 23460} 23461 23462@Misc{ wdmapp-bhattacharjee-ecp:website, 23463 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 23464 Plasmas}}, 23465 author = {A. Bhattacharjee and others}, 23466 note = {ECP application project}, 23467 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 23468 year = {2018} 23469} 23470 23471@Misc{ subsurface-steefel-ecp:website, 23472 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 23473 and Mechanics}}, 23474 note = {ECP application project}, 23475 author = {C. Steefel and others}, 23476 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 23477 year = {2018} 23478} 23479 23480@Article{ chombo-crunch:2014, 23481 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 23482 with Carbon Sequestration}, 23483 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 23484 journal = {Computing in Science and Engineering}, 23485 volume = {16}, 23486 issue = {6}, 23487 year = {2014}, 23488 pages = {22--31}, 23489 doi = {10.1109/MCSE.2014.77} 23490} 23491 23492@Article{ courantfriedrichslewy1967, 23493 title = {On the partial difference equations of mathematical physics}, 23494 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 23495 journal = {IBM journal of Research and Development}, 23496 volume = {11}, 23497 number = {2}, 23498 pages = {215--234}, 23499 year = {1967}, 23500 publisher = {IBM} 23501} 23502 23503@Article{ erway2017solving, 23504 title = {On solving large-scale limited-memory quasi-Newton equations}, 23505 author = {Erway, Jennifer B and Marcia, Roummel F}, 23506 journal = {Linear Algebra and its Applications}, 23507 volume = {515}, 23508 pages = {196--225}, 23509 year = {2017}, 23510 publisher = {Elsevier} 23511} 23512 23513@Article{ griewank2012broyden, 23514 title = {Broyden updating, the good and the bad!}, 23515 author = {Griewank, Andreas}, 23516 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 23517 pages = {301--315}, 23518 year = {2012} 23519} 23520 23521@Book{ tarantola2005, 23522 title = {Inverse problem theory and methods for model parameter estimation}, 23523 author = {Albert Tarantola}, 23524 volume = {89}, 23525 year = {2005}, 23526 publisher = {SIAM} 23527} 23528 23529@Article{ rutkaikristof2010, 23530 title = {Dynamic Monte Carlo simulation in mixtures}, 23531 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 23532 journal = {The Journal of Chemical Physics}, 23533 volume = {132}, 23534 number = {10}, 23535 pages = {104107}, 23536 year = {2010}, 23537 publisher = {AIP} 23538} 23539 23540@Book{ vogel2002, 23541 title = {Computational methods for inverse problems}, 23542 author = {Curtis R Vogel}, 23543 volume = {23}, 23544 year = {2002}, 23545 publisher = {SIAM} 23546} 23547 23548@Article{ malqvistpeterseim2014, 23549 title = {Localization of elliptic multiscale problems}, 23550 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 23551 journal = {Mathematics of Computation}, 23552 volume = {83}, 23553 number = {290}, 23554 pages = {2583--2603}, 23555 year = {2014} 23556} 23557 23558@Article{ brandtbrannickkahllivshits2011, 23559 title = {Bootstrap {AMG}}, 23560 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 23561 journal = {SIAM Journal on Scientific Computing}, 23562 volume = {33}, 23563 number = {2}, 23564 pages = {612--632}, 23565 year = {2011} 23566} 23567 23568@InProceedings{ barralalauzet2014, 23569 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 23570 moving mesh strategy}, 23571 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 23572 booktitle = {44th AIAA Fluid Dynamics Conference}, 23573 pages = {2773}, 23574 year = {2014} 23575} 23576 23577@InProceedings{ barralalauzetloseille2015, 23578 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 23579 problems involving moving geometries}, 23580 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 23581 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 23582 pages = {2039}, 23583 year = {2015} 23584} 23585 23586@Article{ barralolivieralauzet2017, 23587 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 23588 problems with body-fitted moving geometries}, 23589 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 23590 journal = {Journal of Computational Physics}, 23591 volume = {331}, 23592 pages = {157--187}, 23593 year = {2017} 23594} 23595 23596@Article{ ibanezbarralkrakosloseillemichalpark2017, 23597 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 23598 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 23599 Michal and Mike Park}, 23600 journal = {Procedia engineering}, 23601 volume = {203}, 23602 pages = {154--166}, 23603 year = {2017} 23604} 23605 23606@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 23607 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 23608 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 23609 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 23610 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 23611 pages = {1103}, 23612 year = {2018} 23613} 23614 23615@InProceedings{ barralangeloudiskramergormanpiggott2018, 23616 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 23617 modelling}, 23618 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 23619 and Matthew D Piggott}, 23620 booktitle = {EGU General Assembly Conference Abstracts}, 23621 volume = {20}, 23622 pages = {19168}, 23623 year = {2018} 23624} 23625 23626@Article{ principe2009, 23627 title = {{Mathematical models for thermally coupled low speed flows}}, 23628 author = {Javier Principe and Ramon Codina}, 23629 journal = {Advances in Theoretical and Applied Mechanics}, 23630 volume = {2}, 23631 number = {1-4}, 23632 pages = {93--112}, 23633 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 23634 year = {2009} 23635} 23636 23637@Book{ vandervorst2003, 23638 title = {Iterative {K}rylov Methods for Large Linear Systems}, 23639 author = {van der Vorst, H.}, 23640 isbn = {9780521818285}, 23641 publisher = {Cambridge University Press}, 23642 year = {2003} 23643} 23644 23645@Book{ peres2006, 23646 author = {Asher Peres}, 23647 title = {Quantum theory: concepts and methods}, 23648 volume = {57}, 23649 publisher = {Springer Science \& Business Media}, 23650 year = {2006} 23651} 23652 23653@Book{ kuttler2012, 23654 title = {Linear algebra: theory and applications}, 23655 author = {Kenneth Kuttler}, 23656 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 23657 year = {2012} 23658} 23659 23660@Book{ elman_silvester_wathen_2014, 23661 place = {Oxford}, 23662 title = {Finite elements and fast iterative solvers: with applications in incompressible 23663 fluid dynamics}, 23664 publisher = {Oxford University Press}, 23665 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 23666 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 23667 year = {2014} 23668} 23669 23670@Article{ alametal2007, 23671 title = {An evaluation of the ORNL Cray XT3}, 23672 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 23673 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 23674 journal = {International Journal of High Performance Computing Applications}, 23675 volume = {22}, 23676 number = {1}, 23677 pages = {52--80}, 23678 doi = {10.1177/1094342007085019}, 23679 year = {2007} 23680} 23681 23682@Article{ plazacarey2000, 23683 title = {Local refinement of simplicial grids based on the skeleton}, 23684 author = {Plaza, A. and Carey, Graham F.}, 23685 journal = {Applied Numerical Mathematics}, 23686 doi = {10.1016/S0168-9274(99)00022-7}, 23687 issn = {01689274}, 23688 volume = {32}, 23689 number = {2}, 23690 pages = {195--218}, 23691 year = {2000} 23692} 23693 23694@Article{ carsonstrakos2020, 23695 title = {On the cost of iterative computations}, 23696 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 23697 journal = {Phil. Trans. R. Soc. A}, 23698 volume = {378}, 23699 number = {20190050}, 23700 doi = {10.1098/rsta.2019.0050}, 23701 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 23702 year = {2020} 23703} 23704 23705@Article{ schoberl1999, 23706 title = {Multigrid methods for a parameter dependent problem in primal variables}, 23707 author = {Joachim Sch{\"o}berl}, 23708 journal = {Numerische Mathematik}, 23709 volume = {84}, 23710 number = {1}, 23711 pages = {97--119}, 23712 year = {1999} 23713} 23714 23715@Article{ wuleexuzikatanov2008, 23716 title = {Convergence analysis on iterative methods for semidefinite systems}, 23717 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 23718 journal = {Journal of Computational Mathematics}, 23719 pages = {797--815}, 23720 year = {2008} 23721} 23722 23723@Article{ maierrannacher2016, 23724 title = {Duality-based adaptivity in finite element discretization of heterogeneous 23725 multiscale problems}, 23726 author = {Maier, Matthias and Rannacher, Rolf}, 23727 journal = {Journal of Numerical Mathematics}, 23728 volume = {24}, 23729 number = {3}, 23730 pages = {167--187}, 23731 year = {2016} 23732} 23733 23734@Article{ maierrannacher2018, 23735 title = {A duality-based optimization approach for model adaptivity in heterogeneous 23736 multiscale problems}, 23737 author = {Maier, Matthias and Rannacher, Rolf}, 23738 journal = {Multiscale Modeling \& Simulation}, 23739 volume = {16}, 23740 number = {1}, 23741 pages = {412--428}, 23742 year = {2018} 23743} 23744 23745@Article{ margetismaierluskin2017, 23746 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 23747 metamaterial sheet}, 23748 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 23749 journal = {Studies in Applied Mathematics}, 23750 volume = {139}, 23751 number = {4}, 23752 pages = {599--625}, 23753 year = {2017} 23754} 23755 23756@Article{ maiermargetisluskin2017b, 23757 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 23758 approximation and validation}, 23759 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 23760 journal = {Journal of Computational Physics}, 23761 volume = {339}, 23762 pages = {126--145}, 23763 year = {2017} 23764} 23765 23766@Article{ maiermargetisluskin2018, 23767 title = {Generation of surface plasmon-polaritons by edge effects}, 23768 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 23769 journal = {Communications in Mathematical Sciences}, 23770 volume = {16}, 23771 number = {1}, 23772 pages = {77--95}, 23773 url = {http://arxiv.org/abs/1702.00848}, 23774 year = {2018} 23775} 23776 23777@Article{ maiermattheakiskaxirasluskinmargetis2018, 23778 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 23779 metamaterials}, 23780 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23781 Mitchell and Margetis, Dionisios}, 23782 journal = {Physical Review B}, 23783 volume = {97}, 23784 number = {3}, 23785 pages = {035307}, 23786 year = {2018} 23787} 23788 23789@Article{ maiermattheakiskaxirasluskinmargetis2019, 23790 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 23791 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23792 Mitchell and Margetis, Dionisios}, 23793 journal = {Proceedings of the Royal Society A}, 23794 volume = {475}, 23795 number = {2230}, 23796 pages = {20190220}, 23797 year = {2019} 23798} 23799 23800@Article{ maiermargetisluskin2020, 23801 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 23802 two scales}, 23803 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 23804 journal = {Physical Review B}, 23805 volume = {102}, 23806 number = {7}, 23807 pages = {075308}, 23808 year = {2020} 23809} 23810 23811@Article{ margetismaierstauberlowluskin2020, 23812 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 23813 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 23814 Luskin, Mitchell}, 23815 journal = {Journal of Physics A: Mathematical and Theoretical}, 23816 volume = {53}, 23817 number = {5}, 23818 pages = {055201}, 23819 year = {2020} 23820} 23821 23822@Article{ maiermargetismellet2020, 23823 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 23824 structures}, 23825 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 23826 journal = {Journal of Computational and Applied Mathematics}, 23827 volume = {377}, 23828 pages = {112909}, 23829 year = {2020} 23830} 23831 23832@Article{ maierkronbichler2021, 23833 title = {Efficient parallel 3D computation of the compressible Euler equations with an 23834 invariant-domain preserving second-order finite-element scheme}, 23835 author = {Maier, Matthias and Kronbichler, Martin}, 23836 journal = {ACM Transactions on Parallel Computing}, 23837 volume = {8}, 23838 number = {3}, 23839 pages = {1--30}, 23840 year = {2021} 23841} 23842 23843@Article{ guermondmaierpopovtomas2021, 23844 title = {Second-order invariant domain preserving approximation of the compressible 23845 Navier--Stokes equations}, 23846 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 23847 journal = {Computer Methods in Applied Mechanics and Engineering}, 23848 volume = {375}, 23849 pages = {113608}, 23850 year = {2021} 23851} 23852 23853@Article{ liliptonmaier2021, 23854 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 23855 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 23856 eprint = {2009.12166}, 23857 archiveprefix = {arXiv}, 23858 primaryclass = {phys.optics}, 23859 year = {2021} 23860} 23861 23862@Article{ songmaierluskin2020, 23863 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 23864 gradient-index graphene waveguides}, 23865 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23866 journal = {Journal of Computational Physics}, 23867 volume = {423}, 23868 pages = {109871}, 23869 year = {2020} 23870} 23871 23872@Article{ songmaierluskin2019, 23873 title = {Adaptive finite element simulations of waveguide configurations involving 23874 parallel 2D material sheets}, 23875 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23876 journal = {Computer Methods in Applied Mechanics and Engineering}, 23877 volume = {351}, 23878 pages = {20--34}, 23879 year = {2019} 23880} 23881 23882% 23883% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 23884% 23885% 23886@Unpublished{ rob1, 23887 author = {Rob Kunz}, 23888 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 23889 State University}, 23890 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 23891 sponsors = {U.S. Navy, NRC}, 23892 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 23893 simulations, including lake warming by power plants}, 23894 dates = {Oct 3 and 4, 2002}, 23895 email = {rfk@wt.arl.psu.edu} 23896} 23897 23898@Unpublished{ au1, 23899 author = {Feng Wang and William Appelbe}, 23900 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 23901 url = {http://www.vpac.org}, 23902 sponsors = { }, 23903 note = {Using PETSc for a Variety of Geophysical Simulations}, 23904 dates = {Nov 22, 2002} 23905} 23906 23907@Unpublished{ carl1, 23908 author = {Carl Sovinec}, 23909 institution = {Applied Physics, University of Wisconsin}, 23910 url = {http://nimrodteam.org}, 23911 sponsors = {DOE Office of Fusion Research}, 23912 note = {Investigating using PETSc for NIMROD}, 23913 dates = {Nov 21, 2002}, 23914 email = {sovinec@engr.wisc.edu} 23915} 23916 23917@Unpublished{ au1b, 23918 author = {Pablo Carrica and Robert Wilson}, 23919 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 23920 url = {http://}, 23921 sponsors = {Office of Naval Research}, 23922 note = {Using PETSc for a hydrodynamics of ships and submarines}, 23923 dates = {Sept, 2002}, 23924 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 23925} 23926 23927% ------------------- TAO References ---------------------- 23928@Article{ benson:2001:csp, 23929 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 23930 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 23931 journal = {{ACM} Transactions on Mathematical Software}, 23932 volume = {27}, 23933 number = {3}, 23934 month = sep, 23935 year = {2001}, 23936 pages = {361--376} 23937} 23938 23939@TechReport{ tao-user-ref-2000, 23940 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 23941 title = {{TAO} Users Manual}, 23942 year = {2000}, 23943 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23944 number = {ANL/MCS-TM-242}, 23945 note = {See \url{http://www.mcs.anl.gov/tao}} 23946} 23947 23948% ------------------- Optimization References ---------------------- 23949@Book{ optguide93, 23950 title = {Optimization Software Guide}, 23951 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 23952 publisher = {SIAM Publications}, 23953 address = {Philadelphia}, 23954 year = {1993} 23955} 23956 23957@InProceedings{ more84, 23958 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 23959 Hillstrom}, 23960 title = {The {MINPACK} Project}, 23961 booktitle = {Sources and Development of Mathematical Software}, 23962 editor = {Wayne R. Cowell}, 23963 year = {1984}, 23964 pages = {88--111} 23965} 23966 23967@Article{ steihaug:83, 23968 author = {Trond Steihaug}, 23969 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 23970 journal = {SIAM J. Numer. Anal.}, 23971 volume = {20}, 23972 year = {1983}, 23973 pages = {626--637}, 23974 key = {steihaug92 ! trust_region} 23975} 23976 23977@TechReport{ minpack2test, 23978 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 23979 title = {The {MINPACK-2} Test Problem Collection}, 23980 institution = {Argonne National Laboratory}, 23981 year = {1991}, 23982 number = {ANL/MCS-TM-150}, 23983 key = {more91 ! MINPACK-2} 23984} 23985 23986@TechReport{ hohmann:94, 23987 author = {Andreas Hohmann}, 23988 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 23989 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 23990 year = {1994}, 23991 number = {SC-94-4}, 23992 key = {Hohmann94} 23993} 23994 23995@TechReport{ meza:94, 23996 author = {Juan C. Meza}, 23997 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 23998 institution = {Sandia National Laboratory}, 23999 year = {1994}, 24000 number = {SAND94-8225}, 24001 key = {Meza94} 24002} 24003 24004@Book{ dennis:83, 24005 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 24006 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 24007 publisher = {Prentice-Hall, Inc.}, 24008 address = {Englewood Cliffs, NJ}, 24009 year = {1983} 24010} 24011 24012@TechReport{ more:92, 24013 author = {Jorge J. Mor\'{e} and David Thuente}, 24014 title = {Line search algorithms with guaranteed sufficient decrease}, 24015 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 24016 year = {1992}, 24017 number = {MCS-P330-1092} 24018} 24019 24020@Article{ more-toraldo, 24021 author = {Jorge J. Mor\'e and G. Toraldo}, 24022 journal = {SIOPT}, 24023 pages = {93--113}, 24024 title = {On the solution of large quadratic programming problems with bound constraints}, 24025 volume = {1}, 24026 year = {1991} 24027} 24028 24029@Article{ byrd:1995:lma, 24030 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 24031 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 24032 journal = {SIAM Journal on Scientific Computing}, 24033 volume = {16}, 24034 number = {5}, 24035 pages = {1190--1208}, 24036 month = sep, 24037 year = {1995}, 24038 coden = {SJOCE3}, 24039 issn = {1064-8275 (print), 1095-7197 (electronic)}, 24040 mrclass = {90C30 (65K05)}, 24041 mrnumber = {96e:90039}, 24042 mrreviewer = {Henry Wolkowicz}, 24043 bibdate = {Fri Dec 4 16:17:35 MST 1998} 24044} 24045 24046@Article{ lin_c3, 24047 author = {C.-J. Lin and J. J. Mor\'e}, 24048 title = {Newton's method for large bound-constrained optimization problems}, 24049 year = {1999}, 24050 journal = {SIOPT}, 24051 volume = {9(4)}, 24052 pages = {1100--1127}, 24053 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 24054} 24055 24056@TechReport{ dolan2, 24057 author = {E. Dolan and J. J. Mor\'{e}}, 24058 title = {Benchmarking Optimization Software with Performance Profiles}, 24059 year = {2001}, 24060 month = jan, 24061 number = {ANL/MCS-P861-1200}, 24062 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 24063 address = {Argonne, IL}, 24064 url = {http://www.mcs.anl.gov/~more/cops/} 24065} 24066 24067@InProceedings{ owlqn, 24068 author = {Galen Andrew and Jianfeng Gao}, 24069 title = {Scalable training of L1-regularized log-linear models}, 24070 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 24071 pages = {33--40}, 24072 year = {2007} 24073} 24074 24075@Article{ bmrm, 24076 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 24077 title = {Bundle methods for regularized risk minimization}, 24078 year = {2010}, 24079 journal = {Journal of Machine Learning Research}, 24080 volume = {11}, 24081 pages = {311--365} 24082} 24083 24084% ------------------- Component Software References ---------------------- 24085@InProceedings{ cca99, 24086 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 24087 McInnes and S. Parker and B. Smolinski}, 24088 title = {Toward a Common Component Architecture for High-Performance Scientific 24089 Computing}, 24090 booktitle = {Proceedings of {High Performance Distributed Computing}}, 24091 pages = {115--124}, 24092 year = {1999}, 24093 note = {See \url{http://cca-forum.org}} 24094} 24095 24096@Book{ szyperski98, 24097 author = {Clemens Szyperski}, 24098 title = {Component Software: Beyond Object-Oriented Programming}, 24099 publisher = {ACM Press}, 24100 address = {New York}, 24101 year = {1998} 24102} 24103 24104@Article{ broy98, 24105 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 24106 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 24107 Stal and Clemens Szyperski}, 24108 title = {What Characterizes a (Software) Component?}, 24109 journal = {Software -- Concepts and Tools}, 24110 publisher = {Springer-Verlag}, 24111 year = {1998}, 24112 volume = {19}, 24113 pages = {49--56} 24114} 24115 24116@Article{ componentware:94, 24117 author = {Jon Udell}, 24118 title = {Componentware}, 24119 journal = {Byte}, 24120 volume = {may}, 24121 pages = {46--56}, 24122 year = {1994}, 24123 key = {Udell94 ! componentware} 24124} 24125 24126@Misc{ cca-web-page, 24127 author = {{Common Component Architecture Forum}}, 24128 note = {See \url{http://cca-forum.org}} 24129} 24130 24131% --------------- References for Tools Used by TAO Developers ----------------- 24132 24133% 24134% tohtml: Used to generate on-line TAO users manual and manual pages 24135% 24136@TechReport{ tohtml, 24137 author = {William Gropp}, 24138 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 24139 institution = {Argonne National Laboratory}, 24140 number = {ANL/MCS-TM-00}, 24141 month = jan, 24142 year = {1995}, 24143 key = {tohtml} 24144} 24145 24146% 24147% doctext: Used to generate tex version of TAO manual pages 24148% 24149@TechReport{ doctext, 24150 author = {William Gropp}, 24151 title = {Users Manual for doctext: Producing documentation from {C} source code}, 24152 institution = {Argonne National Laboratory}, 24153 number = {ANL/MCS-TM-00}, 24154 month = jan, 24155 year = {1995}, 24156 key = {doctext} 24157} 24158 24159% 24160% bfort: Used to generate TAO Fortran interface 24161% 24162@TechReport{ bfort, 24163 author = {William Gropp}, 24164 title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, 24165 institution = {Argonne National Laboratory}, 24166 number = {ANL/MCS-TM-208}, 24167 month = mar, 24168 year = {1995}, 24169 key = {doctext} 24170} 24171 24172% ------------------------- PETSc References ------------------------------ 24173@InProceedings{ petsc, 24174 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 24175 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 24176 Libraries}, 24177 booktitle = {Modern Software Tools in Scientific Computing}, 24178 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 24179 publisher = {Birkhauser Press}, 24180 pages = {163--202}, 24181 year = {1997} 24182} 24183 24184% ------------------------- Misc Other References ------------------------------ 24185@Misc{ indeps-web-page, 24186 title = {{InDEPS} {W}eb page}, 24187 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 24188 author = {et al. Robert Armstrong}, 24189 institution = {Sandia National Laboratory}, 24190 key = {{InDEPS} {W}eb page} 24191} 24192 24193@Misc{ pooma, 24194 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 24195 chitectures}, 24196 year = {1996}, 24197 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 24198 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 24199} 24200 24201@Misc{ isis++-web-page, 24202 title = {{ISIS++} {W}eb Page}, 24203 note = {See \url{http://ca.sandia.gov/isis}}, 24204 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 24205 institution = {Sandia National Laboratories} 24206} 24207 24208@Misc{ trilinos-web-page, 24209 title = {{Trilinos} {W}eb Page}, 24210 note = {See 24211 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 24212 author = {Mike Heroux et al.}, 24213 institution = {Sandia National Laboratories} 24214} 24215 24216@Misc{ alice-web-page, 24217 title = {{ALICE} {W}eb page}, 24218 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 24219 Argonne National Laboratory}, 24220 key = {{ALICE} {W}eb page} 24221} 24222 24223@Misc{ autodiff-webpage, 24224 author = {{Computational Differentiation Project}}, 24225 note = {See \url{http://www.mcs.anl.gov/autodiff}} 24226} 24227 24228@Misc{ coool-home-page, 24229 author = {Lydia Deng and Wences Gouveia and John Scales}, 24230 title = {{The CWP Object-Oriented Optimization Library}}, 24231 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 24232} 24233 24234@Misc{ rice-inversion-home-page, 24235 author = {Mark S. Gokenbach and William W. Symes}, 24236 title = {{The Hilbert Class Library}}, 24237 note = {See \url{http://www.trip.caam.rice.edu/}} 24238} 24239 24240@Misc{ opt++-home-page, 24241 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 24242 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 24243} 24244 24245@Article{ gockenbach:1999:ccl, 24246 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 24247 title = {C++ Classes for Linking Optimization with Complex Simulations}, 24248 journal = {{ACM} Transactions on Mathematical Software}, 24249 volume = {25}, 24250 number = {2}, 24251 month = jun, 24252 year = {1999}, 24253 pages = {191-212}, 24254 abstract = {The object-oriented programming paradigm can be used to overcome the 24255 incompatibilities between off-the-shelf optimization software and application 24256 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 24257 objects arising in optimization problems, such as vectors, linear operators, and 24258 so forth, as C++ classes, making it possible to write optimization code in a 24259 natural fashion, while allowing application software such as simulators to use the 24260 most convenient data structures and programming style. In spite of the poor 24261 reputation C++ has for runtime performance, the use of mixed-language programming 24262 allows performance equal to that achieved by standard Fortran packages, as 24263 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 24264 accepted = {April 1999}, 24265 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 24266} 24267 24268@Misc{ neos-guide, 24269 author = {{The Optimization Software Guide}}, 24270 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 24271} 24272 24273@Article{ boyd, 24274 title = {Distributed optimization and statistical learning via the alternating direction 24275 method of multipliers}, 24276 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 24277 Jonathan and others}, 24278 journal = {Foundations and Trends{\textregistered} in Machine learning}, 24279 volume = {3}, 24280 number = {1}, 24281 pages = {1-122}, 24282 year = {2011}, 24283 publisher = {Now Publishers, Inc.} 24284} 24285 24286@Misc{ :alertsys, 24287 title = {page{ALERT}}, 24288 organization = {Alert Systems, Inc}, 24289 address = {Madison, Wisconsin}, 24290 note = {http://www.alertsys.com/} 24291} 24292 24293@Manual{ :cmfortran, 24294 title = {{CM} {F}ortran Language Reference Manual}, 24295 organization = {Thinking Machines Corporation}, 24296 year = {1994}, 24297 address = {Cambridge, MA} 24298} 24299 24300@Manual{ :cmmd, 24301 title = {{CMMD} Reference Manual, Version 3.0}, 24302 organization = {Thinking Machines Corporation}, 24303 year = {1993}, 24304 address = {Cambridge, MA} 24305} 24306 24307@Manual{ :cmssl, 24308 title = {{CMSSL} for {CM} {F}ortran}, 24309 volume = {I}, 24310 organization = {Thinking Machines Corporation}, 24311 year = {1994}, 24312 address = {Cambridge, MA} 24313} 24314 24315@Misc{ :condor, 24316 author = {M. Livny}, 24317 title = {{PI}, The {Condor} Project, High Throughput Computing}, 24318 howpublished = {www.cs.wisc.edu/condor} 24319} 24320 24321@Manual{ :connection, 24322 title = {Connection Machine {CM}--5 Technical Summary}, 24323 organization = {Thinking Machines Corporation}, 24324 year = {1993}, 24325 address = {Cambridge, MA} 24326} 24327 24328@Manual{ :cplex, 24329 title = {{CPLEX} Optimizer}, 24330 organization = {ILOG CPLEX Division}, 24331 address = {889 Alder Avenue, Incline Village, Nevada}, 24332 note = {http://www.cplex.com/} 24333} 24334 24335@Manual{ :cplextm, 24336 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 24337 (Version 2.0)}, 24338 organization = {CPLEX Optimization Inc.}, 24339 year = {1992}, 24340 address = {Incline Village, Nevada} 24341} 24342 24343@Misc{ :fatcop, 24344 author = {M. C. Ferris}, 24345 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 24346 Solver}, 24347 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 24348} 24349 24350@Misc{ :metaneos, 24351 author = {S. J. Wright}, 24352 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 24353 howpublished = {www-unix.mcs.anl.gov/metaneos} 24354} 24355 24356@InCollection{ gropp.more:optimization, 24357 author = {W. Gropp and J. J. Mor\'e}, 24358 title = {Optimization environments and the {NEOS} Server}, 24359 booktitle = {Approximation Theory and Optimization}, 24360 pages = {167--182}, 24361 publisher = {Cambridge University Press}, 24362 year = {1997}, 24363 editor = {M. D. Buhmann and A. Iserles} 24364} 24365 24366@Article{ czyzyk.mesnier.ea:neos, 24367 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 24368 title = {The {NEOS} Server}, 24369 journal = {IEEE Journal on Computational Science and Engineering}, 24370 volume = {5}, 24371 year = {1998}, 24372 pages = {68--75} 24373} 24374 24375@Book{ :osl, 24376 title = {Handbook for {IBM OSL}}, 24377 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 24378 year = {1994}, 24379 publisher = {Boyd and Fraser}, 24380 address = {Danvers, Massachusetts} 24381} 24382 24383@Manual{ :pro-matlab, 24384 title = {{PRO}--{MATLAB} User's Guide}, 24385 organization = {The MathWorks, Inc.}, 24386 year = {1989}, 24387 address = {21 Eliot Street, South Natick, MA 01760} 24388} 24389 24390@Misc{ :prostate, 24391 key = {Biomedical}, 24392 title = {Biomedical Business International Newsletter}, 24393 howpublished = {pp. 72--75}, 24394 year = {1996} 24395} 24396 24397@Misc{ :sipcase, 24398 key = {Natural}, 24399 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 24400 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 24401} 24402 24403@Book{ aarts.korst:simulated, 24404 author = {E. Aarts and J. Korst}, 24405 title = {Simulated Annealing and Boltzman Machines}, 24406 year = {1990}, 24407 publisher = {John Wiley \& Sons}, 24408 address = {Chichester} 24409} 24410 24411@TechReport{ aarts.laarhoven.ea:local-search-based, 24412 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 24413 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 24414 institution = {Centre for Quantitative Methods}, 24415 year = {1991}, 24416 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 24417 number = {106}, 24418 type = {CQM-Not} 24419} 24420 24421@Article{ aashtiani.magnanti:equilibria, 24422 author = {H. Z. Aashtiani and T. L. Magnanti}, 24423 title = {Equilibria on a congested transportation network}, 24424 journal = {SIAM Journal on Algebraic and Discrete Methods}, 24425 volume = {2}, 24426 year = {1981}, 24427 pages = {213--226} 24428} 24429 24430@Article{ ablow.brigham:analog, 24431 author = {C. M. Ablow and G. Brigham}, 24432 title = {An Analog Solution of Programming Problems}, 24433 journal = {Operations Research}, 24434 year = {1955}, 24435 volume = {3}, 24436 pages = {388--394} 24437} 24438 24439@Article{ achuthan.grabowski.ea:optimal, 24440 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 24441 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 24442 journal = {Opsearch}, 24443 year = {1981}, 24444 volume = {18}, 24445 pages = {117--138} 24446} 24447 24448@Book{ adelman.robinson:income, 24449 author = {I. Adelman and S. Robinson}, 24450 title = {Income Distribution Policy in Developing Countries}, 24451 publisher = {Stanford University Press}, 24452 year = {1978}, 24453 address = {Stanford, California} 24454} 24455 24456@Article{ adler.resende.ea:implementation, 24457 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 24458 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 24459 journal = {Mathematical Programming}, 24460 year = {1989}, 24461 volume = {44}, 24462 pages = {297--336} 24463} 24464 24465@TechReport{ aeberhard.coomans.ea:comparison, 24466 author = {S. Aeberhard and D. Coomans and O. de Vel}, 24467 title = {Comparison of Classifiers in High Dimensional Settings}, 24468 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 24469 University of North Queensland}, 24470 year = {1992}, 24471 number = {92-02}, 24472 type = {Technical Report} 24473} 24474 24475@Article{ aganagic.cottle:constructive, 24476 author = {M. Aganagi\'{c} and R. W. Cottle}, 24477 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 24478 Minors}, 24479 journal = {Mathematical Programming}, 24480 year = {1987}, 24481 volume = {37}, 24482 pages = {223--231} 24483} 24484 24485@TechReport{ aganagic:iterative, 24486 author = {M. Aganagi\'{c}}, 24487 title = {Iterative Methods for the Linear Complementarity Problem}, 24488 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 24489 University}, 24490 year = {1978}, 24491 type = {SOL}, 24492 number = {78-10}, 24493 address = {Stanford, California} 24494} 24495 24496@Book{ ahlfors:complex, 24497 author = {L. V. Ahlfors}, 24498 title = {Complex Analysis}, 24499 publisher = {McGraw--Hill Book Company}, 24500 address = {New York}, 24501 series = {International Series in Pure and Applied Mathematics}, 24502 edition = {Second}, 24503 year = {1966} 24504} 24505 24506@Article{ ahn:solution, 24507 author = {B--H. Ahn}, 24508 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 24509 journal = {Journal of Optimization Theory and Applications}, 24510 year = {1981}, 24511 volume = {33}, 24512 pages = {175--185} 24513} 24514 24515@Article{ al-fahed.stavroulakis.ea:hard, 24516 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24517 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 24518 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 24519 volume = {71}, 24520 year = {1991}, 24521 pages = {257--265} 24522} 24523 24524@Article{ al-fahed.stavroulakis.ea:linear, 24525 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24526 title = {A linear complementarity approach to the frictionless gripper}, 24527 journal = {International Journal of Robotic Research}, 24528 volume = {11}, 24529 year = {1992}, 24530 pages = {112--122} 24531} 24532 24533@Article{ al-khayyal.falk:jointly, 24534 author = {F. A. Al--Khayyal and J. E. Falk}, 24535 title = {Jointly Constrained Biconvex Programming}, 24536 journal = {Mathematics of Operations Research}, 24537 year = {1983}, 24538 volume = {8}, 24539 pages = {273--286} 24540} 24541 24542@Article{ al-khayyal.kyparisis:finite, 24543 author = {F. A. Al--Khayyal and J. Kyparisis}, 24544 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 24545 Inequalities}, 24546 journal = {Journal of Optimization Theory and Applications}, 24547 year = {1991}, 24548 volume = {70}, 24549 pages = {319--332} 24550} 24551 24552@PhDThesis{ al-khayyal:biconvex, 24553 author = {F. A. Al--Khayyal}, 24554 title = {Biconvex Programming and Biconcave Minimization}, 24555 year = {1977}, 24556 school = {The George Washington University} 24557} 24558 24559@Article{ alart.curnier:mixed, 24560 author = {P. Alart and A. Curnier}, 24561 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 24562 solution methods}, 24563 journal = {Computer Methods in Applied Mechanics and Engineering}, 24564 volume = {92}, 24565 year = {1991}, 24566 pages = {353--375} 24567} 24568 24569@Misc{ alexander.kellog.ea:piecewise, 24570 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 24571 title = {Piecewise smooth continuation}, 24572 howpublished = {Manuscript}, 24573 year = {1979} 24574} 24575 24576@InCollection{ alexander.li.ea:piecewise, 24577 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 24578 title = {Piecewise smooth homotopies}, 24579 booktitle = {Homotopy Methods and Global Convergence}, 24580 pages = {1--14}, 24581 publisher = {Plenum Press}, 24582 year = {1983}, 24583 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 24584 address = {New York} 24585} 24586 24587@InCollection{ alexander:topological, 24588 author = {J.~C. Alexander}, 24589 title = {The topological theory of an embedding method}, 24590 booktitle = {Continuation Methods}, 24591 pages = {37--68}, 24592 publisher = {Academic Press}, 24593 year = {1978}, 24594 editor = {H. Wacker}, 24595 address = {New York} 24596} 24597 24598@Book{ allen:probability, 24599 author = {A. O. Allen}, 24600 title = {Probability, Statistics and Queueing Theory}, 24601 publisher = {Academic Press}, 24602 year = {1990}, 24603 address = {London}, 24604 edition = {Second} 24605} 24606 24607@Book{ allgower.georg:numerical, 24608 author = {E. L. Allgower and K. Georg}, 24609 title = {Numerical Continuation Methods, An Introduction}, 24610 publisher = {Springer-Verlag}, 24611 year = {1990}, 24612 address = {Berlin} 24613} 24614 24615@InProceedings{ allgower.georg:predictor-corrector, 24616 crossref = {bachem.grotschel.ea:mathematical}, 24617 author = {E. L. Allgower and K. Georg}, 24618 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 24619 Zero Points of Nonlinear Mappings}, 24620 pages = {15--56} 24621} 24622 24623@Article{ aluffi-pentini.parisi.ea:algorithm, 24624 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 24625 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 24626 Algorithm}, 24627 journal = {ACM Transactions on Mathematical Software}, 24628 year = {1988}, 24629 volume = {14}, 24630 pages = {366--380} 24631} 24632 24633@Article{ anandalingam.friesz:hierarchical, 24634 author = {G. Anandalingam and T. L. Friesz}, 24635 title = {Hierarchical Optimization: An Introduction}, 24636 journal = {Annals of Operations Research}, 24637 year = {1992}, 24638 volume = {34}, 24639 pages = {1--11} 24640} 24641 24642@Article{ anandalingam.white:solution, 24643 author = {G. Anandalingam and D. J. White}, 24644 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 24645 Functions}, 24646 journal = {IEEE Transactions on Automatic Control}, 24647 year = {1990}, 24648 volume = {35}, 24649 number = {10}, 24650 pages = {1170--1173} 24651} 24652 24653@Article{ andersen.andersen:presolving, 24654 author = {E. Andersen and K. Andersen}, 24655 title = {Presolving in Linear Programming}, 24656 year = {1995}, 24657 journal = {Mathematical Programming}, 24658 volume = {71}, 24659 pages = {221--245} 24660} 24661 24662@InProceedings{ andersen.ye:homogeneous, 24663 author = {E. Andersen and Y. Ye}, 24664 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 24665 Equality Constraints}, 24666 crossref = {ferris.pang:complementarity}, 24667 pages = {1--11} 24668} 24669 24670@Book{ anderson.bai.ea:lapack, 24671 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 24672 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 24673 Sorensen}, 24674 title = {{LAPACK} User's Guide}, 24675 publisher = {SIAM}, 24676 year = {1995}, 24677 address = {Philadelphia, Pennsylvania}, 24678 edition = {Second} 24679} 24680 24681@Article{ anderson.ferris:direct, 24682 author = {E. J. Anderson and M. C. Ferris}, 24683 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 24684 year = {2001}, 24685 journal = {SIAM Journal on Optimization, forthcoming}, 24686 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 24687 key = {55} 24688} 24689 24690@InProceedings{ anderson.ferris:genetic, 24691 author = {E. J. Anderson and M. C. Ferris}, 24692 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 24693 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 24694 Waterloo, Ontario, Canada, May 28--30}, 24695 publisher = {University of Waterloo Press}, 24696 key = {14}, 24697 year = {1990} 24698} 24699 24700@Article{ anderson.ferris:genetic*1, 24701 author = {E. J. Anderson and M. C. Ferris}, 24702 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 24703 Problem}, 24704 journal = {ORSA Journal on Computing}, 24705 year = {1994}, 24706 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 24707 volume = {6}, 24708 pages = {161--173}, 24709 key = {22} 24710} 24711 24712@InProceedings{ anderson.ferris:parallel, 24713 author = {E. J. Anderson and M. C. Ferris}, 24714 title = {Parallel Genetic Algorithms in Optimization}, 24715 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 24716 Computing, Chicago, Illinois, December 11-13}, 24717 year = {1989}, 24718 key = {12} 24719} 24720 24721@Unpublished{ anderson.lewis:primal, 24722 author = {E. J. Anderson and A. S. Lewis}, 24723 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24724 note = {In preparation} 24725} 24726 24727@Book{ anderson.nash:linear, 24728 author = {E. J. Anderson and P. Nash}, 24729 title = {Linear Programming in Infinite--Dimensional Spaces}, 24730 year = {1987}, 24731 publisher = {John Wiley \& Sons}, 24732 address = {Chichester} 24733} 24734 24735@InProceedings{ anderson:primal, 24736 author = {E. J. Anderson}, 24737 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24738 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 24739 Programming, Cambridge, September 1984}, 24740 year = {1985}, 24741 editor = {E. J. Anderson and A. B. Philpott}, 24742 publisher = {Springer-Verlag}, 24743 address = {Berlin} 24744} 24745 24746@Article{ andradottir:method, 24747 author = {S. Andrad\'{o}ttir}, 24748 title = {A Method of Discrete Stochastic Optimization}, 24749 journal = {Management Science}, 24750 year = {1995}, 24751 volume = {41}, 24752 pages = {1946--1961} 24753} 24754 24755@Article{ andradottir:global, 24756 author = {S. Andrad\'{o}ttir}, 24757 title = {A Global Search Method for Discrete Stochastic Optimization}, 24758 journal = {SIAM Journal on Optimization}, 24759 year = {1996}, 24760 volume = {6}, 24761 pages = {513--530} 24762} 24763 24764@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 24765 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 24766 title = {An infeasible--interior--point predictor--corrector algorithm for the 24767 {P}$_x$--geometric {LCP}}, 24768 institution = {Department of Mathematics, The University of Iowa}, 24769 address = {Iowa City, Iowa}, 24770 year = {1994}, 24771 number = {62}, 24772 type = {Reports on Computational Mathematics} 24773} 24774 24775@TechReport{ anitescu.potra:formulating, 24776 author = {M. Anitescu and F. A. Potra}, 24777 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 24778 Linear Complementarity Problems}, 24779 institution = {Department of Mathematics, The University of Iowa}, 24780 year = {1996}, 24781 type = {Report}, 24782 number = {93}, 24783 address = {Iowa City, Iowa} 24784} 24785 24786@Article{ anstreicher.lee.ea:crashing, 24787 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 24788 title = {Crashing a Maximum-Weight Complementarity Basis}, 24789 journal = {Mathematical Programming}, 24790 year = {1992}, 24791 volume = {54}, 24792 pages = {281--294} 24793} 24794 24795@Article{ anstreicher:combined, 24796 author = {K. M. Anstreicher}, 24797 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 24798 programming}, 24799 journal = {Mathematical Programming}, 24800 year = {1991}, 24801 volume = {52}, 24802 pages = {429--440} 24803} 24804 24805@Article{ anstreicher:combined*1, 24806 author = {K. M. Anstreicher}, 24807 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 24808 journal = {Mathematical Programming}, 24809 year = {1989}, 24810 volume = {43}, 24811 pages = {209--223} 24812} 24813 24814@InCollection{ arbenz.gander.ea:remote, 24815 author = {P. Arbenz and W. Gander and M. Oettli}, 24816 title = {The Remote Computational System}, 24817 booktitle = {High-Performance Computation and Networks}, 24818 publisher = {Springer-Verlag}, 24819 year = {1996}, 24820 volume = {1067}, 24821 series = {Lecture Notes in Computer Science}, 24822 pages = {662--667} 24823} 24824 24825@InCollection{ arcus:comsoal, 24826 author = {A. L. Arcus}, 24827 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 24828 booktitle = {Readings in Production and Operations Management}, 24829 year = {1966}, 24830 editor = {E. S. Buffa}, 24831 publisher = {John Wiley \& Sons}, 24832 address = {New York} 24833} 24834 24835@TechReport{ arioli.chan.ea:computing, 24836 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 24837 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 24838 Optimization Calculations}, 24839 institution = {CERFACS}, 24840 year = {1993}, 24841 number = {TR/PA/93/34} 24842} 24843 24844@Article{ armijo:minimization, 24845 author = {L. Armijo}, 24846 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 24847 Derivatives}, 24848 journal = {Pacific Journal of Mathematics}, 24849 year = {1966}, 24850 volume = {16}, 24851 pages = {1--3} 24852} 24853 24854@Article{ arrow.debreu:existence, 24855 author = {K. Arrow and G. Debreu}, 24856 title = {Existence of Equilibrium for a Competitive Economy}, 24857 journal = {Econometrica}, 24858 year = {1954}, 24859 volume = {22}, 24860 pages = {265--290} 24861} 24862 24863@InCollection{ arrow.solow:gradient, 24864 author = {K. J. Arrow and R. M. Solow}, 24865 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 24866 booktitle = {Studies in Linear and Nonlinear Programming}, 24867 year = {1958}, 24868 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 24869 publisher = {Stanford University Press}, 24870 address = {Stanford, California}, 24871 pages = {166--176} 24872} 24873 24874@Book{ aubin.ekeland:nonlinear, 24875 author = {J.-P. Aubin and I. Ekeland}, 24876 title = {Applied nonlinear analysis}, 24877 publisher = {John Wiley \& Sons}, 24878 address = {New York}, 24879 year = {1984} 24880} 24881 24882@Article{ auchmuty:variational, 24883 author = {G. Auchmuty}, 24884 title = {Variational Principles for Variational Inequalities}, 24885 journal = {Numerical Functional Analysis and Optimization}, 24886 year = {1989}, 24887 volume = {10}, 24888 pages = {863--874} 24889} 24890 24891@Book{ auerbach.kotlikoff:dynamic, 24892 author = {A. J. Auerbach and L. J. Kotlikoff}, 24893 title = {Dynamic Fiscal Policy}, 24894 publisher = {Cambridge University Press}, 24895 address = {Cambridge, England}, 24896 year = {1987} 24897} 24898 24899@InProceedings{ ault.deutsch.ea:interpolating, 24900 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 24901 title = {Interpolating Subspaces in Approximation Theory}, 24902 booktitle = {Approximation Theory}, 24903 year = {1970}, 24904 editor = {A. Talbot}, 24905 publisher = {Academic Press}, 24906 address = {London} 24907} 24908 24909@Article{ auslender.crouzeix:global, 24910 author = {A. A. Auslender and J.--P. Crouzeix}, 24911 title = {Global Regularity Theorems}, 24912 journal = {Mathematics of Operations Research}, 24913 year = {1988}, 24914 volume = {13}, 24915 pages = {243--253} 24916} 24917 24918@Article{ auslender.haddou:interior-proximal, 24919 author = {A. Auslender and M. Haddou}, 24920 title = {An interior-proximal method for convex linearly constrained problems and its 24921 extension to variational inequalities}, 24922 year = {1995}, 24923 journal = {Mathematical Programming}, 24924 pages = {77--100}, 24925 volume = {71} 24926} 24927 24928@Article{ auslender:convergence, 24929 author = {A. Auslender}, 24930 title = {Convergence of stationary sequences for variational inequalities with maximal 24931 monotone operators}, 24932 journal = {Applied Mathematics and Optimization}, 24933 volume = {28}, 24934 year = {1993}, 24935 pages = {161--172} 24936} 24937 24938@Book{ auslender:optimization, 24939 author = {A. Auslender}, 24940 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 24941 year = {1976}, 24942 publisher = {Masson}, 24943 address = {Paris} 24944} 24945 24946@TechReport{ averick.carter.ea:minpack-2, 24947 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 24948 title = {The {MINPACK-2} Test Problem Collection}, 24949 institution = {Argonne National Laboratory}, 24950 year = {1992}, 24951 address = {Argonne, Illinois}, 24952 number = {MCS-P153-0692} 24953} 24954 24955@TechReport{ axline.billups.ea:guidelines, 24956 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 24957 title = {Guidelines for Software Security ({U})}, 24958 institution = {SNL}, 24959 year = {1989}, 24960 month = oct, 24961 address = {Albuquerque, New Mexico}, 24962 number = {SAND88-2955} 24963} 24964 24965@Article{ ayres.walter:greenhouse, 24966 author = {R. U. Ayres and J. Walter}, 24967 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 24968 journal = {Environmental and Resource Economics}, 24969 year = {1991}, 24970 volume = {1}, 24971 pages = {237--270} 24972} 24973 24974@PhDThesis{ bagley:behaviour, 24975 author = {J. D. Bagley}, 24976 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 24977 Algorithms}, 24978 year = {1967}, 24979 school = {University of Michigan} 24980} 24981 24982@Article{ bain.stewart:application, 24983 author = {R. S. Bain and W. E. Stewart}, 24984 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 24985 Algebraic Equation Systems}, 24986 journal = {Computers in Chemical Engineering}, 24987 year = {1991}, 24988 volume = {15}, 24989 pages = {203--208} 24990} 24991 24992@Article{ baker.lasdon:successive, 24993 author = {T. E. Baker and L. S. Lasdon}, 24994 title = {Successive Linear Programming at {E}xxon}, 24995 journal = {Management Science}, 24996 year = {1985}, 24997 volume = {31}, 24998 pages = {264--274} 24999} 25000 25001@InProceedings{ baker:reducing, 25002 crossref = {grefenstette:genetic}, 25003 author = {J. E. Baker}, 25004 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 25005 pages = {14--21} 25006} 25007 25008@Article{ balas.zemel:algorithm, 25009 author = {E. Balas and E. Zemel}, 25010 title = {An Algorithm for Large Zero--One Knapsack Problems}, 25011 journal = {Operations Research}, 25012 year = {1980}, 25013 volume = {28}, 25014 pages = {1132--1154} 25015} 25016 25017@Book{ ballard.fullerton.ea:general, 25018 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 25019 title = {A General Equilibrium Model for Tax Policy Evaluation}, 25020 publisher = {The University of Chicago Press}, 25021 year = {1985}, 25022 series = {National Bureau of Economic Research Monograph} 25023} 25024 25025@InProceedings{ balog.angelos.ea:dose, 25026 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 25027 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 25028 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 25029 Radiation Therapy, Salt Lake City}, 25030 year = {1997}, 25031 editor = {D. D. Leavitt and G. Starkshall}, 25032 publisher = {Medical Physics Publishing}, 25033 address = {St. Louis, Missouri}, 25034 pages = {323--326} 25035} 25036 25037@Article{ baraff:fast, 25038 author = {D. Baraff}, 25039 title = {Fast contact force computation for nonpenetrating rigid bodies}, 25040 journal = {Computer Graphics (Proceedings SIGRAPH)}, 25041 year = {1994}, 25042 pages = {23--34}, 25043 volume = {28} 25044} 25045 25046@Article{ baraff:issues, 25047 author = {D. Baraff}, 25048 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 25049 journal = {Algorithmica}, 25050 volume = {10}, 25051 year = {1993}, 25052 pages = {292--352} 25053} 25054 25055@Book{ barrett.berry.ea:templates, 25056 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 25057 Methods}, 25058 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 25059 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 25060 year = {1994}, 25061 publisher = {SIAM}, 25062 address = {Philadelphia, Pennsylvania} 25063} 25064 25065@Article{ bard:algorithm, 25066 author = {J. F. Bard}, 25067 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 25068 journal = {Mathematics of Operations Research}, 25069 year = {1983}, 25070 volume = {8}, 25071 pages = {260--272} 25072} 25073 25074@Article{ bard:convex, 25075 author = {J. F. Bard}, 25076 title = {Convex Two-Level Optimization}, 25077 journal = {Mathematical Programming}, 25078 year = {1988}, 25079 volume = {40}, 25080 pages = {15--27} 25081} 25082 25083@InCollection{ bard:eclectic, 25084 author = {Y. Bard}, 25085 title = {An Eclectic Approach to Nonlinear Programming}, 25086 booktitle = {Optimization}, 25087 publisher = {University of Queensland Press}, 25088 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 25089 year = {1972}, 25090 address = {St. Lucia, Queensland, Australia}, 25091 pages = {116--128} 25092} 25093 25094@Article{ barnes:variation, 25095 author = {E. R. Barnes}, 25096 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 25097 journal = {Mathematical Programming}, 25098 year = {1986}, 25099 volume = {36}, 25100 pages = {174--182} 25101} 25102 25103@Article{ bartels.golub:simplex, 25104 author = {R. H. Bartels and G. H. Golub}, 25105 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 25106 journal = {Communications of the Asociation for Computing Machinery}, 25107 year = {1969}, 25108 volume = {12}, 25109 pages = {266--268} 25110} 25111 25112@Article{ barton.ivey:nelder, 25113 author = {R. Barton and J. S. Ivey}, 25114 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 25115 journal = {Management Science}, 25116 year = {1996}, 25117 volume = {42}, 25118 number = {7}, 25119 pages = {954--973} 25120} 25121 25122@Article{ battiti:first-, 25123 author = {R. Battiti}, 25124 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 25125 {N}ewton's Method}, 25126 journal = {Neural Computation}, 25127 year = {1992}, 25128 volume = {4}, 25129 pages = {141--166} 25130} 25131 25132@Article{ baudet:asynchronous, 25133 author = {G. M. Baudet}, 25134 title = {Asynchronous iterative methods for multiprocesors}, 25135 journal = {Journal of the Association for Computing Machinery}, 25136 year = {1978}, 25137 volume = {25}, 25138 pages = {226--244} 25139} 25140 25141@InProceedings{ baum.haussler:what, 25142 author = {E. B. Baum and D. Haussler}, 25143 title = {What Size Net Gives Valid Generalization}, 25144 booktitle = {Advances in Neural Information Processing Systems I}, 25145 year = {1989}, 25146 editor = {D. S. Touretzky}, 25147 publisher = {Morgan Kaufmann}, 25148 address = {San Mateo, California}, 25149 pages = {81--90} 25150} 25151 25152@Misc{ baum:private, 25153 author = {E. B. Baum}, 25154 title = {Private Communication}, 25155 year = {1992}, 25156 address = {NEC Research Institute, Princeton, New Jersey} 25157} 25158 25159@Book{ bazaraa.sherali.ea:nonlinear, 25160 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 25161 title = {Nonlinear Programming}, 25162 edition = {Second}, 25163 publisher = {John Wiley and Sons}, 25164 address = {New York}, 25165 year = {1993} 25166} 25167 25168@Book{ bazaraa.shetty:nonlinear, 25169 author = {M. S. Bazaraa and C. M. Shetty}, 25170 title = {Nonlinear Programming: Theory and Algorithms}, 25171 publisher = {John Wiley \& Sons}, 25172 year = {1979}, 25173 address = {New York, New York} 25174} 25175 25176@Article{ beale:cycling, 25177 author = {E. M. L. Beale}, 25178 title = {Cycling in the Dual Simplex Method}, 25179 journal = {Naval Research Logistics Quarterly}, 25180 year = {1955}, 25181 volume = {2}, 25182 pages = {103--107} 25183} 25184 25185@InProceedings{ becker.cun:improving, 25186 author = {S. Becker and Y. le Cun}, 25187 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 25188 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 25189 year = {1988}, 25190 editor = {D. S. Touretzky}, 25191 publisher = {Morgan Kaufmann}, 25192 address = {San Mateo, California}, 25193 pages = {29--37} 25194} 25195 25196@Book{ ben-israel.ben-tal.ea:optimality, 25197 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 25198 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 25199 year = {1981}, 25200 publisher = {John Wiley \& Sons}, 25201 address = {New York} 25202} 25203 25204@Article{ ben-israel:newton-raphson, 25205 author = {A. Ben--Israel}, 25206 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 25207 journal = {Journal of Mathematical Analysis and its Applications}, 25208 year = {1966}, 25209 volume = {15}, 25210 pages = {243--252} 25211} 25212 25213@Article{ ben-tal.melman.ea:curved, 25214 author = {A. Ben--Tal and A. Melman and J. Zowe}, 25215 title = {Curved Search Methods for Unconstrained Optimization}, 25216 journal = {Optimization}, 25217 year = {1990}, 25218 volume = {21}, 25219 pages = {669--695}, 25220 publisher = {John Wiley \& Sons}, 25221 address = {New York} 25222} 25223 25224@InProceedings{ bennett.ferris.ea:genetic, 25225 crossref = {belew.booker:fourth}, 25226 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 25227 title = {A Genetic Algorithm for Database Query Optimization}, 25228 pages = {400--407}, 25229 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 25230 key = {19} 25231} 25232 25233@Article{ bennett.mangasarian:bilinear, 25234 author = {K. P. Bennett and O. L. Mangasarian}, 25235 title = {Bilinear Separation of Two Sets in n-Space}, 25236 journal = {Computational Optimization and Applications}, 25237 year = {1993}, 25238 volume = {2}, 25239 pages = {207--227} 25240} 25241 25242@Article{ bennett.mangasarian:multicategory, 25243 author = {K. P. Bennett and O. L. Mangasarian}, 25244 title = {Multicategory Separation via Linear Programming}, 25245 journal = {Optimization Methods and Software}, 25246 year = {1993}, 25247 volume = {3}, 25248 pages = {27--39} 25249} 25250 25251@InProceedings{ bennett.mangasarian:neural, 25252 author = {K. P. Bennett and O. L. Mangasarian}, 25253 title = {Neural Network Training via Linear Programming}, 25254 booktitle = {Advances in Optimization and Parallel Computing}, 25255 year = {1992}, 25256 editor = {P. M. Pardalos}, 25257 publisher = {North Holland}, 25258 address = {Amsterdam}, 25259 pages = {56--67} 25260} 25261 25262@Article{ bennett.mangasarian:robust, 25263 author = {K. P. Bennett and O. L. Mangasarian}, 25264 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 25265 journal = {Optimization Methods and Software}, 25266 year = {1992}, 25267 volume = {1}, 25268 pages = {23--34} 25269} 25270 25271@Article{ bennett.mangasarian:serial, 25272 author = {K. P. Bennett and O. L. Mangasarian}, 25273 title = {Serial and Parallel Multicategory Separation}, 25274 journal = {SIAM Journal on Optimization}, 25275 year = {1994}, 25276 volume = {4}, 25277 pages = {722--734} 25278} 25279 25280@TechReport{ bennett.wu.ea:support, 25281 author = {K. P. Bennett and D. Wu and L. Auslender}, 25282 title = {On Support Vector Decision Trees for Database Marketing}, 25283 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 25284 year = {1998}, 25285 optkey = {}, 25286 opttype = {RPI Math Report}, 25287 optnumber = {98-100}, 25288 optaddress = {Troy, New York}, 25289 optmonth = {}, 25290 optnote = {}, 25291 optannote = {} 25292} 25293 25294@InProceedings{ bennett:decision, 25295 author = {K. P. Bennett}, 25296 title = {Decision Tree Construction Via Linear Programming}, 25297 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 25298 Society Conference}, 25299 year = {1992}, 25300 editor = {M. Evans}, 25301 address = {Utica, Illinois}, 25302 pages = {97--101} 25303} 25304 25305@Book{ berge.ghouila-houri:programming, 25306 author = {C. Berge and A. Ghouila-Houri}, 25307 title = {Programming, Games and Transportation Networks}, 25308 year = {1965}, 25309 publisher = {John Wiley \& Sons}, 25310 address = {New York} 25311} 25312 25313@Book{ berge:topological, 25314 author = {C. Berge}, 25315 title = {Topological Spaces}, 25316 year = {1963}, 25317 publisher = {McMillan}, 25318 address = {New York} 25319} 25320 25321@TechReport{ berkelaar.jansen.ea:basis, 25322 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 25323 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 25324 Complementarity Problems}, 25325 institution = {Department of Econometrics and Operations Research}, 25326 year = {1996}, 25327 address = {Erasmus University, Rotterdam, The Netherlands} 25328} 25329 25330@Article{ bertsekas.baz:distributed, 25331 author = {D. P. Bertsekas and D. El Baz}, 25332 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 25333 journal = {SIAM Journal on Control and Optimization}, 25334 year = {1987}, 25335 volume = {25}, 25336 pages = {74--85} 25337} 25338 25339@Article{ bertsekas.gafni:projection, 25340 author = {D. P. Bertsekas and E. M. Gafni}, 25341 title = {Projection Methods for Variational Inequalities with Application to the Traffic 25342 Assignment Problem}, 25343 journal = {Mathematical Programming Study}, 25344 year = {1982}, 25345 volume = {17}, 25346 pages = {139--159} 25347} 25348 25349@Article{ bertsekas.hossein.ea:relaxation, 25350 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 25351 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 25352 journal = {SIAM Journal on Control and Optimization}, 25353 year = {1987}, 25354 volume = {25}, 25355 pages = {1219--1243} 25356} 25357 25358@Unpublished{ bertsekas.tseng:partial, 25359 author = {D. P. Bertsekas and P. Tseng}, 25360 title = {Partial Proximal Minimization for Convex Programming}, 25361 year = {1991}, 25362 note = {Manuscript} 25363} 25364 25365@Article{ bertsekas.tsitsiklis:analysis, 25366 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25367 title = {An Analysis of Stochastic Shortest Path Problems}, 25368 journal = {Mathematics of Operations Research}, 25369 year = {1991}, 25370 volume = {16}, 25371 pages = {580--595} 25372} 25373 25374@Book{ bertsekas.tsitsiklis:parallel, 25375 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25376 title = {Parallel and Distributed Computation: Numerical Methods}, 25377 publisher = {Prentice-Hall, Inc}, 25378 year = {1989}, 25379 address = {Englewood Cliffs, New Jersey} 25380} 25381 25382@Book{ bertsekas:constrained, 25383 author = {D. P. Bertsekas}, 25384 title = {Constrained Optimization and Lagrange Multiplier Methods}, 25385 year = {1982}, 25386 publisher = {Academic Press}, 25387 address = {New York} 25388} 25389 25390@Book{ bertsekas:dynamic, 25391 author = {D. P. Bertsekas}, 25392 title = {Dynamic Programming and Optimal Control}, 25393 publisher = {Athena Scientific}, 25394 year = {1995}, 25395 address = {Belmont MA} 25396} 25397 25398@Article{ bertsekas:enlarging, 25399 author = {D. P. Bertsekas}, 25400 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 25401 Optimization}, 25402 journal = {Journal of Optimization Theory and Applications}, 25403 year = {1982}, 25404 volume = {36}, 25405 pages = {221--252} 25406} 25407 25408@Article{ bertsekas:goldstein-levitin-poljak, 25409 author = {D. P. Bertsekas}, 25410 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 25411 journal = {IEEE Transactions on Automatic Control}, 25412 year = {1976}, 25413 volume = {AC-21}, 25414 pages = {174--184} 25415} 25416 25417@Article{ bertsekas:multiplier, 25418 author = {D. P. Bertsekas}, 25419 title = {Multiplier Methods: {A} Survey}, 25420 journal = {Automatica}, 25421 year = {1976}, 25422 volume = {12}, 25423 pages = {133--145} 25424} 25425 25426@Article{ bertsekas:necessary, 25427 author = {D. P. Bertsekas}, 25428 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 25429 journal = {Mathematical Programming}, 25430 year = {1975}, 25431 volume = {9}, 25432 pages = {87--99} 25433} 25434 25435@Book{ bertsekas:nonlinear, 25436 author = {D. P. Bertsekas}, 25437 title = {Nonlinear Programming}, 25438 publisher = {Athena Scientific}, 25439 year = {1995}, 25440 address = {Belmont, Massachusetts} 25441} 25442 25443@Article{ bertsekas:projected, 25444 author = {Dimitri P. Bertsekas}, 25445 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 25446 journal = {SIAM Journal on Control and Optimization}, 25447 year = {1982}, 25448 volume = {20}, 25449 pages = {221--246} 25450} 25451 25452@Article{ billups.dirkse.ea:comparison, 25453 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 25454 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 25455 journal = {Computational Optimization and Applications}, 25456 year = {1997}, 25457 pages = {3--25}, 25458 volume = {7}, 25459 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 25460 key = {51} 25461} 25462 25463@Article{ billups.ferris:convergence, 25464 author = {S. C. Billups and M. C. Ferris}, 25465 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 25466 Starting Points}, 25467 journal = {SIAM Journal on Optimization}, 25468 year = {1996}, 25469 volume = {6}, 25470 pages = {316--325}, 25471 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 25472 key = {34} 25473} 25474 25475@TechReport{ billups.ferris:convergence*1, 25476 author = {S. C. Billups and M. C. Ferris}, 25477 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 25478 Points}, 25479 institution = {Computer Sciences Department, University of Wisconsin}, 25480 year = {1993}, 25481 address = {Madison, Wisconsin}, 25482 number = {1180}, 25483 note = {Revised version in SIAM Journal on Optimization.} 25484} 25485 25486@Article{ billups.ferris:qpcomp, 25487 author = {S. C. Billups and M. C. Ferris}, 25488 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 25489 year = {1997}, 25490 journal = {Mathematical Programming}, 25491 pages = {533--562}, 25492 volume = {76}, 25493 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 25494 key = {47} 25495} 25496 25497@Article{ billups.ferris:solutions, 25498 author = {S. C. Billups and M. C. Ferris}, 25499 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 25500 journal = {Mathematics of Operations Research}, 25501 volume = {24}, 25502 pages = {219--236}, 25503 year = {1999}, 25504 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 25505 key = {42}, 25506 institution = {Computer Sciences Department, University of Wisconsin}, 25507 address = {Madison, Wisconsin}, 25508 type = {Mathematical Programming Technical Report}, 25509 number = {94--15} 25510} 25511 25512@TechReport{ billups.murata.ea:users, 25513 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 25514 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 25515 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 25516 institution = {SNL}, 25517 year = {1994}, 25518 month = jan, 25519 address = {Albuquerque, New Mexico}, 25520 number = {SAND91--1482} 25521} 25522 25523@TechReport{ billups.speight.ea:nonmonotone, 25524 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 25525 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 25526 Problems}, 25527 institution = {Department of Mathematics, University of Colorado}, 25528 year = {1999}, 25529 address = {Denver, Colorado} 25530} 25531 25532@PhDThesis{ billups:algorithms, 25533 author = {S. C. Billups}, 25534 title = {Algorithms for Complementarity Problems and Generalized Equations}, 25535 school = {University of Wisconsin--Madison}, 25536 year = {1995}, 25537 address = {Madison, Wisconsin}, 25538 month = aug 25539} 25540 25541@MastersThesis{ billups:augmented, 25542 author = {S. C. Billups}, 25543 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 25544 school = {Virginia Tech}, 25545 year = {1985}, 25546 address = {Blacksburg, Virginia} 25547} 25548 25549@TechReport{ billups:homotopy, 25550 author = {S. C. Billups}, 25551 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 25552 institution = {Department of Mathematics, University of Colorado}, 25553 year = {1998}, 25554 address = {Denver, Colorado} 25555} 25556 25557@Article{ billups:improving, 25558 author = {S. C. Billups}, 25559 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 25560 Proximal Perturbations}, 25561 year = {2000}, 25562 journal = {Mathematical Programming}, 25563 volume = {87}, 25564 pages = {153--176} 25565} 25566 25567@Book{ birge.louveaux:introduction, 25568 author = {J. R. Birge and R. Louveaux}, 25569 title = {Introduction to Stochastic Programming}, 25570 publisher = {Springer}, 25571 address = {New York}, 25572 year = {1997} 25573} 25574 25575@TechReport{ bischof.carle.ea:adifor, 25576 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 25577 title = {{ADIFOR} 2.0 User's Guide}, 25578 institution = {Argonne National Laboratory}, 25579 year = {1995}, 25580 address = {Argonne, Illinois}, 25581 number = {ANL/MCS--TM--192}, 25582 type = {Mathematics and Computer Science Division Report} 25583} 25584 25585@Book{ bisschop.entriken:aimms, 25586 author = {J. Bisschop and R. Entriken}, 25587 title = {{AIMMS} -- The Modeling System}, 25588 year = {1993}, 25589 publisher = {Paragon Decision Technology}, 25590 address = {Haarlem, The Netherlands} 25591} 25592 25593@Article{ bisschop.meeraus:development, 25594 author = {J. Bisschop and A. Meeraus}, 25595 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 25596 Environment}, 25597 journal = {Mathematical Programming Study}, 25598 year = {1982}, 25599 volume = {20}, 25600 pages = {1--29} 25601} 25602 25603@Misc{ bixby.ceria.ea:miplib, 25604 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 25605 title = {{MIPLIB} 3.0}, 25606 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 25607} 25608 25609@InProceedings{ bjorkman.klarbring.ea:sequential, 25610 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 25611 Sj{\"{o}}din}, 25612 title = {Sequential quadratic programming for non-linear elastic contact problems}, 25613 editor = {J. Herskovits}, 25614 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 25615 Systems}, 25616 volume = {2}, 25617 year = {1993}, 25618 pages = {301--308} 25619} 25620 25621@Article{ bjorkman:path, 25622 author = {G. Bj{\"o}rkman}, 25623 title = {Path Following and Critical Points for Contact Problems}, 25624 journal = {Computational Mechanics}, 25625 volume = {10}, 25626 pages = {231--246}, 25627 year = {1992} 25628} 25629 25630@Article{ bjorkman:solution, 25631 author = {G. Bj{\"o}rkman}, 25632 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 25633 of Linear Complementarity Problems}, 25634 journal = {International Journal for Numerical Methods in Engineering}, 25635 volume = {31}, 25636 pages = {1553--1566}, 25637 year = {1991} 25638} 25639 25640@Article{ bland:pivot, 25641 author = {R. G. Bland}, 25642 title = {New Pivot Rules for the Simplex Method}, 25643 journal = {Mathematics of Operations Research}, 25644 year = {1977}, 25645 volume = {2}, 25646 pages = {103--107} 25647} 25648 25649@Article{ block.levin:boundedness, 25650 author = {H. D. Block and S. A. Levin}, 25651 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 25652 Inequalities}, 25653 journal = {Proceedings of the American Mathematical Society}, 25654 year = {1970}, 25655 volume = {26}, 25656 pages = {229--235} 25657} 25658 25659@Book{ bloomer:power, 25660 author = {J. Bloomer}, 25661 title = {Power Programming with {RPC}}, 25662 publisher = {O'Reilly and Associates, Inc.}, 25663 address = {Sebastopol, CA}, 25664 year = {1992} 25665} 25666 25667@InProceedings{ blum.rivest:training, 25668 author = {A. Blum and R. L. Rivest}, 25669 title = {Training a 3-Node Neural Network is {NP}-Complete}, 25670 booktitle = {Advances in Neural Information Processing Systems I}, 25671 year = {1989}, 25672 editor = {D. S. Touretzky}, 25673 publisher = {Morgan Kaufmann}, 25674 address = {San Mateo, California}, 25675 pages = {494--501} 25676} 25677 25678@InProceedings{ boehringer.ferris.ea:exemptions, 25679 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 25680 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 25681 from a General Equilibrium Model for Six {EU} Countries}, 25682 key = {49}, 25683 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 25684 year = {1995} 25685} 25686 25687@Article{ boender.kan:bayesian, 25688 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 25689 title = {Bayesian Stopping Rules for Global Optimization}, 25690 journal = {Mathematical Programming}, 25691 year = {1987}, 25692 volume = {37}, 25693 pages = {59--80} 25694} 25695 25696@Article{ boggs:convergence, 25697 author = {P. T. Boggs}, 25698 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 25699 Problems}, 25700 journal = {Mathematics of Computation}, 25701 year = {1976}, 25702 volume = {30}, 25703 pages = {512--522} 25704} 25705 25706@InProceedings{ bolzon.cochetti.ea:computing, 25707 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 25708 title = {On computing all solutions in decohesion}, 25709 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 25710 International Congress of Theoretical and Applied Mechanics}, 25711 year = {1996}, 25712 address = {Kyoto} 25713} 25714 25715@InProceedings{ bolzon.maier.ea:holonomic, 25716 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25717 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 25718 study of mathematical programming approaches}, 25719 booktitle = {Fracture Mechanics of Concrete Structures}, 25720 editor = {F. H. Wittmann}, 25721 series = {Second International Conference on Fracture Mechanics of Concrete Structures 25722 (FRAMCOS 2)}, 25723 year = {1995}, 25724 publisher = {Aedificatio Publishers}, 25725 pages = {885--898} 25726} 25727 25728@InProceedings{ bolzon.maier.ea:holonomic*1, 25729 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25730 title = {On holonomic structural analysis as a complementarity problem}, 25731 booktitle = {APCOM96, Seoul}, 25732 year = {1996} 25733} 25734 25735@Article{ bolzon.maier.ea:multiplicity, 25736 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25737 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 25738 journal = {Computational Mechanics}, 25739 year = {1997}, 25740 volume = {19}, 25741 pages = {511--516} 25742} 25743 25744@Article{ bongartz.conn.ea:cute, 25745 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 25746 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 25747 year = {1995}, 25748 journal = {{ACM} Transactions on Mathematical Software}, 25749 volume = {21}, 25750 pages = {123--160} 25751} 25752 25753@Article{ boppana:eigenvalues, 25754 author = {R. Boppana}, 25755 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 25756 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 25757 pages = {280--285}, 25758 year = {1987} 25759} 25760 25761@Article{ bortfeld.kahler.ea:x-ray, 25762 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 25763 title = {{X}-ray field compensation with multileaf collimators}, 25764 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25765 year = {1994}, 25766 volume = {28}, 25767 number = {3}, 25768 pages = {723--730} 25769} 25770 25771@Article{ bortfeld.schlegel:optimization, 25772 author = {T. Bortfeld and W. Schlegel}, 25773 title = {Optimization of beam orientations in radiation therapy: some theoretical 25774 considerations}, 25775 journal = {Physics in Medicine and Biology}, 25776 year = {1993}, 25777 volume = {38}, 25778 number = {2}, 25779 pages = {291--304} 25780} 25781 25782@Article{ borwein:stability, 25783 author = {J. M. Borwein}, 25784 title = {Stability and regular points of inequality systems}, 25785 journal = {Journal of Optimization Theory and Applications}, 25786 year = {1986}, 25787 volume = {48}, 25788 pages = {9--52} 25789} 25790 25791@Article{ boyer:present, 25792 author = {A. L. Boyer}, 25793 title = {Present and Future Developments in Radiotherapy Treatment Units}, 25794 journal = {Seminars in Radiation Oncology}, 25795 year = {1995}, 25796 volume = {5}, 25797 number = {2}, 25798 pages = {146--155} 25799} 25800 25801@Article{ bracken.mcgill:mathematical, 25802 author = {J. Bracken and J. T. McGill}, 25803 title = {Mathematical programs with optimization problems in the constraints}, 25804 journal = {Operations Research}, 25805 volume = {21}, 25806 year = {1973}, 25807 pages = {37--44} 25808} 25809 25810@Article{ bradley.fayyad.ea:mathematical, 25811 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 25812 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 25813 journal = {INFORMS Journal on Computing}, 25814 year = {1999}, 25815 volume = {11}, 25816 pages = {217--238} 25817} 25818 25819@TechReport{ bradley.mangasarian.ea:clustering, 25820 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25821 title = {Clustering via Concave Minimization}, 25822 institution = {Computer Sciences Department, University of Wisconsin}, 25823 year = {1996}, 25824 type = {Mathematical Programming Technical Report}, 25825 number = {96-03}, 25826 address = {Madison, Wisconsin} 25827} 25828 25829@TechReport{ bradley.mangasarian.ea:feature, 25830 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25831 title = {Feature Selection via Mathematical Programming}, 25832 institution = {Computer Sciences Department, University of Wisconsin}, 25833 year = {1995}, 25834 type = {Mathematical Programming Technical Report}, 25835 number = {95-21}, 25836 address = {Madison, Wisconsin} 25837} 25838 25839@Article{ bradley.mangasarian:massive, 25840 author = {P. S. Bradley and O. L. Mangasarian}, 25841 title = {Massive Data Discrimination via Linear Support Vector Machines}, 25842 year = {2000}, 25843 journal = {Optimization Methods and Software}, 25844 volume = {13}, 25845 pages = {1-10} 25846} 25847 25848@PhDThesis{ brady:condition, 25849 author = {L. Brady}, 25850 title = {Condition Constants for Solutions of Convex Inequalities}, 25851 year = {1988}, 25852 address = {Madison, Wisconsin}, 25853 school = {Computer Sciences Department, University of Wisconsin} 25854} 25855 25856@Article{ braess:uber, 25857 author = {D. Braess}, 25858 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 25859 journal = {Unternehmensforschung}, 25860 year = {1968}, 25861 volume = {12}, 25862 pages = {258--268} 25863} 25864 25865@Article{ brahme:optimization, 25866 author = {A. Brahme}, 25867 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 25868 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25869 year = {1993}, 25870 volume = {25}, 25871 pages = {373--375} 25872} 25873 25874@Article{ brahme:stationary, 25875 author = {A. Brahme}, 25876 title = {Optimization of stationary and moving beam radiation therapy techniques}, 25877 journal = {Radiother. Oncol.}, 25878 year = {1988}, 25879 volume = {12}, 25880 pages = {129--140} 25881} 25882 25883@InCollection{ brahme:treatment, 25884 author = {A. Brahme}, 25885 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 25886 booktitle = {Radiation Therapy Physics}, 25887 publisher = {Springer-Verlag}, 25888 year = {1995}, 25889 editor = {A. R. Smith}, 25890 address = {Berlin}, 25891 pages = {209--246} 25892} 25893 25894@TechReport{ branch:getting, 25895 author = {M. A. Branch}, 25896 title = {Getting {CUTE} with {M}atlab}, 25897 institution = {Cornell University}, 25898 year = {1994}, 25899 type = {Cornell Theory Center Report}, 25900 number = {CTC94TR194}, 25901 address = {Ithaca, New York} 25902} 25903 25904@Article{ brearley.mitra.ea:analysis, 25905 author = {A. Brearley and G. Mitra and H. Williams}, 25906 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 25907 Algorithm}, 25908 journal = {Mathematical Programming}, 25909 year = {1975}, 25910 volume = {8}, 25911 pages = {54--83} 25912} 25913 25914@Article{ bredensteiner.bennett:feature, 25915 author = {E. Bredensteiner and K. Bennett}, 25916 title = {Feature Minimization within Decision Trees}, 25917 journal = {Computational Optimization and Applications}, 25918 year = {1998}, 25919 volume = {10}, 25920 pages = {111--126} 25921} 25922 25923@Article{ bregman:relaxation, 25924 author = {L. M. Bregman}, 25925 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 25926 Application to the Solution of Problems in Convex Programming}, 25927 journal = {USSR Computational Mathematics and Mathematical Physics}, 25928 year = {1967}, 25929 volume = {7}, 25930 pages = {200--217} 25931} 25932 25933@Book{ brenner.hall:making, 25934 author = {D. J. Brenner and E. J. Hall}, 25935 title = {Making the Radiation Therapy Decision}, 25936 publisher = {Contemporary Books}, 25937 year = {1996}, 25938 address = {Chicago, IL} 25939} 25940 25941@Book{ brent:algorithms, 25942 author = {R. P. Brent}, 25943 title = {Algorithms for Minimization without Derivatives}, 25944 publisher = {Prentice-Hall, Inc}, 25945 year = {1973}, 25946 address = {Englewood Cliffs, New Jersey} 25947} 25948 25949@Article{ brewster.mohan.ea:three, 25950 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 25951 title = {Three dimensional conformal treatment planning with multileaf collimators}, 25952 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25953 year = {1995}, 25954 volume = {33}, 25955 number = {5}, 25956 pages = {1081--1089} 25957} 25958 25959@Article{ brezis.lions:produits, 25960 author = {H. Br\'{e}zis and P.--L. Lions}, 25961 title = {Produits Infinis de Resolvantes}, 25962 journal = {Israel Journal of Mathematics}, 25963 year = {1978}, 25964 volume = {29}, 25965 pages = {329--345} 25966} 25967 25968@Book{ brezis:operateurs, 25969 author = {H. Br\'{e}zis}, 25970 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 25971 Espaces de Hilbert}, 25972 publisher = {North-Holland}, 25973 address = {Amsterdam}, 25974 year = {1973} 25975} 25976 25977@Book{ brooke.kendrick.ea:gams, 25978 author = {A. Brooke and D. Kendrick and A. Meeraus}, 25979 title = {{GAMS}: {A} User's Guide}, 25980 year = {1988}, 25981 publisher = {The Scientific Press}, 25982 address = {South San Francisco, CA} 25983} 25984 25985@Article{ brown.demarzo.ea:computing, 25986 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 25987 title = {Computing Equilibria when Asset Markets Are Incomplete}, 25988 journal = {Econometrica}, 25989 year = {1996}, 25990 volume = {64}, 25991 pages = {1--28} 25992} 25993 25994@Article{ bruck:iterative, 25995 author = {R. E. Bruck}, 25996 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 25997 in {H}ilbert Space}, 25998 journal = {Bulletin of the American Mathematical Society}, 25999 year = {1975}, 26000 volume = {81}, 26001 pages = {890--892} 26002} 26003 26004@Article{ bunch.parlett:direct, 26005 author = {J. R. Bunch and B. N. Parlett}, 26006 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 26007 journal = {SIAM Journal on Numerical Analysis}, 26008 year = {1971}, 26009 volume = {8}, 26010 pages = {639--655} 26011} 26012 26013@Article{ burachik.iusem.ea:enlargement, 26014 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 26015 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 26016 year = {1997}, 26017 journal = {Set-Valued Analysis, forthcoming} 26018} 26019 26020@TechReport{ burachik.iusem:generalized, 26021 author = {R. S. Burachik and A. N. Iusem}, 26022 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 26023 Problem}, 26024 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 26025 year = {1995}, 26026 type = {Working Paper}, 26027 address = {Rio de Janeiro} 26028} 26029 26030@Article{ burachik.iusem:generalized*1, 26031 author = {R. S. Burachik and A. N. Iusem}, 26032 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 26033 {A} {H}ilbert Space}, 26034 year = {1998}, 26035 journal = {SIAM Journal on Optimization}, 26036 volume = {8}, 26037 pages = {197--216} 26038} 26039 26040@Article{ burdakov:globally, 26041 author = {O. P. Burdakov}, 26042 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 26043 of Nonlinear Equations}, 26044 journal = {Soviet Mathematics Doklady}, 26045 year = {1980}, 26046 volume = {22}, 26047 pages = {376--379} 26048} 26049 26050@Article{ burges:tutorial, 26051 author = {C. J. C. Burges}, 26052 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 26053 journal = {Data Mining and Knowledge Discovery}, 26054 volume = {2}, 26055 number = {2}, 26056 pages = {121-167}, 26057 year = {1998} 26058} 26059 26060@Article{ burke.ferris.ea:clarke, 26061 author = {J. V. Burke and M. C. Ferris and M. Qian}, 26062 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 26063 journal = {Journal of Mathematical Analysis and its Applications}, 26064 year = {1992}, 26065 volume = {166}, 26066 pages = {199--213}, 26067 key = {16} 26068} 26069 26070@Unpublished{ burke.ferris.ea:least, 26071 author = {J. V. Burke and M. C. Ferris and L. Qi}, 26072 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 26073 year = {1994}, 26074 month = mar, 26075 note = {Manuscript}, 26076 key = {999} 26077} 26078 26079@Article{ burke.ferris:characterization, 26080 author = {J. V. Burke and M. C. Ferris}, 26081 title = {Characterization of Solution Sets of Convex Programs}, 26082 journal = {Operations Research Letters}, 26083 year = {1991}, 26084 volume = {10}, 26085 pages = {57--60}, 26086 key = {10} 26087} 26088 26089@Article{ burke.ferris:gauss-newton, 26090 author = {J. V. Burke and M. C. Ferris}, 26091 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 26092 journal = {Mathematical Programming}, 26093 year = {1995}, 26094 volume = {71}, 26095 pages = {179--194}, 26096 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 26097 key = {32} 26098} 26099 26100@Article{ burke.ferris:weak, 26101 author = {J. V. Burke and M. C. Ferris}, 26102 title = {Weak Sharp Minima in Mathematical Programming}, 26103 journal = {SIAM Journal on Control and Optimization}, 26104 year = {1993}, 26105 volume = {31}, 26106 pages = {1340--1359}, 26107 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 26108 key = {23} 26109} 26110 26111@Article{ burke.more.ea:convergence, 26112 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 26113 title = {Convergence Properties of Trust Region Methods for Linear and Convex 26114 Constraints}, 26115 journal = {Mathematical Programming}, 26116 year = {1990}, 26117 volume = {47}, 26118 pages = {305--336} 26119} 26120 26121@Article{ burke.more:exposing, 26122 author = {J. V. Burke and J. J. Mor\'{e}}, 26123 title = {Exposing Constraints}, 26124 journal = {SIAM Journal on Optimization}, 26125 year = {1994}, 26126 volume = {4}, 26127 pages = {573--595} 26128} 26129 26130@Article{ burke.more:identification, 26131 author = {J. V. Burke and J. J. Mor\'{e}}, 26132 title = {On the Identification of Active Constraints}, 26133 journal = {SIAM Journal on Numerical Analysis}, 26134 year = {1988}, 26135 volume = {25}, 26136 pages = {1197--1211} 26137} 26138 26139@Article{ burke.poliquin:optimality, 26140 author = {J. V. Burke and R. A. Poliquin}, 26141 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 26142 journal = {Mathematical Programming}, 26143 year = {1992}, 26144 volume = {57}, 26145 pages = {103--120} 26146} 26147 26148@Article{ burke.tseng:unified, 26149 author = {J. V. Burke and P. Tseng}, 26150 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 26151 journal = {SIAM Journal on Optimization}, 26152 year = {1996}, 26153 volume = {6}, 26154 pages = {265--282} 26155} 26156 26157@Article{ burke.xu:global, 26158 author = {J. V. Burke and S. Xu}, 26159 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 26160 Linear Complementarity Problems}, 26161 year = {1998}, 26162 journal = {Mathematics of Operations Research}, 26163 volume = {23}, 26164 pages = {719--735} 26165} 26166 26167@TechReport{ burke:algorithms, 26168 author = {J. V. Burke}, 26169 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 26170 Inequalities that have both Global and Quadratic Convergence Properties}, 26171 institution = {Argonne National Laboratory}, 26172 year = {1985}, 26173 address = {Argonne, Illinois}, 26174 number = {ANL/MCS--TM--54}, 26175 type = {Mathematics and Computer Science Division Report} 26176} 26177 26178@Article{ burke:descent, 26179 author = {J. V. Burke}, 26180 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 26181 journal = {Mathematical Programming}, 26182 year = {1985}, 26183 volume = {33}, 26184 pages = {260--279} 26185} 26186 26187@Article{ burke:exact, 26188 author = {J. V. Burke}, 26189 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 26190 journal = {SIAM Journal on Control and Optimization}, 26191 year = {1991}, 26192 volume = {29}, 26193 pages = {968--998} 26194} 26195 26196@Article{ burke:identification, 26197 author = {J. V. Burke}, 26198 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 26199 journal = {SIAM Journal on Numerical Analysis}, 26200 year = {1990}, 26201 volume = {27}, 26202 pages = {1081--1102} 26203} 26204 26205@Article{ burke:robust, 26206 author = {J. V. Burke}, 26207 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 26208 journal = {SIAM Journal on Optimization}, 26209 year = {1992}, 26210 volume = {2}, 26211 pages = {325--347} 26212} 26213 26214@Article{ burke:second, 26215 author = {J. V. Burke}, 26216 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 26217 journal = {Mathematical Programming}, 26218 year = {1987}, 26219 volume = {38}, 26220 pages = {287--302} 26221} 26222 26223@Article{ burke:sequential, 26224 author = {J. V. Burke}, 26225 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 26226 Programs}, 26227 journal = {Journal of Mathematical Analysis and its Applications}, 26228 year = {1989}, 26229 volume = {139}, 26230 pages = {319--351} 26231} 26232 26233@Article{ burman.kutcher.ea:fitting, 26234 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 26235 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 26236 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26237 year = {1991}, 26238 optvolume = {21}, 26239 optpages = {123-135} 26240} 26241 26242@TechReport{ busovaca:handling, 26243 author = {S. Busovaca}, 26244 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 26245 institution = {University of Waterloo}, 26246 year = {1985}, 26247 address = {Ontario}, 26248 number = {CS85 34}, 26249 type = {Technical Report} 26250} 26251 26252@Article{ butler.martin:method, 26253 author = {T. Butler and A. V. Martin}, 26254 title = {On a Method of {C}ourant for Minimizing Functionals}, 26255 journal = {Journal of Mathematical Physics}, 26256 year = {1962}, 26257 volume = {41}, 26258 pages = {291--299} 26259} 26260 26261@Article{ calamai.more:projected, 26262 author = {P. H. Calamai and J. J. Mor\'{e}}, 26263 title = {Projected Gradient Methods for Linearly Constrained Problems}, 26264 journal = {Mathematical Programming}, 26265 year = {1987}, 26266 volume = {39}, 26267 pages = {93--116} 26268} 26269 26270@Article{ cao.ferris:genetic, 26271 author = {M. Cao and M. C. Ferris}, 26272 title = {Genetic Algorithms in Optimization}, 26273 journal = {Journal of Undergraduate Mathematics and its Applications}, 26274 year = {1991}, 26275 volume = {12}, 26276 pages = {81--90}, 26277 key = {17} 26278} 26279 26280@Article{ cao.ferris:interior, 26281 author = {M. Cao and M. C. Ferris}, 26282 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 26283 journal = {Journal of Optimization Theory and Applications}, 26284 year = {1994}, 26285 volume = {83}, 26286 pages = {269--283}, 26287 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 26288 key = {28} 26289} 26290 26291@Article{ cao.ferris:lineality, 26292 author = {M. Cao and M. C. Ferris}, 26293 title = {Lineality Removal for Copositive--Plus Normal Maps}, 26294 year = {1995}, 26295 volume = {2}, 26296 pages = {1--10}, 26297 journal = {Communications on Applied Nonlinear Analysis}, 26298 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 26299 key = {38} 26300} 26301 26302@Article{ cao.ferris:pc, 26303 author = {M. Cao and M. C. Ferris}, 26304 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 26305 journal = {Linear Algebra and Its Applications}, 26306 year = {1996}, 26307 volume = {246}, 26308 pages = {299--312}, 26309 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 26310 key = {37} 26311} 26312 26313@Article{ cao.ferris:pivotal, 26314 author = {M. Cao and M. C. Ferris}, 26315 title = {A Pivotal Method for Affine Variational Inequalities}, 26316 journal = {Mathematics of Operations Research}, 26317 year = {1996}, 26318 volume = {21}, 26319 pages = {44--64}, 26320 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 26321 key = {29} 26322} 26323 26324@PhDThesis{ cao:piecewise, 26325 author = {M. Cao}, 26326 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 26327 school = {Computer Sciences Department, University of Wisconsin}, 26328 year = {1994}, 26329 address = {Madison, Wisconsin}, 26330 note = {Technical Report 1210} 26331} 26332 26333@Article{ caroe.schultz:dual, 26334 author = {C. C. Car{\o}e and R. Schultz}, 26335 title = {Dual Decomposition in Stochastic Integer Programming}, 26336 journal = {Operations Research Letters}, 26337 volume = {24}, 26338 pages = {37-45}, 26339 year = {1999} 26340} 26341 26342@Article{ carol.targovnik.ea:initial, 26343 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 26344 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 26345 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 26346 conformal radiation therapy system}, 26347 journal = {Stereotactic and Functional Neurosurgery}, 26348 year = {1996}, 26349 volume = {66}, 26350 pages = {30--34} 26351} 26352 26353@Article{ carolan.hill.ea:empirical, 26354 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 26355 Wichmann}, 26356 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 26357 Applications}, 26358 journal = {Operations Research}, 26359 year = {1990}, 26360 volume = {38}, 26361 pages = {240--248} 26362} 26363 26364@Article{ carroll:created, 26365 author = {C. W. Carroll}, 26366 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 26367 Systems}, 26368 journal = {Operations Research}, 26369 year = {1961}, 26370 volume = {9}, 26371 pages = {169--184} 26372} 26373 26374@PhDThesis{ carroll:operations, 26375 author = {C. W. Carroll}, 26376 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 26377 Process}, 26378 year = {1959}, 26379 address = {Appleton, Wisconsin}, 26380 school = {Institute of Paper Chemistry} 26381} 26382 26383@TechReport{ casanova.dongarra:netsolve, 26384 author = {H. Casanova and J. Dongarra}, 26385 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 26386 institution = {University of Tennessee}, 26387 year = {1996}, 26388 type = {Technical Report} 26389} 26390 26391@TechReport{ cavalier.soyster:computational, 26392 author = {T. M. Cavalier and A. L. Soyster}, 26393 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 26394 institution = {Pennsylvania State University}, 26395 year = {1985}, 26396 address = {Pennsylvania}, 26397 number = {85-105}, 26398 type = {ISME Working Paper} 26399} 26400 26401@TechReport{ censor.iusem.ea:interior-point, 26402 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 26403 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 26404 Problem with Paramonotone Operators}, 26405 institution = {University of Haifa}, 26406 year = {1994}, 26407 type = {Working Paper} 26408} 26409 26410@Article{ censor.lent:iterative, 26411 author = {Y. Censor and A. Lent}, 26412 title = {An Iterative Row-Action Method for Interval Convex Programming}, 26413 journal = {Journal of Optimization Theory and Applications}, 26414 year = {1981}, 26415 volume = {34}, 26416 pages = {275--291} 26417} 26418 26419@InCollection{ censor.pierro.ea:iterative, 26420 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 26421 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 26422 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 26423 XXIV}, 26424 publisher = {Banach Center}, 26425 year = {1987}, 26426 editor = {A. J. Wakulicz}, 26427 address = {Warsaw, Poland} 26428} 26429 26430@Article{ censor.segman:block-iterative, 26431 author = {Y. Censor and J. Segman}, 26432 title = {On Block-Iterative Entropy Maximization}, 26433 journal = {Journal of Information and Optimization Science}, 26434 year = {1987}, 26435 volume = {8}, 26436 pages = {275--291} 26437} 26438 26439@Article{ censor.zenios:proximal, 26440 author = {Y. Censor and S. A. Zenios}, 26441 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 26442 journal = {Journal of Optimization Theory and Applications}, 26443 year = {1992}, 26444 volume = {73}, 26445 pages = {451--464} 26446} 26447 26448@Article{ censor:parallel, 26449 author = {Yair Censor}, 26450 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 26451 Therapy}, 26452 journal = {Mathematical Programming}, 26453 year = {1988}, 26454 volume = {42}, 26455 pages = {307--325} 26456} 26457 26458@Article{ censor:row-action, 26459 author = {Yair Censor}, 26460 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 26461 journal = {SIAM Review}, 26462 year = {1981}, 26463 volume = {23}, 26464 pages = {444--466} 26465} 26466 26467@Article{ chajakis.zenios:synchronous, 26468 author = {E. D. Chajakis and S. A. Zenios}, 26469 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 26470 Nonlinear Network Optimization}, 26471 journal = {Parallel Computing}, 26472 year = {1990}, 26473 note = {To appear} 26474} 26475 26476@Article{ chamberlain.powell.ea:watchdog, 26477 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 26478 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 26479 Optimization}, 26480 journal = {Mathematical Programming Study}, 26481 year = {1982}, 26482 volume = {16}, 26483 pages = {1--17} 26484} 26485 26486@Article{ chan.pang:generalized, 26487 author = {D. Chan and J. S. Pang}, 26488 title = {The Generalized Quasi-Variational Inequality Problem}, 26489 journal = {Mathematics of Operations Research}, 26490 volume = {7}, 26491 pages = {211--222}, 26492 year = {1982} 26493} 26494 26495@Article{ charalambous:nonlinear, 26496 author = {C. Charalambous}, 26497 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 26498 journal = {Mathematical Programming}, 26499 year = {1977}, 26500 volume = {12}, 26501 pages = {195--225} 26502} 26503 26504@Article{ charnes.cooper.ea:duality, 26505 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 26506 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 26507 journal = {Proceedings of the National Academy of Sciences of the United States}, 26508 year = {1962}, 26509 pages = {783--786} 26510} 26511 26512@Book{ charnes.cooper.ea:introduction, 26513 author = {A. Charnes and W. W. Cooper and A. Henderson}, 26514 title = {An Introduction to Linear Programming}, 26515 year = {1953}, 26516 publisher = {John Wiley \& Sons}, 26517 address = {New York} 26518} 26519 26520@TechReport{ charnes.semple:practical, 26521 author = {A. Charnes and J. Semple}, 26522 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 26523 institution = {CCS}, 26524 year = {1991}, 26525 address = {Austin, Texas}, 26526 number = {663}, 26527 type = {Research Report} 26528} 26529 26530@InProceedings{ charnes:fundamental, 26531 author = {A. Charnes}, 26532 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 26533 booktitle = {Computer and Information Sciences}, 26534 year = {1964}, 26535 editor = {J. T. Lou and R. H. Wilcox}, 26536 publisher = {Spartan Books}, 26537 address = {Washington, D.C.}, 26538 pages = {67--74} 26539} 26540 26541@TechReport{ chen.chen.ea:penalized, 26542 author = {B. Chen and X. Chen and C. Kanzow}, 26543 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 26544 Numerical Results}, 26545 institution = {Institute of Applied Mathematics, University of Hamburg}, 26546 year = {1997}, 26547 type = {Preprint}, 26548 number = {126}, 26549 address = {Hamburg, Germany} 26550} 26551 26552@Article{ chen.chen:global, 26553 author = {B. Chen and X. Chen}, 26554 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 26555 ${R}_0$ {NCP} or Monotone {NCP}}, 26556 journal = {SIAM Journal on Optimization}, 26557 year = {1999}, 26558 volume = {9}, 26559 pages = {624--645} 26560} 26561 26562@Article{ chen.ferris.ea:fatcop, 26563 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 26564 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 26565 Solver}, 26566 journal = {Annals of Operations Research, forthcoming}, 26567 year = {2000}, 26568 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 26569 key = {89}, 26570 type = {Data Mining Institute Technical Report}, 26571 institution = {Computer Sciences Department, University of Wisconsin}, 26572 address = {Madison, Wisconsin}, 26573 number = {99-11} 26574} 26575 26576@TechReport{ chen.ferris:fatcop, 26577 author = {Q. Chen and M. C. Ferris}, 26578 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 26579 type = {Mathematical Programming Technical Report}, 26580 institution = {Computer Sciences Department, University of Wisconsin}, 26581 address = {Madison, Wisconsin}, 26582 year = {1999}, 26583 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 26584 number = {99-05}, 26585 key = {81}, 26586 annote = {Submitted to {\em SIOPT}} 26587} 26588 26589@Article{ chen.florian:nonlinear, 26590 author = {Y. Chen and M. Florian}, 26591 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 26592 Optimality Conditions}, 26593 journal = {Optimization}, 26594 year = {1995}, 26595 volume = {32}, 26596 pages = {193--209} 26597} 26598 26599@TechReport{ chen.florian:o-d, 26600 author = {Y. Chen and M. Florian}, 26601 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 26602 optimality conditions}, 26603 type = {Publication}, 26604 number = {CRT-94-56}, 26605 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 26606 address = {Montr\'eal, Canada}, 26607 year = {1994} 26608} 26609 26610@Article{ chen.harker:continuation, 26611 author = {B. Chen and P. T. Harker}, 26612 title = {A Continuation Method for Monotone Variational Inequalities}, 26613 journal = {Mathematical Programming}, 26614 volume = {69}, 26615 pages = {237--253}, 26616 year = {1995} 26617} 26618 26619@Article{ chen.harker:non-interior, 26620 author = {B. Chen and P. T. Harker}, 26621 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 26622 journal = {SIAM Journal on Matrix Analysis and Applications}, 26623 year = {1993}, 26624 volume = {14}, 26625 pages = {1168--1190} 26626} 26627 26628@Article{ chen.harker:smooth, 26629 author = {B. Chen and P. T. Harker}, 26630 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 26631 journal = {SIAM Journal on Optimization}, 26632 year = {1997}, 26633 volume = {7}, 26634 pages = {403--420} 26635} 26636 26637@Article{ chen.mangasarian:class, 26638 author = {Chunhui Chen and O. L. Mangasarian}, 26639 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 26640 journal = {Computational Optimization and Applications}, 26641 year = {1996}, 26642 volume = {5}, 26643 pages = {97--138} 26644} 26645 26646@Article{ chen.mangasarian:smoothing, 26647 author = {Chunhui Chen and O. L. Mangasarian}, 26648 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 26649 journal = {Mathematical Programming}, 26650 year = {1995}, 26651 volume = {78}, 26652 pages = {51--70} 26653} 26654 26655@Article{ chen.nashed.ea:convergence, 26656 author = {X. Chen and Z. Nashed and L. Qi}, 26657 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 26658 using Adaptive Outer Inverses}, 26659 year = {1997}, 26660 journal = {SIAM Journal on Optimization}, 26661 volume = {7}, 26662 pages = {445--462} 26663} 26664 26665@Article{ chen.qi.ea:global, 26666 author = {X. Chen and L. Qi and D. Sun}, 26667 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 26668 Application to General Box Constrained Variational Inequalities}, 26669 year = {1998}, 26670 journal = {Mathematics of Computation}, 26671 volume = {67}, 26672 pages = {519--540} 26673} 26674 26675@Article{ chen.teboulle:convergence, 26676 author = {G. Chen and M. Teboulle}, 26677 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 26678 Functions}, 26679 journal = {SIAM Journal on Optimization}, 26680 year = {1993}, 26681 volume = {3}, 26682 pages = {538--543} 26683} 26684 26685@Article{ chen.ye:homotopy-smoothing, 26686 author = {X.~Chen and Y.~Ye}, 26687 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 26688 year = {1999}, 26689 journal = {SIAM Journal on Control and Optimization}, 26690 volume = {37}, 26691 pages = {589--616} 26692} 26693 26694@PhDThesis{ chen:forward-backward, 26695 author = {G. H.--G. Chen}, 26696 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 26697 school = {University of Washington}, 26698 year = {1994} 26699} 26700 26701@PhDThesis{ chen:smoothing, 26702 author = {Chunhui Chen}, 26703 title = {Smoothing Methods in Mathematical Programming}, 26704 school = {Computer Sciences Department, University of Wisconsin}, 26705 year = {1995}, 26706 address = {Madison, Wisconsin}, 26707 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26708 annote = {Mathematical Programming Technical Report 95-12} 26709} 26710 26711@Book{ cheney:introduction, 26712 author = {E. W. Cheney}, 26713 title = {Introduction to Approximation Theory}, 26714 year = {1966}, 26715 publisher = {McGraw--Hill}, 26716 address = {New York} 26717} 26718 26719@Article{ cho.kuterdem.ea:spherical, 26720 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 26721 title = {A spherical dose model for radiosurgery treatment planning}, 26722 journal = {Physics in Medicine and Biology}, 26723 year = {1998}, 26724 volume = {43}, 26725 pages = {3145--3148} 26726} 26727 26728@Article{ cho.lee.ea:optimization, 26729 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 26730 title = {Optimization of intensity modulated beams with volume constraints using two 26731 methods: cost function minimization and projection onto convex sets}, 26732 journal = {Medical Physics}, 26733 year = {1998}, 26734 volume = {25}, 26735 number = {4}, 26736 pages = {435--443} 26737} 26738 26739@Article{ choi.desarbo.ea:product, 26740 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 26741 title = {Product Positioning Under Price Competition}, 26742 journal = {Management Science}, 26743 year = {1990}, 26744 volume = {36}, 26745 pages = {175--199} 26746} 26747 26748@Article{ chow.mallet-parret.ea:finding, 26749 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 26750 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 26751 One}, 26752 journal = {Mathematics of Computing}, 26753 year = {1978}, 26754 volume = {32}, 26755 pages = {887--899} 26756} 26757 26758@Article{ christopherson:mathematical, 26759 author = {D. G. Christopherson}, 26760 title = {A new mathematical method for the solution of film lubrication problems}, 26761 journal = {Proceedings of the Institute of Mechanical Engineers}, 26762 volume = {146}, 26763 year = {1941}, 26764 pages = {126--135} 26765} 26766 26767@TechReport{ chun.lee.ea:implementation, 26768 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 26769 title = {An Implementation of the Bundle Decomposition Algorithm}, 26770 institution = {Department of Industrial Engineering, University of Wisconsin}, 26771 year = {1991}, 26772 address = {Madison, Wisconsin}, 26773 number = {91-6} 26774} 26775 26776@Article{ chung:np-completeness, 26777 author = {S.--J. Chung}, 26778 title = {{NP}-Completeness of the Linear Complementarity Problem}, 26779 journal = {Journal of Optimization Theory and Applications}, 26780 volume = {60}, 26781 year = {1989}, 26782 pages = {393--399} 26783} 26784 26785@Book{ chvatal:linear, 26786 author = {V. Chv\'atal}, 26787 title = {Linear Programming}, 26788 year = {1983}, 26789 publisher = {W. H. Freeman and Company}, 26790 address = {New York} 26791} 26792 26793@Book{ ciarlet:finite, 26794 author = {P. G. Ciarlet}, 26795 title = {The Finite Element Method for Elliptic Problems}, 26796 year = {1978}, 26797 publisher = {North-Holland}, 26798 address = {New York} 26799} 26800 26801@Article{ cinquini.contro:optimal, 26802 author = {C. Cinquini and R. Contro}, 26803 title = {Optimal design of beams discretized by elastic plastic finite element}, 26804 journal = {Computers \& Structures}, 26805 volume = {20}, 26806 year = {1985}, 26807 pages = {475--585} 26808} 26809 26810@Book{ clarke:optimization, 26811 author = {F. H. Clarke}, 26812 title = {Optimization and Nonsmooth Analysis}, 26813 year = {1983}, 26814 publisher = {John Wiley \& Sons}, 26815 address = {New York} 26816} 26817 26818@InProceedings{ cleveland.smith:genetic, 26819 crossref = {schaeffer:third}, 26820 author = {G. A. Cleveland and S. F. Smith}, 26821 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 26822 pages = {160--169} 26823} 26824 26825@Book{ cochran:sampling, 26826 author = {W. Cochran}, 26827 title = {Sampling Techniques}, 26828 publisher = {Wiley}, 26829 year = {1977}, 26830 address = {New York}, 26831 edition = {Third} 26832} 26833 26834@Article{ coleman.conn:nonlinear, 26835 author = {T. F. Coleman and A. R. Conn}, 26836 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 26837 journal = {Mathematical Programming}, 26838 year = {1982}, 26839 volume = {24}, 26840 pages = {123--136} 26841} 26842 26843@Article{ coleman.conn:nonlinear*1, 26844 author = {T. F. Coleman and A. R. Conn}, 26845 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 26846 journal = {Mathematical Programming}, 26847 year = {1982}, 26848 volume = {24}, 26849 pages = {137--161} 26850} 26851 26852@TechReport{ coleman.liu:interior, 26853 author = {T. F. Coleman and J. Liu}, 26854 title = {An interior newton method for quadratic programming}, 26855 institution = {Dept. of Computer Science, Cornell University}, 26856 year = {1993}, 26857 number = {TR 93-1388}, 26858 address = {Ithaca, NY}, 26859 month = oct 26860} 26861 26862@Article{ coleman.more:estimation, 26863 author = {T. F. Coleman and J. J. Mor\'{e}}, 26864 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 26865 journal = {SIAM Journal on Numerical Analysis}, 26866 year = {1983}, 26867 volume = {20}, 26868 pages = {187--209} 26869} 26870 26871@Manual{ coleman.verma:admat, 26872 author = {T. F. Coleman and A. Verma}, 26873 title = {{ADMAT} User Guide}, 26874 year = {2000} 26875} 26876 26877@TechReport{ colville:comparative, 26878 author = {A. R. Colville}, 26879 title = {A Comparative Study on Nonlinear Programming Codes}, 26880 institution = {IBM New York Scientific Center}, 26881 year = {1968}, 26882 month = jun, 26883 number = {320--2949}, 26884 type = {Technical Report} 26885} 26886 26887@Article{ comi.maier:extremum, 26888 author = {C. Comi and G. Maier}, 26889 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 26890 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 26891 journal = {European Journal Mechanics A/Solids}, 26892 volume = {9}, 26893 year = {1990}, 26894 pages = {563--585} 26895} 26896 26897@Misc{ condon.dahl.ea:implementing, 26898 author = {T. Condon and H. Dahl and S. Devarajan}, 26899 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 26900 Model}, 26901 year = {1987}, 26902 howpublished = {{DRD} Discussion Paper 290}, 26903 note = {The World Bank, Washington DC} 26904} 26905 26906@Book{ conn.gould.ea:lancelot, 26907 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26908 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 26909 (Release {A})}, 26910 year = {1992}, 26911 publisher = {Springer Verlag}, 26912 address = {Heidelberg, Berlin}, 26913 series = {Springer Series in Computational Mathematics}, 26914 number = {17} 26915} 26916 26917@Article{ conn.gould.ea:numerical, 26918 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26919 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 26920 Nonlinear Optimization}, 26921 journal = {Mathematical Programming}, 26922 year = {1996}, 26923 volume = {75}, 26924 pages = {73--110} 26925} 26926 26927@Book{ cgt, 26928 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26929 title = {Trust-Region Methods}, 26930 year = {2000}, 26931 publisher = {SIAM}, 26932 address = {Philadelphia, Pennsylvania} 26933} 26934 26935@InCollection{ conn.toint:algorithm, 26936 author = {A. R. Conn and Ph. L. Toint}, 26937 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 26938 Optimization}, 26939 booktitle = {Nonlinear Optimization and Applications}, 26940 editor = {G. Di Pillo and F. Giannessi}, 26941 year = {1996}, 26942 publisher = {Plenum Press}, 26943 address = {New York} 26944} 26945 26946@Article{ conry.seireg:mathematical, 26947 author = {T. F. Conry and A. Seireg}, 26948 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 26949 journal = {{ASME} Transactions Journal of Applied Mechanics}, 26950 volume = {93}, 26951 year = {1971}, 26952 pages = {387--392} 26953} 26954 26955@Article{ cook.gerards.ea:sensitivity, 26956 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 26957 title = {Sensitivity Results in Integer Linear Programming}, 26958 journal = {Mathematical Programming}, 26959 year = {1986}, 26960 volume = {34}, 26961 pages = {251--264} 26962} 26963 26964@Article{ cook:taxonomy, 26965 author = {S. A. Cook}, 26966 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 26967 journal = {Information and Control}, 26968 year = {1985}, 26969 volume = {64}, 26970 pages = {2--22} 26971} 26972 26973@Article{ cooper:gradient, 26974 author = {R. E. M. Cooper}, 26975 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 26976 journal = {Radiology}, 26977 year = {1978}, 26978 volume = {128}, 26979 pages = {235--243} 26980} 26981 26982@Article{ cormack:problem, 26983 author = {A. M. Cormack}, 26984 title = {A problem in roatation therapy with x-rays}, 26985 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26986 year = {1987}, 26987 volume = {13}, 26988 pages = {623--630} 26989} 26990 26991@Article{ cormack:problem*1, 26992 author = {A. M. Cormack}, 26993 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 26994 symmetry}, 26995 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26996 year = {1987}, 26997 volume = {13}, 26998 pages = {1921--1925} 26999} 27000 27001@Article{ cottle.dantzig:complementary, 27002 author = {R. W. Cottle and G. B. Dantzig}, 27003 title = {Complementary Pivot Theory of Mathematical Programming}, 27004 journal = {Linear Algebra and Its Applications}, 27005 year = {1968}, 27006 volume = {1}, 27007 pages = {103--125} 27008} 27009 27010@Article{ cottle.dantzig:generalization, 27011 author = {R. W. Cottle and G. B. Dantzig}, 27012 title = {A Generalization of the Linear Complementarity Problem}, 27013 journal = {Journal of Combinatorial Theory}, 27014 year = {1970}, 27015 volume = {8}, 27016 pages = {79--90} 27017} 27018 27019@Book{ cottle.giannessi.ea:variational, 27020 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 27021 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 27022 year = {1980}, 27023 publisher = {John Wiley \& Sons}, 27024 address = {New York} 27025} 27026 27027@InCollection{ cottle.goheen:special, 27028 author = {R. W. Cottle and M. S. Goheen}, 27029 title = {A Special Class of Large Quadratic Programs}, 27030 pages = {361--390}, 27031 crossref = {mangasarian.meyer.ea:nonlinear*3} 27032} 27033 27034@Article{ cottle.golub.ea:solution, 27035 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 27036 title = {On the Solution of Large Structured Complementarity Problems: The Block 27037 Partitioned Case}, 27038 journal = {Applied Mathematics and Optimization}, 27039 year = {1978}, 27040 volume = {4}, 27041 pages = {347--363} 27042} 27043 27044@Book{ cottle.pang.ea:linear, 27045 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 27046 title = {The Linear Complementarity Problem}, 27047 year = {1992}, 27048 publisher = {Academic Press}, 27049 address = {Boston} 27050} 27051 27052@Article{ cottle.pang.ea:sufficient, 27053 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 27054 title = {Sufficient Matrices and the Linear Complementarity Problem}, 27055 journal = {Linear Algebra and Its Applications}, 27056 year = {1989}, 27057 volume = {114/115}, 27058 pages = {231--249} 27059} 27060 27061@PhDThesis{ cottle:nonlinear, 27062 author = {R. W. Cottle}, 27063 title = {Nonlinear programs with positively bounded {J}acobians}, 27064 school = {Department of Mathematics, University of California}, 27065 year = {1964}, 27066 address = {Berkeley, California} 27067} 27068 27069@Article{ cottle:nonlinear*1, 27070 author = {R. W. Cottle}, 27071 title = {Nonlinear programs with positively bounded {J}acobians}, 27072 journal = {Journal of the Society for Industrial and Applied Mathematics}, 27073 volume = {14}, 27074 year = {1966}, 27075 pages = {147--158} 27076} 27077 27078@InCollection{ cottle:principal, 27079 author = {R. W. Cottle}, 27080 title = {The principal pivoting method of quadratic programming}, 27081 booktitle = {Mathematics of the Decision Sciences, Part 1}, 27082 publisher = {American Mathematical Society}, 27083 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 27084 address = {Providence, Rhode Island}, 27085 year = {1968}, 27086 pages = {144--162} 27087} 27088 27089@Unpublished{ courant:calculus, 27090 author = {R. Courant}, 27091 title = {Calculus of Variations and Supplementary Notes and Exercises}, 27092 year = {1956}, 27093 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 27094 New York University} 27095} 27096 27097@Article{ courant:variational, 27098 author = {R. Courant}, 27099 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 27100 journal = {Bulletin of the American Mathematical Society}, 27101 year = {1943}, 27102 volume = {49}, 27103 pages = {1--23} 27104} 27105 27106@Book{ cristianini.shawe-taylor:introduction, 27107 author = {N. Cristianini and J. Shawe-Taylor}, 27108 title = {An Introduction to Support Vector Machines}, 27109 publisher = {Cambridge University Press}, 27110 address = {Cambridge}, 27111 year = {2000} 27112} 27113 27114@Article{ cromme:strong, 27115 author = {L. Cromme}, 27116 title = {Strong Uniqueness}, 27117 journal = {Numerische Mathematik}, 27118 year = {1978}, 27119 volume = {29}, 27120 pages = {179--193} 27121} 27122 27123@Article{ crowder.johnson.ea:solving, 27124 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 27125 title = {Solving Large Scale Zero-One Linear Programming Problems}, 27126 journal = {Operations Research}, 27127 year = {1983}, 27128 volume = {31}, 27129 pages = {803--834} 27130} 27131 27132@Article{ cryer.dempster:equivalence, 27133 author = {C. W. Cryer and M. A. H. Dempster}, 27134 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 27135 Lattice {H}ilbert Spaces}, 27136 journal = {SIAM Journal on Control and Optimization}, 27137 year = {1980}, 27138 volume = {18}, 27139 pages = {76--89} 27140} 27141 27142@Article{ cryer:method, 27143 author = {C. W. Cryer}, 27144 title = {The method of {C}hristopherson for solving free boundary problems for infinite 27145 journal bearings by means of finite differences}, 27146 journal = {Mathematics of Computation}, 27147 volume = {25}, 27148 year = {1971}, 27149 pages = {435--553} 27150} 27151 27152@Article{ cryer:solution, 27153 author = {C. W. Cryer}, 27154 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 27155 journal = {SIAM Journal on Control and Optimization}, 27156 year = {1971}, 27157 volume = {9}, 27158 pages = {385--392} 27159} 27160 27161@Article{ cryer:solution*1, 27162 author = {C. W. Cryer}, 27163 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 27164 journal = {SIAM Journal on Control}, 27165 year = {1971}, 27166 volume = {9}, 27167 pages = {385--392} 27168} 27169 27170@Manual{ culler:split-c, 27171 author = {D. Culler}, 27172 title = {The Split--{C} Programming Language}, 27173 organization = {Computer Science Department, University of California, Berkeley} 27174} 27175 27176@InProceedings{ cun.denker.ea:optimal, 27177 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 27178 title = {Optimal Brain Damage}, 27179 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 27180 year = {1990}, 27181 editor = {D. S. Touretzky}, 27182 publisher = {Morgan Kaufmann}, 27183 address = {San Mateo, California}, 27184 pages = {598--605} 27185} 27186 27187@TechReport{ czyzyk.mehrotra.ea:pcx, 27188 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 27189 title = {{PCx} Users Guide}, 27190 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 27191 University}, 27192 year = {1996}, 27193 type = {Technical Report}, 27194 number = {OTC 96/01} 27195} 27196 27197@TechReport{ czyzyk.mesnier.ea:network-enabled, 27198 address = {Argonne, Illinois}, 27199 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 27200 institution = {Argonne National Laboratory}, 27201 number = {MCS-P615-0996}, 27202 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 27203 type = {Preprint}, 27204 year = {1996} 27205} 27206 27207@Article{ czyzyk.wisniewski.ea:optimization, 27208 title = {Optimization Case Studies in the {NEOS} Guide}, 27209 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 27210 journal = {SIAM Review}, 27211 volume = {41}, 27212 pages = {148--163}, 27213 year = {1999} 27214} 27215 27216@Article{ dai.laan.ea:simplicial, 27217 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 27218 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 27219 Polyhedron}, 27220 journal = {SIAM Journal on Optimization}, 27221 year = {1991}, 27222 volume = {1}, 27223 pages = {151--165} 27224} 27225 27226@Article{ dai.talman:linear, 27227 author = {Y. Dai and D. Talman}, 27228 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 27229 journal = {Mathematics of Operations Research}, 27230 year = {1993}, 27231 pages = {635--644} 27232} 27233 27234@Book{ daniel:approximate, 27235 author = {J. W. Daniel}, 27236 title = {The approximate minimization of functionals}, 27237 year = {1971}, 27238 publisher = {Prentice-Hall, Inc}, 27239 address = {Englewood Cliffs, New Jersey} 27240} 27241 27242@Article{ danskin:theory, 27243 author = {J. M. Danskin}, 27244 title = {The Theory of Min--Max, with Applications}, 27245 journal = {SIAM Journal on Applied Mathematics}, 27246 year = {1964}, 27247 volume = {14}, 27248 pages = {641--664} 27249} 27250 27251@Book{ danskin:theory*1, 27252 author = {J. M. Danskin}, 27253 title = {The Theory of Min--Max}, 27254 year = {1967}, 27255 publisher = {Springer-Verlag}, 27256 address = {New York} 27257} 27258 27259@InCollection{ dantzig.cottle:positive, 27260 author = {G. B. Dantzig and R. W. Cottle}, 27261 title = {Positive (semi-)definite programming}, 27262 booktitle = {Nonlinear Programming}, 27263 publisher = {North-Holland}, 27264 editor = {J. Abadie}, 27265 address = {Amsterdam}, 27266 year = {1967}, 27267 pages = {55--73} 27268} 27269 27270@Article{ dantzig.manne:complementarity, 27271 author = {G. B. Dantzig and A. S. Manne}, 27272 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 27273 Proportions}, 27274 journal = {Journal of Economic Theory}, 27275 year = {1974}, 27276 volume = {9}, 27277 pages = {312--323} 27278} 27279 27280@Article{ dantzig.wolfe:decomposition, 27281 author = {G. B. Dantzig and P. Wolfe}, 27282 title = {Decomposition Principle for Linear Programs}, 27283 journal = {Operations Research}, 27284 year = {1960}, 27285 volume = {8}, 27286 pages = {101--111} 27287} 27288 27289@Book{ dantzig:linear, 27290 author = {G. B. Dantzig}, 27291 title = {Linear Programming and Extensions}, 27292 year = {1963}, 27293 publisher = {Princeton University Press}, 27294 address = {Princeton, New Jersey} 27295} 27296 27297@Manual{ dash:xpress-mp, 27298 title = {{XPRESS-MP} User Guide}, 27299 organization = {Dash Associates}, 27300 address = {Blisworth House, Blisworth, Northants, UK}, 27301 note = {http://www.dashopt.com/} 27302} 27303 27304@Book{ davis:handbook, 27305 author = {L. D. Davis}, 27306 title = {The Handbook of Genetic Algorithms}, 27307 year = {1990}, 27308 publisher = {Van Nostrand Reinhold} 27309} 27310 27311@TechReport{ davis:users, 27312 author = {T. A. Davis}, 27313 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 27314 type = {{Technical Report}}, 27315 year = {1993}, 27316 institution = {Computer and Information Sciences Department, University of Florida}, 27317 address = {Gainesville, Florida} 27318} 27319 27320@TechReport{ dax:computation, 27321 author = {A. Dax}, 27322 title = {The Computation of Descent Directions at Degenerate Points}, 27323 institution = {Hydrological Service of Israel}, 27324 year = {1985}, 27325 type = {Technical Report} 27326} 27327 27328@Article{ dax:note, 27329 author = {A. Dax}, 27330 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 27331 Problem}, 27332 journal = {Mathematical Programming}, 27333 year = {1986}, 27334 volume = {36}, 27335 pages = {72--80} 27336} 27337 27338@Article{ deasy:multiple, 27339 author = {J. O. Deasy}, 27340 title = {Multiple local minima in radiotherapy optimization problems with dose volume 27341 constraints}, 27342 journal = {Medical Physics}, 27343 year = {1997}, 27344 optvolume = {24}, 27345 optnumber = {7}, 27346 optpages = {1157-1161} 27347} 27348 27349@Article{ deboor.ron:computational, 27350 author = {C. {deBoor} and A. Ron}, 27351 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 27352 journal = {Mathematics of Computation}, 27353 year = {1992}, 27354 volume = {58}, 27355 pages = {705--727} 27356} 27357 27358@Article{ debremaecker.ferris.ea:compressional, 27359 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 27360 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 27361 Problems}, 27362 year = {2000}, 27363 key = {82}, 27364 journal = {Engineering Fracture Mechanics}, 27365 volume = {66}, 27366 pages = {287--303} 27367} 27368 27369@Article{ debremaecker.ferris:comparison, 27370 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 27371 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 27372 year = {2000}, 27373 key = {90}, 27374 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 27375 journal = {Engineering Fracture Mechanics}, 27376 volume = {66}, 27377 pages = {601--605}, 27378 institution = {Computer Sciences Department, University of Wisconsin}, 27379 address = {Madison, Wisconsin}, 27380 number = {00-01} 27381} 27382 27383@Article{ dedonato.maier:mathematical, 27384 author = {O. {De~Donato} and G. Maier}, 27385 title = {Mathematical programming methods for the inelastic analysis of reinforced 27386 concrete frames allowing for limited rotation capacity}, 27387 journal = {International Journal for Numerical Methods in Engineering}, 27388 volume = {4}, 27389 year = {1972}, 27390 pages = {307--329} 27391} 27392 27393@Book{ deimling:nonlinear, 27394 author = {K. Deimling}, 27395 title = {Nonlinear Functional Analysis}, 27396 publisher = {Springer-Verlag}, 27397 year = {1985} 27398} 27399 27400@PhDThesis{ dejong:analysis, 27401 author = {K. A. De~Jong}, 27402 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 27403 year = {1975}, 27404 school = {University of Michigan}, 27405 note = {Dissertation Abstracts International 36(10), 5140B} 27406} 27407 27408@Article{ deleone.mangasarian.ea:multi-sweep, 27409 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 27410 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 27411 Linear Complementarity Problem}, 27412 journal = {Annals of Operations Research}, 27413 year = {1990}, 27414 volume = {22}, 27415 pages = {43--54} 27416} 27417 27418@InCollection{ deleone.mangasarian:serial, 27419 author = {R. {De~Leone} and O. L. Mangasarian}, 27420 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 27421 {L}agrangian Successive Overrelaxation}, 27422 booktitle = {Optimization, Parallel Processing and Applications}, 27423 publisher = {Springer-Verlag}, 27424 year = {1988}, 27425 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 27426 volume = {304}, 27427 series = {Lecture Notes in Economics and Mathematical Systems}, 27428 pages = {103--124}, 27429 address = {Berlin} 27430} 27431 27432@TechReport{ deluca.facchinei.ea:combining, 27433 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27434 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 27435 Complementarity Problems: Theory and Numerical Results}, 27436 type = {Preprint}, 27437 institution = {Institute of Applied Mathematics, University of Hamburg}, 27438 year = {1996} 27439} 27440 27441@TechReport{ deluca.facchinei.ea:general, 27442 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27443 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 27444 Numerical Results}, 27445 type = {Preprint}, 27446 institution = {Institute of Applied Mathematics, University of Hamburg}, 27447 year = {1997} 27448} 27449 27450@Article{ deluca.facchinei.ea:semismooth, 27451 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27452 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 27453 Problems}, 27454 journal = {Mathematical Programming}, 27455 volume = {75}, 27456 pages = {407--439}, 27457 year = {1996} 27458} 27459 27460@Article{ deluca.facchinei.ea:theoretical, 27461 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27462 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 27463 Complementarity Problems}, 27464 year = {1999}, 27465 journal = {Computational Optimization and Applications, forthcoming} 27466} 27467 27468@Article{ demarzo.eaves:computing, 27469 author = {P. M. DeMarzo and B. C. Eaves}, 27470 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 27471 journal = {Journal of Mathematical Economics}, 27472 year = {1996}, 27473 volume = {26}, 27474 pages = {479--497} 27475} 27476 27477@Article{ dembo.steihaug:truncated, 27478 author = {R. S. Dembo and T. Steihaug}, 27479 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 27480 Optimization}, 27481 journal = {Mathematical Programming}, 27482 year = {1983}, 27483 volume = {26}, 27484 pages = {190--212} 27485} 27486 27487@Article{ dembo:performance, 27488 author = {R. S. Dembo}, 27489 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 27490 journal = {Mathematical Programming Study}, 27491 year = {1986}, 27492 volume = {26}, 27493 pages = {245--248} 27494} 27495 27496@Article{ demoor.vandenberghe.ea:generalized, 27497 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 27498 title = {The generalized linear complementarity problem and an algorithm to find all its 27499 solutions}, 27500 journal = {Mathematical Programming}, 27501 volume = {57}, 27502 year = {1992}, 27503 pages = {415--426} 27504} 27505 27506@Book{ demyanov.vasilev:nondifferentiable, 27507 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 27508 title = {Nondifferentiable Optimization}, 27509 publisher = {Optimization Software, Inc.}, 27510 year = {1985}, 27511 address = {New York} 27512} 27513 27514@Article{ dennis.torczon:direct, 27515 author = {J. E. Dennis and V. Torczon}, 27516 title = {Direct Search Methods on Parallel Machines}, 27517 journal = {SIAM Journal on Optimization}, 27518 year = {1991}, 27519 volume = {1}, 27520 pages = {448--474} 27521} 27522 27523@TechReport{ depierro.iusem:convergence, 27524 author = {A. R. {De~Pierro} and A. N. Iusem}, 27525 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 27526 Linear Complementarity Problems}, 27527 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 27528 year = {1990}, 27529 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 27530} 27531 27532@Article{ depierro.iusem:relaxed, 27533 author = {A. R. {De~Pierro} and A. N. Iusem}, 27534 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 27535 journal = {Journal of Optimization Theory and Applications}, 27536 year = {1986}, 27537 volume = {51}, 27538 pages = {421--440} 27539} 27540 27541@Book{ dervis.melo.ea:general, 27542 author = {K. Dervis and J. de Melo and S. Robinson}, 27543 title = {General Equilibrium Models of Development Policy}, 27544 publisher = {Cambridge University Press}, 27545 year = {1982}, 27546 address = {Cambridge, England} 27547} 27548 27549@Article{ deschutter.demoor:minimal, 27550 author = {B. {De~Schutter} and B. {De~Moor}}, 27551 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 27552 Problem}, 27553 journal = {Systems \& Control Letters}, 27554 year = {1995}, 27555 pages = {103--111} 27556} 27557 27558@Article{ desilets.golden.ea:predicting, 27559 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 27560 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 27561 journal = {Computers \& Operations Research}, 27562 year = {1992}, 27563 volume = {19}, 27564 pages = {277--285} 27565} 27566 27567@PhDThesis{ desilva:sensitivity, 27568 author = {A. H. DeSilva}, 27569 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 27570 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 27571 Production}, 27572 school = {George Washington University}, 27573 address = {Washington, D.C.}, 27574 year = {1978} 27575} 27576 27577@TechReport{ dijkstra:cooperating, 27578 author = {E. W. Dijkstra}, 27579 title = {Cooperating Sequential Processes}, 27580 institution = {Technological University}, 27581 year = {1965}, 27582 address = {Eindhoven, The Netherlands}, 27583 number = {EWD--123}, 27584 type = {Technical Report} 27585} 27586 27587@Article{ dikin:iterative, 27588 author = {I. I. Dikin}, 27589 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 27590 journal = {Soviet Mathematics Doklady}, 27591 year = {1967}, 27592 volume = {8}, 27593 pages = {674--675} 27594} 27595 27596@InCollection{ dipillo.grippo.ea:class, 27597 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 27598 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 27599 booktitle = {System Modelling and Optimization}, 27600 year = {1981}, 27601 editor = {R. F. Drenick and F. Kozin}, 27602 publisher = {Springer-Verlag}, 27603 address = {Berlin} 27604} 27605 27606@Article{ dipillo.grippo:augmented, 27607 author = {G. Di~Pillo and L. Grippo}, 27608 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 27609 Problems}, 27610 journal = {Journal of Optimization Theory and Applications}, 27611 year = {1982}, 27612 volume = {36}, 27613 pages = {495--519} 27614} 27615 27616@Article{ dipillo.grippo:class, 27617 author = {G. Di~Pillo and L. Grippo}, 27618 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 27619 journal = {SIAM Journal on Control and Optimization}, 27620 year = {1979}, 27621 volume = {17}, 27622 pages = {618--628} 27623} 27624 27625@Article{ dipillo.grippo:continuously, 27626 author = {G. Di~Pillo and L. Grippo}, 27627 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 27628 Problems with Inequality Constraints}, 27629 journal = {SIAM Journal on Control and Optimization}, 27630 year = {1985}, 27631 volume = {23}, 27632 pages = {72--84} 27633} 27634 27635@Article{ dipillo.grippo:exact, 27636 author = {G. Di~Pillo and L. Grippo}, 27637 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 27638 Programming Problems}, 27639 journal = {Mathematical Programming}, 27640 year = {1986}, 27641 volume = {36}, 27642 pages = {1--18} 27643} 27644 27645@TechReport{ dirkse.ferris.ea:gams, 27646 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 27647 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 27648 institution = {Computer Sciences Department, University of Wisconsin}, 27649 year = {1994}, 27650 address = {Madison, Wisconsin}, 27651 number = {94-07}, 27652 type = {Mathematical Programming Technical Report}, 27653 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 27654 key = {25} 27655} 27656 27657@InProceedings{ dirkse.ferris:crash, 27658 crossref = {ferris.pang:complementarity}, 27659 author = {S. P. Dirkse and M. C. Ferris}, 27660 title = {Crash Techniques for Large-Scale Complementarity Problems}, 27661 pages = {40--61}, 27662 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 27663 key = {52} 27664} 27665 27666@Article{ dirkse.ferris:mcplib, 27667 author = {S. P. Dirkse and M. C. Ferris}, 27668 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 27669 journal = {Optimization Methods and Software}, 27670 pages = {319--345}, 27671 volume = {5}, 27672 year = {1995}, 27673 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 27674 key = {36} 27675} 27676 27677@InCollection{ dirkse.ferris:modeling, 27678 author = {S. P. Dirkse and M. C. Ferris}, 27679 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 27680 year = {1999}, 27681 pages = {127--148}, 27682 editor = {M. Fukushima and L. Qi}, 27683 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 27684 publisher = {Kluwer Academic Publishers}, 27685 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 27686 key = {62} 27687} 27688 27689@Article{ dirkse.ferris:path, 27690 author = {S. P. Dirkse and M. C. Ferris}, 27691 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 27692 Complementarity Problems}, 27693 journal = {Optimization Methods and Software}, 27694 pages = {123--156}, 27695 volume = {5}, 27696 year = {1995}, 27697 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 27698 key = {33} 27699} 27700 27701@Article{ dirkse.ferris:pathsearch, 27702 author = {S. P. Dirkse and M. C. Ferris}, 27703 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 27704 journal = {Annals of Operations Research}, 27705 vol = {68}, 27706 year = {1996}, 27707 pages = {211--232}, 27708 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 27709 key = {39} 27710} 27711 27712@InCollection{ dirkse.ferris:traffic, 27713 author = {S. P. Dirkse and M. C. Ferris}, 27714 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 27715 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 27716 Management}, 27717 publisher = {Springer-Verlag}, 27718 year = {1998}, 27719 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 27720 series = {NATO ASI Series F}, 27721 volume = {166}, 27722 pages = {136--163}, 27723 key = {61}, 27724 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 27725} 27726 27727@PhDThesis{ dirkse:robust, 27728 author = {S. P. Dirkse}, 27729 title = {Robust Solution of Mixed Complementarity Problems}, 27730 school = {Computer Sciences Department, University of Wisconsin}, 27731 year = {1994}, 27732 address = {Madison, Wisconsin}, 27733 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 27734 annote = {Mathematical Programming Technical Report 94-12} 27735} 27736 27737@TechReport{ dixon.mills:neural, 27738 author = {L. C. Dixon and D. J. Mills}, 27739 title = {Neural Nets for Massively Parallel Optimisation}, 27740 institution = {Hatfield Polytechnic}, 27741 year = {1992}, 27742 address = {Hatfield, Hertforshire, England}, 27743 number = {Numerical Optimisation Centre Technical Report No. 259} 27744} 27745 27746@Article{ dontchev:local, 27747 author = {A. L. Dontchev}, 27748 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 27749 journal = {C.R. Acad. Sci. Paris Series I}, 27750 year = {1996}, 27751 volume = {332}, 27752 pages = {327--331} 27753} 27754 27755@Article{ douglas.rachford:numerical, 27756 author = {J. Douglas and H. H. Rachford}, 27757 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 27758 Variables}, 27759 journal = {Transactions of the American Mathematical Society}, 27760 year = {1956}, 27761 volume = {82}, 27762 pages = {421--439} 27763} 27764 27765@Article{ drud:conopt, 27766 author = {A. Drud}, 27767 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 27768 Problems}, 27769 journal = {Mathematical Programming}, 27770 year = {1985}, 27771 volume = {31}, 27772 pages = {153--191} 27773} 27774 27775@Article{ dsouza.meyer.ea:mixed, 27776 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27777 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27778 Optimization}, 27779 journal = {Medical Physics}, 27780 year = {1999}, 27781 key = {85}, 27782 volume = {26}, 27783 number = {6}, 27784 pages = {1099} 27785} 27786 27787@TechReport{ dsouza.meyer.ea:mixed*1, 27788 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27789 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27790 Optimization}, 27791 year = {1999}, 27792 key = {87}, 27793 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 27794 institution = {Computer Sciences Department, University of Wisconsin}, 27795 address = {Madison, Wisconsin}, 27796 number = {99-08}, 27797 type = {Mathematical Programming Technical Report}, 27798 annote = {Submitted to } 27799} 27800 27801@Article{ dsouza.meyer.ea:iterative, 27802 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 27803 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 27804 Brachytherapy Treatment Optimization}, 27805 year = {2000}, 27806 key = {96}, 27807 journal = {Physics and Medicine in Biology, forthcoming} 27808} 27809 27810@Article{ du.yu.ea:multileaf, 27811 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 27812 G. Gustafson and A. Martinez and J. W. Wong}, 27813 title = {A multileaf collimator field prescription preparation system for conventional 27814 radiotherapy}, 27815 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27816 year = {1994}, 27817 volume = {30}, 27818 number = {3}, 27819 pages = {707--714} 27820} 27821 27822@Article{ duda.fossum:pattern, 27823 author = {R. O. Duda and H. Fossum}, 27824 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 27825 Discriminant Functions}, 27826 journal = {IEEE Transactions on Electronic Computers}, 27827 year = {1966}, 27828 volume = {15}, 27829 pages = {220--232} 27830} 27831 27832@Book{ duda.hart:pattern, 27833 author = {R. O. Duda and P. E. Hart}, 27834 title = {Pattern Classification and Scene Analysis}, 27835 year = {1973}, 27836 publisher = {John Wiley \& Sons}, 27837 address = {New York} 27838} 27839 27840@Book{ duff.erisman.ea:direct, 27841 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 27842 title = {Direct Methods for Sparse Matrices}, 27843 publisher = {Oxford University Press}, 27844 year = {1986}, 27845 address = {Oxford, England} 27846} 27847 27848@InCollection{ duffin:infinite, 27849 author = {R. J. Duffin}, 27850 title = {Infinite Programs}, 27851 booktitle = {Linear Inequalities and Related Systems}, 27852 year = {1975}, 27853 editor = {H. W. Kuhn and A. W. Tucker}, 27854 publisher = {Princeton University Press}, 27855 address = {Princeton, New Jersey}, 27856 pages = {157--170} 27857} 27858 27859@Article{ dunn.sachs:effect, 27860 author = {J. C. Dunn and E. Sachs}, 27861 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 27862 journal = {Applied Mathematics and Optimization}, 27863 year = {1983}, 27864 volume = {10}, 27865 pages = {143--157} 27866} 27867 27868@Article{ dunn:convergence, 27869 author = {J. C. Dunn}, 27870 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 27871 journal = {Journal of Optimization Theory and Applications}, 27872 year = {1987}, 27873 volume = {55}, 27874 pages = {203--216} 27875} 27876 27877@Article{ dunn:global, 27878 author = {J. C. Dunn}, 27879 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 27880 Gradient Processes}, 27881 journal = {SIAM Journal on Control and Optimization}, 27882 year = {1981}, 27883 volume = {19}, 27884 pages = {368--400} 27885} 27886 27887@Article{ dunn:rates, 27888 author = {J. C. Dunn}, 27889 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 27890 Nonsingular Extremals}, 27891 journal = {SIAM Journal on Control and Optimization}, 27892 year = {1979}, 27893 volume = {17}, 27894 pages = {187--211} 27895} 27896 27897@Article{ dupuis.simha:sampling, 27898 author = {P. Dupuis and R. Simha}, 27899 title = {On Sampling-Controlled Stochastic Approximation}, 27900 journal = {{IEEE} Transactions on Automatic Control}, 27901 year = {1991}, 27902 volume = {36}, 27903 pages = {915--924} 27904} 27905 27906@TechReport{ eager.ferris.ea:models, 27907 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27908 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 27909 institution = {Computer Sciences Department, University of Wisconsin}, 27910 year = {1999}, 27911 type = {Technical Report}, 27912 number = {1402}, 27913 address = {Madison, Wisconsin}, 27914 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 27915 key = {84} 27916} 27917 27918@InProceedings{ eager.ferris.ea:optimized, 27919 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27920 title = {Optimized Regional Caching for On-Demand Data Delivery}, 27921 year = {1999}, 27922 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 27923 volume = {3654}, 27924 address = {Bellingham, Washington}, 27925 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 27926 key = {69}, 27927 pages = {301--316}, 27928 annote = {18 percent acceptance rate} 27929} 27930 27931@Article{ eager.ferris.ea:optimized*1, 27932 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27933 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 27934 journal = {Performance Evaluation}, 27935 year = {2000}, 27936 key = {72}, 27937 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 27938 volume = {42}, 27939 pages = {163--185} 27940} 27941 27942@InProceedings{ eager.vernon:dynamic, 27943 author = {D. L. Eager and M. K. Vernon}, 27944 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 27945 year = {1998}, 27946 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 27947 ({MIS '98})}, 27948 pages = {18--32}, 27949 address = {Istanbul, Turkey} 27950} 27951 27952@Article{ eaves.lemke:equivalence, 27953 author = {B. C. Eaves and C. E. Lemke}, 27954 title = {Equivalence of {LCP} and {PLS}}, 27955 journal = {Mathematics of Operations Research}, 27956 year = {1981}, 27957 volume = {6}, 27958 pages = {475--484} 27959} 27960 27961@Article{ eaves.rothblum:relationships, 27962 author = {B. C. Eaves and U. G. Rothblum}, 27963 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 27964 journal = {Linear Algebra and Its Applications}, 27965 year = {1990}, 27966 volume = {132}, 27967 pages = {1--63} 27968} 27969 27970@Article{ eaves:basic, 27971 author = {B. C. Eaves}, 27972 title = {On the Basic Theorem of Complementarity}, 27973 journal = {Mathematical Programming}, 27974 year = {1971}, 27975 volume = {1}, 27976 pages = {68--87} 27977} 27978 27979@Article{ eaves:computing, 27980 author = {B. C. Eaves}, 27981 title = {Computing Stationary Points}, 27982 journal = {Mathematical Programming Study}, 27983 year = {1978}, 27984 volume = {7}, 27985 pages = {1--14} 27986} 27987 27988@InCollection{ eaves:computing*1, 27989 author = {B. C. Eaves}, 27990 title = {Computing Stationary Points, Again}, 27991 pages = {391--405}, 27992 crossref = {mangasarian.meyer.ea:nonlinear*3} 27993} 27994 27995@Article{ eaves:homotopies, 27996 author = {B. C. Eaves}, 27997 title = {Homotopies for Computation of Fixed Points}, 27998 journal = {Mathematical Programming}, 27999 year = {1972}, 28000 volume = {3}, 28001 pages = {1--22} 28002} 28003 28004@Article{ eaves:linear, 28005 author = {B. C. Eaves}, 28006 title = {The Linear Complementarity Problem}, 28007 journal = {Management Science}, 28008 year = {1971}, 28009 volume = {17}, 28010 pages = {612--634} 28011} 28012 28013@Article{ eaves:quadratic, 28014 author = {B. C. Eaves}, 28015 title = {On Quadratic Programming}, 28016 journal = {Management Science}, 28017 year = {1971}, 28018 volume = {17}, 28019 pages = {698--711} 28020} 28021 28022@InProceedings{ eaves:short, 28023 author = {B. C. Eaves}, 28024 title = {A Short Course in Solving Equations with {PL} Homotopies}, 28025 booktitle = {Nonlinear Programming}, 28026 organization = {American Mathematical Society}, 28027 year = {1976}, 28028 editor = {R. W. Cottle and C. E. Lemke}, 28029 publisher = {SIAM--AMS Proceedings}, 28030 address = {Providence, RI}, 28031 pages = {73--143} 28032} 28033 28034@InCollection{ ebiefung.kostreva:global, 28035 author = {A. A. Ebiefung and M. M. Kostreva}, 28036 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 28037 Class of Polynomial Complementarity Problems}, 28038 editors = {C. Floudas and P. Pardalos}, 28039 booktitle = {Recent Advances in Global Optimization}, 28040 publisher = {Princeton University Press}, 28041 pages = {102--124}, 28042 year = {1991} 28043} 28044 28045@TechReport{ ebiefung.kostreva:z-matrices, 28046 author = {A. A. Ebiefung and M. M. Kostreva}, 28047 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 28048 institution = {Department of Mathematical Sciences, Clemson University}, 28049 year = {1991}, 28050 number = {608}, 28051 address = {Clemson, South Carolina} 28052} 28053 28054@TechReport{ eckstein.bertsekas:alternating, 28055 author = {J. Eckstein and D. P. Bertsekas}, 28056 title = {An Alternating Direction Method for Linear Programming}, 28057 institution = {Harvard Business School}, 28058 year = {1990}, 28059 type = {Working Paper}, 28060 number = {90-063}, 28061 address = {Boston, MA} 28062} 28063 28064@Article{ eckstein.bertsekas:douglas-rachford, 28065 author = {J. Eckstein and D. P. Bertsekas}, 28066 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 28067 Maximal Monotone Operators}, 28068 journal = {Mathematical Programming}, 28069 year = {1992}, 28070 pages = {293--318}, 28071 volume = {55} 28072} 28073 28074@Article{ eckstein.bertsekas:douglas-rachford*1, 28075 author = {J. Eckstein and D. P. Bertsekas}, 28076 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 28077 for Maximal Monotone Operators}, 28078 journal = {Mathematical Programming}, 28079 year = {1991}, 28080 note = {To appear} 28081} 28082 28083@TechReport{ eckstein.ferris:operator, 28084 author = {J. Eckstein and M. C. Ferris}, 28085 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 28086 institution = {Thinking Machines Corporation}, 28087 year = {1992}, 28088 address = {Cambridge, MA 02142}, 28089 number = {239}, 28090 type = {TMC}, 28091 key = {26} 28092} 28093 28094@Article{ eckstein.ferris:operator*1, 28095 author = {J. Eckstein and M. C. Ferris}, 28096 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 28097 Parallel Application to Optimal Control}, 28098 volume = {10}, 28099 pages = {218--235}, 28100 year = {1998}, 28101 journal = {INFORMS Journal on Computing}, 28102 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 28103 key = {44} 28104} 28105 28106@Article{ eckstein.ferris:smooth, 28107 author = {J. Eckstein and M. C. Ferris}, 28108 title = {Smooth Methods of Multipliers for Complementarity Problems}, 28109 key = {58}, 28110 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 28111 year = {1999}, 28112 journal = {Mathematical Programming}, 28113 volume = {86}, 28114 pages = {65--90} 28115} 28116 28117@InProceedings{ eckstein.hart.ea:resource, 28118 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 28119 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 28120 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 28121 year = {1997}, 28122 note = {www.cs.sandia.gov/ISUG97} 28123} 28124 28125@Article{ eckstein:alternating, 28126 author = {J. Eckstein}, 28127 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 28128 CM-2}}, 28129 journal = {ORSA Journal on Computing}, 28130 year = {to appear} 28131} 28132 28133@Article{ eckstein:approximate, 28134 author = {J. Eckstein}, 28135 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 28136 year = {1998}, 28137 journal = {Mathematical Programming}, 28138 volume = {83}, 28139 pages = {113--124} 28140} 28141 28142@Article{ eckstein:communication, 28143 author = {J. Eckstein}, 28144 title = {How Much Communication Does Parallel Branch and Bound Need}, 28145 journal = {{INFORMS} Journal on Computing}, 28146 volume = {9}, 28147 year = {1997}, 28148 pages = {15--29} 28149} 28150 28151@Article{ eckstein:distributed, 28152 author = {J. Eckstein}, 28153 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 28154 Integer Programming on the {CM}-5}, 28155 journal = {Computational Optimization and Applications}, 28156 volume = {7}, 28157 pages = {199--220}, 28158 year = {1997} 28159} 28160 28161@TechReport{ eckstein:lions-mercier, 28162 author = {J. Eckstein}, 28163 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 28164 as instances of the Proximal Point Algorithm}, 28165 institution = {MIT}, 28166 year = {1988}, 28167 address = {Cambridge, Massachusetts}, 28168 number = {LIDS-P-1769} 28169} 28170 28171@Article{ eckstein:nonlinear, 28172 author = {J. Eckstein}, 28173 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 28174 to Convex Programming}, 28175 journal = {Mathematics of Operations Research}, 28176 year = {1993}, 28177 pages = {202--226}, 28178 volume = {18} 28179} 28180 28181@Article{ eckstein:parallel, 28182 author = {J. Eckstein}, 28183 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 28184 {CM}-5}, 28185 journal = {SIAM Journal on Optimization}, 28186 volume = {4}, 28187 pages = {794--814}, 28188 year = {1994} 28189} 28190 28191@TechReport{ eckstein:smooth, 28192 author = {J. Eckstein}, 28193 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 28194 institution = {Rutgers Center for Operations Research, Rutgers University}, 28195 address = {New Brunswick, New Jersey}, 28196 year = {1996}, 28197 type = {Research Report}, 28198 number = {27-96} 28199} 28200 28201@PhDThesis{ eckstein:splitting, 28202 author = {J. Eckstein}, 28203 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 28204 Optimization}, 28205 school = {Massachusetts Institute of Technology}, 28206 year = {1989}, 28207 address = {Cambridge, MA}, 28208 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 28209} 28210 28211@Article{ eglese:simulated, 28212 author = {R. W. Eglese}, 28213 title = {Simulated Annealing: {A} Tool for Operational Research}, 28214 journal = {European Journal of Operations Research}, 28215 year = {1990}, 28216 volume = {46}, 28217 pages = {271--281} 28218} 28219 28220@Book{ ekeland.temam:convex, 28221 author = {I. Ekeland and R. Temam}, 28222 title = {Convex Analysis and Variational Problems}, 28223 year = {1976}, 28224 publisher = {North--Holland}, 28225 address = {Amsterdam} 28226} 28227 28228@Article{ ekeland:variational, 28229 author = {I. Ekeland}, 28230 title = {On the Variational Principle}, 28231 journal = {Journal of Mathematical Analysis and Applications}, 28232 year = {1974}, 28233 volume = {47}, 28234 pages = {324--353} 28235} 28236 28237@TechReport{ el-bakry.tapia.ea:formulation, 28238 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 28239 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 28240 for nonlinear programming}, 28241 type = {{Technical Report TR92-40}}, 28242 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 28243 year = {1992} 28244} 28245 28246@Article{ eldersveld.saunders:block, 28247 author = {S. K. Eldersveld and M. A. Saunders}, 28248 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 28249 journal = {SIAM Journal on Matrix Analysis and Applications}, 28250 year = {1992}, 28251 volume = {13}, 28252 pages = {191--201} 28253} 28254 28255@Article{ elster.neumaier:grid, 28256 author = {C. Elster and A. Neumaier}, 28257 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 28258 journal = {{IMA} Journal of Numerical Analysis}, 28259 year = {1995}, 28260 volume = {15}, 28261 pages = {585--608} 28262} 28263 28264@Article{ epema.livny.ea:worldwide, 28265 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 28266 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 28267 journal = {Journal on Future Generations of Computer Systems}, 28268 year = {1996}, 28269 volume = {12}, 28270 pages = {53--65} 28271} 28272 28273@Book{ ermoliev.editors:numerical, 28274 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 28275 title = {Numerical Techniques for Stochastic Optimization Problems}, 28276 year = {1988}, 28277 publisher = {Springer-Verlag}, 28278 address = {Berlin} 28279} 28280 28281@TechReport{ evett.spiehler:rule, 28282 author = {I. W. Evett and E. J. Spiehler}, 28283 title = {Rule Induction in Forensic Science}, 28284 institution = {Central Research Establishment, Home Office Forensic Science Service}, 28285 year = {1987}, 28286 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 28287 type = {Technical Report} 28288} 28289 28290@Article{ evtushenko.purtov:sufficient, 28291 author = {Y. G. Evtushenko and V. A. Purtov}, 28292 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 28293 journal = {Soviet Mathematics Doklady}, 28294 year = {1984}, 28295 volume = {30}, 28296 pages = {313--316} 28297} 28298 28299@Article{ facchinei.fischer.ea:regularity, 28300 author = {F. Facchinei and A. Fischer and C. Kanzow}, 28301 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 28302 journal = {SIAM Journal on Optimization}, 28303 year = {1998}, 28304 volume = {8}, 28305 pages = {850--869} 28306} 28307 28308@Article{ facchinei.fischer.ea:semismooth, 28309 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 28310 Constraints}, 28311 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 28312 journal = {Complementarity and Variational Problems: State of the Art}, 28313 volume = {92}, 28314 pages = {76}, 28315 year = {1997} 28316} 28317 28318@TechReport{ facchinei.fischer.ea:simply, 28319 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 28320 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 28321 Variational Inequalities}, 28322 institution = {University of Hamburg}, 28323 year = {1996} 28324} 28325 28326@Article{ facchinei.jiang.ea:smoothing, 28327 author = {F. Facchinei and H. Jiang and L. Qi}, 28328 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 28329 year = {1999}, 28330 journal = {Mathematical Programming}, 28331 volume = {85}, 28332 pages = {107--134} 28333} 28334 28335@Article{ facchinei.kanzow:nonsmooth, 28336 author = {F. Facchinei and C. Kanzow}, 28337 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 28338 Complementarity Problems}, 28339 year = {1997}, 28340 journal = {Mathematical Programming}, 28341 volume = {76}, 28342 pages = {493--512} 28343} 28344 28345@Article{ facchinei.kanzow:unconstrained, 28346 author = {F. Facchinei and C. Kanzow}, 28347 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 28348 {L}agrangian}, 28349 year = {1997}, 28350 journal = {Journal of Optimization Theory and Applications}, 28351 volume = {92}, 28352 pages = {99--115} 28353} 28354 28355@TechReport{ facchinei.pang:total, 28356 author = {F. Facchinei and J. S. Pang}, 28357 title = {Total stability of variational inequalities}, 28358 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 28359 year = {1988}, 28360 type = {Manuscript}, 28361 address = {Roma, Italy} 28362} 28363 28364@Article{ facchinei.soares:merit, 28365 author = {F. Facchinei and J. Soares}, 28366 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 28367 Algorithm}, 28368 journal = {SIAM Journal on Optimization}, 28369 year = {1997}, 28370 volume = {7}, 28371 pages = {225--247} 28372} 28373 28374@InCollection{ facchinei.soares:testing, 28375 author = {F. Facchinei and J. Soares}, 28376 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 28377 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 28378 publisher = {Plenum Press}, 28379 address = {New York}, 28380 editor = {F. Giannessi and A. Maugeri}, 28381 year = {1995}, 28382 pages = {69--83} 28383} 28384 28385@InProceedings{ fahlman.lebiere:cascade-correlation, 28386 author = {S. E. Fahlman and C. Lebiere}, 28387 title = {The cascade-correlation learning architecture}, 28388 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 28389 year = {1990}, 28390 editor = {D. S. Touretzky}, 28391 publisher = {Morgan Kaufmann}, 28392 address = {San Mateo, California}, 28393 pages = {524--532} 28394} 28395 28396@InProceedings{ fang.geiser.ea:software, 28397 author = {G. Fang and B. Geiser and T. R. Mackie}, 28398 title = {Software system for {UW}/{GE} tomotherapy prototype}, 28399 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 28400 Radiation Therapy, Salt Lake City}, 28401 year = {1997}, 28402 editor = {D. D. Leavitt and G. Starkshall}, 28403 publisher = {Medical Physics Publishing}, 28404 address = {St. Louis, Missouri}, 28405 pages = {332--334} 28406} 28407 28408@Book{ fang.puthenpura:linear, 28409 author = {S.--C. Fang and S. Puthenpura}, 28410 title = {Linear Optimization and Extensions}, 28411 year = {1993}, 28412 publisher = {Prentice-Hall, Inc}, 28413 address = {Englewood Cliffs, New Jersey} 28414} 28415 28416@Article{ fayard.plateau:algorithm, 28417 author = {D. Fayard and G. Plateau}, 28418 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 28419 journal = {Computing}, 28420 year = {1982}, 28421 volume = {28}, 28422 pages = {269--287} 28423} 28424 28425@Book{ feller:introduction, 28426 author = {W. Feller}, 28427 title = {An Introduction to Probability Theory and its Applications}, 28428 publisher = {John Wiley \& Sons}, 28429 year = {1968}, 28430 address = {New York} 28431} 28432 28433@Article{ ferris.fourer.ea:expressing, 28434 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 28435 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 28436 journal = {SIAM Journal on Optimization}, 28437 volume = {9}, 28438 pages = {991--1009}, 28439 year = {1999}, 28440 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 28441 key = {65}, 28442 institution = {Computer Sciences Department, University of Wisconsin}, 28443 address = {Madison, Wisconsin}, 28444 number = {98-02}, 28445 type = {Mathematical Programming Technical Report} 28446} 28447 28448@TechReport{ ferris.horn:nlp2mcp, 28449 author = {M. C. Ferris and J. D. Horn}, 28450 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 28451 problems}, 28452 year = {1998}, 28453 institution = {Computer Sciences Department, University of Wisconsin}, 28454 note = {In preparation} 28455} 28456 28457@Article{ ferris.horn:partitioning, 28458 author = {M. C. Ferris and J. D. Horn}, 28459 title = {Partitioning Mathematical Programs for Parallel Solution}, 28460 year = {1998}, 28461 volume = {80}, 28462 pages = {35--62}, 28463 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 28464 journal = {Mathematical Programming}, 28465 key = {40} 28466} 28467 28468@Article{ ferris.kanzow.ea:feasible, 28469 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 28470 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 28471 year = {1999}, 28472 journal = {Mathematical Programming}, 28473 volume = {86}, 28474 pages = {475--497}, 28475 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 28476 key = {67} 28477} 28478 28479@InCollection{ ferris.kanzow:complementarity, 28480 author = {M. C. Ferris and C. Kanzow}, 28481 title = {Complementarity and Related Problems: {A} Survey}, 28482 booktitle = {Handbook of Applied Optimization, forthcoming}, 28483 key = {74}, 28484 publisher = {Oxford University Press}, 28485 year = {2000}, 28486 editor = {P. M. Pardalos and M. G. C. Resende}, 28487 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 28488 institution = {Computer Sciences Department, University of Wisconsin}, 28489 address = {Madison, Wisconsin}, 28490 number = {98-17}, 28491 type = {Mathematical Programming Technical Report} 28492} 28493 28494@Article{ ferris.lucidi.ea:nonmonotone, 28495 author = {M. C. Ferris and S. Lucidi and M. Roma}, 28496 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 28497 journal = {Computational Optimization and Applications}, 28498 volume = {6}, 28499 pages = {117--136}, 28500 year = {1996}, 28501 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 28502 key = {43} 28503} 28504 28505@TechReport{ ferris.lucidi:globally, 28506 author = {M. C. Ferris and S. Lucidi}, 28507 title = {Globally Convergent Methods for Nonlinear Equations}, 28508 institution = {Computer Sciences Department, University of Wisconsin}, 28509 year = {1991}, 28510 address = {Madison, Wisconsin}, 28511 number = {1030}, 28512 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 28513 key = {21} 28514} 28515 28516@Article{ ferris.lucidi:nonmonotone, 28517 author = {M. C. Ferris and S. Lucidi}, 28518 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 28519 journal = {Journal of Optimization Theory and Applications}, 28520 year = {1994}, 28521 volume = {81}, 28522 pages = {53--71}, 28523 key = {30} 28524} 28525 28526@Article{ ferris.mangasarian:breast, 28527 author = {M. C. Ferris and O. L. Mangasarian}, 28528 title = {Breast Cancer Diagnosis via Linear Programming}, 28529 key = {50}, 28530 journal = {{IEEE} Computational Science and Engineering}, 28531 year = {1995}, 28532 volume = {2}, 28533 pages = {70--71} 28534} 28535 28536@Article{ ferris.mangasarian:error, 28537 author = {M. C. Ferris and O. L. Mangasarian}, 28538 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 28539 Inequalities}, 28540 journal = {Annals of Operations Research}, 28541 year = {1993}, 28542 volume = {47}, 28543 pages = {293--305}, 28544 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 28545 key = {24} 28546} 28547 28548@Article{ ferris.mangasarian:finite, 28549 author = {M. C. Ferris and O. L. Mangasarian}, 28550 title = {Finite Perturbation of Convex Programs}, 28551 journal = {Applied Mathematics and Optimization}, 28552 year = {1991}, 28553 volume = {23}, 28554 pages = {263--273}, 28555 key = {08} 28556} 28557 28558@Book{ ferris.mangasarian:linear, 28559 author = {M. C. Ferris and O. L. Mangasarian}, 28560 title = {Linear Programming via {MATLAB}}, 28561 publisher = {in preparation}, 28562 year = {1995}, 28563 address = {Madison, Wisconsin} 28564} 28565 28566@Article{ ferris.mangasarian:minimum, 28567 author = {M. C. Ferris and O. L. Mangasarian}, 28568 title = {Minimum Principle Sufficiency}, 28569 journal = {Mathematical Programming}, 28570 year = {1992}, 28571 volume = {57}, 28572 pages = {1--14}, 28573 key = {11} 28574} 28575 28576@Article{ ferris.mangasarian:parallel, 28577 author = {M. C. Ferris and O. L. Mangasarian}, 28578 title = {Parallel Constraint Distribution}, 28579 journal = {SIAM Journal on Optimization}, 28580 year = {1991}, 28581 volume = {1}, 28582 pages = {487--500}, 28583 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 28584 key = {18} 28585} 28586 28587@Article{ ferris.mangasarian:parallel*1, 28588 author = {M. C. Ferris and O. L. Mangasarian}, 28589 title = {Parallel Variable Distribution}, 28590 journal = {SIAM Journal on Optimization}, 28591 year = {1994}, 28592 volume = {4}, 28593 pages = {815--832}, 28594 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 28595 key = {31} 28596} 28597 28598@Article{ ferris.meeraus.ea:computing, 28599 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 28600 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 28601 journal = {Optimization Methods and Software}, 28602 year = {1999}, 28603 volume = {10}, 28604 pages = {669--685}, 28605 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 28606 key = {45} 28607} 28608 28609@Article{ ferris.mesnier.ea:neos, 28610 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 28611 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 28612 {I}nternet}, 28613 year = {2000}, 28614 journal = {{ACM} Transactions on Mathematical Software}, 28615 key = {54}, 28616 volume = {26}, 28617 pages = {1--18}, 28618 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 28619 institution = {Computer Sciences Department, University of Wisconsin}, 28620 address = {Madison, Wisconsin}, 28621 number = {96-08}, 28622 type = {Mathematical Programming Technical Report}, 28623 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 28624 Argonne National Laboratory}, 28625 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 28626 1996} 28627} 28628 28629@InCollection{ ferris.meyer:models, 28630 author = {M. C. Ferris and R. R. Meyer}, 28631 title = {Models and Solution for On-Demand Data Delivery Problems}, 28632 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 28633 key = {80}, 28634 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 28635 Problems}, 28636 editor = {P. M. Pardalos}, 28637 series = {Nonconvex Optimization and its Applications}, 28638 volume = {42}, 28639 address = {Dordrect}, 28640 year = {2000}, 28641 pages = {175--188}, 28642 publisher = {Kluwer}, 28643 type = {Mathematical Programming Technical Report}, 28644 institution = {Computer Sciences Department, University of Wisconsin}, 28645 number = {99-04} 28646} 28647 28648@InProceedings{ ferris.munson.ea:homotopy, 28649 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 28650 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 28651 booktitle = {Numerical Analysis 1999}, 28652 key = {88}, 28653 year = {2000}, 28654 editor = {D. F. Griffiths and G. A. Watson}, 28655 series = {Research Notes in Mathematics}, 28656 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 28657 address = {London}, 28658 pages = {143--167}, 28659 publisher = {Chapman and Hall}, 28660 institution = {Computer Sciences Department, University of Wisconsin}, 28661 number = {99-09}, 28662 type = {Mathematical Programming Technical Report} 28663} 28664 28665@TechReport{ ferris.munson.ea:practical, 28666 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 28667 title = {A Practical Approach to Sample-Path Simulation Optimization}, 28668 type = {Data Mining Institute Technical Report}, 28669 institution = {Computer Sciences Department, University of Wisconsin}, 28670 address = {Madison, Wisconsin}, 28671 year = {2000}, 28672 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 28673 number = {00-03}, 28674 key = {92}, 28675 annote = {To appear in WSC 2000} 28676} 28677 28678@InCollection{ ferris.munson:case, 28679 author = {M. C. Ferris and T. S. Munson}, 28680 title = {Case Studies in Complementarity: Improving Model Formulation}, 28681 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 28682 key = {73}, 28683 pages = {79--98}, 28684 publisher = {Springer Verlag}, 28685 year = {1999}, 28686 editor = {M. Th\'{e}ra and R. Tichatschke}, 28687 number = {477}, 28688 series = {Lecture Notes in Economics and Mathematical Systems}, 28689 address = {Berlin}, 28690 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 28691 type = {Mathematical Programming Technical Report}, 28692 institution = {Computer Sciences Department, University of Wisconsin} 28693} 28694 28695@Article{ ferris.munson:complementarity, 28696 author = {M. C. Ferris and T. S. Munson}, 28697 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 28698 year = {2000}, 28699 volume = {24}, 28700 pages = {165--188}, 28701 journal = {Journal of Economic Dynamics and Control}, 28702 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 28703 key = {70}, 28704 type = {Mathematical Programming Technical Report}, 28705 institution = {Computer Sciences Department, University of Wisconsin}, 28706 address = {Madison, Wisconsin}, 28707 number = {98-12} 28708} 28709 28710@Misc{ ferris.munson:condor, 28711 author = {M. C. Ferris and T. S. Munson}, 28712 title = {Condor Modeling Language Interface}, 28713 organization = {Computer Sciences Department, University of Wisconsin}, 28714 address = {Madison, Wisconsin}, 28715 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 28716} 28717 28718@Manual{ ferris.munson:gams, 28719 author = {M. C. Ferris and T. S. Munson}, 28720 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 28721 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 28722} 28723 28724@Article{ ferris.munson:interfaces, 28725 author = {M. C. Ferris and T. S. Munson}, 28726 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 28727 journal = {Computational Optimization and Applications}, 28728 volume = {12}, 28729 pages = {207--227}, 28730 year = {1999}, 28731 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 28732 key = {63}, 28733 institution = {Computer Sciences Department, University of Wisconsin}, 28734 address = {Madison, Wisconsin}, 28735 number = {97-12}, 28736 type = {Mathematical Programming Technical Report} 28737} 28738 28739@TechReport{ ferris.munson:interior, 28740 author = {M. C. Ferris and T. S. Munson}, 28741 title = {Interior Point Methods for Massive Support Vector Machines}, 28742 institution = {Computer Sciences Department, University of Wisconsin}, 28743 year = {2000}, 28744 key = {94}, 28745 type = {Data Mining Institute Technical Report}, 28746 number = {00-05}, 28747 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 28748 address = {Madison, Wisconsin}, 28749 annote = {Submitted to SIOPT} 28750} 28751 28752@Article{ ferris.munson:linear, 28753 author = {M. C. Ferris and T. S. Munson}, 28754 title = {Linear Programming for Emergency Broadcast Systems}, 28755 year = {1999}, 28756 journal = {{SIAG/OPT} Newsletter}, 28757 volume = {10}, 28758 pages = {6--8}, 28759 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 28760 key = {76}, 28761 type = {Mathematical Programming Technical Report}, 28762 institution = {Computer Sciences Department, University of Wisconsin}, 28763 address = {Madison, Wisconsin}, 28764 number = {98-20} 28765} 28766 28767@Article{ ferris.munson:modeling, 28768 author = {M. C. Ferris and T. S. Munson}, 28769 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 28770 year = {2000}, 28771 journal = {Mathematical Programming}, 28772 volume = {88}, 28773 pages = {487--506}, 28774 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 28775 key = {71}, 28776 type = {Mathematical Programming Technical Report}, 28777 institution = {Computer Sciences Department, University of Wisconsin}, 28778 address = {Madison, Wisconsin}, 28779 number = {98-13} 28780} 28781 28782@TechReport{ ferris.munson:preprocessing, 28783 author = {M. C. Ferris and T. S. Munson}, 28784 title = {Preprocessing Complementarity Problems}, 28785 type = {Mathematical Programming Technical Report}, 28786 institution = {Computer Sciences Department, University of Wisconsin}, 28787 address = {Madison, Wisconsin}, 28788 year = {1999}, 28789 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 28790 number = {99-07}, 28791 key = {86}, 28792 annote = {Submitted to ICCP 99} 28793} 28794 28795@TechReport{ ferris.munson:semismooth, 28796 author = {M. C. Ferris and T. S. Munson}, 28797 title = {Semismooth Support Vector Machines}, 28798 institution = {Computer Sciences Department, University of Wisconsin}, 28799 year = {2000}, 28800 key = {97}, 28801 type = {Data Mining Institute Technical Report}, 28802 number = {00-09}, 28803 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 28804 address = {Madison, Wisconsin}, 28805 annote = {Submitted to Math Prog B} 28806} 28807 28808@Article{ ferris.pang:engineering, 28809 author = {M. C. Ferris and J. S. Pang}, 28810 title = {Engineering and Economic Applications of Complementarity Problems}, 28811 year = {1997}, 28812 journal = {SIAM Review}, 28813 volume = {39}, 28814 pages = {669--713}, 28815 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 28816 key = {46} 28817} 28818 28819@Article{ ferris.pang:nondegenerate, 28820 author = {M. C. Ferris and J. S. Pang}, 28821 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 28822 journal = {SIAM Journal on Control and Optimization}, 28823 year = {1996}, 28824 volume = {34}, 28825 pages = {244--263}, 28826 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 28827 key = {35} 28828} 28829 28830@Article{ ferris.philpott:affine, 28831 author = {M. C. Ferris and A. B. Philpott}, 28832 title = {On Affine Scaling and Semi--Infinite Programming}, 28833 journal = {Mathematical Programming}, 28834 year = {1992}, 28835 volume = {56}, 28836 pages = {361--364}, 28837 key = {15} 28838} 28839 28840@Article{ ferris.philpott:interior, 28841 author = {M. C. Ferris and A. B. Philpott}, 28842 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 28843 journal = {Mathematical Programming}, 28844 year = {1989}, 28845 volume = {43}, 28846 pages = {257--276}, 28847 key = {04} 28848} 28849 28850@Article{ ferris.philpott:performance, 28851 author = {M. C. Ferris and A. B. Philpott}, 28852 title = {On the Performance of {K}armarkar's Algorithm}, 28853 journal = {Journal of the Operational Research Society}, 28854 year = {1988}, 28855 volume = {39}, 28856 pages = {257--270}, 28857 key = {03} 28858} 28859 28860@InCollection{ ferris.ralph:projected, 28861 author = {M. C. Ferris and D. Ralph}, 28862 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 28863 Maps}, 28864 booktitle = {Recent Advances in Nonsmooth Optimization}, 28865 publisher = {World Scientific Publishers}, 28866 year = {1995}, 28867 pages = {57--87}, 28868 editor = {D. Du and L. Qi and R. Womersley}, 28869 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 28870 key = {41} 28871} 28872 28873@Article{ ferris.ruszczynski:robust, 28874 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 28875 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 28876 year = {2000}, 28877 journal = {Networks}, 28878 volume = {35}, 28879 pages = {181--194}, 28880 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 28881 key = {60} 28882} 28883 28884@InCollection{ ferris.rutherford:accessing, 28885 author = {M. C. Ferris and T. F. Rutherford}, 28886 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 28887 booktitle = {Nonlinear Optimization and Applications}, 28888 key = {48}, 28889 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 28890 editor = {G. Di Pillo and F. Giannessi}, 28891 year = {1996}, 28892 pages = {141--153}, 28893 publisher = {Plenum Press}, 28894 address = {New York} 28895} 28896 28897@InCollection{ ferris.shepard:optimizing, 28898 author = {M. C. Ferris and D. M. Shepard}, 28899 title = {Optimization of Gamma Knife Radiosurgery}, 28900 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 28901 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 28902 publisher = {AMS}, 28903 year = {2000}, 28904 optseries = {DIMACS}, 28905 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 28906 key = {91}, 28907 type = {Data Mining Institute Technical Report}, 28908 institution = {Computer Sciences Department, University of Wisconsin}, 28909 address = {Madison, Wisconsin}, 28910 number = {00-01} 28911} 28912 28913@InCollection{ ferris.sinapiromsaran:formulating, 28914 author = {M. C. Ferris and K. Sinapiromsaran}, 28915 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 28916 booktitle = {Optimization}, 28917 key = {77}, 28918 publisher = {Springer-Verlag}, 28919 year = {2000}, 28920 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 28921 volume = {481}, 28922 series = {Lecture Notes in Economics and Mathematical Systems}, 28923 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 28924 type = {Mathematical Programming Technical Report}, 28925 institution = {Computer Sciences Department, University of Wisconsin}, 28926 address = {Madison, Wisconsin}, 28927 number = {98-21} 28928} 28929 28930@Article{ ferris.tin-loi:limit, 28931 author = {M. C. Ferris and F. Tin-Loi}, 28932 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 28933 Complementarity Constraints}, 28934 year = {2001}, 28935 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 28936 key = {78}, 28937 journal = {International Journal of Mechanical Sciences}, 28938 pages = {209--224}, 28939 volume = {43}, 28940 type = {Mathematical Programming Technical Report}, 28941 institution = {Computer Sciences Department, University of Wisconsin}, 28942 address = {Madison, Wisconsin}, 28943 number = {99-01} 28944} 28945 28946@Article{ ferris.tin-loi:nonlinear, 28947 author = {M. C. Ferris and F. Tin-Loi}, 28948 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 28949 Elastoplasticity}, 28950 year = {1998}, 28951 key = {64}, 28952 volume = {6}, 28953 pages = {857--870}, 28954 journal = {Structural Engineering and Mechanics} 28955} 28956 28957@Article{ ferris.tin-loi:solution, 28958 author = {M. C. Ferris and F. Tin-Loi}, 28959 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 28960 and Complementarity Constraints}, 28961 year = {1999}, 28962 journal = {Computer Methods in Applied Mechanics and Engineering}, 28963 volume = {174}, 28964 pages = {107--120}, 28965 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 28966 key = {66} 28967} 28968 28969@Article{ ferris.vlach:scheduling, 28970 author = {M. C. Ferris and M. Vlach}, 28971 title = {Scheduling with Earliness and Tardiness Penalties}, 28972 journal = {Naval Research Logistics Quarterly}, 28973 year = {1992}, 28974 volume = {39}, 28975 pages = {229--245}, 28976 key = {13} 28977} 28978 28979@TechReport{ ferris.zavriev:linear, 28980 author = {M. C. Ferris and S. K Zavriev}, 28981 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 28982 institution = {Computer Sciences Department, University of Wisconsin}, 28983 year = {1996}, 28984 key = {56}, 28985 address = {Madison, Wisconsin}, 28986 type = {Mathematical Programming Technical Report}, 28987 number = {96--12}, 28988 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 28989} 28990 28991@Article{ ferris:finite, 28992 author = {M. C. Ferris}, 28993 title = {Finite Termination of the Proximal Point Algorithm}, 28994 journal = {Mathematical Programming}, 28995 year = {1991}, 28996 volume = {50}, 28997 pages = {359--366}, 28998 key = {06} 28999} 29000 29001@Article{ ferris:iterative, 29002 author = {M. C. Ferris}, 29003 title = {Iterative Linear Programming Solution of Convex Programs}, 29004 journal = {Journal of Optimization Theory and Applications}, 29005 year = {1990}, 29006 volume = {65}, 29007 pages = {53--65}, 29008 key = {07} 29009} 29010 29011@Article{ ferris:linear, 29012 author = {M. C. Ferris}, 29013 title = {The Linear Complementarity Problem}, 29014 journal = {Bulletin of the American Mathematical Society}, 29015 year = {1993}, 29016 volume = {28}, 29017 pages = {169--175}, 29018 key = {27} 29019} 29020 29021@MastersThesis{ ferris:linear*1, 29022 author = {M. C. Ferris}, 29023 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 29024 Solving a Class of Structural Optimization Problems}, 29025 year = {1985}, 29026 school = {University of Cambridge}, 29027 address = {England}, 29028 key = {01} 29029} 29030 29031@TechReport{ ferris:matlab, 29032 author = {M. C. Ferris}, 29033 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 29034 institution = {Computer Sciences Department, University of Wisconsin}, 29035 year = {1998}, 29036 address = {Madison, Wisconsin}, 29037 type = {Mathematical Programming Technical Report}, 29038 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 29039 number = {98-19}, 29040 key = {75} 29041} 29042 29043@Article{ ferris:parallel, 29044 author = {M. C. Ferris}, 29045 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 29046 journal = {Mathematics of Operations Research}, 29047 year = {1994}, 29048 volume = {19}, 29049 pages = {645--658}, 29050 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 29051 key = {20} 29052} 29053 29054@TechReport{ ferris:parallel*1, 29055 author = {M. C. Ferris}, 29056 title = {Parallel Solution of Extremely Large Knapsack Problems}, 29057 institution = {Computer Sciences Department, University of Wisconsin}, 29058 year = {1989}, 29059 address = {Madison, Wisconsin}, 29060 number = {842}, 29061 key = {09} 29062} 29063 29064@PhDThesis{ ferris:weak, 29065 author = {M. C. Ferris}, 29066 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29067 year = {1988}, 29068 school = {University of Cambridge}, 29069 address = {England}, 29070 key = {02} 29071} 29072 29073@TechReport{ ferris:weak*1, 29074 author = {M. C. Ferris}, 29075 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29076 institution = {Computer Sciences Department, University of Wisconsin}, 29077 year = {1988}, 29078 address = {Madison, Wisconsin}, 29079 number = {779}, 29080 key = {05} 29081} 29082 29083@Book{ fiacco.mccormick:nonlinear, 29084 author = {A. V. Fiacco and G. P. McCormick}, 29085 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 29086 year = {1968}, 29087 publisher = {John Wiley \& Sons}, 29088 address = {New York}, 29089 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 29090} 29091 29092@Book{ fiacco:introduction, 29093 author = {A. V. Fiacco}, 29094 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 29095 year = {1983}, 29096 publisher = {Academic Press}, 29097 address = {New York} 29098} 29099 29100@Article{ fiedler.ptak:matrices, 29101 author = {M. Fiedler and V. Pt\'{a}k}, 29102 title = {On matrices with nonpositive off-diagonal elements and positive principal 29103 minors}, 29104 journal = {Czechoslovak Mathematics Journal}, 29105 volume = {12}, 29106 pages = {382--400}, 29107 year = {1962} 29108} 29109 29110@Article{ fischer.kanzow:finite, 29111 author = {A. Fischer and C. Kanzow}, 29112 title = {On Finite Termination of an Iterative Method for Linear Complementarity 29113 Problems}, 29114 journal = {Mathematical Programming}, 29115 volume = {74}, 29116 pages = {279--292}, 29117 year = {1996} 29118} 29119 29120@TechReport{ fischer:constrained, 29121 author = {A. Fischer}, 29122 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 29123 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 29124 year = {1995}, 29125 type = {Technical Report}, 29126 number = {MATH-NM-10-1995}, 29127 address = {Dresden} 29128} 29129 29130@Article{ fischer:local, 29131 author = {A. Fischer}, 29132 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 29133 weak conditions}, 29134 journal = {Optimization Methods and Software}, 29135 year = {1995}, 29136 volume = {6}, 29137 pages = {83--107} 29138} 29139 29140@InCollection{ fischer:ncp-function, 29141 author = {A. Fischer}, 29142 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 29143 booktitle = {Recent Advances in Nonsmooth Optimization}, 29144 publisher = {World Scientific Publishers}, 29145 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 29146 year = {1995}, 29147 pages = {88--105} 29148} 29149 29150@Article{ fischer:newton-type, 29151 author = {A. Fischer}, 29152 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 29153 Problems}, 29154 journal = {Journal of Optimization Theory and Applications}, 29155 year = {1995}, 29156 volume = {86}, 29157 pages = {585--608} 29158} 29159 29160@Article{ fischer:solution, 29161 author = {A. Fischer}, 29162 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 29163 Functions}, 29164 year = {1997}, 29165 journal = {Mathematical Programming}, 29166 pages = {513--532} 29167} 29168 29169@Article{ fischer:special, 29170 author = {A. Fischer}, 29171 title = {A Special {N}ewton--Type Optimization Method}, 29172 journal = {Optimization}, 29173 year = {1992}, 29174 volume = {24}, 29175 pages = {269--284} 29176} 29177 29178@Article{ fisher:use, 29179 author = {R. A. Fisher}, 29180 title = {The Use of Multiple Measurements in Taxonomic Problems}, 29181 journal = {Annual Eugenics}, 29182 year = {1936}, 29183 volume = {7}, 29184 number = {Part II}, 29185 pages = {179--188} 29186} 29187 29188@Book{ fishman:principles, 29189 author = {G. Fishman}, 29190 title = {Principles of Discrete Event Simulation}, 29191 publisher = {Wiley}, 29192 address = {New York, NY}, 29193 year = {1978} 29194} 29195 29196@Article{ fitchard.aldridge.ea:registration, 29197 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 29198 title = {Registration of Synthetic Tomographic Projection Data Sets Using 29199 Cross-Correlation}, 29200 journal = {Physics in Medicine and Biology}, 29201 year = {1998}, 29202 volume = {43}, 29203 pages = {1645--1657} 29204} 29205 29206@Article{ fletcher.matthews:stable, 29207 author = {R. Fletcher and S. P. J. Matthews}, 29208 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 29209 journal = {Mathematical Programming}, 29210 year = {1984}, 29211 volume = {30}, 29212 pages = {267--284} 29213} 29214 29215@TechReport{ fletcher.maza:nonlinear, 29216 author = {R. Fletcher and E. Sainz de la Maza}, 29217 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 29218 Programming}, 29219 institution = {Department of Mathematical Sciences}, 29220 year = {1987}, 29221 address = {The University, Dundee, Scotland}, 29222 number = {NA/100}, 29223 type = {Numerical Analysis Report} 29224} 29225 29226@InCollection{ fletcher:class, 29227 author = {R. Fletcher}, 29228 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 29229 Properties}, 29230 booktitle = {Integer and Nonlinear Programming}, 29231 year = {1970}, 29232 editor = {J. Abadie}, 29233 publisher = {North--Holland}, 29234 address = {Amsterdam}, 29235 pages = {157--173} 29236} 29237 29238@Article{ fletcher:exact, 29239 author = {R. Fletcher}, 29240 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 29241 journal = {Mathematical Programming}, 29242 year = {1973}, 29243 volume = {5}, 29244 pages = {129--150} 29245} 29246 29247@Article{ fletcher:generalized, 29248 author = {R. Fletcher}, 29249 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 29250 Equations}, 29251 journal = {The Computer Journal}, 29252 year = {1968}, 29253 volume = {10}, 29254 pages = {392--399} 29255} 29256 29257@InProceedings{ fletcher:penalty, 29258 crossref = {bachem.grotschel.ea:mathematical}, 29259 author = {R. Fletcher}, 29260 title = {Penalty Functions}, 29261 pages = {87--114} 29262} 29263 29264@Book{ fletcher:practical, 29265 author = {R. Fletcher}, 29266 title = {Practical Methods of Optimization}, 29267 year = {1981}, 29268 publisher = {John Wiley \& Sons}, 29269 address = {Chichester}, 29270 volume = {1} 29271} 29272 29273@Book{ fletcher:practical*1, 29274 author = {R. Fletcher}, 29275 title = {Practical Methods of Optimization}, 29276 year = {1981}, 29277 publisher = {John Wiley \& Sons}, 29278 address = {Chichester}, 29279 volume = {2} 29280} 29281 29282@Book{ fletcher:practical*2, 29283 author = {R. Fletcher}, 29284 title = {Practical Methods of Optimization}, 29285 year = {1987}, 29286 publisher = {John Wiley \& Sons}, 29287 address = {New York}, 29288 edition = {second} 29289} 29290 29291@Unpublished{ fletcher:recent, 29292 author = {R. Fletcher}, 29293 title = {Recent Developments in Nonlinear Programming}, 29294 note = {Presentation at SOR 96, Braunchweig, Germany}, 29295 year = {1996} 29296} 29297 29298@InCollection{ fletcher:second, 29299 author = {R. Fletcher}, 29300 title = {Second Order Correction for Nondifferentiable Optimization}, 29301 booktitle = {Numerical Analysis}, 29302 year = {1982}, 29303 editor = {G. A. Watson}, 29304 publisher = {Springer-Verlag}, 29305 address = {Berlin}, 29306 pages = {85--114} 29307} 29308 29309@InCollection{ florian:mathematical, 29310 author = {M. Florian}, 29311 title = {Mathematical programming applications in national, regional, and urban planning}, 29312 editors = {M. Iri and K. Tanabe}, 29313 booktitle = {Mathematical Programming: Recent Developments and Applications}, 29314 publisher = {Kluwer Academic Publishers}, 29315 address = {Tokyo}, 29316 year = {1989} 29317} 29318 29319@Article{ florian:nonlinear, 29320 author = {M. Florian}, 29321 title = {Nonlinear Cost Network Models in Transportation Analysis}, 29322 journal = {Mathematical Programming Study}, 29323 year = {1986}, 29324 volume = {26}, 29325 pages = {167--196} 29326} 29327 29328@Article{ flynn:computer, 29329 author = {M.~J. Flynn}, 29330 title = {Some Computer Organizations and their Effectiveness}, 29331 journal = {IEEE Transactions on Computers}, 29332 year = {1972}, 29333 volume = {C-21}, 29334 pages = {948--960} 29335} 29336 29337@InProceedings{ fogarty:varying, 29338 crossref = {schaeffer:third}, 29339 author = {T. C. Fogarty}, 29340 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 29341 pages = {422--427} 29342} 29343 29344@Article{ forrest.goldfarb:steepest-edge, 29345 author = {J. J. Forrest and D. Goldfarb}, 29346 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 29347 journal = {Mathematical Programming}, 29348 year = {1992}, 29349 volume = {57}, 29350 pages = {341--374} 29351} 29352 29353@Article{ forrest.tomlin:updating, 29354 author = {J. J. H. Forrest and J. A. Tomlin}, 29355 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 29356 Simplex Method}, 29357 journal = {Mathematical Programming}, 29358 year = {1972}, 29359 volume = {2}, 29360 pages = {263--278} 29361} 29362 29363@TechReport{ forsgren.gill.ea:computing, 29364 author = {A. Forsgren and P. E. Gill and W. Murray}, 29365 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 29366 institution = {Department of Mathematics, Royal Institute of Technology}, 29367 year = {1993}, 29368 number = {TRITA-MAT-1993-9}, 29369 address = {Stockholm, Sweden} 29370} 29371 29372@TechReport{ forsgren.gill:primal-dual, 29373 author = {A. Forsgren and P. E. Gill}, 29374 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 29375 institution = {Department of Mathematics, University of California}, 29376 year = {1996}, 29377 type = {Report NA}, 29378 number = {96-3}, 29379 address = {San Diego} 29380} 29381 29382@InCollection{ fortin.glowinski:decomposition-coordination, 29383 author = {M. Fortin and R. Glowinski}, 29384 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 29385 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 29386 Problems}, 29387 publisher = {North-Holland}, 29388 year = {1983}, 29389 editor = {M. Fortin and R. Glowinski}, 29390 address = {Amsterdam} 29391} 29392 29393@Misc{ foster.kesselman:globus, 29394 author = {I. Foster and C. Kesselman}, 29395 title = {The Globus Project}, 29396 howpublished = {www.globus.org} 29397} 29398 29399@Article{ foster.kesselman:globus*1, 29400 author = {I. Foster and C. Kesselman}, 29401 title = {Globus: A Metacomputing Infrastructure Toolkit}, 29402 journal = {International Journal of Supercomputer Applications}, 29403 volume = {11}, 29404 pages = {115--128}, 29405 year = {1997} 29406} 29407 29408@Book{ foster.kesselman:grid, 29409 editor = {I. Foster and C. Kesselman}, 29410 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 29411 publisher = {Morgan Kaufmann Publishers}, 29412 year = {1999} 29413} 29414 29415@Book{ fourer.gay.ea:ampl, 29416 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29417 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 29418 year = {1993}, 29419 publisher = {Duxbury Press} 29420} 29421 29422@Article{ fourer.gay.ea:modeling, 29423 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29424 title = {A Modeling Language for Mathematical Programming}, 29425 journal = {Management Science}, 29426 year = {1990}, 29427 volume = {36}, 29428 pages = {519--554} 29429} 29430 29431@Article{ fraass:development, 29432 author = {A. Fraass}, 29433 title = {The development of conformal radiation therapy}, 29434 journal = {Medical Physics}, 29435 year = {1995}, 29436 volume = {22}, 29437 number = {11}, 29438 pages = {1911--1921} 29439} 29440 29441@TechReport{ fraley:algorithms, 29442 author = {C. Fraley}, 29443 title = {Algorithms for Nonlinear Least Squares}, 29444 institution = {Stanford University}, 29445 year = {1988}, 29446 number = {{SOL} 88.16}, 29447 type = {Technical Report} 29448} 29449 29450@InCollection{ francois.mcdonald.ea:uruguay, 29451 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29452 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 29453 booktitle = {The {U}ruguay Round and the Developing Economies}, 29454 address = {New York}, 29455 editors = {W. Martin and L. A. Winters}, 29456 publisher = {Cambridge University Press} 29457} 29458 29459@InCollection{ francois.mcdonald.ea:uruguay*1, 29460 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29461 title = {The {U}ruguay Round: {A} Global Analysis}, 29462 booktitle = {Challenges and Opportunities for East Asian Trade}, 29463 address = {Cambridge}, 29464 editors = {D. Robertson}, 29465 publisher = {Cambridge University Press} 29466} 29467 29468@Article{ frank.wolfe:algorithm, 29469 author = {M. Frank and P. Wolfe}, 29470 title = {An Algorithm for Quadratic Programming}, 29471 journal = {Naval Research Logistics Quarterly}, 29472 year = {1956}, 29473 volume = {3}, 29474 pages = {95--110} 29475} 29476 29477@Article{ freund.nachtigal:qmrpack, 29478 author = {R. W. Freund and N. M. Nachtigal}, 29479 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 29480 journal = {{ACM} Transactions on Mathematical Software}, 29481 year = {1996}, 29482 volume = {22}, 29483 pages = {46--77} 29484} 29485 29486@InProceedings{ freund.schapire:experiments, 29487 author = {Y. Freund and R. E. Schapire}, 29488 title = {Experiments with a New Boosting Algorithm}, 29489 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 29490 pages = {148--156}, 29491 year = {1996}, 29492 editor = {L. Saitta}, 29493 publisher = {Morgan Kaufmann} 29494} 29495 29496@Unpublished{ freund.todd:barrier, 29497 author = {Robert M. Freund and Michael J. Todd}, 29498 title = {Barrier functions and interior-point algorithms for linear programming with 29499 zero-, one-, or two-sided bounds on the variables}, 29500 year = {1992}, 29501 month = jul 29502} 29503 29504@Article{ friedman.chernina:iterative, 29505 author = {V. M. Friedman and V. S. Chernina}, 29506 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 29507 note = {In Russian}, 29508 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 29509 volume = {1}, 29510 pages = {116--120}, 29511 year = {1967} 29512} 29513 29514@Article{ friesz.bernstein.ea:day-to-day, 29515 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 29516 Ganjalizadeh}, 29517 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 29518 Systems}, 29519 journal = {Operations Research}, 29520 year = {1994}, 29521 volume = {42}, 29522 pages = {1120--1136} 29523} 29524 29525@Article{ friesz.tobin.ea:nonlinear, 29526 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 29527 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 29528 Derived Demand Network Equilibrium Problem}, 29529 journal = {Journal of Regional Science}, 29530 year = {1983}, 29531 volume = {23}, 29532 pages = {337--359} 29533} 29534 29535@Article{ friesz:network, 29536 author = {T. L. Friesz}, 29537 title = {Network Equilibrium, Design and Aggregation}, 29538 journal = {Transportation Research}, 29539 volume = {19A}, 29540 year = {1985}, 29541 pages = {413--427} 29542} 29543 29544@Unpublished{ frisch:logarithmic, 29545 author = {K. R. Frisch}, 29546 title = {The Logarithmic Potential Method of Convex Programming}, 29547 year = {1955}, 29548 note = {Unpublished manuscript, University Institute of Economics, Oslo} 29549} 29550 29551@Book{ fukunaga:statistical, 29552 author = {K. Fukunaga}, 29553 title = {Statistical Pattern Recognition}, 29554 year = {1990}, 29555 publisher = {Academic Press}, 29556 address = {New York} 29557} 29558 29559@Article{ fukushima.luo.ea:globally, 29560 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 29561 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 29562 Programs with Linear Complementarity Constraints}, 29563 journal = {Computational Optimization and Applications}, 29564 year = {1998}, 29565 volume = {10}, 29566 pages = {5--34} 29567} 29568 29569@Article{ fukushima:equivalent, 29570 author = {M. Fukushima}, 29571 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 29572 Asymmetric Variational Inequality Problems}, 29573 journal = {Mathematical Programming}, 29574 year = {1992}, 29575 volume = {53}, 29576 pages = {99--110} 29577} 29578 29579@Article{ fukushima:primal, 29580 author = {M. Fukushima}, 29581 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 29582 Mappings with Application to the Traffic Equilibrium Problem}, 29583 journal = {Mathematical Programming}, 29584 year = {1996}, 29585 volume = {72}, 29586 pages = {1--15} 29587} 29588 29589@Article{ gabay.mercier:dual, 29590 author = {D. Gabay and B. Mercier}, 29591 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 29592 Finite Element Approximations}, 29593 journal = {Computational Mathematics and Applications}, 29594 year = {1976}, 29595 volume = {2}, 29596 pages = {17--48} 29597} 29598 29599@InCollection{ gabay:applications, 29600 author = {D. Gabay}, 29601 title = {Applications of the Method of Multipliers to Variational Inequalities}, 29602 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 29603 Problems}, 29604 publisher = {North-Holland}, 29605 year = {1983}, 29606 editor = {M. Fortin and R. Glowinski}, 29607 address = {Amsterdam} 29608} 29609 29610@Unpublished{ gabriel.bernstein:path, 29611 author = {S. A. Gabriel and D. Berstein}, 29612 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 29613 Equilibrium Problem}, 29614 note = {Draft, 1995} 29615} 29616 29617@TechReport{ gabriel.kydes:nonlinear, 29618 author = {S. A. Gabriel and A. S. Kydes}, 29619 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 29620 System}, 29621 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 29622 year = {1995}, 29623 type = {Preprint}, 29624 number = {MCS-P504-0395}, 29625 address = {Argonne, Illinois}, 29626 month = mar 29627} 29628 29629@InProceedings{ gabriel.more:smoothing, 29630 crossref = {ferris.pang:complementarity}, 29631 author = {S. A. Gabriel and J. J. Mor\'{e}}, 29632 title = {Smoothing of Mixed Complementarity Problems} 29633} 29634 29635@Article{ gabriel.pang:inexact, 29636 author = {S. A. Gabriel and J. S. Pang}, 29637 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 29638 journal = {Computational Optimization and Applications}, 29639 year = {1992}, 29640 volume = {1}, 29641 pages = {67--91} 29642} 29643 29644@InCollection{ gabriel.pang:trust, 29645 author = {S. A. Gabriel and J. S. Pang}, 29646 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 29647 booktitle = {Large--Scale Optimization: State of the Art}, 29648 publisher = {Kluwer Academic Publishers}, 29649 year = {1994}, 29650 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 29651 pages = {159--186} 29652} 29653 29654@PhDThesis{ gabriel:algorithms, 29655 author = {S. A. Gabriel}, 29656 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 29657 Extensions}, 29658 school = {The Johns Hopkins University}, 29659 year = {1992}, 29660 address = {Baltimore, Maryland} 29661} 29662 29663@Article{ gafni.bertsekas:two-metric, 29664 author = {E. M. Gafni and D. P. Bertsekas}, 29665 title = {Two-Metric Projection Methods for Constrained Optimization}, 29666 journal = {SIAM Journal on Control and Optimization}, 29667 year = {1984}, 29668 volume = {22}, 29669 pages = {936--964} 29670} 29671 29672@InProceedings{ gaivoronski:convergence, 29673 author = {A. A. Gaivoronski}, 29674 title = {Convergence of Parallel Backpropagation for Neural Networks}, 29675 booktitle = {SIAM Journal on Optimization}, 29676 year = {1994}, 29677 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 29678 submitted} 29679} 29680 29681@Misc{ gaivoronski:private, 29682 author = {A. A. Gaivoronski}, 29683 title = {Private Communication}, 29684 year = {1992}, 29685 month = nov, 29686 address = {ITALTEL, Milan} 29687} 29688 29689@Book{ gale:theory, 29690 author = {D. Gale}, 29691 title = {The Theory of Linear Economic Models}, 29692 year = {1960}, 29693 publisher = {McGraw-Hill Book Company}, 29694 address = {New York} 29695} 29696 29697@Book{ gallant:neural, 29698 author = {S. I. Gallant}, 29699 title = {Neural Network Learning and Expert Systems}, 29700 year = {1993}, 29701 publisher = {MIT Press}, 29702 address = {Cambridge, Massachusetts} 29703} 29704 29705@InProceedings{ ganti.gehrke.ea:framework, 29706 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 29707 title = {A Framework for Measuring Changes in Data Characteristics}, 29708 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 29709 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 29710 publisher = {ACM Press}, 29711 year = {1999}, 29712 isbn = {1-58113-062-7}, 29713 pages = {126--137} 29714} 29715 29716@Book{ ganz:gamma, 29717 author = {J. C. Ganz}, 29718 title = {Gamma Knife Surgery}, 29719 publisher = {Springer-Verlag Wien}, 29720 year = {1997}, 29721 address = {Austria} 29722} 29723 29724@TechReport{ gao:nonlinear, 29725 author = {Y. Gao}, 29726 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 29727 Conditions}, 29728 type = {Manuscript}, 29729 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 29730 month = oct, 29731 year = {1994} 29732} 29733 29734@Article{ garcia-palomares.mangasarian:superlinearly, 29735 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 29736 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 29737 Optimization Problems}, 29738 journal = {Mathematical Programming}, 29739 year = {1976}, 29740 volume = {11}, 29741 pages = {1--13} 29742} 29743 29744@Article{ garcia-palomares.restuccia:global, 29745 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 29746 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 29747 journal = {Mathematical Programming}, 29748 year = {1981}, 29749 volume = {21}, 29750 pages = {290--300} 29751} 29752 29753@InProceedings{ garcia-palomares:superlinearly, 29754 author = {U. M. {Garcia--Palomares}}, 29755 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 29756 crossref = {mangasarian.meyer.ea:nonlinear*2}, 29757 pages = {101--119} 29758} 29759 29760@Article{ garcia.gould:theorem, 29761 author = {C. B. Garcia and F. J. Gould}, 29762 title = {A Theorem on Homotopy Paths}, 29763 journal = {Mathematics of Operations Research}, 29764 year = {1978}, 29765 volume = {3}, 29766 pages = {282--289} 29767} 29768 29769@Book{ garcia.zangwill:pathways, 29770 author = {C. B. Garcia and W. I. Zangwill}, 29771 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 29772 year = {1981}, 29773 publisher = {Prentice-Hall, Inc}, 29774 address = {Englewood Cliffs, New Jersey} 29775} 29776 29777@Book{ garey.johnson:computers, 29778 author = {M. R. Garey and D. S. Johnson}, 29779 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 29780 year = {1979}, 29781 publisher = {W.H. Freeman and Company}, 29782 address = {San Francisco} 29783} 29784 29785@Article{ garey.tarjan.ea:one-processor, 29786 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 29787 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 29788 journal = {Mathematics of Operations Research}, 29789 year = {1988}, 29790 volume = {13}, 29791 pages = {330--348} 29792} 29793 29794@Book{ garfinkel.nemhauser:integer, 29795 author = {R. S. Garfinkel and G. L. Nemhauser}, 29796 title = {Integer Programming}, 29797 year = {1972}, 29798 publisher = {John Wiley \& Sons}, 29799 address = {New York} 29800} 29801 29802@Book{ gass:linear, 29803 author = {S. Gass}, 29804 title = {Linear Programming Methods and Applications}, 29805 edition = {Fifth}, 29806 publisher = {Boyd and Fraser Publishing Company}, 29807 address = {Danvers, Massachusetts}, 29808 year = {1985} 29809} 29810 29811@InProceedings{ gay:combining, 29812 author = {D. M. Gay}, 29813 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 29814 booktitle = {Sparse Matrix Proceedings 1978}, 29815 editor = {I. S. Duff and G. W. Stewart}, 29816 year = {1978}, 29817 organization = {SIAM}, 29818 address = {Philadelphia, Pennsylvania}, 29819 pages = {313--334} 29820} 29821 29822@Article{ gay:electronic, 29823 author = {D. M. Gay}, 29824 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 29825 journal = {{COAL} Newsletter}, 29826 year = {1985}, 29827 volume = {13}, 29828 pages = {10--12} 29829} 29830 29831@TechReport{ gay:hooking, 29832 author = {D. M. Gay}, 29833 title = {Hooking Your Solver to {AMPL}}, 29834 year = {1997}, 29835 institution = {Bell Laboratories}, 29836 address = {Murray Hill, New Jersey}, 29837 note = {Revised 1994, 1997} 29838} 29839 29840@Article{ gay:variant, 29841 author = {D. Gay}, 29842 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 29843 Form}, 29844 journal = {Mathematical Programming}, 29845 year = {1987}, 29846 volume = {37}, 29847 pages = {81--90} 29848} 29849 29850@Article{ geiger.kanzow:resolution, 29851 author = {C. Geiger and C. Kanzow}, 29852 title = {On the Resolution of Monotone Complementarity Problems}, 29853 journal = {Computational Optimization and Applications}, 29854 volume = {5}, 29855 year = {1996}, 29856 pages = {155--173} 29857} 29858 29859@Book{ geist.beguelin.ea:pvm, 29860 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 29861 V. S. Sunderam}, 29862 title = {{PVM}: Parallel Virtual Machine}, 29863 publisher = {MIT Press}, 29864 address = {Cambridge, Massachusetts}, 29865 year = {1994} 29866} 29867 29868@Article{ gendron.crainic:parallel, 29869 author = {B. Gendron and T. G. Crainic}, 29870 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 29871 journal = {Operations Research}, 29872 year = {1994}, 29873 volume = {42}, 29874 pages = {1042--1060} 29875} 29876 29877@Article{ george:automatic, 29878 author = {A. George}, 29879 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 29880 journal = {SIAM Journal on Numerical Analysis}, 29881 vol = {17}, 29882 pages = {740--751}, 29883 year = {1980} 29884} 29885 29886@InProceedings{ georges-schleuter:asparagos, 29887 crossref = {schaeffer:third}, 29888 author = {M. Georges--Schleuter}, 29889 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 29890 pages = {416--421} 29891} 29892 29893@Article{ georgiou:comments, 29894 author = {G. M. Georgiou}, 29895 title = {Comments On Hidden Nodes in Neural Nets}, 29896 journal = {IEEE Transactions on Circuits and Systems}, 29897 year = {1991}, 29898 volume = {38}, 29899 pages = {1410} 29900} 29901 29902@TechReport{ gertz.linderoth.ea:object-oriented, 29903 author = {M. Gertz and J. Linderoth and S. Wright}, 29904 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 29905 institution = {MCS Division, Argonne National Laboratory}, 29906 year = {in preparation} 29907} 29908 29909@Article{ ghellinck.vial:polynomial, 29910 author = {G. de Ghellinck and J.--Ph. Vial}, 29911 title = {A Polynomial {N}ewton Method for Linear Programming}, 29912 journal = {Algorithmica}, 29913 year = {1986}, 29914 volume = {1}, 29915 pages = {425--453} 29916} 29917 29918@InCollection{ gilbert.ng:predicting, 29919 author = {J. R. Gilbert and E. Ng}, 29920 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 29921 year = {1993}, 29922 booktitle = {Graph Theory and Sparse Matrix Computation}, 29923 editor = {A. George and J. Gilbert and J. Liu}, 29924 publisher = {Springer-Verlag} 29925} 29926 29927@Article{ gilbert-lemarechal, 29928 author = {J. C. Gilbert and C. Lemarechal}, 29929 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 29930 journal = {Mathematical Programming}, 29931 year = {1989}, 29932 volume = {45}, 29933 pages = {407--434} 29934} 29935 29936@Article{ gill.murray.ea:computing, 29937 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29938 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 29939 journal = {SIAM Journal on Scientific and Statistical Computing}, 29940 year = {1983}, 29941 volume = {4}, 29942 pages = {310--321} 29943} 29944 29945@Article{ gill.murray.ea:maintaining, 29946 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29947 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 29948 year = {1987}, 29949 journal = {Linear Algebra and Its Applications}, 29950 volume = {88/89}, 29951 pages = {239--270} 29952} 29953 29954@Book{ gill.murray.ea:practical, 29955 author = {P. E. Gill and W. Murray and M. H. Wright}, 29956 title = {Practical Optimization}, 29957 year = {1981}, 29958 publisher = {Academic Press}, 29959 address = {London} 29960} 29961 29962@Article{ gill.murray.ea:practical*1, 29963 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29964 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 29965 journal = {Mathematical Programming}, 29966 year = {1989}, 29967 volume = {45}, 29968 pages = {437--474} 29969} 29970 29971@Article{ gill.murray.ea:projected, 29972 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 29973 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 29974 to {K}armarkar's Projective Method}, 29975 journal = {Mathematical Programming}, 29976 year = {1986}, 29977 volume = {36}, 29978 pages = {183--209} 29979} 29980 29981@Article{ gill.murray:newton-type, 29982 author = {P. E. Gill and W. Murray}, 29983 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 29984 journal = {Mathematical Programming}, 29985 year = {1974}, 29986 volume = {7}, 29987 pages = {311--350} 29988} 29989 29990@InProceedings{ gill.murray:nonlinear, 29991 author = {P. E. Gill and W. Murray}, 29992 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 29993 booktitle = {Numerical Analysis, Dundee 1975}, 29994 year = {1976}, 29995 editor = {G. A. Watson}, 29996 publisher = {Springer-Verlag}, 29997 address = {Berlin}, 29998 note = {Lecture Notes in Mathematics 506} 29999} 30000 30001@Book{ ginsburgh.waelbroeck:activity, 30002 author = {V. Ginsburgh and J. Waelbroeck}, 30003 title = {Activity Analysis and General Equilibrium Modelling}, 30004 publisher = {North--Holland}, 30005 year = {1981}, 30006 address = {Amsterdam} 30007} 30008 30009@Article{ glad.goldstein:errors, 30010 author = {T. Glad and A. Goldstein}, 30011 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 30012 journal = {BIT}, 30013 year = {1977}, 30014 volume = {17}, 30015 pages = {160--169} 30016} 30017 30018@Article{ glad.polak:multiplier, 30019 author = {T. Glad and E. Polak}, 30020 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 30021 journal = {Mathematical Programming}, 30022 year = {1979}, 30023 volume = {17}, 30024 pages = {140--155} 30025} 30026 30027@Book{ glashoff.gustafson:linear, 30028 author = {K. Glashoff and S.--\AA. Gustafson}, 30029 title = {Linear Optimization and Approximation}, 30030 year = {1983}, 30031 publisher = {Springer-Verlag}, 30032 address = {New York} 30033} 30034 30035@Article{ glover:improved, 30036 author = {F. Glover}, 30037 title = {Improved Linear Programming Models for Discriminant Analysis}, 30038 journal = {Decision Sciences}, 30039 year = {1990}, 30040 volume = {21}, 30041 pages = {771--785} 30042} 30043 30044@Book{ glasserman:gradient, 30045 author = {P. Glasserman}, 30046 title = {Gradient Estimation via Perturbation Analysis}, 30047 publisher = {Kluwer}, 30048 year = {1991}, 30049 address = {Norwell, MA} 30050} 30051 30052@Article{ glover:tabu, 30053 author = {F. Glover}, 30054 title = {Tabu Search -- Part 1}, 30055 journal = {ORSA Journal on Computing}, 30056 year = {1989}, 30057 volume = {1}, 30058 pages = {190--206} 30059} 30060 30061@Article{ glowinski.marroco:sur, 30062 author = {R. Glowinski and A. Marroco}, 30063 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 30064 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 30065 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 30066 year = {1975}, 30067 volume = {9(R-2)}, 30068 pages = {41--76} 30069} 30070 30071@TechReport{ goeleven.nguyen:convergence, 30072 author = {D. Goeleven and V. H. Nguyen}, 30073 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 30074 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 30075 year = {1992}, 30076 address = {B-5000 Namur, Belgium} 30077} 30078 30079@Book{ goldberg:genetic, 30080 author = {D. E. Goldberg}, 30081 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 30082 year = {1989}, 30083 publisher = {Addison-Wesley}, 30084 address = {Reading MA} 30085} 30086 30087@Article{ golden.skiscim:simulated, 30088 author = {B. L. Golden and C. C. Skiscim}, 30089 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 30090 journal = {Naval Research Logistics Quarterly}, 30091 year = {1989}, 30092 volume = {33}, 30093 pages = {261--279} 30094} 30095 30096@Article{ goldfarb.reid:practical, 30097 author = {D. Goldfarb and J. K. Reid}, 30098 title = {A Practical Steepest--Edge Simplex Algorithm}, 30099 journal = {Mathematical Programming}, 30100 year = {1977}, 30101 volume = {12}, 30102 pages = {361--371} 30103} 30104 30105@InProceedings{ goldman.tucker:theory, 30106 author = {A. J. Goldman and A. W. Tucker}, 30107 title = {Theory of Linear Programming}, 30108 booktitle = {Linear Inequalities and Related Systems}, 30109 year = {1956}, 30110 editor = {H. W. Kuhn and A. W. Tucker}, 30111 publisher = {Princeton University Press}, 30112 address = {Princeton, New Jersey}, 30113 pages = {53--97} 30114} 30115 30116@Book{ goldstein:constructive, 30117 author = {A. A. Goldstein}, 30118 title = {Constructive Real Analysis}, 30119 year = {1967}, 30120 publisher = {Harper and Row}, 30121 address = {New York} 30122} 30123 30124@Article{ golshtein:block, 30125 author = {Ye. G. Golshtein}, 30126 title = {The Block Method of Convex Programming}, 30127 journal = {Soviet Mathematics Doklady}, 30128 year = {1986}, 30129 volume = {33}, 30130 pages = {584--587} 30131} 30132 30133@Article{ golshtein:general, 30134 author = {Ye. G. Golshtein}, 30135 title = {A General Approach to Decomposition of Optimization Systems}, 30136 journal = {Soviet Journal of Computer and Systems Sciences}, 30137 year = {1987}, 30138 volume = {3}, 30139 pages = {105--114} 30140} 30141 30142@Article{ golub.kahan:calculating, 30143 author = {G. H. Golub and W. Kahan}, 30144 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 30145 journal = {SIAM Journal on Numerical Analysis}, 30146 year = {1965}, 30147 volume = {2}, 30148 pages = {205--224} 30149} 30150 30151@Book{ golub.vanloan:matrix, 30152 author = {G. H. Golub and C. F. {Van Loan}}, 30153 title = {Matrix Computations}, 30154 year = {1996}, 30155 publisher = {The John Hopkins University Press}, 30156 address = {Baltimore, Maryland}, 30157 edition = {Third} 30158} 30159 30160@TechReport{ gomez.barron:exponential, 30161 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 30162 title = {The Exponential Tunneling Method}, 30163 institution = {Universidad Nacional Autonoma de Mexico}, 30164 year = {1991}, 30165 type = {Serie Reportes de Investigacion}, 30166 number = {3}, 30167 address = {Mexico} 30168} 30169 30170@Article{ gondzio:multiple, 30171 author = {J. Gondzio}, 30172 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 30173 journal = {Computational Optimization and Applications}, 30174 year = {1996}, 30175 volume = {6}, 30176 pages = {137--156} 30177} 30178 30179@TechReport{ gonzaga:algorithm, 30180 author = {C. C. Gonzaga}, 30181 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 30182 operations}, 30183 institution = {Electronics Research Laboratory, University of California}, 30184 year = {1987}, 30185 address = {Berkeley, California}, 30186 number = {UCB/ERL M87/10}, 30187 type = {Memorandum} 30188} 30189 30190@Article{ gould.tolle:necessary, 30191 author = {F. J. Gould and J. W. Tolle}, 30192 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 30193 journal = {SIAM Journal on Applied Mathematics}, 30194 year = {1971}, 30195 volume = {20}, 30196 pages = {164--172} 30197} 30198 30199@InProceedings{ goux.kulkarni.ea:enabling, 30200 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 30201 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 30202 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 30203 Distributed Computing}, 30204 year = {2000} 30205} 30206 30207@Article{ gowda.pang:basic, 30208 author = {M. S. Gowda and J. S. Pang}, 30209 title = {The Basic Theorem of Complementarity Revisited}, 30210 journal = {Mathematical Programming}, 30211 year = {1993}, 30212 volume = {58}, 30213 pages = {161--178} 30214} 30215 30216@Article{ gowda.pang:boundedness, 30217 author = {M. S. Gowda and J. S. Pang}, 30218 title = {On the Boundedness and Stability of Solutions to the Affine Variational 30219 Inequality Problem}, 30220 journal = {SIAM Journal on Control and Optimization}, 30221 year = {1994}, 30222 volume = {32}, 30223 pages = {421--441} 30224} 30225 30226@Article{ gowda.pang:stability, 30227 author = {M. S. Gowda and J. S. Pang}, 30228 title = {Stability analysis of variational inequalities and nonlinear complementarity 30229 problems, via the mixed linear complementarity problem and degree theory}, 30230 journal = {Mathematics of Operations Research}, 30231 year = {1994}, 30232 volume = {19}, 30233 pages = {831--879} 30234} 30235 30236@Article{ gowda.sznajder:generalizations, 30237 author = {M. S. Gowda and R. Sznajder}, 30238 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 30239 Horizontal {LCP}s}, 30240 journal = {Linear Algebra and Its Applications}, 30241 year = {1995}, 30242 volume = {223/224}, 30243 pages = {695--715} 30244} 30245 30246@Article{ gowda.sznajder:generalized, 30247 author = {M. S. Gowda and R. Sznajder}, 30248 title = {The Generalized Order Linear Complementarity Problem}, 30249 journal = {SIAM Journal on Matrix Analysis and Applications}, 30250 year = {1994} 30251} 30252 30253@Article{ gowda:analysis, 30254 author = {M. S. Gowda}, 30255 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 30256 Function via its Recession Function}, 30257 journal = {SIAM Journal on Matrix Analysis and Applications}, 30258 year = {1996}, 30259 volume = {17}, 30260 pages = {594--609} 30261} 30262 30263@Article{ gowda:applications, 30264 author = {M. S. Gowda}, 30265 title = {Applications of Degree Theory to Linear Complementarity Problems}, 30266 journal = {Mathematics of Operations Research}, 30267 year = {1993}, 30268 volume = {18}, 30269 pages = {868--879} 30270} 30271 30272@Article{ grant.woo:clinical, 30273 author = {W. I. Grant and S. Y. Woo}, 30274 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 30275 Delivery}, 30276 journal = {Seminars in Radiation Oncology}, 30277 year = {1999}, 30278 volume = {9}, 30279 pages = {99--107} 30280} 30281 30282@Article{ greenberg.hegerich:branch, 30283 author = {H. Greenberg and R. L. Hegerich}, 30284 title = {A Branch Search Algorithm for the Knapsack Problem}, 30285 journal = {Management Science}, 30286 year = {1970}, 30287 volume = {16}, 30288 pages = {327--332} 30289} 30290 30291@InCollection{ grefenstette:incorporating, 30292 crossref = {davis:genetic}, 30293 author = {J. J. Grefenstette}, 30294 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 30295} 30296 30297@Book{ griewank.corliss:automatic, 30298 editor = {A. Griewank and G. F. Corliss}, 30299 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 30300 publisher = {SIAM}, 30301 year = {1991}, 30302 address = {Philadelphia, Pennsylvania} 30303} 30304 30305@Article{ griewank.juedes.ea:adol-c, 30306 author = {A. Griewank and D. Juedes and J. Utke}, 30307 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 30308 in {C}/{C}++}, 30309 journal = {{ACM} Transactions on Mathematical Software}, 30310 year = {1996}, 30311 volume = {22}, 30312 pages = {131--167} 30313} 30314 30315@Article{ griffith.stewart:nonlinear, 30316 author = {R. E. Griffith and R. A. Stewart}, 30317 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 30318 Systems}, 30319 journal = {Management Science}, 30320 year = {1961}, 30321 volume = {7}, 30322 pages = {379--392} 30323} 30324 30325@Article{ grinold:mathematical, 30326 author = {R. C. Grinold}, 30327 title = {Mathematical Methods for {PA}ttern Classification}, 30328 journal = {Management Science}, 30329 year = {1972}, 30330 volume = {19}, 30331 pages = {272--289} 30332} 30333 30334@Article{ grippo.lampariello.ea:class, 30335 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30336 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 30337 journal = {Numerische Mathematik}, 30338 year = {1991}, 30339 volume = {59}, 30340 pages = {779--805} 30341} 30342 30343@Article{ grippo.lampariello.ea:global, 30344 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30345 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 30346 Without Derivatives}, 30347 journal = {Journal of Optimization Theory and Applications}, 30348 year = {1988}, 30349 volume = {56}, 30350 pages = {385--406} 30351} 30352 30353@Article{ grippo.lampariello.ea:nonmonotone, 30354 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30355 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 30356 journal = {SIAM Journal on Numerical Analysis}, 30357 year = {1986}, 30358 volume = {23}, 30359 pages = {707--716} 30360} 30361 30362@Misc{ grippo:private, 30363 author = {L. Grippo}, 30364 title = {Private Communication}, 30365 year = {1992}, 30366 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 30367} 30368 30369@Article{ grotschel.lovasz.ea:ellipsoid, 30370 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 30371 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 30372 journal = {Combinatorica}, 30373 year = {1981}, 30374 volume = {1}, 30375 pages = {169--197} 30376} 30377 30378@Article{ guignard:generalized, 30379 author = {M. Guignard}, 30380 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 30381 {B}anach Space}, 30382 journal = {SIAM Journal on Control and Optimization}, 30383 year = {1969}, 30384 volume = {7}, 30385 pages = {232--241} 30386} 30387 30388@Article{ guler.ye:convergence, 30389 author = {O. G{\"{u}}ler and Y. Ye}, 30390 title = {Convergence Behavior of Interior--Point Algorithms}, 30391 journal = {Mathematical Programming}, 30392 year = {1993}, 30393 volume = {60}, 30394 pages = {215--228} 30395} 30396 30397@Article{ guler:existence, 30398 author = {O. G{\"{u}}ler}, 30399 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 30400 Complementarity Problems}, 30401 journal = {Mathematics of Operations Research}, 30402 year = {1993}, 30403 volume = {18}, 30404 pages = {128--147} 30405} 30406 30407@Article{ guler:generalized, 30408 author = {O. G{\"{u}}ler}, 30409 title = {Generalized Linear Complementarity Problems}, 30410 journal = {Mathematics of Operations Research}, 30411 year = {1995}, 30412 volume = {20}, 30413 pages = {441--448} 30414} 30415 30416@Article{ gupta.sen:minimizing, 30417 author = {S. Gupta and T. Sen}, 30418 title = {Minimizing the Range of Lateness on a Single Machine}, 30419 journal = {Journal of the Operational Research Society}, 30420 year = {1984}, 30421 volume = {35}, 30422 pages = {853--857} 30423} 30424 30425@InCollection{ gustafson:numerical, 30426 author = {S.-\AA. Gustafson}, 30427 title = {On Numerical Analysis in Semi-Infinite Programming}, 30428 booktitle = {Semi-Infinite Programming}, 30429 year = {1979}, 30430 editor = {R. Hettich}, 30431 publisher = {Springer-Verlag}, 30432 address = {Berlin} 30433} 30434 30435@Article{ gustafsson.lind.ea:simultaneous, 30436 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 30437 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 30438 or compensation filters using a generalized pencil beam algorithm}, 30439 journal = {Medical Physics}, 30440 year = {1995}, 30441 volume = {22}, 30442 number = {7}, 30443 pages = {1141--1156} 30444} 30445 30446@PhDThesis{ ha:decomposition, 30447 author = {C. D. Ha}, 30448 title = {Decomposition Methods for Structured Convex Programming}, 30449 year = {1980}, 30450 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30451} 30452 30453@TechReport{ haakonsen.mathiesen:toward, 30454 author = {L. Haakonsen and L. Mathiesen}, 30455 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 30456 institution = {NHH, Bergen}, 30457 year = {1995}, 30458 type = {Discussion Paper}, 30459 number = {3/95} 30460} 30461 30462@Article{ haaland.norman.ea:vemod, 30463 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 30464 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 30465 journal = {Scandinavian Journal of Economics}, 30466 year = {1987} 30467} 30468 30469@Article{ haarhoff.buys:method, 30470 author = {P. C. Haarhoff and J. D. Buys}, 30471 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 30472 Constraints}, 30473 journal = {Computer Journal}, 30474 year = {1970}, 30475 volume = {12}, 30476 pages = {178--184} 30477} 30478 30479@Article{ habetler.kostreva:direct, 30480 author = {G. J. Habetler and M. M. Kostreva}, 30481 title = {On a direct algorithm for nonlinear complementarity problems}, 30482 journal = {SIAM Journal on Control and Optimization}, 30483 volume = {16}, 30484 year = {1978}, 30485 pages = {504--511} 30486} 30487 30488@Book{ hadamard:cauchys, 30489 author = {J. Hadamard}, 30490 title = {Cauchy's Problem in Linear Partial Differential Equations}, 30491 year = {1923}, 30492 publisher = {Yale University Press} 30493} 30494 30495@Article{ haddock.mittenthal:simulation, 30496 author = {J. Haddock and J. Mittenthal}, 30497 title = {Simulation optimization using simulated annealing}, 30498 journal = {Comput. Ind. Eng.}, 30499 year = {1992}, 30500 volume = {22}, 30501 pages = {387--395} 30502} 30503 30504@TechReport{ hamala:general, 30505 author = {M. Hamala}, 30506 title = {A General Approach to Interior Point Methods with Linear Parameter for 30507 Mathematical Programming}, 30508 institution = {Royal Institute of Technology}, 30509 year = {1978}, 30510 number = {1978--20}, 30511 type = {Department of Mathematics Paper TRITA--MAT} 30512} 30513 30514@Article{ han.mangasarian:dual, 30515 author = {S.--P. Han and O. L. Mangasarian}, 30516 title = {A Dual Differentiable Exact Penalty Function}, 30517 journal = {Mathematical Programming}, 30518 year = {1983}, 30519 volume = {25}, 30520 pages = {293--301} 30521} 30522 30523@Article{ han.mangasarian:exact, 30524 author = {S.--P. Han and O. L. Mangasarian}, 30525 title = {Exact Penalty Functions in Nonlinear Programming}, 30526 journal = {Mathematical Programming}, 30527 year = {1979}, 30528 volume = {17}, 30529 pages = {251--269} 30530} 30531 30532@Article{ han.pang.ea:globally, 30533 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 30534 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 30535 journal = {Mathematics of Operations Research}, 30536 year = {1992}, 30537 volume = {17}, 30538 pages = {586--607} 30539} 30540 30541@Article{ han:decomposition, 30542 author = {S.--P. Han}, 30543 title = {A Decomposition Method and its Application to Convex Programming}, 30544 journal = {Mathematics of Operations Research}, 30545 year = {1989}, 30546 volume = {14}, 30547 pages = {237--248} 30548} 30549 30550@Article{ han:globally, 30551 author = {S.--P. Han}, 30552 title = {A Globally Convergent Method for Nonlinear Programming}, 30553 journal = {Journal of Optimization Theory and Applications}, 30554 year = {1977}, 30555 volume = {22}, 30556 pages = {297--309} 30557} 30558 30559@Article{ han:superlinearly, 30560 author = {S.--P. Han}, 30561 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 30562 Programming Problems}, 30563 journal = {Mathematical Programming}, 30564 year = {1976}, 30565 volume = {11}, 30566 pages = {263--282} 30567} 30568 30569@Article{ hansen.koopmans:definition, 30570 author = {T. Hansen and T. C. Koopmans}, 30571 title = {On the Definition and Computation of a Capital Stock Invariant Under 30572 Optimization}, 30573 journal = {Journal of Economic Theory}, 30574 year = {1972}, 30575 volume = {5}, 30576 pages = {487--523} 30577} 30578 30579@InCollection{ harker.pang:damped, 30580 author = {P. T. Harker and J. S. Pang}, 30581 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 30582 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 30583 publisher = {AMS}, 30584 year = {1990}, 30585 editor = {E. L. Allgower and K. Georg}, 30586 number = {26}, 30587 series = {Lectures on Applied Mathematics}, 30588 address = {Providence, Rhode Island}, 30589 pages = {265--284} 30590} 30591 30592@Article{ harker.pang:existence, 30593 author = {P. T. Harker and J. S. Pang}, 30594 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 30595 Constraints}, 30596 journal = {Operations Research Letters}, 30597 year = {1988}, 30598 volume = {7}, 30599 pages = {61--64} 30600} 30601 30602@Article{ harker.pang:finite-dimensional, 30603 author = {P. T. Harker and J. S. Pang}, 30604 title = {Finite--dimensional variational inequality and nonlinear complementarity 30605 problems: {A} survey of theory, algorithms and applications}, 30606 journal = {Mathematical Programming}, 30607 year = {1990}, 30608 volume = {48}, 30609 pages = {161--220} 30610} 30611 30612@Article{ harker.xiao:newtons, 30613 author = {P. T. Harker and B. Xiao}, 30614 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 30615 {B}--Differentiable Equation Approach}, 30616 journal = {Mathematical Programming}, 30617 year = {1990}, 30618 volume = {48}, 30619 pages = {339--358} 30620} 30621 30622@Article{ harker:accelerating, 30623 author = {P. T. Harker}, 30624 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 30625 Finite--Dimensional Variational Inequalities}, 30626 journal = {Mathematical Programming}, 30627 year = {1988}, 30628 volume = {41}, 30629 pages = {29--50} 30630} 30631 30632@Article{ harker:generalized, 30633 author = {P. T. Harker}, 30634 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 30635 journal = {European Journal of Operations Research}, 30636 volume = {54}, 30637 pages = {81--94}, 30638 year = {1987} 30639} 30640 30641@Book{ harker:lectures, 30642 author = {P. T. Harker}, 30643 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 30644 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 30645 year = {1993}, 30646 series = {CORE Lecture Series} 30647} 30648 30649@Article{ harris:pivot, 30650 author = {P. M. J. Harris}, 30651 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 30652 journal = {Mathematical Programming}, 30653 year = {1973}, 30654 volume = {5}, 30655 pages = {1--28} 30656} 30657 30658@InCollection{ harrison.kristrom:carbon, 30659 author = {G. W. Harrison and B. Kristrom}, 30660 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 30661 booktitle = {Environment and Transport in Economic Modelling}, 30662 publisher = {Kluwer Academic Publishers}, 30663 year = {1997}, 30664 editor = {R. Roson and K. A. Small}, 30665 address = {Amsterdam} 30666} 30667 30668@Article{ harrison.rutherford.ea:increased, 30669 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30670 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 30671 journal = {Journal of Economic Integration}, 30672 year = {1996}, 30673 volume = {11}, 30674 pages = {332--365} 30675} 30676 30677@Article{ harrison.rutherford.ea:liberalizing, 30678 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 30679 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 30680 journal = {Journal of Policy Modeling}, 30681 year = {1995}, 30682 volume = {17} 30683} 30684 30685@Article{ harrison.rutherford.ea:quantifying, 30686 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30687 title = {Quantifying the {U}ruguay Round}, 30688 journal = {Finance and Development}, 30689 year = {1995}, 30690 volume = {32}, 30691 pages = {38--41} 30692} 30693 30694@InProceedings{ harrison.rutherford.ea:quantifying*1, 30695 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30696 title = {Quantifying the {U}ruguay Round}, 30697 year = {1996}, 30698 booktitle = {The {U}ruguay Round and the Developing Economies}, 30699 address = {New York}, 30700 editors = {W. Martin and L. A. Winters}, 30701 publisher = {Cambridge University Press} 30702} 30703 30704@Article{ harrison.rutherford.ea:quantifying*2, 30705 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30706 title = {Quantifying the {U}ruguay Round}, 30707 journal = {The Economic Journal}, 30708 year = {1997}, 30709 volume = {107}, 30710 pages = {1405--1430} 30711} 30712 30713@Article{ harrison.rutherford.ea:trade, 30714 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30715 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 30716 journal = {The World Bank Economic Review}, 30717 year = {1993}, 30718 volume = {7}, 30719 pages = {191--217} 30720} 30721 30722@Article{ hartman.stampacchia:nonlinear, 30723 author = {P. Hartman and G. Stampacchia}, 30724 title = {On some nonlinear differential-functional equations}, 30725 journal = {Acta Mathematica}, 30726 year = {1966}, 30727 volume = {115}, 30728 pages = {271--310} 30729} 30730 30731@Book{ harvey:forecasting, 30732 author = {Andrew C. Harvey}, 30733 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 30734 publisher = {Cambridge University Press}, 30735 address = {New York, NY}, 30736 year = {1989} 30737} 30738 30739@Article{ haurie.marcotte:relationship, 30740 author = {A. Haurie and P. Marcotte}, 30741 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 30742 journal = {Networks}, 30743 year = {1985}, 30744 volume = {15}, 30745 pages = {295--308} 30746} 30747 30748@Article{ hearn.lawphongpanich.ea:restricted, 30749 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 30750 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 30751 journal = {Mathematical Programming Study}, 30752 year = {1987}, 30753 volume = {31}, 30754 pages = {99--118} 30755} 30756 30757@Article{ hearn:gap, 30758 author = {D. W. Hearn}, 30759 title = {The Gap Function of a Convex Program}, 30760 journal = {Operations Research Letters}, 30761 year = {1982}, 30762 volume = {1}, 30763 pages = {67--71} 30764} 30765 30766@Article{ hedlund.gustavsson:design, 30767 author = {P. Hedlund and A. Gustavsson}, 30768 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 30769 Ability}, 30770 journal = {Analytica Chimica Acta}, 30771 year = {1992}, 30772 volume = {259}, 30773 pages = {243--256} 30774} 30775 30776@Article{ helgason.kennington.ea:parallelization, 30777 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 30778 title = {A Parallelization of the Simplex Method}, 30779 journal = {Annals of Operations Research}, 30780 year = {1988}, 30781 volume = {14}, 30782 pages = {17--40} 30783} 30784 30785@Article{ helgason.kennington.ea:polynomially, 30786 author = {Richard Helgason and James Kennington and H. Lall}, 30787 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 30788 journal = {Mathematical Programming}, 30789 year = {1980}, 30790 volume = {18}, 30791 pages = {338--343} 30792} 30793 30794@Book{ henderson.quandt:microeconomic, 30795 author = {J. M. Henderson and R. E. Quandt}, 30796 title = {Microeconomic Theory}, 30797 publisher = {McGraw--Hill}, 30798 address = {New York}, 30799 year = {1980}, 30800 edition = {Third} 30801} 30802 30803@TechReport{ hendrickson.leland:chaco, 30804 author = {B. Hendrickson and R. Leland}, 30805 title = {The {C}haco User's Guide: Version 2}, 30806 institution = {Sandia National Laboratories}, 30807 type = {Technical Report}, 30808 number = {SAND94-2692}, 30809 address = {Albuquerque, New Mexico}, 30810 year = {1994} 30811} 30812 30813@InProceedings{ hendrickson.leland:multilevel, 30814 author = {B. Hendrickson and R. Leland}, 30815 title = {A Multilevel Algorithm for Partitioning Graphs}, 30816 booktitle = {Proceedings of Supercomputing '95}, 30817 year = {1995} 30818} 30819 30820@Book{ hertz.krogh.ea:introduction, 30821 author = {J. Hertz and A. Krogh and R. G. Palmer}, 30822 title = {Introduction to the Theory of Neural Computation}, 30823 year = {1991}, 30824 publisher = {Addison-Wesley}, 30825 address = {Redwood City, California} 30826} 30827 30828@Article{ hertz.werra:tabu, 30829 author = {A. Hertz and D. de Werra}, 30830 title = {Using {T}abu Search techniques for Graph Coloring}, 30831 journal = {Computing}, 30832 year = {1987}, 30833 volume = {29}, 30834 pages = {345--351} 30835} 30836 30837@InCollection{ hettich:review, 30838 author = {R. Hettich}, 30839 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 30840 booktitle = {Semi-Infinite Programming and Applications}, 30841 year = {1983}, 30842 editor = {A. V. Fiacco and K. O. Kortanek}, 30843 publisher = {Springer-Verlag}, 30844 address = {Berlin} 30845} 30846 30847@Article{ highleyman:note, 30848 author = {W. H. Highleyman}, 30849 title = {A Note on Linear Separation}, 30850 journal = {IRE Transactions on Electronic Computers}, 30851 year = {1961}, 30852 volume = {10}, 30853 pages = {777--778} 30854} 30855 30856@Article{ hildreth:quadratic, 30857 author = {C. Hildreth}, 30858 title = {A Quadratic Programming Procedure}, 30859 journal = {Naval Research Logistics Quarterly}, 30860 year = {1957}, 30861 volume = {4}, 30862 pages = {79--85}, 30863 note = {Erratum, p. 361} 30864} 30865 30866@Book{ himmelblau:applied, 30867 author = {D. M. Himmelblau}, 30868 title = {Applied Nonlinear Programming}, 30869 year = {1972}, 30870 publisher = {McGraw--Hill}, 30871 address = {New York} 30872} 30873 30874@Book{ hiriart-urruty.lemarechal:convex, 30875 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 30876 title = {Convex Analysis and Minimization Algorithms {I}}, 30877 year = {1993}, 30878 publisher = {Springer Verlag}, 30879 address = {Berlin}, 30880 volume = {305}, 30881 series = {Grundlehren der mathematischen Wissenschaften} 30882} 30883 30884@TechReport{ hironaka:introduction, 30885 author = {H. Hironaka}, 30886 title = {Introduction to real-analytic sets and real-analytic maps}, 30887 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 30888 year = {1973}, 30889 type = {Technical Report}, 30890 address = {Pisa, Italy} 30891} 30892 30893@Article{ ho.lee.ea:decomposition, 30894 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 30895 title = {Decomposition of Linear Programs Using Parallel Computation}, 30896 journal = {Mathematical Programming}, 30897 year = {1988}, 30898 volume = {42}, 30899 pages = {391--405} 30900} 30901 30902@Article{ ho.loute:computational, 30903 author = {J. K. Ho and E. Loute}, 30904 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 30905 for Linear Programming}, 30906 journal = {Mathematical Programming}, 30907 year = {1983}, 30908 volume = {27}, 30909 pages = {283--290} 30910} 30911 30912@Book{ hock.schittkowski:test, 30913 author = {W. Hock and K. Schittkowski}, 30914 title = {Test Examples for Nonlinear Programming Codes}, 30915 volume = {187}, 30916 series = {Lecture Notes in Economics and Mathematical Systems}, 30917 year = {1981}, 30918 publisher = {Springer Verlag}, 30919 address = {Berlin, Germany} 30920} 30921 30922@Book{ hockney.jesshope:parallel, 30923 author = {R. W. Hockney and C. R. Jesshope}, 30924 title = {Parallel Computers 2}, 30925 publisher = {Adam Hilger}, 30926 year = {1988}, 30927 address = {Bristol} 30928} 30929 30930@Article{ hoffman:approximate, 30931 author = {A. J. Hoffman}, 30932 title = {On Approximate Solutions of Systems of Linear Inequalities}, 30933 journal = {Journal of Research of the National Bureau of Standards}, 30934 year = {1952}, 30935 volume = {49}, 30936 pages = {263--265} 30937} 30938 30939@Article{ hogan:comments, 30940 author = {W. W. Hogan}, 30941 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 30942 for the {USA}}, 30943 journal = {The Energy Journal}, 30944 year = {1990}, 30945 volume = {11}, 30946 pages = {75--84} 30947} 30948 30949@Article{ hogan:energy, 30950 author = {W. W. Hogan}, 30951 title = {Energy Policy Models for {P}roject {I}ndependence}, 30952 journal = {Computers \& Operations Research}, 30953 year = {1975}, 30954 volume = {2}, 30955 pages = {251--271} 30956} 30957 30958@Book{ holland:adaptation, 30959 author = {J. Holland}, 30960 title = {Adaptation in Natural and Artificial Systems}, 30961 year = {1975}, 30962 publisher = {The University of Michigan Press}, 30963 address = {Ann Arbor, Michigan} 30964} 30965 30966@Article{ holmes.mackie:comparison, 30967 author = {T. Holmes and T. R. Mackie}, 30968 title = {A comparison of three inverse treatment planning algorithms}, 30969 journal = {Physics in Medicine and Biology}, 30970 year = {1994}, 30971 volume = {39}, 30972 number = {1}, 30973 pages = {91--106} 30974} 30975 30976@Article{ holmes.mackie:filtered, 30977 author = {T. Holmes and T. R. Mackie}, 30978 title = {A filtered backprojection dose calculation method for inverse treatment 30979 planning}, 30980 journal = {Medical Physics}, 30981 year = {1994}, 30982 volume = {21}, 30983 number = {2}, 30984 pages = {303--313} 30985} 30986 30987@Article{ hooke.jeeves:direct, 30988 author = {R. Hooke and T. A. Jeeves}, 30989 title = {Direct Search Solution of Numerical and Statistical Problems}, 30990 journal = {Journal of Associated Computing Machinery}, 30991 year = {1961}, 30992 volume = {8}, 30993 pages = {212--229} 30994} 30995 30996@Article{ hoppe.mittelmann:multi-grid, 30997 author = {R. H. W. Hoppe and H. D. Mittelmann}, 30998 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 30999 Inequalities}, 31000 journal = {Journal of Computational and Applied Mathematics}, 31001 year = {1989}, 31002 volume = {26}, 31003 pages = {35--46} 31004} 31005 31006@Book{ horn.johnson:matrix, 31007 author = {R. A. Horn and C. R. Johnson}, 31008 title = {Matrix Anaysis}, 31009 publisher = {Cambridge University Press}, 31010 year = {1985}, 31011 address = {Cambridge, England} 31012} 31013 31014@Article{ hornik.stinchcombe.ea:multilayer, 31015 author = {K. Hornik and M. Stinchcombe and H. White}, 31016 title = {Multilayer Feedforward Networks are Universal Approximators}, 31017 journal = {Neural Networks}, 31018 year = {1989}, 31019 volume = {2}, 31020 pages = {359--366} 31021} 31022 31023@Article{ horowitz.sahni:computing, 31024 author = {E. Horowitz and S. Sahni}, 31025 title = {Computing Partitions with Applications to the Knapsack Problem}, 31026 journal = {jacm}, 31027 year = {1974}, 31028 volume = {21}, 31029 pages = {277--292} 31030} 31031 31032@Article{ hristov.fallone:continuous, 31033 author = {D. H. Hristov and B. G. Fallone}, 31034 title = {A continuous penalty function method for inverse treatment planning}, 31035 journal = {Medical Physics}, 31036 year = {1998}, 31037 volume = {25}, 31038 number = {2}, 31039 pages = {208--223} 31040} 31041 31042@Article{ hu.cheng.ea:numerical, 31043 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 31044 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 31045 analysis}, 31046 journal = {Transactions of the {ASME}}, 31047 volume = {116}, 31048 year = {1994}, 31049 pages = {470--478} 31050} 31051 31052@InProceedings{ hua.sheu:skyscraper, 31053 author = {K. A. Hua and S. Sheu}, 31054 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 31055 Video-On-Demand Systems}, 31056 year = {1997}, 31057 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 31058 address = {Cannes, France}, 31059 pages = {89--100} 31060} 31061 31062@Article{ huang.pang:option, 31063 author = {J. Huang and J. S. Pang}, 31064 title = {Option Pricing and Linear Complementarity}, 31065 journal = {Journal of Computational Finance}, 31066 volume = {2}, 31067 year = {1998}, 31068 pages = {31--60} 31069} 31070 31071@InCollection{ huard:resolution, 31072 author = {P. Huard}, 31073 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 31074 of Centers}, 31075 booktitle = {Nonlinear Programming}, 31076 year = {1967}, 31077 editor = {J. Abadie}, 31078 publisher = {North--Holland}, 31079 address = {Amsterdam}, 31080 pages = {207--219} 31081} 31082 31083@Book{ huber:robust, 31084 author = {P. J. Huber}, 31085 title = {Robust Statistics}, 31086 year = {1981}, 31087 publisher = {John Wiley}, 31088 address = {New York} 31089} 31090 31091@Book{ hudson:piecewise, 31092 author = {J. F. P. Hudson}, 31093 title = {Piecewise Linear Topology}, 31094 publisher = {Benjamin}, 31095 address = {New York}, 31096 year = {1969} 31097} 31098 31099@InCollection{ hunter.markusen.ea:north, 31100 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 31101 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 31102 booktitle = {Modeling North American Economic Integration}, 31103 publisher = {Kluwer Academic Publishers}, 31104 year = {1995}, 31105 editor = {T. Kehoe and P. Kehoe}, 31106 pages = {117--130} 31107} 31108 31109@Article{ ibarra.kim:fast, 31110 author = {O. H. Ibarra and C. E. Kim}, 31111 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 31112 journal = {jacm}, 31113 year = {1975}, 31114 volume = {22}, 31115 pages = {463--468} 31116} 31117 31118@Article{ ijiri:fundamental, 31119 author = {Y. Ijiri}, 31120 title = {Fundamental Queries in Aggregation Theory}, 31121 journal = {Journal of the American Statistical Association}, 31122 year = {1971}, 31123 volume = {66}, 31124 pages = {766--782} 31125} 31126 31127@Article{ ingargiola.korsh:reduction, 31128 author = {G. P. Ingargiola and J. F. Korsh}, 31129 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 31130 journal = {Management Science}, 31131 year = {1973}, 31132 volume = {20}, 31133 pages = {460--463} 31134} 31135 31136@Article{ ioffe:variational, 31137 author = {A. D. Ioffe}, 31138 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 31139 Second--Order Directional Derivative}, 31140 journal = {Journal of Mathematical Analysis and its Applications}, 31141 year = {1993} 31142} 31143 31144@Article{ iri.imai:multiplicative, 31145 author = {M. Iri and H. Imai}, 31146 title = {A Multiplicative Barrier Function Method for Linear Programming}, 31147 journal = {Algorithmica}, 31148 year = {1986}, 31149 volume = {1}, 31150 pages = {455--482} 31151} 31152 31153@Article{ isac.goeleven:implicit, 31154 author = {G. Isac and D. Goeleven}, 31155 title = {The Implicit General Order Complementarity Problem, Models and Iterative 31156 Methods}, 31157 journal = {Annals of Operations Research}, 31158 year = {1993} 31159} 31160 31161@Article{ isac.kostreva:generalized, 31162 author = {G. Isac and M. M. Kostreva}, 31163 title = {The Generalized Order Complementarity Problem}, 31164 journal = {Journal of Optimization Theory and Applications}, 31165 volume = {19}, 31166 pages = {227--232}, 31167 year = {1991} 31168} 31169 31170@Book{ isac:complementarity, 31171 author = {G. Isac}, 31172 title = {Complementarity Problems}, 31173 publisher = {Springer-Verlag}, 31174 year = {1992}, 31175 series = {Lecture Notes in Mathematics}, 31176 address = {New York} 31177} 31178 31179@Article{ iusem.svaiter:variant, 31180 author = {A. N. Iusem and B. F. Svaiter}, 31181 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 31182 Search Strategy}, 31183 journal = {Optimization}, 31184 year = {1997}, 31185 volume = {42}, 31186 pages = {309--321} 31187} 31188 31189@Article{ iusem:convergence, 31190 author = {A. N. Iusem}, 31191 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 31192 Problems}, 31193 journal = {Mathematical Programming}, 31194 year = {1993}, 31195 volume = {59}, 31196 pages = {33--48} 31197} 31198 31199@Article{ jackson.kutcher.ea:probability, 31200 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 31201 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 31202 Architecture subject to Non-Uniform Irradiation}, 31203 journal = {Medical Physics}, 31204 year = {1993}, 31205 volume = {20}, 31206 pages = {613--625} 31207} 31208 31209@Article{ jackson:optimization, 31210 author = {A. Jackson and X. H. Wang and R. Mohan}, 31211 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 31212 (abstract)}, 31213 journal = {Medical Physics}, 31214 year = {1994}, 31215 volume = {21}, 31216 pages = {1006} 31217} 31218 31219@TechReport{ jackson:scheduling, 31220 author = {J. R. Jackson}, 31221 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 31222 institution = {University of California}, 31223 year = {1955}, 31224 address = {Los Angeles}, 31225 number = {43}, 31226 type = {Research Report} 31227} 31228 31229@Article{ jansen.roos.ea:polynomiality, 31230 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 31231 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 31232 Complementarity Problems}, 31233 journal = {Mathematical Programming}, 31234 volume = {78}, 31235 pages = {315--346}, 31236 year = {1997} 31237} 31238 31239@Article{ jiang.fukushima.ea:trust, 31240 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 31241 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 31242 journal = {SIAM Journal on Optimization}, 31243 volume = {8}, 31244 pages = {140--157}, 31245 year = {1998} 31246} 31247 31248@Article{ jiang.qi:nonsmooth, 31249 author = {H. Jiang and L. Qi}, 31250 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 31251 journal = {SIAM Journal on Control and Optimization}, 31252 volume = {35}, 31253 pages = {178--193}, 31254 year = {1997} 31255} 31256 31257@TechReport{ jiang.ralph:qpecgen, 31258 author = {H. Jiang and D. Ralph}, 31259 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 31260 Objectives and Affine Variational Inequality Constraints}, 31261 year = {1997}, 31262 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31263 address = {Australia} 31264} 31265 31266@TechReport{ jiang.ralph:smooth, 31267 author = {H. Jiang and D. Ralph}, 31268 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 31269 Constraints}, 31270 year = {1997}, 31271 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31272 address = {Australia} 31273} 31274 31275@Article{ jiang:unconstrained, 31276 author = {H. Jiang}, 31277 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 31278 journal = {Journal of Global Optimization, forthcoming}, 31279 year = {1997} 31280} 31281 31282@Article{ jittorntrum.osborne:strong, 31283 author = {K. Jittorntrum and M. R. Osborne}, 31284 title = {Strong uniqueness and second order convergence in nonlinear discrete 31285 approximation}, 31286 journal = {Numerische Mathematik}, 31287 year = {1980}, 31288 volume = {34}, 31289 pages = {439--455} 31290} 31291 31292@InProceedings{ jog.suh.ea:effects, 31293 crossref = {schaeffer:third}, 31294 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31295 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 31296 Genetic Algorithm for the Travelling Salesman Problem}, 31297 pages = {110--115} 31298} 31299 31300@Article{ jog.suh.ea:parallel, 31301 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31302 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 31303 journal = {SIAM Journal on Optimization}, 31304 year = {1991}, 31305 volume = {1} 31306} 31307 31308@Article{ johansson.klarbring:rigid, 31309 author = {L. Johansson and A. Klarbring}, 31310 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 31311 Complementarity}, 31312 journal = {Mechanics of Structures \& Machines}, 31313 volume = {20}, 31314 pages = {293--319}, 31315 year = {1992} 31316} 31317 31318@Article{ johnson.aragon.ea:optimization, 31319 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 31320 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 31321 Partitioning}, 31322 journal = {Operations Research}, 31323 year = {1989}, 31324 volume = {37}, 31325 pages = {865--892} 31326} 31327 31328@Article{ johnson:optimally, 31329 author = {R. Johnson}, 31330 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 31331 journal = {Management Science}, 31332 year = {1988}, 31333 volume = {34}, 31334 pages = {240--253} 31335} 31336 31337@Article{ johnsson:solving, 31338 author = {S. L. Johnsson}, 31339 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 31340 journal = {SIAM Journal on Scientific and Statistical Computing}, 31341 year = {1987}, 31342 volume = {8}, 31343 pages = {475--489} 31344} 31345 31346@Article{ jorgenson.wilcoxen:reducing, 31347 author = {D. W. Jorgenson and P. J. Wilcoxen}, 31348 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 31349 journal = {Resource and Energy Economics}, 31350 year = {1993}, 31351 volume = {15}, 31352 pages = {7--25} 31353} 31354 31355@TechReport{ josephy:hogans, 31356 author = {N. H. Josephy}, 31357 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 31358 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31359 year = {1979}, 31360 address = {Madison, Wisconsin}, 31361 number = {1972}, 31362 type = {Technical Summary Report} 31363} 31364 31365@TechReport{ josephy:newton, 31366 author = {N. H. Josephy}, 31367 title = {A {N}ewton Method for the {PIES} Energy Model}, 31368 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31369 year = {1979}, 31370 address = {Madison, Wisconsin}, 31371 number = {1971}, 31372 type = {Technical Summary Report} 31373} 31374 31375@PhDThesis{ josephy:newtons, 31376 author = {N. H. Josephy}, 31377 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 31378 year = {1979}, 31379 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 31380} 31381 31382@TechReport{ josephy:newtons*1, 31383 author = {N. H. Josephy}, 31384 title = {{N}ewton's Method for Generalized Equations}, 31385 institution = {Mathematics Research Center, University of Wisconsin}, 31386 year = {1979}, 31387 address = {Madison, Wisconsin}, 31388 number = {1965}, 31389 type = {Technical Summary Report} 31390} 31391 31392@TechReport{ josephy:quasi-newton, 31393 author = {N. H. Josephy}, 31394 title = {Quasi--{N}ewton Methods for Generalized Equations}, 31395 institution = {Mathematics Research Center, University of Wisconsin}, 31396 year = {1979}, 31397 address = {Madison, Wisconsin}, 31398 number = {1966}, 31399 type = {Technical Summary Report} 31400} 31401 31402@PhDThesis{ kabbadj:methodes, 31403 author = {S. Kabbadj}, 31404 title = {Methodes Proximales Entropiques}, 31405 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 31406 year = {1994}, 31407 type = {Doctoral Thesis} 31408} 31409 31410@Book{ kall.wallace:stochastic, 31411 author = {P. Kall and S. W. Wallace}, 31412 title = {Stochastic Programming}, 31413 publisher = {John Wiley \& Sons}, 31414 year = {1994}, 31415 address = {Chichester} 31416} 31417 31418@Article{ kallman.agren.ea:tumor, 31419 author = {P. Kallman and A. Agren and A. Brahme}, 31420 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 31421 journal = {International Journal of Radiation Biology}, 31422 year = {1992}, 31423 volume = {62}, 31424 pages = {249--262} 31425} 31426 31427@Misc{ kalvelagen:gams, 31428 author = {Erwin Kalvelagen}, 31429 title = {The {GAMS} {I/O} Library}, 31430 howpublished = {mimeo, GAMS Development Corporation}, 31431 year = {1992}, 31432 note = {Preliminary Version} 31433} 31434 31435@Article{ kaneko:complete, 31436 author = {I. Kaneko}, 31437 title = {Complete solution of a class of elastic-plastic structures}, 31438 journal = {Computer Methods in Applied Mechanics and Engineering}, 31439 volume = {21}, 31440 year = {1980}, 31441 pages = {193--209} 31442} 31443 31444@Article{ kaneko:mathematical, 31445 author = {I. Kaneko}, 31446 title = {A mathematical programming method for the inelastic analysis of reinforced 31447 concrete frames}, 31448 journal = {International Journal for Numerical Methods in Engineering}, 31449 volume = {11}, 31450 year = {1977}, 31451 pages = {1137--1154} 31452} 31453 31454@Article{ kaneko:piecewise, 31455 author = {I. Kaneko}, 31456 title = {Piecewise linear elastic-plastic analysis}, 31457 journal = {International Journal for Numerical Methods in Engineering}, 31458 volume = {14}, 31459 year = {1979}, 31460 pages = {757--767} 31461} 31462 31463@Article{ kanet:minimizing, 31464 author = {J. J. Kanet}, 31465 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 31466 Date}, 31467 journal = {Naval Research Logistics Quarterly}, 31468 year = {1981}, 31469 volume = {28}, 31470 pages = {643--651} 31471} 31472 31473@Article{ kantorovich:mathematical, 31474 author = {L. V. Kantorovich}, 31475 title = {Mathematical Methods in the Organization and Planning of Production}, 31476 journal = {Management Science}, 31477 year = {1960}, 31478 volume = {6}, 31479 pages = {366--422}, 31480 note = {English translation, Russian version 1939} 31481} 31482 31483@Article{ kanzow.fukushima:equivalence, 31484 author = {C. Kanzow and M. Fukushima}, 31485 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 31486 Unconstrained Minimization}, 31487 journal = {Journal of Optimization Theory and Applications}, 31488 year = {1996}, 31489 volume = {90}, 31490 pages = {581--603} 31491} 31492 31493@Article{ kanzow.fukushima:theoretical, 31494 author = {C. Kanzow and M. Fukushima}, 31495 title = {Theoretical and Numerical Investigation of the {D}-gap function for 31496 Box-Constrained Variational Inequalities}, 31497 journal = {Mathematical Programming}, 31498 year = {1998}, 31499 volume = {83}, 31500 pages = {55--88} 31501} 31502 31503@Article{ kanzow.jiang:continuation, 31504 author = {C. Kanzow and H. Jiang}, 31505 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 31506 journal = {Mathematical Programming}, 31507 year = {1998}, 31508 volume = {81}, 31509 pages = {103--125} 31510} 31511 31512@Article{ kanzow.kleinmichel:class, 31513 author = {C. Kanzow and H. Kleinmichel}, 31514 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 31515 Optimization}, 31516 journal = {Optimization Methods and Software}, 31517 year = {1995}, 31518 volume = {5}, 31519 pages = {173--198} 31520} 31521 31522@Article{ kanzow.kleinmichel:new, 31523 author = {C. Kanzow and H. Kleinmichel}, 31524 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 31525 Problems}, 31526 journal = {Computational Optimization and Applications}, 31527 volume = {11}, 31528 pages = {227--251}, 31529 year = {1998} 31530} 31531 31532@Article{ kanzow.pieper:jacobian, 31533 author = {C. Kanzow and H. Pieper}, 31534 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 31535 journal = {SIAM Journal on Optimization}, 31536 year = {1999}, 31537 volume = {9}, 31538 pages = {342--373} 31539} 31540 31541@Article{ kanzow.qi:qp-free, 31542 author = {C. Kanzow and H. -D. Qi}, 31543 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 31544 problems}, 31545 journal = {Mathematical Programming}, 31546 year = {1999}, 31547 volume = {85}, 31548 pages = {81--106} 31549} 31550 31551@Article{ kanzow.yamashita.ea:ncp-functions, 31552 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 31553 title = {New {NCP}-functions and their properties}, 31554 journal = {Journal of Optimization Theory and Applications}, 31555 year = {1997}, 31556 volume = {94}, 31557 pages = {115--135} 31558} 31559 31560@TechReport{ kanzow.zupke:inexact, 31561 author = {C. Kanzow and M. Zupke}, 31562 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 31563 year = {1997}, 31564 institution = {Institute of Applied Mathematics, University of Hamburg}, 31565 type = {Preprint}, 31566 number = {127}, 31567 address = {Hamburg, Germany} 31568} 31569 31570@Article{ kanzow:approach, 31571 author = {C. Kanzow}, 31572 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 31573 {P}-Functions}, 31574 journal = {Operations Research Letters}, 31575 volume = {20}, 31576 year = {1997}, 31577 pages = {85--92} 31578} 31579 31580@Article{ kanzow:equation-based, 31581 author = {C. Kanzow}, 31582 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 31583 journal = {Optimization Methods and Software}, 31584 year = {1994}, 31585 volume = {3}, 31586 pages = {327--340} 31587} 31588 31589@Article{ kanzow:global, 31590 author = {C. Kanzow}, 31591 title = {Global Convergence Properties of Some Iterative Methods for Linear 31592 Complementarity Problems}, 31593 journal = {SIAM Journal on Optimization}, 31594 year = {1996}, 31595 volume = {6}, 31596 pages = {326--341} 31597} 31598 31599@Article{ kanzow:inexact, 31600 author = {C. Kanzow}, 31601 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 31602 journal = {Numerische Mathematik, forthcoming}, 31603 year = {1999} 31604} 31605 31606@Article{ kanzow:noninterior, 31607 author = {C. Kanzow}, 31608 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 31609 journal = {SIAM Journal on Matrix Analysis and Applications}, 31610 volume = {17}, 31611 pages = {851--868}, 31612 year = {1996} 31613} 31614 31615@Article{ kanzow:nonlinear, 31616 author = {C. Kanzow}, 31617 title = {Nonlinear Complementarity as Unconstrained Optimization}, 31618 journal = {Journal of Optimization Theory and Applications}, 31619 year = {1996}, 31620 volume = {88}, 31621 pages = {139--155} 31622} 31623 31624@TechReport{ kanzow:semismooth, 31625 author = {C. Kanzow}, 31626 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 31627 Problems}, 31628 institution = {Institute of Applied Mathematics, University of Hamburg}, 31629 year = {1997}, 31630 type = {Preprint}, 31631 address = {Hamburg, Germany} 31632} 31633 31634@TechReport{ kanzow:tools, 31635 annote = {This should be replaced by kanzow:noninterior}, 31636 author = {C. Kanzow}, 31637 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 31638 institution = {Institute of Applied Mathematics, University of Hamburg}, 31639 year = {1994}, 31640 address = {Germany} 31641} 31642 31643@Article{ kaplan.meier:nonparametric, 31644 author = {E. L. Kaplan and P. Meier}, 31645 title = {Nonparametric Estimation from Incomplete Observations}, 31646 journal = {J. Am. Stat. Assoc.}, 31647 year = {1958}, 31648 volume = {53}, 31649 pages = {457--481} 31650} 31651 31652@Article{ karamardian:complementarity, 31653 author = {S. Karamardian}, 31654 title = {The Complementarity Problem}, 31655 journal = {Mathematical Programming}, 31656 year = {1972}, 31657 volume = {2}, 31658 pages = {107--129} 31659} 31660 31661@Article{ karamardian:complementarity*1, 31662 author = {S. Karamardian}, 31663 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 31664 journal = {Journal of Optimization Theory and Applications}, 31665 year = {1976}, 31666 volume = {18}, 31667 pages = {445--454} 31668} 31669 31670@Article{ karamardian:generalized, 31671 author = {S. Karamardian}, 31672 title = {Generalized Complementarity Problem}, 31673 journal = {Journal of Optimization Theory and Applications}, 31674 year = {1971}, 31675 volume = {8}, 31676 pages = {161--167} 31677} 31678 31679@Article{ karmarkar.karp.ea:probabilistic, 31680 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 31681 title = {Probabilistic Analysis of Optimum Partitioning}, 31682 journal = {Journal of Applied Probability}, 31683 year = {1986}, 31684 volume = {23}, 31685 pages = {626--645} 31686} 31687 31688@Article{ karmarkar:polynomial, 31689 author = {N. Karmarkar}, 31690 title = {A New Polynomial Time Algorithm for Linear Programming}, 31691 journal = {Combinatorica}, 31692 year = {1984}, 31693 volume = {4}, 31694 pages = {373--395} 31695} 31696 31697@Unpublished{ karp:probabilistic, 31698 author = {R. M. Karp}, 31699 title = {Probabilistic Analysis of Algorithms}, 31700 note = {(Lecture Notes)} 31701} 31702 31703@InCollection{ karp:reducibility, 31704 author = {R. M. Karp}, 31705 title = {Reducibility among Combinatorial Problems}, 31706 booktitle = {Complexity of Computer Computations}, 31707 year = {1972}, 31708 editor = {R. E. Miller and J. W. Thatcher}, 31709 publisher = {Plenum Press}, 31710 address = {New York}, 31711 pages = {85--103} 31712} 31713 31714@MastersThesis{ karush:minima, 31715 author = {W. Karush}, 31716 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 31717 year = {1939}, 31718 school = {Department of Mathematics, University of Chicago} 31719} 31720 31721@TechReport{ karypis.kumar:metis, 31722 author = {G. Karypis and V. Kumar}, 31723 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 31724 Version 2.0}, 31725 institution = {University of Minnesota, Department of Computer Science}, 31726 type = {Technical Report}, 31727 address = {Minnesota}, 31728 year = {1995} 31729} 31730 31731@TechReport{ karypis.kumar:multilevel, 31732 author = {G. Karypis and V. Kumar}, 31733 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 31734 institution = {University of Minnesota, Department of Computer Science}, 31735 type = {Technical Report}, 31736 number = {95-064}, 31737 address = {Minnesota}, 31738 year = {1995} 31739} 31740 31741@Article{ katukani:generalization, 31742 author = {S. Katukani}, 31743 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 31744 journal = {Duke Mathematical Journal}, 31745 year = {1941}, 31746 volume = {8}, 31747 pages = {457--459} 31748} 31749 31750@Article{ keifer.wolfowitz:stochastic, 31751 author = {J. Keifer and J. Wolfowitz}, 31752 title = {Stochastic Estimation of the Maximum of a Regression Function}, 31753 journal = {Annals of Mathematical Statistics}, 31754 year = {1952}, 31755 volume = {23}, 31756 pages = {462--466} 31757} 31758 31759@InCollection{ kellog.li.ea:method, 31760 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 31761 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 31762 booktitle = {Computing Fixed Points with Applications}, 31763 year = {1977}, 31764 editor = {S. Karamardian}, 31765 publisher = {Academic Press}, 31766 pages = {133--147} 31767} 31768 31769@Book{ kennington.helgason:algorithms, 31770 author = {J. L. Kennington and R. V. Helgason}, 31771 title = {Algorithms for Network Programming}, 31772 year = {1980}, 31773 publisher = {John Wiley \& Sons}, 31774 address = {New York} 31775} 31776 31777@Article{ kernighan.lin:efficient, 31778 author = {B. W. Kernighan and S. Lin}, 31779 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 31780 journal = {The Bell System Technical Journal}, 31781 pages = {291--307}, 31782 volume = {29}, 31783 year = {1970} 31784} 31785 31786@Article{ khachian:polynomial, 31787 author = {L. G. Khachian}, 31788 title = {A Polynomial Algorithm for Linear Programming}, 31789 journal = {Soviet Mathematics Doklady}, 31790 year = {1979}, 31791 volume = {20}, 31792 pages = {191--194} 31793} 31794 31795@Article{ khobotov:modification, 31796 author = {E. N. Khobotov}, 31797 title = {A Modification of the Extragradient Method for the Solution of Variational 31798 Inequalities and some Optimization Problems}, 31799 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 31800 year = {1987}, 31801 volume = {27}, 31802 pages = {1462--1473} 31803} 31804 31805@Book{ khuri.cornell:response, 31806 author = {A. I. Khuri and J. A. Cornell}, 31807 title = {Response Surfaces: Designs and Analyses}, 31808 publisher = {Marcel Dekker}, 31809 year = {1987}, 31810 address = {New York} 31811} 31812 31813@Article{ kibardin:decomposition, 31814 author = {V. M. Kibardin}, 31815 title = {Decomposition into Functions in the Minimization Problems}, 31816 journal = {Automation and Remote Control}, 31817 year = {1980}, 31818 volume = {40}, 31819 pages = {1311--1323} 31820} 31821 31822@TechReport{ king:sposl, 31823 author = {A. J. King}, 31824 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 31825 institution = {IBM T.J. Watson Research Center}, 31826 year = {1994}, 31827 number = {RC 19757}, 31828 address = {Yorktown Heights, New York} 31829} 31830 31831@Article{ kirkpatrick.gelatt.ea:optimization, 31832 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 31833 title = {Optimization by Simulated Annealing}, 31834 journal = {Science}, 31835 year = {1983}, 31836 volume = {220}, 31837 pages = {671--680} 31838} 31839 31840@Book{ kiwiel:methods, 31841 author = {K. C. Kiwiel}, 31842 title = {Methods of Descent for Nondifferentiable Optimization}, 31843 year = {1985}, 31844 publisher = {Springer-Verlag}, 31845 address = {Berlin}, 31846 series = {Lecture Notes in Mathematics}, 31847 number = {1133} 31848} 31849 31850@Article{ kiwiel:twice, 31851 author = {K. C. Kiwiel}, 31852 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 31853 journal = {Journal of Optimization Theory and Applications}, 31854 year = {1996}, 31855 volume = {88}, 31856 pages = {233--236} 31857} 31858 31859@Article{ klarbring.bjorkman:mathematical, 31860 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31861 title = {A mathematical programming approach to contact problems with friction and varying 31862 contact surface}, 31863 journal = {Computers \& Structures}, 31864 volume = {30}, 31865 year = {1988}, 31866 pages = {1185--1198} 31867} 31868 31869@Article{ klarbring.bjorkman:solution, 31870 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31871 title = {Solution of large displacement contact problems with friction using {N}ewton's 31872 method for generalized equations}, 31873 journal = {International Journal for Numerical Methods in Engineering}, 31874 volume = {34}, 31875 year = {1992}, 31876 pages = {249--269} 31877} 31878 31879@Article{ klarbring.pang:existence, 31880 author = {A. Klarbring and J. S. Pang}, 31881 title = {Existence of solution to discrete semicoercive frictional contact problems}, 31882 journal = {{SIAM} Journal on Optimization, under review}, 31883 year = {1996} 31884} 31885 31886@Article{ klarbring:discrete, 31887 author = {A. Klarbring}, 31888 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 31889 (Stability, Uniqueness and Variational Principles)}, 31890 journal = {International Journal on Solids and Structures}, 31891 volume = {24}, 31892 pages = {459--479}, 31893 year = {1988} 31894} 31895 31896@TechReport{ klarbring:large, 31897 author = {A. Klarbring}, 31898 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 31899 Discretization}, 31900 number = {LiTH-IKP-R-798}, 31901 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 31902 address = {Link{\"o}ping}, 31903 year = {1994} 31904} 31905 31906@Article{ klarbring:mathematical, 31907 author = {A. Klarbring}, 31908 title = {A mathematical programming approach to three dimensional contact problems with 31909 friction}, 31910 journal = {Computer Methods in Applied Mechanics and Engineering}, 31911 volume = {58}, 31912 year = {1986}, 31913 pages = {175--200} 31914} 31915 31916@InCollection{ klarbring:mathematical*1, 31917 author = {A. Klarbring}, 31918 title = {Mathematical programming and augmented {L}agrangian methods for frictional 31919 contact problems}, 31920 editor = {A. Curnier}, 31921 booktitle = {Proceedings Contact Mechanics International Symposium}, 31922 publisher = {Presse Polytechniques et Universitaires Romandes}, 31923 address = {Lausanne}, 31924 year = {1992}, 31925 pages = {409--422} 31926} 31927 31928@InCollection{ klarbring:mathematical*2, 31929 author = {A. Klarbring}, 31930 title = {Mathematical programming in contact problems}, 31931 editors = {M. H. Aliabadi and C. A. Brebbia}, 31932 booktitle = {Computational Methods for Contact Problems}, 31933 publisher = {Computational Mechanics Publications}, 31934 address = {Southampton}, 31935 year = {1993}, 31936 pages = {233--264} 31937} 31938 31939@Article{ klarbring:quadratic, 31940 author = {A. Klarbring}, 31941 title = {A quadratic program in frictionless contact problems}, 31942 journal = {International Journal of Engineering Science}, 31943 volume = {24}, 31944 pages = {1207--1217}, 31945 year = {1986} 31946} 31947 31948@InCollection{ klee.minty:how, 31949 author = {V. Klee and G. J. Minty}, 31950 title = {How Good is the Simplex Algorithm?}, 31951 booktitle = {Inequalities--III}, 31952 year = {1972}, 31953 publisher = {Academic Press}, 31954 pages = {159--175} 31955} 31956 31957@Article{ kleywegt.shapiro:sample, 31958 author = {A. Kleywegt and A. Shapiro}, 31959 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 31960 journal = {Stochastic Programming E-Print Series}, 31961 year = {1999}, 31962 note = {Available from dochost.rz.hu-berlin.de/speps} 31963} 31964 31965@Book{ knuth:art, 31966 author = {D. E. Knuth}, 31967 title = {The Art of Computer Programming}, 31968 publisher = {Addison-Wesley Longman Inc.}, 31969 address = {Reading, Massachusetts}, 31970 year = {1998}, 31971 edition = {Third}, 31972 volume = {2} 31973} 31974 31975@InProceedings{ kocvara.outrata:nonsmooth, 31976 author = {M. Ko\v{c}vara and J. V. Outrata}, 31977 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 31978 crossref = {ferris.pang:complementarity}, 31979 pages = {148--164} 31980} 31981 31982@Article{ kocvara.outrata:optimization, 31983 author = {M. Ko\v{c}vara and J. V. Outrata}, 31984 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 31985 volume = {15}, 31986 journal = {Numerical Fucntional Analysis and Optimization}, 31987 year = {1994}, 31988 pages = {869--887} 31989} 31990 31991@InCollection{ kocvara.outrata:solution, 31992 author = {M. Ko\v{c}vara and J. V. Outrata}, 31993 title = {On the solution of optimum design problems with variational inequalities}, 31994 editors = {D. Z. Du and L. Qi and R. Womersley}, 31995 booktitle = {Recent Advances in Nonsmooth Optimization}, 31996 publisher = {World Scientific Publishers}, 31997 address = {Singapore}, 31998 year = {1995}, 31999 pages = {172--192} 32000} 32001 32002@Article{ kojima.hirabayashi:homotopy, 32003 author = {M. Kojima and R. Hirabayashi}, 32004 title = {Continuous deformation of nonlinear programs}, 32005 journal = {Mathematical Programming Study}, 32006 editor = {A.~V. Fiacco}, 32007 publisher = {North--Holland}, 32008 address = {Amsterdam}, 32009 year = {1984}, 32010 volume = {21}, 32011 pages = {150--198} 32012} 32013 32014@Article{ kojima.megiddo.ea:homotopy, 32015 author = {M. Kojima and N. Megiddo and T. Noma}, 32016 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 32017 journal = {Mathematics of Operations Research}, 32018 year = {1991}, 32019 volume = {16}, 32020 pages = {754--774} 32021} 32022 32023@TechReport{ kojima.megiddo.ea:primal-dual, 32024 author = {M. Kojima and N. Megiddo and S. Mizuno}, 32025 title = {A primal-dual exterior point algorithm for linear programming}, 32026 institution = {IBM Alamaden Research Center}, 32027 year = {1991}, 32028 number = {RJ 8500}, 32029 address = {San Jose, California} 32030} 32031 32032@Book{ kojima.megiddo.ea:unified, 32033 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 32034 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 32035 Problems}, 32036 year = {1991}, 32037 publisher = {Springer-Verlag}, 32038 address = {Berlin}, 32039 volume = {538}, 32040 series = {Lecture Notes in Computer Science} 32041} 32042 32043@Article{ kojima.mizuno.ea:continuation, 32044 author = {M. Kojima and S. Mizuno and T. Noma}, 32045 title = {A New Continuation Method for Complementarity Problems with Uniform 32046 {P}-function}, 32047 journal = {Mathematical Programming}, 32048 year = {1989}, 32049 volume = {43}, 32050 pages = {107--113} 32051} 32052 32053@TechReport{ kojima.mizuno.ea:infeasible, 32054 author = {M. Kojima and S. Mizuno and M. Todd}, 32055 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 32056 programming}, 32057 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 32058 year = {1992}, 32059 number = {1023}, 32060 address = {Ithaca, New York}, 32061 month = aug 32062} 32063 32064@Article{ kojima.mizuno.ea:onl, 32065 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32066 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 32067 complementarity problems}, 32068 journal = {Mathematical Programming}, 32069 year = {1991}, 32070 volume = {50}, 32071 pages = {331--342} 32072} 32073 32074@Article{ kojima.mizuno.ea:polynomial-time, 32075 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32076 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 32077 journal = {Mathematical Programming}, 32078 year = {1989}, 32079 volume = {44}, 32080 pages = {1--20} 32081} 32082 32083@Article{ kojima.noma.ea:global, 32084 author = {M. Kojima and T. Noma and A. Yoshise}, 32085 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 32086 journal = {Mathematical Programming}, 32087 volume = {65}, 32088 pages = {43--72}, 32089 year = {1994} 32090} 32091 32092@Article{ kojima.shindo.ea:interior-point, 32093 author = {M. Kojima and S. Shindo and S. Hara}, 32094 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 32095 Problem in Symmetric Matrices}, 32096 journal = {SIAM Journal on Optimization}, 32097 volume = {7}, 32098 pages = {86--125} 32099} 32100 32101@Article{ kojima.shindo:extensions, 32102 author = {M. Kojima and S. Shindo}, 32103 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 32104 Equations}, 32105 journal = {Journal of Operations Research Society of Japan}, 32106 year = {1986}, 32107 volume = {29}, 32108 pages = {352--374} 32109} 32110 32111@Article{ kojima:computational, 32112 author = {M. Kojima}, 32113 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 32114 journal = {Keio Engineering Reports}, 32115 year = {1974}, 32116 volume = {27}, 32117 pages = {1--41} 32118} 32119 32120@Article{ kojima:recent, 32121 author = {M. Kojima}, 32122 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 32123 continuation methods}, 32124 journal = {Systems and Control}, 32125 year = {1981}, 32126 volume = {25}, 32127 pages = {421--430} 32128} 32129 32130@Article{ kolesar:branch, 32131 author = {P. J. Kolesar}, 32132 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 32133 journal = {Management Science}, 32134 year = {1967}, 32135 volume = {13}, 32136 pages = {723--735} 32137} 32138 32139@Book{ kolman.beck:elementary, 32140 author = {B. Kolman and R. E. Beck}, 32141 title = {Elementary Linear Programming with Applications}, 32142 year = {1980}, 32143 publisher = {Academic Press} 32144} 32145 32146@Book{ koopmans:activity, 32147 editor = {T. C. Koopmans}, 32148 title = {Activity Analysis of Production and Allocation}, 32149 publisher = {John Wiley}, 32150 address = {New York}, 32151 year = {1951} 32152} 32153 32154@Article{ korpelevich:extragradient, 32155 author = {G. M. Korpelevich}, 32156 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 32157 journal = {Matecon}, 32158 year = {1976}, 32159 volume = {12}, 32160 pages = {747--756} 32161} 32162 32163@Article{ kortanek.shi:convergence, 32164 author = {K. O. Kortanek and M. Shi}, 32165 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 32166 Algorithm}, 32167 journal = {European Journal of Operational Research}, 32168 year = {1987}, 32169 volume = {32}, 32170 pages = {47--61} 32171} 32172 32173@TechReport{ kortanek.shi:remarks, 32174 author = {K. O. Kortanek and M. Shi}, 32175 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 32176 Hybrid Algorithm 1985-6'}, 32177 institution = {College of Business Administration, University of Iowa}, 32178 year = {1987}, 32179 address = {Iowa City}, 32180 number = {87--1}, 32181 type = {Working Paper} 32182} 32183 32184@TechReport{ kortanek:vector-supercomputer, 32185 author = {K. O. Kortanek}, 32186 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 32187 institution = {College of Business Administration, University of Iowa}, 32188 year = {1987}, 32189 address = {Iowa City}, 32190 number = {87--2}, 32191 type = {Working Paper} 32192} 32193 32194@Article{ kostreva:block, 32195 author = {M. M. Kostreva}, 32196 title = {Block Pivot Methods for Solving the Complementarity Problem}, 32197 journal = {Linear Algebra and Its Applications}, 32198 volume = {21}, 32199 pages = {207--215}, 32200 year = {1978} 32201} 32202 32203@Article{ kostreva:elasto-hydrodynamic, 32204 author = {M. M. Kostreva}, 32205 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 32206 journal = {International Journal for Numerical Methods in Fluids}, 32207 year = {1984}, 32208 volume = {4}, 32209 pages = {377--397} 32210} 32211 32212@Article{ kostreva:recent, 32213 author = {M. M. Kostreva}, 32214 title = {Recent Results on Complementarity Models for Engineering and Economics}, 32215 journal = {Infor, Journal of the Canadian {OR} Society}, 32216 year = {1990}, 32217 volume = {28}, 32218 pages = {324--334} 32219} 32220 32221@Article{ kotiah.steinberg:occurrences, 32222 author = {T. C. T. Kotiah and D. I. Steinberg}, 32223 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 32224 Programming Models}, 32225 journal = {Communications of the ACM}, 32226 volume = {20}, 32227 year = {1977}, 32228 pages = {107--112} 32229} 32230 32231@Article{ kotiah.steinberg:possibility, 32232 author = {T. C. T. Kotiah and D. I. Steinberg}, 32233 title = {On the Possibility of Cycling with the Simplex Method}, 32234 journal = {Operations Research}, 32235 volume = {26}, 32236 year = {1978}, 32237 pages = {374--376} 32238} 32239 32240@InCollection{ kuhn.tucker:nonlinear, 32241 author = {H. W. Kuhn and A. W. Tucker}, 32242 title = {Nonlinear Programming}, 32243 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 32244 Probability}, 32245 year = {1951}, 32246 editor = {J. Neyman}, 32247 publisher = {University of California Press}, 32248 address = {Berkeley and Los Angeles}, 32249 pages = {481--492} 32250} 32251 32252@Article{ kummer:metric, 32253 author = {B. Kummer}, 32254 title = {Metric regularity: characterizations, nonsmooth variations, and successive 32255 approximation}, 32256 journal = {Journal of Mathematical Analysis and its Applications}, 32257 year = {}, 32258 optkey = {}, 32259 optvolume = {}, 32260 optnumber = {}, 32261 optpages = {}, 32262 optmonth = {}, 32263 optnote = {}, 32264 optannote = {} 32265} 32266 32267@InCollection{ kummer:newtons, 32268 author = {B. Kummer}, 32269 title = {{N}ewton's Method for Non--Differentiable Functions}, 32270 booktitle = {Advances in Mathematical Optimization}, 32271 publisher = {Akademie--Verlag}, 32272 year = {1988}, 32273 editors = {J. Guddat et al.}, 32274 pages = {114--125}, 32275 address = {Berlin} 32276} 32277 32278@Unpublished{ kuntsevich.kappel:solvopt, 32279 author = {A. Kuntsevich and F. Kappel}, 32280 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 32281 year = {1997}, 32282 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 32283 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 32284} 32285 32286@Book{ kushner.clark:stochastic, 32287 author = {H. J. Kushner and D. S. Clark}, 32288 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 32289 publisher = {Springer-Verlag}, 32290 year = {1978}, 32291 address = {New York} 32292} 32293 32294@Article{ kutcher.burman.ea:histogram, 32295 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 32296 title = {Histogram reduction method for calculating complication probabilities for 32297 three-dimensional treatment planning evaluation}, 32298 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32299 year = {1991}, 32300 optvolume = {21}, 32301 optpages = {137-146} 32302} 32303 32304@Article{ kutcher.burman:calculation, 32305 author = {G. J. Kutcher and C. Burman}, 32306 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 32307 Irradiation: The Effective Volume Method}, 32308 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32309 year = {1989}, 32310 volume = {16}, 32311 pages = {1623--1630} 32312} 32313 32314@Article{ kwak.lee:complementarity, 32315 author = {B. M. Kwak and B. C. Lee.}, 32316 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 32317 Problem}, 32318 journal = {Computers and Structures}, 32319 volume = {18}, 32320 pages = {469--480}, 32321 year = {1988} 32322} 32323 32324@Article{ kwak:complementarity, 32325 author = {B. M. Kwak}, 32326 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 32327 journal = {Journal of Applied Mechanics}, 32328 volume = {58}, 32329 pages = {134--140}, 32330 year = {1991} 32331} 32332 32333@Article{ lagarias.reeds.ea:convergence, 32334 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 32335 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 32336 journal = {SIAM Journal on Optimization}, 32337 year = {1998}, 32338 volume = {9}, 32339 pages = {112--147} 32340} 32341 32342@Article{ lahaye:methode, 32343 author = {E. Lahaye}, 32344 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 32345 transcendantes}, 32346 journal = {C. R. Acad. Sci. Paris}, 32347 year = {1934}, 32348 volume = {198}, 32349 pages = {1840--1842} 32350} 32351 32352@Article{ lahaye:solution, 32353 author = {E. Lahaye}, 32354 title = {Solution of Systems of Transcendental Equations}, 32355 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 32356 year = {1948}, 32357 volume = {5}, 32358 pages = {805--822} 32359} 32360 32361@Article{ lahenbruch.mickey:estimation, 32362 author = {P. A. Lahenbruch and R. M. Mickey}, 32363 title = {Estimation of Error Rates in Discriminant Analysis}, 32364 journal = {Technometrics}, 32365 year = {1968}, 32366 volume = {10}, 32367 pages = {1--11} 32368} 32369 32370@Article{ lakshminarayan.lakshmanan.ea:optimal, 32371 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 32372 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 32373 journal = {Operations Research}, 32374 year = {1978}, 32375 volume = {26}, 32376 pages = {1079--1082} 32377} 32378 32379@Article{ land.doig:automatic, 32380 author = {A. H. Land and A. G. Doig}, 32381 title = {An Automatic Method for Solving Discrete Programming Problems}, 32382 journal = {Econometrica}, 32383 volume = {28}, 32384 year = {1960}, 32385 pages = {497-520} 32386} 32387 32388@Article{ langer.morrill:comparison, 32389 author = {M. Langer and S. Morrill}, 32390 title = {A comparison of mixed integer programming and fast simulated annealing for 32391 optimized beam weights in radiation therapy}, 32392 journal = {Medical Physics}, 32393 year = {1996}, 32394 volume = {23}, 32395 number = {6}, 32396 pages = {957--964} 32397} 32398 32399@Article{ larsson.patriksson:class, 32400 author = {T. Larsson and M. Patriksson}, 32401 title = {A Class of Gap Functions for Variational Inequalities}, 32402 journal = {Mathematical Programming}, 32403 year = {1994}, 32404 volume = {64}, 32405 pages = {53--79} 32406} 32407 32408@Article{ lasdon.waren.ea:solving, 32409 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 32410 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 32411 Linear Programming Algorithms}, 32412 journal = {ACM SIGMAP Bulletin}, 32413 year = {1979}, 32414 volume = {27}, 32415 pages = {9--15} 32416} 32417 32418@TechReport{ lawler.lenstra.ea:sequencing, 32419 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 32420 title = {Sequencing and Scheduling: Algorithms and Complexity}, 32421 institution = {Centre for Mathematics and Computer Science}, 32422 year = {1989}, 32423 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 32424 number = {BS--R89xx} 32425} 32426 32427@Article{ lawler:fast, 32428 author = {E. L. Lawler}, 32429 title = {Fast Approximations Algorithms for Knapsack Problems}, 32430 journal = {Mathematics of Operations Research}, 32431 year = {1979}, 32432 volume = {4}, 32433 pages = {339--356} 32434} 32435 32436@Book{ lawless:statistical, 32437 author = {J. F. Lawless}, 32438 title = {Statistical Models and Methods for Lifetime Data}, 32439 year = {1982}, 32440 publisher = {John Wiley and Sons}, 32441 address = {New York, NY} 32442} 32443 32444@Article{ lawrence.spingarn:fixed, 32445 author = {J. Lawrence and J. E. Spingarn}, 32446 title = {On fixed points of non-expansive piecewise isometric mappings}, 32447 journal = {Proceedings of the London Mathematical Society}, 32448 year = {1987}, 32449 volume = {55}, 32450 number = {3}, 32451 pages = {605--624} 32452} 32453 32454@Article{ leavitt.martin.ea:dynamic, 32455 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 32456 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 32457 dose delivery}, 32458 journal = {Medical Physics}, 32459 year = {1990}, 32460 volume = {17}, 32461 number = {1}, 32462 pages = {87--92} 32463} 32464 32465@Article{ leblanc.morlok.ea:efficient, 32466 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 32467 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 32468 Problem}, 32469 journal = {Transportation Research}, 32470 volume = {9}, 32471 year = {1975}, 32472 pages = {309--318} 32473} 32474 32475@Article{ lee:computational, 32476 author = {S. S. Lee}, 32477 title = {A computational method for frictional contact problem using finite element 32478 method}, 32479 journal = {International Journal for Numerical Methods in Engineering}, 32480 volume = {37}, 32481 year = {1994}, 32482 pages = {217--228} 32483} 32484 32485@PhDThesis{ lee:military, 32486 author = {D. K. Lee}, 32487 title = {Military Force Planning Problems Under Uncertainty}, 32488 school = {University of Wisconsin -- Madison}, 32489 year = {1996}, 32490 address = {Madison, Wisconsin} 32491} 32492 32493@Article{ leibel.kutcher.ea:improved, 32494 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 32495 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 32496 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 32497 the Nasopharynx}, 32498 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32499 year = {1991}, 32500 volume = {20}, 32501 pages = {823--833} 32502} 32503 32504@Article{ lee.gallagher.ea:treatment, 32505 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 32506 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 32507 Computational Approaches and Experiments with Permanent Prostate Implant 32508 Planning}, 32509 journal = {Physics in Medicine and Biology}, 32510 year = {1999}, 32511 volume = {44}, 32512 pages = {145--165} 32513} 32514 32515@Article{ lemarechal.nemirovskii.ea:variants, 32516 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 32517 title = {New Variants of Bundle Methods}, 32518 year = {1995}, 32519 journal = {Mathematical Programming}, 32520 volume = {69}, 32521 pages = {111--147} 32522} 32523 32524@InCollection{ lemarechal.strodiot.ea:bundle, 32525 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 32526 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 32527 booktitle = {Nonlinear Programming}, 32528 year = {1981}, 32529 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 32530 publisher = {Academic Press}, 32531 pages = {245--282}, 32532 volume = {4} 32533} 32534 32535@Article{ lemke.howson:equilibrium, 32536 author = {C. E. Lemke and J. T. Howson}, 32537 title = {Equilibrium Points of Bimatrix Games}, 32538 journal = {SIAM Journal on Applied Mathematics}, 32539 year = {1964}, 32540 volume = {12}, 32541 pages = {413--423} 32542} 32543 32544@Article{ lemke:bimatrix, 32545 author = {C. E. Lemke}, 32546 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 32547 journal = {Management Science}, 32548 year = {1965}, 32549 volume = {11}, 32550 pages = {681--689} 32551} 32552 32553@InCollection{ lemke:complementary, 32554 author = {C. E. Lemke}, 32555 title = {On Complementary Pivot Theory}, 32556 booktitle = {Mathematics of the Decision Sciences: Part 1}, 32557 publisher = {American Mathematical Society}, 32558 year = {1968}, 32559 editor = {G. B. Dantzig and A. F. Veinott}, 32560 volume = {11}, 32561 series = {Lectures in Applied Mathematics}, 32562 address = {Providence}, 32563 pages = {95--114} 32564} 32565 32566@Article{ levenberg:method, 32567 author = {K. Levenberg}, 32568 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 32569 journal = {Quarterly Applied Mathematics}, 32570 year = {1944}, 32571 volume = {2}, 32572 pages = {164--168} 32573} 32574 32575@Article{ levitin.polyak:constrained, 32576 author = {E. S. Levitin and B. T. Polyak}, 32577 title = {Constrained minimization methods}, 32578 journal = {Computational Mathematics and Mathematical Physics}, 32579 year = {1968}, 32580 volume = {6}, 32581 pages = {1--50}, 32582 note = {Translated from Russian} 32583} 32584 32585@Article{ li.swetis:linear, 32586 author = {W. Li and J. J. Swetits}, 32587 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 32588 journal = {SIAM Journal on Optimization}, 32589 volume = {8}, 32590 pages = {457-475}, 32591 year = {1998} 32592} 32593 32594@TechReport{ li:error, 32595 author = {W. Li}, 32596 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 32597 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32598 year = {1993}, 32599 address = {Norfolk, VA 23529}, 32600 number = {TR93-1}, 32601 note = {SIAM Journal on Control and Optimization, to appear} 32602} 32603 32604@TechReport{ li:linearly, 32605 author = {W. Li}, 32606 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 32607 Quadratic Splines}, 32608 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32609 year = {1993}, 32610 address = {Norfolk, VA 23529}, 32611 number = {TR93-3}, 32612 note = {Journal of Optimization Theory and Applications, to appear} 32613} 32614 32615@InProceedings{ li:merit, 32616 author = {W. Li}, 32617 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 32618 Problems}, 32619 crossref = {ferris.pang:complementarity} 32620} 32621 32622@Article{ li:remarks, 32623 author = {W. Li}, 32624 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 32625 Complementarity Problem}, 32626 journal = {SIAM Journal on Optimization}, 32627 year = {1993}, 32628 volume = {3}, 32629 pages = {155--163} 32630} 32631 32632@TechReport{ li:sharp, 32633 author = {W. Li}, 32634 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 32635 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32636 year = {1991}, 32637 address = {Norfolk, VA 23529}, 32638 number = {TR91-13}, 32639 note = {SIAM Journal on Control and Optimization, to appear} 32640} 32641 32642@Article{ lin.kernighan:efficient, 32643 author = {S. Lin and B. W. Kernighan}, 32644 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 32645 journal = {Operations Research}, 32646 year = {1973}, 32647 volume = {21}, 32648 pages = {498--516} 32649} 32650 32651@Article{ lin.pang:iterative, 32652 author = {Y. Y. Lin and J. S. Pang}, 32653 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 32654 journal = {SIAM Journal on Control and Optimization}, 32655 year = {1987}, 32656 volume = {25}, 32657 pages = {383--411} 32658} 32659 32660@Unpublished{ linderoth:branch, 32661 author = {J. Linderoth}, 32662 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 32663 institution = {Argonne National Laboratories}, 32664 year = {2000}, 32665 note = {Working Paper} 32666} 32667 32668@Article{ lions.stampacchia:variational, 32669 author = {J. L. Lions and G. Stampacchia}, 32670 title = {Variational Inequalities}, 32671 journal = {Communications on Pure and Applied Math}, 32672 year = {1967}, 32673 volume = {20}, 32674 pages = {493--19} 32675} 32676 32677@Article{ lions.mercier:splitting, 32678 author = {P.--L. Lions and B. Mercier}, 32679 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 32680 journal = {SIAM Journal on Numerical Analysis}, 32681 year = {1979}, 32682 volume = {16}, 32683 pages = {964--979} 32684} 32685 32686@Article{ lions:methode, 32687 author = {P.--L. Lions}, 32688 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 32689 journal = {Israel Journal of Mathematics}, 32690 year = {1978}, 32691 volume = {31}, 32692 number = {2}, 32693 pages = {204--208} 32694} 32695 32696@InProceedings{ litzkow.livny.ea:condor, 32697 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 32698 title = {Condor: {A} Hunter of Idle Workstations}, 32699 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 32700 Systems}, 32701 year = {1988}, 32702 pages = {104--111}, 32703 month = jun 32704} 32705 32706@Article{ liu.nocedal:limited, 32707 author = {D. C. Liu and J. Nocedal}, 32708 title = {On the Limited Memory Method for Large Scale Optimization}, 32709 journal = {Mathematical Programming}, 32710 year = {1989}, 32711 volume = {45}, 32712 pages = {503--528} 32713} 32714 32715@InBook{ livny.raman:high, 32716 author = {M. Livny and R. Raman}, 32717 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 32718 chapter = {High Throughput Resource Management}, 32719 publisher = {Morgan Kaufmann Publishers}, 32720 year = {1999}, 32721 pages = {311--337} 32722} 32723 32724@Article{ llacer:inverse, 32725 author = {J. Llacer}, 32726 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 32727 Method}, 32728 journal = {Medical Physics}, 32729 year = {1997}, 32730 volume = {24}, 32731 number = {11}, 32732 pages = {1751--1764} 32733} 32734 32735@Book{ lojasiewicz:ensembles, 32736 author = {M. S. Lojasiewicz}, 32737 title = {Ensembles semi-analytiques}, 32738 publisher = {Institut des Hautes Etudes Scientifiques}, 32739 year = {1964}, 32740 address = {Bures-sur-Yvette} 32741} 32742 32743@Article{ lootsma:logarithmic, 32744 author = {F. A. Lootsma}, 32745 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 32746 journal = {Phillips Research Reports}, 32747 year = {1967}, 32748 volume = {22}, 32749 pages = {329--344} 32750} 32751 32752@InCollection{ lootsma:survey, 32753 author = {F. A. Lootsma}, 32754 title = {A Survey of Methods for Solving Constrained Minimization Problems via 32755 Unconstrained Minimization}, 32756 booktitle = {Numerical Methods for Nonlinear Optimization}, 32757 year = {1972}, 32758 editor = {F. A. Lootsma}, 32759 publisher = {Academic Press}, 32760 address = {London} 32761} 32762 32763@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 32764 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32765 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 32766 Regional Trade Blocks}, 32767 institution = {National Bureau of Economic Research, Inc.}, 32768 year = {1993}, 32769 number = {4512}, 32770 address = {Cambridge, Massechusetts} 32771} 32772 32773@InCollection{ lopezdesilanes.markusen.ea:auto, 32774 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32775 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 32776 year = {1994}, 32777 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 32778 publisher = {Cambridge University Press}, 32779 editor = {C. Shields and J. Francois} 32780} 32781 32782@Article{ lopezdesilanes.markusen.ea:complementarity, 32783 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32784 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 32785 journal = {Journal of Development Economics}, 32786 year = {1994}, 32787 volume = {45}, 32788 pages = {133--151} 32789} 32790 32791@Article{ lopezdesilanes.markusen.ea:trade, 32792 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32793 title = {Trade Policy Subtleties with Multinational Firms}, 32794 journal = {European Economic Review}, 32795 year = {1996} 32796} 32797 32798@Article{ lotstedt:coulomb, 32799 author = {P. L{\"{o}}tstedt}, 32800 title = {Coulomb friction in two-dimensional rigid body systems}, 32801 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 32802 volume = {61}, 32803 year = {1981}, 32804 pages = {605--615} 32805} 32806 32807@Article{ lotstedt:mechanical, 32808 author = {P. L{\"{o}}tstedt}, 32809 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 32810 journal = {SIAM Journal on Applied Mathematics}, 32811 volume = {42}, 32812 year = {1982}, 32813 pages = {281--296} 32814} 32815 32816@Book{ luenberger:linear, 32817 author = {D. G. Luenberger}, 32818 title = {Linear and Nonlinear Programming}, 32819 year = {1984}, 32820 publisher = {Addison-Wesley}, 32821 edition = {Second} 32822} 32823 32824@Book{ luenberger:optimization, 32825 author = {D. G. Luenberger}, 32826 title = {Optimization by Vector Space Methods}, 32827 year = {1969}, 32828 publisher = {John Wiley \& Sons}, 32829 address = {New York} 32830} 32831 32832@Article{ lundy.mees:convergence, 32833 author = {M. Lundy and A. Mees}, 32834 title = {Convergence of an Annealing Algorithm}, 32835 journal = {Mathematical Programming}, 32836 year = {1986}, 32837 volume = {34}, 32838 pages = {111--124} 32839} 32840 32841@Article{ luo.luo:extension, 32842 author = {X.-D. Luo and Z.-Q. Luo}, 32843 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 32844 journal = {SIAM Journal on Optimization}, 32845 year = {1994}, 32846 volume = {4}, 32847 pages = {383--392} 32848} 32849 32850@Article{ luo.mangasarian.ea:error, 32851 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 32852 title = {New Error Bounds for the Linear Complementarity Problem}, 32853 journal = {Mathematics of Operations Research}, 32854 year = {1994}, 32855 pages = {880--892}, 32856 volume = {19} 32857} 32858 32859@Article{ luo.pang.ea:exact, 32860 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 32861 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 32862 Equilibrium Constraints}, 32863 journal = {Mathematical Programming}, 32864 volume = {75}, 32865 pages = {19--76}, 32866 year = {1996} 32867} 32868 32869@Book{ luo.pang.ea:mathematical, 32870 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 32871 title = {Mathematical Programs with Equilibrium Constraints}, 32872 publisher = {Cambridge University Press}, 32873 year = {1996} 32874} 32875 32876@Article{ luo.pang:error, 32877 author = {Z.-Q. Luo and J. S. Pang}, 32878 title = {Error Bounds for Analytic Systems and their Applications}, 32879 journal = {Mathematical Programming}, 32880 year = {1994}, 32881 volume = {67}, 32882 pages = {1--28} 32883} 32884 32885@Article{ luo.shu.ea:optimizing, 32886 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 32887 title = {Optimizing computerized treatment planning for the Gamma Knife by source 32888 culling}, 32889 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32890 year = {1999}, 32891 volume = {45}, 32892 number = {5}, 32893 pages = {1339--1346} 32894} 32895 32896@InProceedings{ luo.tseng:class, 32897 author = {Z.-Q. Luo and P. Tseng}, 32898 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 32899 crossref = {ferris.pang:complementarity}, 32900 pages = {204--225} 32901} 32902 32903@Article{ luo.tseng:convergence, 32904 author = {Z.-Q. Luo and P. Tseng}, 32905 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 32906 Minimization}, 32907 journal = {Journal of Optimization Theory and Applications}, 32908 year = {1992}, 32909 volume = {72}, 32910 pages = {7--35} 32911} 32912 32913@Article{ luo.tseng:convergence*1, 32914 author = {Z.-Q. Luo and P. Tseng}, 32915 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 32916 Linear Complementarity Problem}, 32917 journal = {SIAM Journal on Control and Optimization}, 32918 year = {1991}, 32919 volume = {29}, 32920 pages = {1037--1060} 32921} 32922 32923@Article{ luo.tseng:convergence*2, 32924 author = {Z.-Q. Luo and P. Tseng}, 32925 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 32926 journal = {Mathematics of Operations Research}, 32927 year = {1993}, 32928 volume = {18}, 32929 pages = {846--867} 32930} 32931 32932@Article{ luo.tseng:error, 32933 author = {Z.--Q. Luo and P. Tseng}, 32934 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 32935 Affine Variational Inequality Problem}, 32936 journal = {SIAM Journal on Optimization}, 32937 year = {1992}, 32938 volume = {2}, 32939 pages = {43--54} 32940} 32941 32942@Article{ luo.tseng:error*1, 32943 author = {Z.-Q. Luo and P. Tseng}, 32944 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 32945 Over a Polyhedral Set}, 32946 journal = {SIAM Journal on Optimization}, 32947 year = {1993}, 32948 volume = {3}, 32949 pages = {43--59} 32950} 32951 32952@Article{ luo.tseng:error*2, 32953 author = {Z.-Q. Luo and P. Tseng}, 32954 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 32955 Approach}, 32956 journal = {Annals of Operations Research}, 32957 year = {1993}, 32958 volume = {46}, 32959 pages = {157--178} 32960} 32961 32962@Article{ luo.tseng:global, 32963 author = {Z.-Q. Luo and P. Tseng}, 32964 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 32965 Problems}, 32966 journal = {Operations Research Letters}, 32967 year = {1992}, 32968 volume = {11}, 32969 pages = {159--165} 32970} 32971 32972@Article{ luo.tseng:linear, 32973 author = {Z.-Q. Luo and P. Tseng}, 32974 title = {On the linear convergence of descent methods for convex essentially smooth 32975 minimization}, 32976 journal = {SIAM Journal on Control and Optimization}, 32977 year = {1992}, 32978 volume = {30}, 32979 pages = {408--425} 32980} 32981 32982@TechReport{ luo:convergence, 32983 author = {Z.-Q. Luo}, 32984 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 32985 Quadratic Programs}, 32986 institution = {Communications Research Laboratory, McMaster University}, 32987 year = {1992}, 32988 address = {Hamilton, Ontario} 32989} 32990 32991@Article{ lustig.marsten.ea:computational, 32992 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32993 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 32994 Programming}, 32995 journal = {Linear Algebra and Its Applications}, 32996 year = {1991}, 32997 volume = {152}, 32998 pages = {191--222} 32999} 33000 33001@Article{ lustig.marsten.ea:implementing, 33002 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 33003 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 33004 programming}, 33005 journal = {SIAM Journal on Optimization}, 33006 year = {1992}, 33007 volume = {2}, 33008 pages = {435--449} 33009} 33010 33011@Article{ lustig.marsten.ea:interior-point, 33012 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 33013 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 33014 journal = {ORSA Journal on Computing}, 33015 year = {1994}, 33016 volume = {6}, 33017 number = {1}, 33018 pages = {1--38} 33019} 33020 33021@Article{ lyman.wolbarst:optimization, 33022 author = {J. T. Lyman and A. B. Wolbarst}, 33023 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 33024 Algorithm}, 33025 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33026 year = {1989}, 33027 volume = {17}, 33028 pages = {433--436} 33029} 33030 33031@Article{ mackie.holmes.ea:tomotherapy*1, 33032 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 33033 J. Yang and B. Paliwal and T. Kinsella}, 33034 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 33035 journal = {Medical Physics}, 33036 year = {1993}, 33037 volume = {20}, 33038 number = {6}, 33039 pages = {1709--1719} 33040} 33041 33042@Article{ mackie.holmes.ea:tomotherapy*2, 33043 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 33044 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 33045 journal = {Int. J. of Imaging Systems and Technology}, 33046 year = {1995}, 33047 volume = {6}, 33048 pages = {43--55} 33049} 33050 33051@Article{ mackie.scrimger.ea:convolution, 33052 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 33053 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 33054 journal = {Medical Physics}, 33055 year = {1985}, 33056 volume = {12}, 33057 pages = {188--196} 33058} 33059 33060@Article{ mackinnon:technique, 33061 author = {James G. Mac{K}innon}, 33062 title = {A Technique for the Solution of Spatial Equilibrium Models}, 33063 journal = {Journal of Regional Science}, 33064 year = {1976}, 33065 volume = {16}, 33066 pages = {293--307} 33067} 33068 33069@PhDThesis{ madsen:minimization, 33070 author = {K. Madsen}, 33071 title = {Minimization of Nonlinear Approximation Functions}, 33072 year = {1985}, 33073 address = {Lyngby, Denmark}, 33074 school = {Institute of Numerical Analysis, Technical University of Denmark}, 33075 annote = {Dissertation} 33076} 33077 33078@Book{ magill.quinzii:theory, 33079 author = {M. Magill and M. Quinzii}, 33080 title = {Theory of Incomplete Markets}, 33081 publisher = {MIT Press}, 33082 year = {1996} 33083} 33084 33085@InCollection{ magnanti:models, 33086 author = {T. L. Magnanti}, 33087 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 33088 booktitle = {Transportation Planning Models}, 33089 year = {1984}, 33090 editor = {M. Florian}, 33091 publisher = {North Holland}, 33092 pages = {153--186} 33093} 33094 33095@InCollection{ maguregui:modified, 33096 author = {J. Maguregui}, 33097 title = {A modified {N}ewton algorithm for functions over convex sets}, 33098 crossref = {mangasarian.meyer.ea:nonlinear*3}, 33099 pages = {461--473} 33100} 33101 33102@PhDThesis{ maguregui:regular, 33103 author = {J. Maguregui}, 33104 title = {Regular Multivalued Functions and Algorithmic Applications}, 33105 year = {1977}, 33106 address = {Madison, Wisconsin}, 33107 school = {Computer Sciences Department, University of Wisconsin} 33108} 33109 33110@Article{ mahey.oualibouch.ea:proximal, 33111 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 33112 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 33113 journal = {SIAM Journal on Optimization}, 33114 year = {1995}, 33115 volume = {5}, 33116 pages = {454--466} 33117} 33118 33119@Article{ mahey.pham:partial, 33120 author = {P. Mahey and D. T. Pham}, 33121 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 33122 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 33123 year = {1993}, 33124 volume = {27}, 33125 pages = {375--392} 33126} 33127 33128@InCollection{ maier.novati:shakedown, 33129 author = {G. Maier and G. Novati}, 33130 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 33131 geometric effects with reference to discrete structural models}, 33132 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 33133 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 33134 publisher = {Pineridge Press}, 33135 address = {Swansea}, 33136 year = {1990}, 33137 pages = {451--471} 33138} 33139 33140@Article{ maier:incremental, 33141 author = {G. Maier}, 33142 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 33143 Instabilizing Effects}, 33144 journal = {International Journal of Solids and Structures}, 33145 volume = {7}, 33146 year = {1971}, 33147 pages = {345--372} 33148} 33149 33150@InCollection{ maier:inverse, 33151 author = {G. Maier}, 33152 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 33153 booktitle = {Serie VIII}, 33154 publisher = {Academia Nazionale dei Lincei}, 33155 year = {1981}, 33156 volume = {LXX}, 33157 pages = {203--209} 33158} 33159 33160@Article{ maier:matrix, 33161 author = {G. Maier}, 33162 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 33163 yield planes}, 33164 journal = {Meccanica}, 33165 volume = {5}, 33166 year = {1970}, 33167 pages = {54--66} 33168} 33169 33170@Article{ maier:quadratic, 33171 author = {G. Maier}, 33172 title = {A quadratic programming approach for certain classes of nonlinear structural 33173 problems}, 33174 journal = {Meccanica}, 33175 volume = {3}, 33176 year = {1968}, 33177 pages = {121--130} 33178} 33179 33180@Book{ manber:introduction, 33181 author = {U. Manber}, 33182 title = {Introduction to Algorithms: {A} Creative Approach}, 33183 year = {1989}, 33184 publisher = {Addison-Wesley} 33185} 33186 33187@Article{ mangasarian.deleone:error, 33188 author = {O. L. Mangasarian and R. {De~Leone}}, 33189 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 33190 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 33191 journal = {Applied Mathematics and Optimization}, 33192 year = {1988}, 33193 volume = {17}, 33194 pages = {1--14} 33195} 33196 33197@Article{ mangasarian.deleone:parallel, 33198 author = {O. L. Mangasarian and R. {De~Leone}}, 33199 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 33200 Problems and Linear Programs}, 33201 journal = {Journal of Optimization Theory and Applications}, 33202 year = {1987}, 33203 volume = {54}, 33204 pages = {437--446} 33205} 33206 33207@Article{ mangasarian.fromovitz:fritz, 33208 author = {O. L. Mangasarian and S. Fromovitz}, 33209 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 33210 and inequality constraints}, 33211 journal = {Journal of Mathematical Analysis and its Applications}, 33212 year = {1967}, 33213 volume = {17}, 33214 pages = {37--47} 33215} 33216 33217@Article{ mangasarian.mclinden:simple, 33218 author = {O. L. Mangasarian and L. McLinden}, 33219 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 33220 Programs}, 33221 journal = {Mathematical Programming}, 33222 year = {1985}, 33223 volume = {32}, 33224 pages = {32--40} 33225} 33226 33227@Article{ mangasarian.meyer:nonlinear, 33228 author = {O. L. Mangasarian and R. R. Meyer}, 33229 title = {Nonlinear Perturbation of Linear Programs}, 33230 journal = {SIAM Journal on Control and Optimization}, 33231 year = {1979}, 33232 volume = {17}, 33233 pages = {745--752} 33234} 33235 33236@TechReport{ mangasarian.musicant:active, 33237 author = {O. L. Mangasarian and David R. Musicant}, 33238 title = {Active Set Support Vector Machine Classification}, 33239 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33240 year = {2000}, 33241 number = {00-04}, 33242 address = {Madison, Wisconsin} 33243} 33244 33245@TechReport{ mangasarian.musicant:lagrangian, 33246 author = {O. L. Mangasarian and D. R. Musicant}, 33247 title = {Lagrangian Support Vector Machines}, 33248 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33249 year = {2000}, 33250 number = {00-06}, 33251 address = {Madison, Wisconsin} 33252} 33253 33254@TechReport{ mangasarian.musicant:robust, 33255 author = {O. L. Mangasarian and David R. Musicant}, 33256 title = {Robust Linear and Support Vector Regression}, 33257 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33258 year = {1999}, 33259 number = {99-09}, 33260 address = {Madison, Wisconsin} 33261} 33262 33263@Article{ mangasarian.musicant:successive, 33264 author = {O. L. Mangasarian and David R. Musicant}, 33265 title = {Successive Overrelaxation for Support Vector Machines}, 33266 journal = {IEEE Transactions on Neural Networks}, 33267 volume = {10}, 33268 year = {1999}, 33269 pages = {1032-1037} 33270} 33271 33272@Article{ mangasarian.pang:exact, 33273 author = {O. L. Mangasarian and J. S. Pang}, 33274 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 33275 Constraints}, 33276 journal = {Optimization}, 33277 year = {1997}, 33278 volume = {42}, 33279 pages = {1--8} 33280} 33281 33282@Article{ mangasarian.pang:extended, 33283 author = {O. L. Mangasarian and J. S. Pang}, 33284 title = {The Extended Linear Complementarity Problem}, 33285 journal = {SIAM Journal on Matrix Analysis and Applications}, 33286 year = {1994}, 33287 volume = {16} 33288} 33289 33290@Article{ mangasarian.ren:error, 33291 author = {O. L. Mangasarian and J. Ren}, 33292 title = {New error bounds for the nonlinear complementarity problem}, 33293 year = {1994}, 33294 volume = {1}, 33295 pages = {49--56}, 33296 journal = {Communications on Applied Nonlinear Analysis} 33297} 33298 33299@Article{ mangasarian.ren:improved, 33300 author = {O. L. Mangasarian and J. Ren}, 33301 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 33302 year = {1994}, 33303 volume = {66}, 33304 journal = {Mathematical Programming}, 33305 pages = {241--255} 33306} 33307 33308@InProceedings{ mangasarian.setiono.ea:pattern, 33309 crossref = {coleman.li:large-scale}, 33310 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 33311 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 33312 Diagnosis}, 33313 pages = {22--31} 33314} 33315 33316@Article{ mangasarian.shiau:error, 33317 author = {O. L. Mangasarian and T.--H. Shiau}, 33318 title = {Error Bounds for Monotone Linear Complementarity Problems}, 33319 journal = {Mathematical Programming}, 33320 year = {1986}, 33321 volume = {36}, 33322 pages = {81--89} 33323} 33324 33325@Article{ mangasarian.shiau:lipschitz, 33326 author = {O. L. Mangasarian and T.--H. Shiau}, 33327 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 33328 Complementarity Problems}, 33329 journal = {SIAM Journal on Control and Optimization}, 33330 year = {1987}, 33331 volume = {25}, 33332 pages = {583--595} 33333} 33334 33335@Article{ mangasarian.solodov:nonlinear, 33336 author = {O. L. Mangasarian and M. V. Solodov}, 33337 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 33338 journal = {Mathematical Programming}, 33339 year = {1993}, 33340 volume = {62}, 33341 pages = {277--298} 33342} 33343 33344@Article{ mangasarian.solodov:serial, 33345 author = {O. L. Mangasarian and M. V. Solodov}, 33346 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 33347 Minimization}, 33348 year = {1994}, 33349 journal = {Optimization Methods and Software}, 33350 volume = {4}, 33351 pages = {103--116} 33352} 33353 33354@Article{ mangasarian.street.ea:breast, 33355 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 33356 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 33357 journal = {Operations Research}, 33358 year = {1995}, 33359 volume = {43}, 33360 pages = {570--577} 33361} 33362 33363@Article{ mangasarian.wolberg:cancer, 33364 author = {O. L. Mangasarian and W. H. Wolberg}, 33365 title = {Cancer Diagnosis via Linear Programming}, 33366 journal = {SIAM News}, 33367 year = {1990}, 33368 volume = {23}, 33369 pages = {1 \& 18} 33370} 33371 33372@InCollection{ mangasarian:applications, 33373 author = {O. L. Mangasarian}, 33374 title = {Some Applications of Penalty Functions in Mathematical Programming}, 33375 booktitle = {Optimization and Related Fields}, 33376 year = {1986}, 33377 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 33378 publisher = {Springer-Verlag}, 33379 address = {Heidelberg}, 33380 pages = {307--329}, 33381 note = {Lecture Notes in Mathematics 1190} 33382} 33383 33384@Article{ mangasarian:characterization, 33385 author = {O. L. Mangasarian}, 33386 title = {Characterization of linear complementarity problems as linear programs}, 33387 journal = {Mathematical Programming Study}, 33388 year = {1978}, 33389 volume = {7}, 33390 pages = {74--87} 33391} 33392 33393@InProceedings{ mangasarian:condition, 33394 author = {O. L. Mangasarian}, 33395 title = {A condition number for linear inequalities and linear programs}, 33396 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 33397 1981}, 33398 year = {1981}, 33399 editor = {G. Bamberg and O. Opitz}, 33400 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 33401 address = {Konigstein}, 33402 pages = {3--15} 33403} 33404 33405@Article{ mangasarian:convergence, 33406 author = {O. L. Mangasarian}, 33407 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 33408 Symmetric Monotone Linear Complementarity Problem}, 33409 journal = {SIAM Journal on Optimization}, 33410 volume = {1}, 33411 pages = {114--122}, 33412 year = {1991} 33413} 33414 33415@Article{ mangasarian:equivalence, 33416 author = {O. L. Mangasarian}, 33417 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 33418 journal = {SIAM Journal on Applied Mathematics}, 33419 year = {1976}, 33420 volume = {31}, 33421 pages = {89--92} 33422} 33423 33424@Article{ mangasarian:error, 33425 author = {O. L. Mangasarian}, 33426 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 33427 journal = {ORSA Journal on Computing}, 33428 volume = {15}, 33429 pages = {187--192}, 33430 year = {1994} 33431} 33432 33433@Article{ mangasarian:error*1, 33434 author = {O. L. Mangasarian}, 33435 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 33436 journal = {Mathematical Programming}, 33437 year = {1990}, 33438 volume = {48}, 33439 pages = {437--445} 33440} 33441 33442@Article{ mangasarian:generalized, 33443 author = {O. L. Mangasarian}, 33444 title = {Generalized Linear Complementarity Problems as Linear Programs}, 33445 journal = {Methods of Operations Research}, 33446 year = {1979}, 33447 editor = {W. Oettli and F. Steffens}, 33448 volume = {31}, 33449 pages = {393--402} 33450} 33451 33452@InCollection{ mangasarian:generalized*1, 33453 author = {O. L. Mangasarian}, 33454 title = {Generalized Support Vector Machines}, 33455 year = {2000}, 33456 pages = {135-146}, 33457 booktitle = {Advances in Large Margin Classifiers}, 33458 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 33459 publisher = {MIT Press}, 33460 address = {Cambridge, MA} 33461} 33462 33463@Article{ mangasarian:global, 33464 author = {O. L. Mangasarian}, 33465 title = {Global error bounds for monotone affine variational inequality problems}, 33466 journal = {Linear Algebra and Its Applications}, 33467 year = {1992}, 33468 pages = {153--164} 33469} 33470 33471@InCollection{ mangasarian:least, 33472 author = {O. L. Mangasarian}, 33473 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 33474 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 33475 year = {1990}, 33476 publisher = {Oxford University Press}, 33477 address = {New York}, 33478 pages = {217--221} 33479} 33480 33481@Article{ mangasarian:least-norm, 33482 author = {O. L. Mangasarian}, 33483 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 33484 Problem}, 33485 journal = {Journal of Mathematical Analysis and Applications}, 33486 year = {1983}, 33487 volume = {92}, 33488 pages = {240--251} 33489} 33490 33491@Article{ mangasarian:linear, 33492 author = {O. L. Mangasarian}, 33493 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 33494 journal = {Mathematical Programming}, 33495 year = {1976}, 33496 volume = {10}, 33497 pages = {263--270} 33498} 33499 33500@Article{ mangasarian:linear*1, 33501 author = {O. L. Mangasarian}, 33502 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 33503 journal = {Operations Research}, 33504 year = {1965}, 33505 volume = {13}, 33506 pages = {444--452} 33507} 33508 33509@Article{ mangasarian:locally, 33510 author = {O. L. Mangasarian}, 33511 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 33512 Complementarity Problems}, 33513 journal = {Mathematical Programming}, 33514 year = {1980}, 33515 volume = {19}, 33516 pages = {200--212} 33517} 33518 33519@InCollection{ mangasarian:machine, 33520 author = {O. L. Mangasarian}, 33521 title = {Machine Learning via Polyhedral Concave Minimization}, 33522 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 33523 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 33524 pages = {175-188}, 33525 year = {1996}, 33526 address = {Heidelberg}, 33527 publisher = {Physica-Verlag A Springer-Verlag Company} 33528} 33529 33530@Article{ mangasarian:mathematical, 33531 author = {O. L. Mangasarian}, 33532 title = {Mathematical Programming in Neural Networks}, 33533 journal = {ORSA Journal on Computing}, 33534 volume = {5}, 33535 pages = {349--360}, 33536 year = {1993} 33537} 33538 33539@InProceedings{ mangasarian:mathematical*1, 33540 author = {O. L. Mangasarian}, 33541 title = {Mathematical Programming in Machine Learning}, 33542 booktitle = {Nonlinear Optimization and Applications}, 33543 editor = {G. Di Pillo and F. Giannessi}, 33544 publisher = {Plenum Publishing}, 33545 address = {New York}, 33546 pages = {283--295}, 33547 year = {1996} 33548} 33549 33550@Article{ mangasarian:mathematical*2, 33551 author = {O. L. Mangasarian}, 33552 title = {Mathematical Programming in Data Mining}, 33553 journal = {Data Mining and Knowledge Discovery}, 33554 volume = {1}, 33555 year = {1997}, 33556 pages = {183-201} 33557} 33558 33559@Article{ mangasarian:multi-surface, 33560 author = {O. L. Mangasarian}, 33561 title = {Multi-surface Method of Pattern Separation}, 33562 journal = {IEEE Transactions on Information Theory}, 33563 year = {1968}, 33564 volume = {IT-14}, 33565 pages = {801--807} 33566} 33567 33568@Book{ mangasarian:nonlinear, 33569 author = {O. L. Mangasarian}, 33570 title = {Nonlinear Programming}, 33571 year = {1969}, 33572 publisher = {McGraw--Hill}, 33573 address = {New York}, 33574 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 33575} 33576 33577@Article{ mangasarian:normal, 33578 author = {O. L. Mangasarian}, 33579 title = {Normal Solutions of Linear Programs}, 33580 journal = {Mathematical Programming Study}, 33581 year = {1984}, 33582 volume = {22}, 33583 pages = {206--216} 33584} 33585 33586@Article{ mangasarian:optimal, 33587 author = {O. L. Mangasarian}, 33588 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 33589 Linear Programs}, 33590 journal = {Journal of Optimization Theory and Applications}, 33591 year = {1981}, 33592 volume = {35}, 33593 pages = {123--128} 33594} 33595 33596@Article{ mangasarian:parallel, 33597 author = {O. L. Mangasarian}, 33598 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 33599 journal = {SIAM Journal on Control and Optimization}, 33600 volume = {33}, 33601 pages = {1916--1925}, 33602 year = {1995} 33603} 33604 33605@TechReport{ mangasarian:regularized, 33606 author = {O. L. Mangasarian}, 33607 title = {Regularized Linear Programs with Equilibrium Constraints}, 33608 institution = {Computer Sciences Department, University of Wisconsin}, 33609 year = {1997}, 33610 address = {Madison, Wisconsin}, 33611 type = {Mathematical Programming Technical Report}, 33612 number = {97--13}, 33613 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 33614} 33615 33616@Article{ mangasarian:simple, 33617 author = {O. L. Mangasarian}, 33618 title = {A Simple Characterization of Solution Sets of Convex Programs}, 33619 journal = {Operations Research Letters}, 33620 year = {1988}, 33621 volume = {7}, 33622 pages = {21--26} 33623} 33624 33625@Article{ mangasarian:solution, 33626 author = {O. L. Mangasarian}, 33627 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 33628 journal = {Journal of Optimization Theory and Applications}, 33629 year = {1977}, 33630 month = aug, 33631 volume = {22}, 33632 pages = {465--485} 33633} 33634 33635@Article{ mangasarian:stable, 33636 author = {O. L. Mangasarian}, 33637 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 33638 journal = {Linear Algebra and Its Applications}, 33639 year = {1981}, 33640 volume = {41}, 33641 pages = {209--223} 33642} 33643 33644@Article{ mangasarian:sufficiency, 33645 author = {O. L. Mangasarian}, 33646 title = {Sufficiency of Exact Penalty Minimization}, 33647 journal = {SIAM Journal on Control and Optimization}, 33648 year = {1985}, 33649 month = jan, 33650 volume = {23}, 33651 pages = {30--37} 33652} 33653 33654@Article{ mangasarian:unconstrained, 33655 author = {O. L. Mangasarian}, 33656 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 33657 journal = {SIAM Journal on Control and Optimization}, 33658 year = {1975}, 33659 volume = {13}, 33660 pages = {772--791} 33661} 33662 33663@Book{ manne.richels:buying, 33664 author = {A. S. Manne and R. G. Richels}, 33665 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 33666 publisher = {MIT Press}, 33667 year = {1992}, 33668 address = {Cambridge MA} 33669} 33670 33671@Article{ manne.richels:global, 33672 author = {A. S. Manne and R. G. Richels}, 33673 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 33674 journal = {The Energy Journal}, 33675 year = {1991}, 33676 volume = {12}, 33677 pages = {87--107} 33678} 33679 33680@Article{ manne.richels:international, 33681 author = {A. S. Manne and R. G. Richels}, 33682 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 33683 journal = {Economic Review}, 33684 year = {1991}, 33685 volume = {81}, 33686 pages = {135--139} 33687} 33688 33689@Article{ manne.rutherford:international, 33690 author = {A. S. Manne and T. F. Rutherford}, 33691 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 33692 General Equilibrium Model}, 33693 journal = {The Energy Journal}, 33694 year = {1993}, 33695 volume = {14}, 33696 pages = {1--20} 33697} 33698 33699@InCollection{ manne:eta-macro, 33700 author = {A. S. Manne}, 33701 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 33702 booktitle = {Modeling Energy-Economy Interactions}, 33703 year = {1977}, 33704 editor = {C. J. Hitch}, 33705 publisher = {Resources for the Future}, 33706 address = {Washington DC} 33707} 33708 33709@PhDThesis{ maratos:exact, 33710 author = {N. Maratos}, 33711 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 33712 Problems}, 33713 year = {1978}, 33714 school = {Imperial College, University of London} 33715} 33716 33717@Article{ marcotte.dussault:note, 33718 author = {P. Marcotte and J.--P. Dussault}, 33719 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 33720 Inequalities}, 33721 journal = {Operations Research Letters}, 33722 year = {1987}, 33723 volume = {6}, 33724 pages = {35--42} 33725} 33726 33727@Article{ marcotte.zhu:exact, 33728 author = {P. Marcotte and D. L. Zhu}, 33729 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 33730 Problem}, 33731 journal = {Mathematical Programming}, 33732 year = {1996}, 33733 volume = {74}, 33734 pages = {141--158} 33735} 33736 33737@Article{ marcotte:algorithm, 33738 author = {P. Marcotte}, 33739 title = {A New Algorithm for Solving Variational Inequalities with Application to the 33740 Traffic Assignment Problem}, 33741 journal = {Mathematical Programming}, 33742 year = {1985}, 33743 volume = {33}, 33744 pages = {339--351} 33745} 33746 33747@Article{ marcotte:application, 33748 author = {P. Marcotte}, 33749 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 33750 Equilibrium Problems}, 33751 journal = {Information Systems and Operational Research}, 33752 year = {1991}, 33753 volume = {29}, 33754 pages = {258--270} 33755} 33756 33757@Article{ marcotte:network, 33758 author = {P. Marcotte}, 33759 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 33760 journal = {Mathematical Programming}, 33761 year = {1986}, 33762 volume = {34}, 33763 pages = {142--162} 33764} 33765 33766@Article{ markusen.rutherford.ea:el, 33767 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33768 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 33769 journal = {Cuadernos Economicos de Ice}, 33770 year = {1995}, 33771 volume = {59}, 33772 pages = {57--68} 33773} 33774 33775@Article{ markusen.rutherford.ea:trade, 33776 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33777 title = {Trade liberalization in a multinational-dominated industry}, 33778 journal = {Journal of International Economics}, 33779 year = {1995}, 33780 volume = {38}, 33781 pages = {95--118} 33782} 33783 33784@Article{ markusen.rutherford:discrete, 33785 author = {J. R. Markusen and T. F. Rutherford}, 33786 title = {Discrete plant-location decisions in an applied general equilibrium model of 33787 trade liberalization}, 33788 journal = {Weltwirtshchaftliches Archiv}, 33789 year = {1994} 33790} 33791 33792@Article{ markusen.wigle:nash, 33793 author = {J. Markusen and R. Wigle}, 33794 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 33795 Country Size, Scale Economies and Capital Mobility}, 33796 journal = {Journal of Political Mobility}, 33797 year = {1989}, 33798 volume = {97}, 33799 pages = {368--386} 33800} 33801 33802@Article{ marquardt:algorithm, 33803 author = {D. W. Marquardt}, 33804 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 33805 journal = {SIAM Journal on Applied Mathematics}, 33806 year = {1963}, 33807 volume = {11}, 33808 pages = {431--441} 33809} 33810 33811@Article{ martello.toth:algorithm, 33812 author = {S. Martello and P. Toth}, 33813 title = {A New Algorithm for the 0--1 Knapsack Problem}, 33814 journal = {Management Science}, 33815 year = {1988}, 33816 volume = {34}, 33817 pages = {633--644} 33818} 33819 33820@InCollection{ martello.toth:algorithms, 33821 author = {S. Martello and P. Toth}, 33822 title = {Algorithms for Knapsack Problems}, 33823 booktitle = {Surveys in Combinatorial Optimization}, 33824 year = {1987}, 33825 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 33826 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 33827 address = {Amsterdam} 33828} 33829 33830@Article{ martello.toth:mixture, 33831 author = {S. Martello and P. Toth}, 33832 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 33833 Problem}, 33834 journal = {Management Science}, 33835 year = {1984}, 33836 volume = {30}, 33837 pages = {765--771} 33838} 33839 33840@Article{ martello.toth:worst-case, 33841 author = {S. Martello and P. Toth}, 33842 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 33843 journal = {Mathematical Programming}, 33844 year = {1984}, 33845 volume = {28}, 33846 pages = {198--205} 33847} 33848 33849@Article{ martinet:regularisation, 33850 author = {Bernard Martinet}, 33851 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 33852 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 33853 year = {1970}, 33854 volume = {4}, 33855 pages = {154--159} 33856} 33857 33858@Article{ maskin.tirole:theory, 33859 author = {E. Maskin and J. Tirole}, 33860 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 33861 fixed costs}, 33862 journal = {Econometrica}, 33863 volume = {56}, 33864 year = {1988}, 33865 pages = {549--569} 33866} 33867 33868@Article{ maskin.tirole:theory*1, 33869 author = {E. Maskin and J. Tirole}, 33870 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 33871 Edgeworth cycles}, 33872 journal = {Econometrica}, 33873 volume = {56}, 33874 year = {1988}, 33875 pages = {571--579} 33876} 33877 33878@Article{ maskus.rutherford.ea:economic, 33879 author = {K. Maskus and T. F. Rutherford and S. Selby}, 33880 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 33881 {M}exico}, 33882 journal = {North American Journal of Economics and Finance}, 33883 year = {1996} 33884} 33885 33886@Article{ mastor:experimental, 33887 author = {A. A. Mastor}, 33888 title = {An Experimental Investigation and Comparative Evaluation of Production Line 33889 Balancing Techniques}, 33890 journal = {Management Science}, 33891 year = {1970}, 33892 volume = {16}, 33893 pages = {728--746} 33894} 33895 33896@Article{ mathias.pang:error, 33897 author = {R. Mathias and J. S. Pang}, 33898 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 33899 journal = {Linear Algebra and Its Applications}, 33900 year = {1990}, 33901 volume = {132}, 33902 pages = {123--136} 33903} 33904 33905@Article{ mathiesen:algorithm, 33906 author = {L. Mathiesen}, 33907 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 33908 {W}alrasian Equilibrium Model: An Example}, 33909 journal = {Mathematical Programming}, 33910 year = {1987}, 33911 volume = {37}, 33912 pages = {1--18} 33913} 33914 33915@Article{ mathiesen:computation, 33916 author = {L. Mathiesen}, 33917 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 33918 Problems}, 33919 journal = {Mathematical Programming Study}, 33920 year = {1985}, 33921 volume = {23}, 33922 pages = {144--162} 33923} 33924 33925@Article{ mathiesen:computational, 33926 author = {L. Mathiesen}, 33927 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 33928 Complementarity Problems}, 33929 journal = {Operations Research}, 33930 year = {1985}, 33931 volume = {33}, 33932 pages = {1225--1250} 33933} 33934 33935@Book{ matlab:users, 33936 author = {{MATLAB}}, 33937 title = {User's Guide}, 33938 year = {1992}, 33939 publisher = {The MathWorks, Inc.} 33940} 33941 33942@Book{ mcclelland.rummelhart:explorations, 33943 author = {J. L. McClelland and D. E. Rummelhart}, 33944 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 33945 Programs, and Exercises}, 33946 year = {1987}, 33947 publisher = {MIT Press}, 33948 address = {Cambridge, Massachusetts} 33949} 33950 33951@Article{ mccormick:modification, 33952 author = {G. P. McCormick}, 33953 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 33954 journal = {Mathematical Programming}, 33955 year = {1977}, 33956 volume = {13}, 33957 pages = {111--115} 33958} 33959 33960@Book{ mccormick:nonlinear, 33961 author = {G. P. McCormick}, 33962 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 33963 year = {1983}, 33964 publisher = {John Wiley \& Sons}, 33965 address = {New York} 33966} 33967 33968@Article{ mcculloch.pitts:logical, 33969 author = {W. McCulloch and W. Pitts}, 33970 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 33971 journal = {Bulletin of Mathematical Biophysics}, 33972 year = {1943}, 33973 volume = {7}, 33974 pages = {115--133} 33975} 33976 33977@TechReport{ mckenna.zenios:optimal, 33978 author = {M. McKenna and S. A. Zenios}, 33979 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 33980 institution = {Thinking Machines Corporation}, 33981 year = {1990}, 33982 type = {Working Paper}, 33983 address = {Cambridge, MA} 33984} 33985 33986@Article{ mckinnon:convergence, 33987 author = {K. I. M. McKinnon}, 33988 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 33989 journal = {SIAM Journal on Optimization}, 33990 year = {1998}, 33991 volume = {9}, 33992 pages = {148--158} 33993} 33994 33995@Article{ mcshane.monma.ea:implementation, 33996 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 33997 title = {An implementation of a primal-dual interior point method for linear programming}, 33998 journal = {ORSA Journal of Computing}, 33999 year = {1989}, 34000 volume = {1}, 34001 pages = {70--83} 34002} 34003 34004@PhDThesis{ medhi:decomposition, 34005 author = {D. Medhi}, 34006 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 34007 Optimization}, 34008 school = {Computer Sciences Department, University of Wisconsin}, 34009 year = {1987}, 34010 address = {Madison, Wisconsin}, 34011 note = {Technical Report 718} 34012} 34013 34014@Article{ medhi:parallel, 34015 author = {D. Medhi}, 34016 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 34017 Programming Problems}, 34018 journal = {Annals of Operations Research}, 34019 year = {1990}, 34020 volume = {22}, 34021 pages = {101--127} 34022} 34023 34024@Article{ megiddo:complexity, 34025 author = {N. Megiddo}, 34026 title = {On the complexity of polyhedral separability}, 34027 journal = {Discrete and Computational Geometry}, 34028 year = {1988}, 34029 volume = {3}, 34030 pages = {325--337} 34031} 34032 34033@Article{ megiddo:finding, 34034 author = {N. Megiddo}, 34035 title = {On Finding Primal-- and Dual--Optimal Bases}, 34036 journal = {ORSA Journal on Computing}, 34037 year = {1991}, 34038 volume = {3}, 34039 pages = {63--65} 34040} 34041 34042@Article{ mehrotra:implementation, 34043 author = {S. Mehrotra}, 34044 title = {On the implementation of a primal-dual interior point method}, 34045 journal = {SIAM Journal on Optimization}, 34046 year = {1992}, 34047 volume = {2}, 34048 pages = {575--601} 34049} 34050 34051@PhDThesis{ merrill:applications, 34052 author = {O. H. Merrill}, 34053 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 34054 Semicontinuous Point to Set Mappings}, 34055 year = {1972}, 34056 school = {University of Michigan} 34057} 34058 34059@Article{ merten.muller:variance, 34060 author = {A. G. Merten and M. E. Muller}, 34061 title = {Variance Minimization in Single Machine Sequencing Problems}, 34062 journal = {Management Science}, 34063 year = {1972}, 34064 volume = {18}, 34065 pages = {518--528} 34066} 34067 34068@TechReport{ meyer:continuity, 34069 author = {R. R. Meyer}, 34070 title = {Continuity Properties of Linear Programs}, 34071 institution = {Computer Sciences Department, University of Wisconsin}, 34072 year = {1979}, 34073 address = {Madison, Wisconsin}, 34074 number = {373} 34075} 34076 34077@Article{ miersemann.mittelmann:continuation, 34078 author = {E. Miersemann and H. D. Mittelmann}, 34079 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 34080 journal = {Journal of Computational and Applied Mathematics}, 34081 year = {1989}, 34082 volume = {26}, 34083 pages = {23--34} 34084} 34085 34086@Article{ mifflin:semismooth, 34087 author = {R. Mifflin}, 34088 title = {Semismooth and semiconvex functions in constrained optimization}, 34089 journal = {SIAM Journal on Control and Optimization}, 34090 year = {1977}, 34091 volume = {15}, 34092 pages = {957--972} 34093} 34094 34095@Article{ mifflin:stable, 34096 author = {R. Mifflin}, 34097 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 34098 journal = {Mathematical Programming}, 34099 vol = {16}, 34100 pages = {141--158}, 34101 year = {1979} 34102} 34103 34104@Book{ miller:survival, 34105 author = {Jr. R. G. Miller}, 34106 title = {Survival Analysis}, 34107 year = {1981}, 34108 publisher = {John Wiley \& Sons}, 34109 address = {New York} 34110} 34111 34112@Book{ minsky.papert:perceptrons, 34113 author = {M. Minsky and S. Papert}, 34114 title = {Perceptrons: An Introduction to Computational Geometry}, 34115 year = {1969}, 34116 publisher = {MIT Press}, 34117 address = {Cambridge, Massachusetts} 34118} 34119 34120@Article{ minty:monotone, 34121 author = {G. J. Minty}, 34122 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 34123 journal = {Duke Mathematics Journal}, 34124 year = {1962}, 34125 volume = {29}, 34126 pages = {341--346} 34127} 34128 34129@Article{ minty:monotonicity, 34130 author = {G. J. Minty}, 34131 title = {On the Monotonicity of the Gradient of a Convex Function}, 34132 journal = {Pacific Journal of Mathematics}, 34133 year = {1964}, 34134 volume = {14}, 34135 pages = {243--247} 34136} 34137 34138@TechReport{ mizuno.jarre.ea:unified, 34139 author = {S. Mizuno and F. Jarre and J. Stoer}, 34140 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 34141 linear complementarity problems}, 34142 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 34143 address = {W{\"{u}}rzburg, Germany}, 34144 year = {1994}, 34145 number = {Nr. 213}, 34146 type = {Preprint} 34147} 34148 34149@TechReport{ mizuno:polynomiality, 34150 author = {S. Mizuno}, 34151 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 34152 for linear programming}, 34153 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 34154 year = {1993}, 34155 number = {1006}, 34156 address = {Ithaca, New York}, 34157 month = jan 34158} 34159 34160@Article{ mohan.mageras.ea:clinically, 34161 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 34162 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 34163 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 34164 journal = {Medical Physics}, 34165 year = {1992}, 34166 volume = {19}, 34167 number = {4}, 34168 pages = {933--944} 34169} 34170 34171@Article{ mohan:field, 34172 author = {R. Mohan}, 34173 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 34174 Collimation}, 34175 journal = {Seminars in Radiation Oncology}, 34176 year = {1995}, 34177 volume = {5}, 34178 number = {2}, 34179 pages = {86--99} 34180} 34181 34182@Article{ monteiro.pang.ea:positive, 34183 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 34184 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 34185 journal = {SIAM Journal on Optimization}, 34186 year = {1995}, 34187 volume = {5}, 34188 pages = {129--148} 34189} 34190 34191@Article{ monteiro.tsuchiya:limiting, 34192 author = {R. D. C. Monteiro and T. Tsuchiya}, 34193 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 34194 Monotone Horizontal Linear Complementarity Problem}, 34195 year = {1996}, 34196 journal = {Mathematics of Operations Research}, 34197 pages = {793--814}, 34198 volume = {21} 34199} 34200 34201@Article{ monteiro.wright:local, 34202 author = {R. D. C. Monteiro and S. J. Wright}, 34203 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 34204 journal = {Computational Optimization and Applications}, 34205 year = {1994}, 34206 volume = {3}, 34207 pages = {131--155} 34208} 34209 34210@Article{ monteiro.wright:superlinear, 34211 author = {R. D. C. Monteiro and S. J. Wright}, 34212 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 34213 year = {1996}, 34214 journal = {SIAM Journal on Optimization}, 34215 volume = {6}, 34216 pages = {1--18} 34217} 34218 34219@Article{ monteiro.wright:superlinear*1, 34220 author = {R. D. C. Monteiro and S. J. Wright}, 34221 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 34222 journal = {Mathematical Programming}, 34223 year = {1995}, 34224 volume = {69}, 34225 pages = {311--333} 34226} 34227 34228@Article{ more.garbow.ea:testing, 34229 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 34230 title = {Testing Unconstrained Optimization Software}, 34231 journal = {ACM Transactions on Mathematical Software}, 34232 year = {1981}, 34233 volume = {7}, 34234 pages = {17--41} 34235} 34236 34237@Article{ more.rheinboldt:p, 34238 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 34239 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 34240 Mappings}, 34241 journal = {Linear Algebra and Its Applications}, 34242 year = {1973}, 34243 volume = {6}, 34244 pages = {45--68} 34245} 34246 34247@Article{ more.sorensen:use, 34248 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34249 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 34250 journal = {Mathematical Programming}, 34251 year = {1979}, 34252 volume = {16}, 34253 pages = {1--20} 34254} 34255 34256@Article{ more.sorensen:computing, 34257 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34258 title = {Computing a Trust Region Step}, 34259 journal = {SIAM Journal on Scientific and Statistical Computing}, 34260 year = {1983}, 34261 volume = {4}, 34262 pages = {553--572} 34263} 34264 34265@Article{ more.toraldo:solution, 34266 author = {J. J. Mor\'e and G. Toraldo}, 34267 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 34268 journal = {SIAM Journal on Optimization}, 34269 year = {1991}, 34270 volume = {1}, 34271 pages = {93--113} 34272} 34273 34274@TechReport{ more.vavasis:solution, 34275 author = {J. J. Mor\'{e} and S. A. Vavasis}, 34276 title = {On the Solution of Concave Knapsack Problems}, 34277 institution = {Argonne National Laboratory}, 34278 year = {1988}, 34279 address = {Argonne, Illinois}, 34280 number = {ANL/MCS--P40--1288}, 34281 type = {Mathematics and Computer Science Division Report} 34282} 34283 34284@Book{ more.wright:optimization, 34285 author = {J. J. Mor\'{e} and S. J. Wright}, 34286 title = {Optimization Software Guide}, 34287 publisher = {SIAM}, 34288 address = {Philadelphia, Pennsylvania}, 34289 series = {Frontiers in Applied Mathematics}, 34290 number = {14}, 34291 year = {1993} 34292} 34293 34294@TechReport{ more.wu:global, 34295 author = {J. J. Mor\'{e} and Z. Wu}, 34296 title = {Global Continuation for Distance Geometry Problems}, 34297 institution = {Argonne National Laboratory}, 34298 year = {1995}, 34299 type = {Preprint}, 34300 number = {MCS-P505-0395}, 34301 address = {Argonne, Illinois} 34302} 34303 34304@TechReport{ more.wu:issues, 34305 author = {J. J. Mor\'{e} and Z. Wu}, 34306 title = {Issues in Large-Scale Global Molecular Optimization}, 34307 institution = {Argonne National Laboratory}, 34308 year = {1995}, 34309 type = {Preprint}, 34310 number = {MCS-P539-1095}, 34311 address = {Argonne, Illinois} 34312} 34313 34314@TechReport{ more:collection, 34315 author = {J. J. Mor\'e}, 34316 title = {A Collection of Nonlinear Model Problems}, 34317 institution = {Argonne National Laboratory}, 34318 year = {1989}, 34319 type = {Preprint}, 34320 address = {Argonne, Illinois}, 34321 number = {MCS-P60-0289} 34322} 34323 34324@Article{ more:global, 34325 author = {J. J. Mor\'e}, 34326 title = {Global Methods for Nonlinear Complementarity Problems}, 34327 year = {1996}, 34328 journal = {Mathematics of Operations Research}, 34329 pages = {589--614}, 34330 volume = {21} 34331} 34332 34333@Article{ moreau:proximite, 34334 author = {J.--J. Moreau}, 34335 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 34336 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 34337 year = {1965}, 34338 volume = {93}, 34339 pages = {273--299} 34340} 34341 34342@Article{ morrill.lane.ea:dose-volume, 34343 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 34344 title = {Dose-volume considerations with linear programming}, 34345 journal = {Medical Physics}, 34346 year = {1991}, 34347 volume = {18}, 34348 number = {6}, 34349 pages = {1201--1210} 34350} 34351 34352@Article{ morrill:very, 34353 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 34354 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 34355 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34356 year = {1995}, 34357 volume = {31}, 34358 pages = {179--188} 34359} 34360 34361@TechReport{ morshedi.tapia:karmarkar, 34362 author = {A. M. Morshedi and R. A. Tapia}, 34363 title = {Karmarkar as a Classical Method}, 34364 institution = {Department of Mathematical Sciences, Rice University}, 34365 year = {1987}, 34366 number = {87--7}, 34367 type = {Technical Report} 34368} 34369 34370@Article{ mosco:dual, 34371 author = {U. Mosco}, 34372 title = {Dual Variational Inequalities}, 34373 journal = {Journal of Mathematical Analysis and its Applications}, 34374 year = {1972}, 34375 volume = {40}, 34376 pages = {202--206} 34377} 34378 34379@Article{ motzkin.schoenberg:relaxation, 34380 author = {T. S. Motzkin and I. J. Schoenberg}, 34381 title = {The relaxation method for linear inequalities}, 34382 journal = {Canadian Journal of Mathematics}, 34383 year = {1954}, 34384 volume = {6}, 34385 pages = {393--404} 34386} 34387 34388@InProceedings{ muhlenbein:parallel, 34389 crossref = {schaeffer:third}, 34390 author = {H. M{\"{}u}hlenbein}, 34391 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 34392 pages = {416--421} 34393} 34394 34395@Article{ mukhopadhyay.roy.ea:polynomial, 34396 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 34397 title = {A polynomial time algorithm for generating neural networks for pattern 34398 classification: Its stability properties and some test results}, 34399 journal = {Neural Computation}, 34400 year = {1993}, 34401 volume = {5}, 34402 pages = {317--330} 34403} 34404 34405@Article{ mulvey.ruszczynski:diagonal, 34406 author = {J. M. Mulvey and A. Ruszczynski}, 34407 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 34408 journal = {Operations Research Letters}, 34409 year = {1992}, 34410 volume = {12}, 34411 pages = {205--215} 34412} 34413 34414@TechReport{ mulvey.ruszczynski:scenario, 34415 author = {J. M. Mulvey and A. Ruszczynski}, 34416 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 34417 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 34418 year = {1991}, 34419 address = {Princeton, New Jersey}, 34420 number = {SOR 91-19}, 34421 type = {Technical Report} 34422} 34423 34424@PhDThesis{ munson:algorithms, 34425 author = {T. S. Munson}, 34426 title = {Algorithms and Environments for Complementarity}, 34427 school = {University of Wisconsin--Madison}, 34428 year = {2000}, 34429 address = {Madison, Wisconsin}, 34430 month = aug, 34431 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 34432} 34433 34434@Article{ munson.facchinei.ea:semismooth, 34435 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 34436 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 34437 journal = {INFORMS Journal on Computing}, 34438 year = {2001}, 34439 volume = {forthcoming} 34440} 34441 34442@Article{ murchland:braess, 34443 author = {J. D. Murchland}, 34444 title = {Braess' Paradox of Traffic Flow}, 34445 journal = {Transportation Research}, 34446 year = {1970}, 34447 volume = {4}, 34448 pages = {391--394} 34449} 34450 34451@Unpublished{ murphy.aha:uci, 34452 author = {P. M. Murphy and D. W. Aha}, 34453 title = {{UCI} Repository of Machine Learning Databases}, 34454 year = {1992}, 34455 note = {Department of Information and Computer Science, University of California, Irvine, 34456 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 34457} 34458 34459@Book{ murphy.lawrence.ea:american, 34460 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 34461 title = {American Cancer Society Textbook of Clinical Oncology}, 34462 publisher = {The American Cancer Society, Inc.}, 34463 address = {Atlanta, Georgia}, 34464 year = {1995} 34465} 34466 34467@Article{ murphy.sherali.ea:mathematical, 34468 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 34469 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 34470 Equilibrium}, 34471 journal = {Mathematical Programming}, 34472 year = {1982}, 34473 volume = {24}, 34474 pages = {92--106} 34475} 34476 34477@TechReport{ murtagh.saunders:minos, 34478 author = {B. A. Murtagh and M. A. Saunders}, 34479 title = {{MINOS} 5.0 User's Guide}, 34480 institution = {Stanford University}, 34481 address = {Stanford, California}, 34482 year = {1983}, 34483 number = {{SOL} 83.20}, 34484 type = {Technical Report} 34485} 34486 34487@InProceedings{ murthy.kasif.ea:oc1, 34488 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 34489 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 34490 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 34491 year = {1993}, 34492 publisher = {The AAAI Press/The MIT Press}, 34493 address = {Cambridge, MA 02142}, 34494 pages = {322--327} 34495} 34496 34497@Book{ murty:linear, 34498 author = {K. G. Murty}, 34499 title = {Linear Complementarity, Linear and Nonlinear Programming}, 34500 year = {1988}, 34501 publisher = {Helderman-Verlag}, 34502 address = {Berlin} 34503} 34504 34505@Book{ murty:linear*1, 34506 author = {K. G. Murty}, 34507 title = {Linear Programming}, 34508 year = {1983}, 34509 publisher = {John Wiley \& Sons}, 34510 address = {New York} 34511} 34512 34513@Article{ murty:number, 34514 author = {K. G. Murty}, 34515 title = {On the number of solutions of the complementarity problem and spanning properties 34516 of cones}, 34517 journal = {Linear Algebra and Its Applications}, 34518 year = {1972}, 34519 volume = {5}, 34520 pages = {65--108} 34521} 34522 34523@Book{ murty:linear*2, 34524 author = {K. G. Murty}, 34525 title = {Linear and Combinatorial Programming}, 34526 year = {1976}, 34527 publisher = {John Wiley \& Sons}, 34528 address = {New York} 34529} 34530 34531@Book{ nagurney:network, 34532 author = {A. Nagurney}, 34533 title = {Network Economics -- {A} Variational Inequality Approach}, 34534 publisher = {Kluwer Academic Publishers}, 34535 year = {1993}, 34536 address = {Dordrecht, The Netherlands} 34537} 34538 34539@Article{ nash.nocedal:numerical, 34540 author = {S. G. Nash and J. Nocedal}, 34541 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 34542 Method for Large Scale Optimization}, 34543 journal = {SIAM Journal on Optimization}, 34544 year = {1991}, 34545 volume = {3}, 34546 pages = {358--372} 34547} 34548 34549@Article{ nash:equilibrium, 34550 author = {J. F. Nash}, 34551 title = {Equilibrium Points in {N}--Person Games}, 34552 journal = {Proceedings of the National Academy of Sciences}, 34553 year = {1950}, 34554 volume = {36}, 34555 pages = {48--49} 34556} 34557 34558@Article{ nash:non-cooperative, 34559 author = {J. F. Nash}, 34560 title = {Non-cooperative games}, 34561 journal = {Annals of Mathematics}, 34562 year = {1951}, 34563 volume = {54}, 34564 pages = {286--295} 34565} 34566 34567@Article{ nash:newton-type, 34568 author = {S. G. Nash}, 34569 title = {{N}ewton--Type Minimization via {L}anczos Method}, 34570 journal = {SIAM Journal on Numerical Analysis}, 34571 year = {1984}, 34572 volume = {21}, 34573 pages = {770--788} 34574} 34575 34576@Article{ nauss:efficient, 34577 author = {R. M. Nauss}, 34578 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 34579 journal = {Management Science}, 34580 year = {1976}, 34581 volume = {23}, 34582 pages = {27--31} 34583} 34584 34585@Book{ nazareth:computer, 34586 author = {J. L. Nazareth}, 34587 title = {Computer Solution of Linear Programs}, 34588 year = {1987}, 34589 publisher = {Oxford University Press}, 34590 address = {Oxford} 34591} 34592 34593@Article{ nelder.mead:simplex, 34594 title = {A Simplex Method for Function Minimization}, 34595 author = {J. A. Nelder and R. Mead}, 34596 journal = {Computer Journal}, 34597 volume = {7}, 34598 pages = {308--313}, 34599 year = {1965} 34600} 34601 34602@Article{ nemhauser.savelsbergh.ea:minto, 34603 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 34604 title = {{MINTO}, {A} Mixed Integer Optimizer}, 34605 journal = {Operations Research Letters}, 34606 year = {1994}, 34607 optkey = {}, 34608 optvolume = {15}, 34609 optnumber = {}, 34610 optpages = {47--58}, 34611 optmonth = {}, 34612 optnote = {}, 34613 optannote = {} 34614} 34615 34616@Book{ nemhauser.wolsey:integer, 34617 author = {G. L. Nemhauser and L. A. Wolsey}, 34618 title = {Integer and Combinatorial Optimization}, 34619 publisher = {John Wiley \& Sons}, 34620 year = {1988}, 34621 address = {New York, NY} 34622} 34623 34624@Article{ nestor.pasurka:alternative, 34625 author = {D. Vaughn Nestor and C. Pasurka}, 34626 title = {Alternative Specifications for Environmental Control Costs in a General 34627 Equilibrium Framework}, 34628 journal = {Economics Letters}, 34629 year = {1995}, 34630 volume = {48}, 34631 pages = {273--280} 34632} 34633 34634@Article{ nestor.pasurka:cge, 34635 author = {D. Vaughn Nestor and C. Pasurka}, 34636 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 34637 of Environmental Policy}, 34638 journal = {Economic Modelling}, 34639 year = {1995}, 34640 volume = {12}, 34641 pages = {53--59} 34642} 34643 34644@Article{ newman.shapiro:theorems, 34645 author = {D. J. Newman and H. S. Shapiro}, 34646 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 34647 journal = {Duke Mathematical Journal}, 34648 year = {1963}, 34649 volume = {30}, 34650 pages = {673--682} 34651} 34652 34653@Article{ ng.peyton:block, 34654 author = {E. Ng and B. Peyton}, 34655 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 34656 journal = {SIAM Journal on Scientific and Statistical Computing}, 34657 year = {1993}, 34658 volume = {14}, 34659 pages = {1034--1056} 34660} 34661 34662@TechReport{ nielsen.zenios:solving, 34663 author = {S. S. Nielsen and S. A. Zenios}, 34664 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 34665 Algorithms}, 34666 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 34667 year = {1992}, 34668 address = {Philadelphia}, 34669 number = {92-01-05} 34670} 34671 34672@Article{ niemierko:optimization, 34673 author = {A. Niemierko}, 34674 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 34675 Points and Constraints}, 34676 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34677 year = {1992}, 34678 volume = {23}, 34679 pages = {99--108} 34680} 34681 34682@InCollection{ niemierko:treatment, 34683 author = {A. Niemierko}, 34684 title = {Treatment Plan Optimization}, 34685 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 34686 editor = {J. A. Purdy and B. Emami}, 34687 publisher = {Medical Physics Publishing}, 34688 year = {1993}, 34689 pages = {49--55}, 34690 address = {St. Louis, Missouri} 34691} 34692 34693@Article{ niemireko:optimization, 34694 author = {A. Niemierko}, 34695 title = {Optimization of intensity modulated beams: Local or global optimum?}, 34696 journal = {Medical Physics}, 34697 year = {1996}, 34698 optvolume = {23}, 34699 optpages = {1072} 34700} 34701 34702@Manual{ nih:radiation, 34703 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 34704 author = {N. C. I. National Institutes of Health}, 34705 organization = {NIH Publication}, 34706 address = {Bethesda, Maryland}, 34707 edition = {97-2227}, 34708 year = {1997} 34709} 34710 34711@Book{ nilsson:learning, 34712 author = {N. J. Nilsson}, 34713 title = {Learning Machines}, 34714 year = {1966}, 34715 publisher = {MIT Press}, 34716 address = {Cambridge, Massachusetts} 34717} 34718 34719@Article{ nocedal:theory, 34720 author = {J. Nocedal}, 34721 title = {Theory of Algorithms for Unconstrained Optimization}, 34722 journal = {Acta Numerica}, 34723 year = {1992}, 34724 pages = {199--242} 34725} 34726 34727@InProceedings{ noyes:neural, 34728 author = {J. L. Noyes}, 34729 title = {Neural Network Optimization Methods}, 34730 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 34731 Processing}, 34732 year = {1991}, 34733 publisher = {Indiana-Purdue University}, 34734 address = {Fort Wayne, Indiana}, 34735 pages = {1--12} 34736} 34737 34738@Article{ nygard.juell.ea:neural, 34739 author = {K. E. Nygard and P. Juell and N. Kadaba}, 34740 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 34741 journal = {ORSA Journal on Computing}, 34742 year = {1990}, 34743 volume = {4}, 34744 pages = {353--364} 34745} 34746 34747@Article{ oh.goenka:elastohydrodynamic, 34748 author = {K. P. Oh and P. K. Goenka}, 34749 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 34750 journal = {Transactions of the {ASME}, Journal of Tribology}, 34751 volume = {107}, 34752 year = {1985}, 34753 pages = {389--395} 34754} 34755 34756@Article{ oh.li.ea:elastohydrodynamic, 34757 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 34758 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 34759 journal = {Transactions of the {ASME}, Journal of Tribology}, 34760 volume = {109}, 34761 pages = {356--362}, 34762 year = {1987} 34763} 34764 34765@Article{ oh:analysis, 34766 author = {K. P. Oh}, 34767 title = {Analysis of a Needle Bearing}, 34768 journal = {Transactions of the {ASME}, Journal of Tribology}, 34769 volume = {106}, 34770 pages = {78--87}, 34771 year = {1984} 34772} 34773 34774@Article{ oh:formulation, 34775 author = {K. P. Oh}, 34776 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 34777 Complementarity Problem}, 34778 journal = {Transactions of the {ASME}, Journal of Tribology}, 34779 volume = {108}, 34780 year = {1986}, 34781 pages = {598--604} 34782} 34783 34784@Article{ oh:numerical, 34785 author = {K. P. Oh}, 34786 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 34787 Nonlinear Complementarity Problem}, 34788 journal = {Transactions of the {ASME}, Journal of Tribology}, 34789 volume = {106}, 34790 year = {1984}, 34791 pages = {88--95} 34792} 34793 34794@Article{ olivera.shepard.ea:maximum, 34795 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 34796 and E. E. Fitchard and T. R. Mackie}, 34797 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 34798 journal = {Physics in Medicine and Biology}, 34799 year = {1998}, 34800 pages = {3277--3294} 34801} 34802 34803@Article{ opial:weak, 34804 author = {Z. Opial}, 34805 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 34806 Mappings}, 34807 journal = {Bulletin of the American Mathematical Society}, 34808 year = {1967}, 34809 volume = {73}, 34810 pages = {591--597} 34811} 34812 34813@Book{ orchard-hays:advanced, 34814 author = {W. Orchard--Hays}, 34815 title = {Advanced Linear Programming Computing Techniques}, 34816 year = {1968}, 34817 publisher = {McGraw--Hill}, 34818 address = {New York} 34819} 34820 34821@Article{ orourke.taylor.ea:factor, 34822 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 34823 title = {Factor price convergence in the late nineteenth century}, 34824 journal = {International Economic Review}, 34825 year = {1996} 34826} 34827 34828@Article{ orourke.williamson:open, 34829 author = {K. O'Rourke and J. G. Williamson}, 34830 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 34831 accounting}, 34832 journal = {Scandinavian Economic and Social History}, 34833 year = {1995}, 34834 volume = {XLIII}, 34835 pages = {171--203} 34836} 34837 34838@Article{ orourke:costs, 34839 author = {K. O'Rourke}, 34840 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 34841 journal = {Research in Economic History}, 34842 year = {1995}, 34843 volume = {15}, 34844 pages = {215--259} 34845} 34846 34847@Article{ orourke:industrial, 34848 author = {K. O'Rourke}, 34849 title = {Industrial policy, employment policy and the non-traded sector}, 34850 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 34851 year = {1996} 34852} 34853 34854@Article{ orourke:measuring, 34855 author = {K. O'Rourke}, 34856 title = {Measuring protection: a cautionary tale}, 34857 journal = {Journal of Development Economics}, 34858 year = {1996} 34859} 34860 34861@Book{ ortega.rheinboldt:iterative, 34862 author = {J. M. Ortega and W. C. Rheinboldt}, 34863 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 34864 year = {1970}, 34865 publisher = {Academic Press}, 34866 address = {San Diego, California} 34867} 34868 34869@Book{ ortega:introduction, 34870 author = {J. M. Ortega}, 34871 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 34872 year = {1988}, 34873 publisher = {Plenum Press}, 34874 address = {New York} 34875} 34876 34877@Book{ ortega:numerical, 34878 author = {J. M. Ortega}, 34879 title = {Numerical Analysis, {A} Second Course}, 34880 year = {1972}, 34881 publisher = {Academic Press} 34882} 34883 34884@Article{ osborne.womersley:strong, 34885 author = {M. R. Osborne and R. S. Womersley}, 34886 title = {Strong uniqueness in sequential linear programming}, 34887 journal = {Journal of the Australian Mathematical Society, Series B}, 34888 year = {1990}, 34889 volume = {31}, 34890 pages = {379--384} 34891} 34892 34893@InCollection{ osborne:strong, 34894 author = {M. R. Osborne}, 34895 title = {Strong uniqueness in nonlinear approximation}, 34896 booktitle = {The numerical solution of nonlinear problems}, 34897 year = {1981}, 34898 editor = {C. T. H. Baker and C. Phillips}, 34899 publisher = {Clarendon Press}, 34900 address = {Oxford} 34901} 34902 34903@Book{ outrata.kocvara.ea:nonsmooth, 34904 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 34905 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 34906 publisher = {Kluwer Academic Publishers}, 34907 year = {1998}, 34908 address = {Dordrecht, The Netherlands} 34909} 34910 34911@Article{ outrata.zowe:numerical, 34912 author = {J. V. Outrata and J. Zowe}, 34913 title = {A Numerical Approach to Optimization Problems with Variational Inequality 34914 Constraints}, 34915 journal = {Mathematical Programming}, 34916 year = {1995}, 34917 volume = {68}, 34918 pages = {105--130} 34919} 34920 34921@Article{ outrata:necessary, 34922 author = {J. V. Outrata}, 34923 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 34924 journal = {Journal of Optimization Theory and Applications}, 34925 volume = {76}, 34926 year = {1993}, 34927 pages = {305--320} 34928} 34929 34930@Article{ outrata:numerical, 34931 author = {J. V. Outrata}, 34932 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 34933 journal = {Zeitschrift f{\"{u}}r Operations Research}, 34934 volume = {4}, 34935 year = {1990}, 34936 pages = {255--278} 34937} 34938 34939@Article{ outrata:optimization, 34940 author = {J. V. Outrata}, 34941 title = {On Optimization Problems with Variational Inequality Constraints}, 34942 journal = {SIAM Journal on Optimization}, 34943 volume = {4}, 34944 year = {1994}, 34945 pages = {340--357} 34946} 34947 34948@Article{ paige.saunders:lsqr, 34949 author = {C. C. Paige and M. A. Saunders}, 34950 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 34951 journal = {{ACM} Transactions on Mathematical Software}, 34952 year = {1982}, 34953 volume = {8}, 34954 pages = {43--71} 34955} 34956 34957@Article{ paige.saunders:solution, 34958 author = {C. C. Paige and M. A. Saunders}, 34959 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 34960 journal = {SIAM Journal on Numerical Analysis}, 34961 year = {1975}, 34962 volume = {12}, 34963 pages = {617--629} 34964} 34965 34966@Article{ palacios-gomez.lasdon.ea:nonlinear, 34967 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 34968 title = {Nonlinear Optimization by Successive Linear Programming}, 34969 journal = {Management Science}, 34970 year = {1982}, 34971 volume = {28}, 34972 pages = {1106--1120} 34973} 34974 34975@Article{ palomares.mangasarian:superlinearly, 34976 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 34977 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 34978 Optimization Problems}, 34979 journal = {Mathematical Programming}, 34980 year = {1976}, 34981 volume = {11}, 34982 pages = {1--13} 34983} 34984 34985@Article{ panagiotopoulos.al-fahed:robot, 34986 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 34987 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 34988 journal = {The International Journal of Robotics Research}, 34989 year = {1994}, 34990 volume = {13}, 34991 pages = {127--136} 34992} 34993 34994@Book{ panagiotopoulos:hemivariational, 34995 author = {P. D. Panagiotopoulos}, 34996 title = {Hemivariational Inequalities}, 34997 publisher = {Springer-Verlag}, 34998 address = {Berlin}, 34999 year = {1993} 35000} 35001 35002@Book{ panagiotopoulos:inequality, 35003 author = {P. D. Panagiotopoulos}, 35004 title = {Inequality Problems in Mechanics and Applications}, 35005 publisher = {Birkh{\"{a}}user}, 35006 address = {Boston}, 35007 year = {1985} 35008} 35009 35010@Article{ pang.chan:iterative, 35011 author = {J. S. Pang and D. Chan}, 35012 title = {Iterative Methods for Variational and Complementarity Problems}, 35013 journal = {Mathematical Programming}, 35014 year = {1982}, 35015 volume = {24}, 35016 pages = {284--313} 35017} 35018 35019@Article{ pang.gabriel:nesqp, 35020 author = {J. S. Pang and S. A. Gabriel}, 35021 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 35022 journal = {Mathematical Programming}, 35023 year = {1993}, 35024 volume = {60}, 35025 pages = {295--338} 35026} 35027 35028@Article{ pang.han.ea:minimization, 35029 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 35030 title = {Minimization of Locally {L}ipschitzian Functions}, 35031 journal = {SIAM Journal on Optimization}, 35032 year = {1991}, 35033 volume = {1}, 35034 pages = {57--82} 35035} 35036 35037@Article{ pang.qi:nonsmooth, 35038 author = {J. S. Pang and L. Qi}, 35039 title = {Nonsmooth Equations: Motivation and Algorithms}, 35040 journal = {SIAM Journal on Optimization}, 35041 year = {1993}, 35042 volume = {3}, 35043 pages = {443--465} 35044} 35045 35046@Article{ pang.trinkle.ea:complementarity, 35047 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 35048 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 35049 journal = {Computational Optimization and Applications}, 35050 volume = {5}, 35051 pages = {97--138}, 35052 year = {1996} 35053} 35054 35055@Article{ pang.trinkle:complementarity, 35056 author = {J. S. Pang and J. C. Trinkle}, 35057 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 35058 Contact Problems with {C}oulomb Friction}, 35059 year = {1996}, 35060 journal = {Mathematical Programming}, 35061 volume = {73}, 35062 pages = {199--226} 35063} 35064 35065@TechReport{ pang.wang:embedding, 35066 author = {J. S. Pang and Z. P. Wang}, 35067 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 35068 Problems}, 35069 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35070 year = {1990}, 35071 address = {Baltimore, Maryland} 35072} 35073 35074@TechReport{ pang.yang:parallel, 35075 author = {J. S. Pang and J. M. Yang}, 35076 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 35077 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35078 year = {1987}, 35079 address = {Baltimore, Maryland}, 35080 type = {Manuscript} 35081} 35082 35083@Article{ pang.yu:linearized, 35084 author = {J. S. Pang and C. S. Yu}, 35085 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 35086 Networks}, 35087 journal = {Networks}, 35088 volume = {14}, 35089 pages = {427--438}, 35090 year = {1984} 35091} 35092 35093@Article{ pang:b-differentiable, 35094 author = {J. S. Pang}, 35095 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 35096 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 35097 Inequality Problems}, 35098 journal = {Mathematical Programming}, 35099 year = {1991}, 35100 volume = {51}, 35101 pages = {101--132} 35102} 35103 35104@InCollection{ pang:complementarity, 35105 author = {J. S. Pang}, 35106 title = {Complementarity Problems}, 35107 booktitle = {Handbook in Global Optimization}, 35108 publisher = {Kluwer Academic Publishers}, 35109 year = {1994}, 35110 editor = {R. Horst and P. Pardalos}, 35111 address = {Boston} 35112} 35113 35114@Article{ pang:convergence, 35115 author = {J. S. Pang}, 35116 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 35117 Problem}, 35118 journal = {Journal of Optimization Theory and Applications}, 35119 year = {1982}, 35120 volume = {37}, 35121 pages = {149--162} 35122} 35123 35124@Article{ pang:convergence*1, 35125 author = {J. S. Pang}, 35126 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 35127 Application of some Sensitivity Results}, 35128 journal = {Mathematical Programming}, 35129 year = {1993}, 35130 volume = {58}, 35131 pages = {149--160} 35132} 35133 35134@Article{ pang:inexact, 35135 author = {J. S. Pang}, 35136 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 35137 journal = {Mathematical Programming}, 35138 year = {1986}, 35139 volume = {36}, 35140 pages = {54--71} 35141} 35142 35143@Article{ pang:more, 35144 author = {J. S. Pang}, 35145 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 35146 Complementarity Problem}, 35147 journal = {Journal of Optimization Theory and Applications}, 35148 year = {1986}, 35149 volume = {49}, 35150 pages = {107--134} 35151} 35152 35153@Article{ pang:more*1, 35154 author = {J. S. Pang}, 35155 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 35156 Complementarity Problems}, 35157 journal = {Journal of Optimization Theory and Applications}, 35158 year = {1986}, 35159 volume = {49}, 35160 pages = {107--134} 35161} 35162 35163@Article{ pang:necessary, 35164 author = {J. S. Pang}, 35165 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 35166 the Linear Complementarity Problem}, 35167 journal = {Journal of Optimization Theory and Applications}, 35168 year = {1984}, 35169 volume = {42}, 35170 pages = {1--17} 35171} 35172 35173@Article{ pang:newtons, 35174 author = {J. S. Pang}, 35175 title = {{N}ewton's Method for {B}--Differentiable Equations}, 35176 journal = {Mathematics of Operations Research}, 35177 year = {1990}, 35178 volume = {15}, 35179 pages = {311--341} 35180} 35181 35182@Article{ pang:posteriori, 35183 author = {J. S. Pang}, 35184 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 35185 Problem}, 35186 journal = {Mathematics of Operations Research}, 35187 year = {1987}, 35188 volume = {12}, 35189 pages = {474--484} 35190} 35191 35192@Article{ pantoja.mayne:sequential, 35193 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 35194 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 35195 with Control Inequality Constraints}, 35196 journal = {International Journal on Control}, 35197 year = {1991}, 35198 volume = {53}, 35199 pages = {823--836} 35200} 35201 35202@Book{ papadimitriou.steiglitz:combinatorial, 35203 author = {C. H. Papadimitriou and K. Steiglitz}, 35204 title = {Combinatorial Optimization: Algorithms and Complexity}, 35205 year = {1982}, 35206 publisher = {Prentice-Hall, Inc}, 35207 address = {Englewood Cliffs, New Jersey} 35208} 35209 35210@Article{ papanikolau.mackie.ea:investigation, 35211 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 35212 Reckwerdt}, 35213 title = {Investigation of the convolution method for polyenergetic spectra}, 35214 journal = {Medical Physics}, 35215 year = {1993}, 35216 volume = {20}, 35217 number = {5}, 35218 pages = {1327--1336} 35219} 35220 35221@Article{ parisot:resolution, 35222 author = {G. R. Parisot}, 35223 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 35224 Lin\'{e}aire par Application de la Programmation Logarithmique}, 35225 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 35226 year = {1961}, 35227 volume = {20}, 35228 pages = {227--259} 35229} 35230 35231@Article{ parker.cave.ea:comparison, 35232 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 35233 title = {Comparison of Simplex Algorithms}, 35234 journal = {Analytica Chimica Acta}, 35235 year = {1985}, 35236 volume = {175}, 35237 pages = {231--237} 35238} 35239 35240@InProceedings{ parker:optimal, 35241 author = {D. Parker}, 35242 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 35243 Second Order Hebbian Learning}, 35244 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 35245 II}, 35246 year = {1987}, 35247 address = {San Diego:IEEE}, 35248 pages = {593--600} 35249} 35250 35251@Book{ pascali.sburlan:nonlinear, 35252 author = {D. Pascali and S. Sburlan}, 35253 title = {Nonlinear Mappings of Monotone Type}, 35254 publisher = {Editura Academeie}, 35255 year = {1978} 35256} 35257 35258@Article{ passty:ergodic, 35259 author = {G. B. Passty}, 35260 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 35261 space}, 35262 journal = {Journal of Mathematical Analysis and Applications}, 35263 year = {1979}, 35264 volume = {72}, 35265 pages = {383--390} 35266} 35267 35268@Article{ peaceman.rachford:numerical, 35269 author = {D. W. Peaceman and H. H. Rachford}, 35270 title = {The numerical solution of parabolic and elliptic differential equations}, 35271 journal = {SIAM Journal}, 35272 year = {1955}, 35273 volume = {3}, 35274 pages = {28--41} 35275} 35276 35277@Book{ peck.tiesberg:global, 35278 author = {S. Peck and T. Tiesberg}, 35279 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 35280 {CETA}}, 35281 publisher = {The Electric Power Institute}, 35282 year = {1992}, 35283 address = {Paolo Alto CA} 35284} 35285 35286@TechReport{ peng:convexity, 35287 author = {J. -M. Peng}, 35288 title = {The Convexity of the Implicit {L}agrangian}, 35289 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35290 year = {1995}, 35291 type = {Technical Report}, 35292 address = {Beijing} 35293} 35294 35295@Article{ peng:equivalence, 35296 author = {J. -M. Peng}, 35297 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 35298 journal = {Mathematical Programming}, 35299 year = {1997}, 35300 volume = {78}, 35301 pages = {347--356} 35302} 35303 35304@Article{ pennisi:taking, 35305 author = {E. Pennisi}, 35306 title = {Taking a structured approach to understanding proteins}, 35307 journal = {Science}, 35308 year = {1998}, 35309 volume = {279}, 35310 pages = {978--979} 35311} 35312 35313@Article{ penot:regularity, 35314 author = {J. P. Penot}, 35315 title = {On regularity conditions in mathematical programming}, 35316 journal = {Mathematical Programming Study}, 35317 year = {1982}, 35318 volume = {17}, 35319 pages = {28--66} 35320} 35321 35322@Book{ perez:principles, 35323 author = {C. A. Perez and L. W. Brady}, 35324 title = {Principles and practice of radiotherapy}, 35325 publisher = {Lippincott-Raven}, 35326 year = {1998}, 35327 address = {Philadelphia}, 35328 edition = {3rd} 35329} 35330 35331@Article{ perroni.rutherford:international, 35332 author = {C. Perroni and T. Rutherford}, 35333 title = {International Trade in Carbon Emission Rights and Basic Materials: General 35334 Equilibrium Calculations for 2020}, 35335 journal = {Scandinavian Journal of Economics}, 35336 year = {1993} 35337} 35338 35339@Article{ perroni.rutherford:regular, 35340 author = {C. Perroni and T. Rutherford}, 35341 title = {Regular Flexibility of Nested {CES} Functions}, 35342 journal = {European Economic Review}, 35343 year = {1995}, 35344 volume = {39}, 35345 pages = {335--343} 35346} 35347 35348@InCollection{ perroni.wigle:environmental, 35349 author = {C. Perroni and R. M. Wigle}, 35350 title = {Environmental Policy Modeling}, 35351 booktitle = {Global Trade Analysis: Modeling and Applications}, 35352 publisher = {Cambridge University Press}, 35353 year = {1996}, 35354 editor = {T. Hertel} 35355} 35356 35357@Article{ peterson:review, 35358 author = {D. W. Peterson}, 35359 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 35360 journal = {SIAM Review}, 35361 year = {1973}, 35362 volume = {15}, 35363 pages = {639--654} 35364} 35365 35366@PhDThesis{ petersson:optimization, 35367 author = {J. Petersson}, 35368 title = {Optimization of Structures in Unilateral Contact}, 35369 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 35370 number = {397}, 35371 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 35372 University}, 35373 address = {Link{\"o}ping, Sweden}, 35374 year = {1995} 35375} 35376 35377@Book{ petri:modelling, 35378 author = {P. Petri}, 35379 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 35380 publisher = {Harvard University Press}, 35381 year = {1984} 35382} 35383 35384@InProceedings{ petrzykowski:application, 35385 author = {T. Petrzykowski}, 35386 title = {Application of the Steepest Ascent Method to Concave Programming}, 35387 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 35388 year = {1962}, 35389 publisher = {North--Holland}, 35390 address = {Amsterdam}, 35391 pages = {185--189} 35392} 35393 35394@InProceedings{ pettey.leuze.ea:parallel, 35395 crossref = {grefenstette:genetic}, 35396 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 35397 title = {A Parallel Genetic Algorithm}, 35398 pages = {155--161} 35399} 35400 35401@InProceedings{ pettey.leuze:theoretical, 35402 crossref = {schaeffer:third}, 35403 author = {C. C. Pettey and M. R. Leuze}, 35404 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 35405 pages = {398--405} 35406} 35407 35408@Book{ pfeiffer.glocker:multibody, 35409 author = {F. Pfeiffer and C. Glocker}, 35410 title = {Multibody Dynamics with Unilateral Contact}, 35411 year = {1996}, 35412 publisher = {John Wiley \& Sons} 35413} 35414 35415@TechReport{ pierro.iusem:convergence, 35416 author = {A. R. de Pierro and A. N. Iusem}, 35417 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 35418 Linear Complementarity Problems}, 35419 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 35420 year = {1990}, 35421 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 35422} 35423 35424@InCollection{ pillo.grippo.ea:class, 35425 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 35426 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 35427 booktitle = {System Modelling and Optimization}, 35428 year = {1981}, 35429 editor = {R. F. Drenick and F. Kozin}, 35430 publisher = {Springer-Verlag}, 35431 address = {Berlin} 35432} 35433 35434@Article{ pillo.grippo:augmented, 35435 author = {G. Di Pillo and L. Grippo}, 35436 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 35437 Problems}, 35438 journal = {Journal of Optimization Theory and Applications}, 35439 year = {1982}, 35440 volume = {36}, 35441 pages = {495--519} 35442} 35443 35444@Article{ pillo.grippo:class, 35445 author = {G. Di Pillo and L. Grippo}, 35446 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 35447 journal = {SIAM Journal on Control and Optimization}, 35448 year = {1979}, 35449 volume = {17}, 35450 pages = {618--628} 35451} 35452 35453@Article{ pillo.grippo:continuously, 35454 author = {G. Di Pillo and L. Grippo}, 35455 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 35456 Problems with Inequality Constraints}, 35457 journal = {SIAM Journal on Control and Optimization}, 35458 year = {1985}, 35459 volume = {23}, 35460 pages = {72--84} 35461} 35462 35463@Article{ pillo.grippo:exact, 35464 author = {G. Di Pillo and L. Grippo}, 35465 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 35466 Programming Problems}, 35467 journal = {Mathematical Programming}, 35468 year = {1986}, 35469 volume = {36}, 35470 pages = {1--18} 35471} 35472 35473@InProceedings{ plambeck.fu.ea:throughput, 35474 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35475 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 35476 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 35477 editor = {J. Schoen}, 35478 year = {1993}, 35479 publisher = {Society for Computer Simulation}, 35480 address = {San Diego, CA}, 35481 pages = {70--75} 35482} 35483 35484@Article{ plambeck.fu.ea:sample-path, 35485 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35486 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 35487 journal = {Mathematical Programming}, 35488 year = {1996}, 35489 volume = {75}, 35490 pages = {137--176} 35491} 35492 35493@InProceedings{ platt:sequential, 35494 author = {J. Platt}, 35495 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 35496 Machines}, 35497 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 35498 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 35499 publisher = {MIT Press}, 35500 pages = {185-208}, 35501 year = {1999} 35502} 35503 35504@Book{ poincare:sur, 35505 author = {H. Poincar\'{e}}, 35506 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 35507 year = {1881}, 35508 publisher = {Oeuvres I}, 35509 address = {Gauthier--Villars, Paris} 35510} 35511 35512@Article{ polak.ribiere:note, 35513 author = {E. Polak and G. Ribi\`{e}re}, 35514 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 35515 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 35516 year = {1969}, 35517 volume = {16-R1}, 35518 pages = {35--43} 35519} 35520 35521@Book{ polak:computational, 35522 author = {E. Polak}, 35523 title = {Computational Methods in Optimization; {A} Unified Approach}, 35524 year = {1971}, 35525 publisher = {Academic Press}, 35526 address = {New York} 35527} 35528 35529@Article{ polak:global, 35530 author = {E. Polak}, 35531 title = {On the Global Stabilization of Locally Convergent Algorithms}, 35532 journal = {Automatica}, 35533 year = {1976}, 35534 volume = {12}, 35535 pages = {337--349} 35536} 35537 35538@Article{ polyak.tretiyakov:concerning, 35539 author = {B. T. Polyak and N. V. Tretiyakov}, 35540 title = {Concerning an Iterative Method for Linear Programming and its Economic 35541 Interpretation}, 35542 journal = {Economics and Mathematical Methods}, 35543 year = {1972}, 35544 volume = {8}, 35545 pages = {740--751}, 35546 note = {(Russian)} 35547} 35548 35549@Article{ polyak.tretiyakov:method, 35550 author = {B. T. Polyak and N. V. Tretiyakov}, 35551 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 35552 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 35553 year = {1973}, 35554 volume = {13}, 35555 pages = {42--58} 35556} 35557 35558@Article{ polyak:conjugate, 35559 author = {B. T. Polyak}, 35560 title = {The conjugate gradient method in extremal problems}, 35561 journal = {USSR Computational Mathematics and Mathematical Physics}, 35562 year = {1969}, 35563 volume = {9}, 35564 pages = {94--112}, 35565 note = {Translated from Russian} 35566} 35567 35568@Book{ polyak:introduction, 35569 author = {B. T. Polyak}, 35570 title = {Introduction to Optimization}, 35571 year = {1987}, 35572 publisher = {Optimization Software, Inc.}, 35573 address = {Publications Division, New York} 35574} 35575 35576@Unpublished{ polyak:methods, 35577 author = {R. A. Polyak}, 35578 title = {On the Methods of Centers}, 35579 year = {1988}, 35580 note = {Unpublished manuscript} 35581} 35582 35583@Unpublished{ polyak:sharp, 35584 author = {B. T. Polyak}, 35585 title = {Sharp Minima}, 35586 year = {1979}, 35587 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 35588 Applications, {IIASA}, Laxenburg, Austria} 35589} 35590 35591@InProceedings{ polyak:smooth, 35592 author = {R. A. Polyak}, 35593 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 35594 Problems with Constraints}, 35595 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 35596 Programming}, 35597 year = {1982}, 35598 address = {Bonn} 35599} 35600 35601@Article{ polychronopoulos.tsitsiklis:analysis, 35602 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 35603 title = {Stochastic Shortest Path Problems with Recourse}, 35604 journal = {Networks}, 35605 year = {1996}, 35606 volume = {27}, 35607 pages = {133--143} 35608} 35609 35610@TechReport{ potra.bonnans:infeasible, 35611 author = {F. A. Potra and J. F. Bonnans}, 35612 title = {Infeasible path following algorithms for linear complementarity problems}, 35613 institution = {INRIA}, 35614 year = {1994}, 35615 month = dec, 35616 number = {RR--2445}, 35617 type = {Research Report} 35618} 35619 35620@Article{ potra.sheng:large-step, 35621 author = {F. A. Potra and R. Sheng}, 35622 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 35623 year = {1997}, 35624 journal = {SIAM Journal on Optimization}, 35625 volume = {7}, 35626 pages = {318--335} 35627} 35628 35629@Article{ potra:infeasible, 35630 author = {F. A. Potra}, 35631 title = {An infeasible interior-point predictor-corrector algorithm for linear 35632 programming}, 35633 journal = {SIAM Journal on Optimization}, 35634 year = {1996}, 35635 volume = {6}, 35636 pages = {19--32} 35637} 35638 35639@TechReport{ potra:onl, 35640 author = {F. A. Potra}, 35641 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 35642 convergence.}, 35643 institution = {Department of Mathematics, The University of Iowa}, 35644 address = {Iowa City, Iowa}, 35645 year = {1994}, 35646 number = {50}, 35647 type = {Reports on Computational Mathematics} 35648} 35649 35650@TechReport{ potra:predictor-corrector, 35651 author = {F. A. Potra}, 35652 title = {On a predictor-corrector method for solving linear programs from infeasible 35653 starting points}, 35654 institution = {Department of Mathematics, University of Iowa}, 35655 address = {Iowa City, Iowa}, 35656 year = {1992}, 35657 number = {34}, 35658 type = {Reports on Computational Mathematics} 35659} 35660 35661@TechReport{ potra:quadratically, 35662 author = {F. A. Potra}, 35663 title = {A quadratically convergent infeasible interior-point algorithm for linear 35664 programming}, 35665 institution = {Department of Mathematics, University of Iowa}, 35666 year = {1992}, 35667 number = {28}, 35668 address = {Iowa City, Iowa}, 35669 month = jul 35670} 35671 35672@InCollection{ powell:convergence, 35673 author = {M. J. D. Powell}, 35674 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 35675 Optimization Calculations}, 35676 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35677 pages = {27--63} 35678} 35679 35680@InProceedings{ powell:direct, 35681 author = {M. J. D. Powell}, 35682 title = {A Direct Search Optimization Method that Models the Objective and Constraint 35683 Functions by Linear Interpolation}, 35684 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 35685 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 35686 volume = {275}, 35687 year = {1994}, 35688 publisher = {Kluwer Academic Publishers}, 35689 pages = {51--67}, 35690 address = {Dordrecht, The Netherlands} 35691} 35692 35693@Article{ powell:efficient, 35694 author = {M. J. D. Powell}, 35695 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 35696 without Calculating Derivatives}, 35697 journal = {Computer Journal}, 35698 year = {1964}, 35699 volume = {17}, 35700 pages = {155--162} 35701} 35702 35703@InCollection{ powell:general, 35704 author = {M. J. D. Powell}, 35705 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 35706 booktitle = {Approximation Theory IV}, 35707 year = {1983}, 35708 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 35709 publisher = {Academic Press}, 35710 address = {New York}, 35711 pages = {187--218} 35712} 35713 35714@InCollection{ powell:hybrid, 35715 author = {M. J. D. Powell}, 35716 title = {A hybrid method for nonlinear equations}, 35717 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 35718 publisher = {Gordon and Breach}, 35719 year = {1970}, 35720 editor = {P. Rabinowitz} 35721} 35722 35723@TechReport{ powell:karmarkars, 35724 author = {M. J. D. Powell}, 35725 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 35726 institution = {Department of Applied Mathematics and Theoretical Physics, University of 35727 Cambridge}, 35728 year = {1989}, 35729 month = nov, 35730 address = {Cambridge, CB3 9EW, England} 35731} 35732 35733@InCollection{ powell:method, 35734 author = {M. J. D. Powell}, 35735 title = {A Method for Nonlinear Constraints in Minimization Problems}, 35736 booktitle = {Optimization}, 35737 year = {1969}, 35738 editor = {R. Fletcher}, 35739 publisher = {Academic Press}, 35740 address = {London}, 35741 pages = {283--298} 35742} 35743 35744@Book{ prekopa:stochastic, 35745 author = {A. Pr{\'{e}}kopa}, 35746 title = {Stochastic Programming}, 35747 publisher = {Kluwer Academic Publishers}, 35748 year = {1995}, 35749 address = {Dordrecht, The Netherlands} 35750} 35751 35752@Book{ press.flannery.ea:numerical, 35753 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 35754 Vetterling}, 35755 title = {Numerical Recipes : the Art of Scientific Computing}, 35756 publisher = {Cambridge University Press}, 35757 year = {1988} 35758} 35759 35760@Article{ pruyne.livny:interfacing, 35761 author = {J. Pruyne and M. Livny}, 35762 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 35763 journal = {Journal on Future Generations of Computer Systems}, 35764 volume = {12}, 35765 year = {1996}, 35766 pages = {67--85} 35767} 35768 35769@InCollection{ pruyne.livny:parallel, 35770 author = {J. Pruyne and M. Livny}, 35771 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 35772 booktitle = {Job Scheduling Strategies for Parallel Processing}, 35773 publisher = {Springer-Verlag}, 35774 year = {1995}, 35775 editor = {D. G. Feitelson and L. Rudolph}, 35776 volume = {949}, 35777 series = {Lecture Notes in Computer Science} 35778} 35779 35780@PhDThesis{ pruyne:resource, 35781 author = {J. C. Pruyne}, 35782 title = {Resource Management Services for Parallel Applications}, 35783 school = {University of Wisconsin--Madison}, 35784 year = {1996}, 35785 address = {Madison, Wisconsin} 35786} 35787 35788@Book{ pshenichny.danilin:numerical, 35789 author = {B. N. Pshenichny and Yu. M. Danilin}, 35790 title = {Numerical Methods in Extremal Problems}, 35791 year = {1978}, 35792 publisher = {MIR Publishers}, 35793 address = {Moscow} 35794} 35795 35796@TechReport{ qi.chen:globally, 35797 author = {L. Qi and X. Chen}, 35798 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 35799 institution = {School of Mathematics, University of New South Wales}, 35800 year = {1993}, 35801 annote = {revised}, 35802 address = {Sydney} 35803} 35804 35805@Article{ qi.jiang:semismooth, 35806 author = {L. Qi and H. Jiang}, 35807 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 35808 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 35809 journal = {Mathematics of Operations Research}, 35810 volume = {22}, 35811 pages = {301--325}, 35812 year = {1997} 35813} 35814 35815@TechReport{ qi.peng:unconstrained, 35816 author = {H. -D. Qi and J. -M. Peng}, 35817 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 35818 Problems}, 35819 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35820 year = {1996}, 35821 type = {Technical Report}, 35822 address = {Beijing} 35823} 35824 35825@InCollection{ qi.sun:survey, 35826 author = {L. Qi and D. Sun}, 35827 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 35828 year = {1999}, 35829 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 35830 booktitle = {Progress in Optimization}, 35831 pages = {121--146}, 35832 series = {Applied Optimization}, 35833 volume = {30}, 35834 publisher = {Kluwer Academic Publishers}, 35835 address = {Dordrecht} 35836} 35837 35838@Article{ qi.sun:nonsmooth, 35839 author = {L. Qi and J. Sun}, 35840 title = {A Nonsmooth Version of {N}ewton's Method}, 35841 journal = {Mathematical Programming}, 35842 year = {1993}, 35843 volume = {58}, 35844 pages = {353--368} 35845} 35846 35847@Article{ qi:convergence, 35848 author = {L. Qi}, 35849 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 35850 journal = {Mathematics of Operations Research}, 35851 year = {1993}, 35852 volume = {18}, 35853 pages = {227--244} 35854} 35855 35856@TechReport{ qi:regular, 35857 author = {L. Qi}, 35858 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 35859 convergent generalized {N}ewton methods for complementarity and variational 35860 inequality problems}, 35861 institution = {School of Mathematics, University of New South Wales}, 35862 year = {1997}, 35863 type = {Applied Mathematics Report}, 35864 number = {AMR 97/14}, 35865 address = {Sydney, Australia} 35866} 35867 35868@Article{ radner:competitive, 35869 author = {R. Radner}, 35870 title = {Competitive Equilibrium under Uncertainty}, 35871 journal = {Econometrica}, 35872 year = {1968}, 35873 volume = {36}, 35874 pages = {31--58} 35875} 35876 35877@Article{ radstrom:embedding, 35878 author = {H. R{\aa}dstr{\"{o}}m}, 35879 title = {An embedding theorem for spaces of convex sets}, 35880 journal = {Proc. Amer. Math. Soc.}, 35881 year = {1952}, 35882 volume = {3}, 35883 pages = {165--169} 35884} 35885 35886@Article{ raghavachari:connections, 35887 author = {M. Raghavachari}, 35888 title = {On Connections between Zero--One Integer Programming and Concave Programming 35889 Under Linear Constraints}, 35890 journal = {Operations Research}, 35891 year = {1969}, 35892 volume = {17}, 35893 pages = {680--684} 35894} 35895 35896@Article{ rajan.burridge.ea:dynamics, 35897 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 35898 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 35899 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 35900 month = mar, 35901 year = {1987}, 35902 pages = {671--677} 35903} 35904 35905@Article{ ralph:branching, 35906 author = {D. Ralph}, 35907 title = {On Branching Numbers of Normal Manifolds}, 35908 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 35909 volume = {22}, 35910 pages = {1041--1050}, 35911 year = {1994} 35912} 35913 35914@Article{ ralph:global, 35915 author = {D. Ralph}, 35916 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 35917 Path Search}, 35918 journal = {Mathematics of Operations Research}, 35919 year = {1994}, 35920 volume = {19}, 35921 pages = {352--389} 35922} 35923 35924@InProceedings{ ralph:piecewise, 35925 author = {D. Ralph}, 35926 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 35927 with Linear Complementarity Constraints}, 35928 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 35929 Applications (CTAC95)}, 35930 year = {1996} 35931} 35932 35933@PhDThesis{ raman:integration, 35934 author = {R. Raman}, 35935 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 35936 for process systems.}, 35937 address = {Pittsburgh, Pennsylvania}, 35938 year = {1993}, 35939 school = {Department of Chemical Engineering, Carnegie Mellon University} 35940} 35941 35942@PhDThesis{ rangaraj:nonsmooth, 35943 author = {Narayan Rangaraj}, 35944 title = {Nonsmooth Optimization: Algorithms and Applications}, 35945 year = {1990}, 35946 address = {Baltimore, MD}, 35947 school = {Department of Mathematical Sciences, The Johns Hopkins University} 35948} 35949 35950@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 35951 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 35952 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 35953 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35954 Radiation Therapy, Salt Lake City}, 35955 year = {1997}, 35956 editor = {D. D. Leavitt and G. Starkshall}, 35957 publisher = {Medical Physics Publishing}, 35958 address = {St. Louis, Missouri}, 35959 pages = {420--422} 35960} 35961 35962@Article{ reid:sparsity-exploiting, 35963 author = {J. K. Reid}, 35964 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear 35965 Programming Bases}, 35966 journal = {Mathematical Programming}, 35967 year = {1982}, 35968 volume = {24}, 35969 pages = {55--69} 35970} 35971 35972@Book{ reingold.nievergelt.ea:combinatorial, 35973 author = {E. Reingold and J. Nievergelt and N. Deo}, 35974 title = {Combinatorial Algorithms: Theory and Practice}, 35975 publisher = {Prentice-Hall, Inc}, 35976 address = {Englewood Cliffs, New Jersey} 35977} 35978 35979@PhDThesis{ reinoza:degree, 35980 author = {J. A. Reinoza}, 35981 title = {A Degree for Generalized Equations}, 35982 year = {1979}, 35983 address = {Madison, Wisconsin}, 35984 school = {University of Wisconsin} 35985} 35986 35987@Article{ reinoza:solving, 35988 author = {A. Reinoza}, 35989 title = {Solving Generalized Equations via Homotopies}, 35990 journal = {Mathematical Programming}, 35991 year = {1985}, 35992 volume = {31}, 35993 pages = {307--320} 35994} 35995 35996@PhDThesis{ ren:computable, 35997 author = {J. Ren}, 35998 title = {Computable Error Bounds in Mathematical Programming}, 35999 school = {Computer Sciences Department, University of Wisconsin}, 36000 year = {1993}, 36001 address = {Madison, Wisconsin}, 36002 note = {Technical Report 1173} 36003} 36004 36005@Article{ renegar:polynomial-time, 36006 author = {J. Renegar}, 36007 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 36008 Programming}, 36009 journal = {Mathematical Programming}, 36010 year = {1988}, 36011 volume = {40}, 36012 pages = {59--94} 36013} 36014 36015@Article{ robbins.monro:stochastic, 36016 author = {H. Robbins and S. Monro}, 36017 title = {A Stochastic Approximation Method}, 36018 journal = {Annals of Mathematical Statistics}, 36019 year = {1951}, 36020 volume = {22}, 36021 pages = {400--407} 36022} 36023 36024@Article{ robinson:analysis, 36025 author = {S. M. Robinson}, 36026 title = {Analysis of Sample-Path Optimization}, 36027 journal = {Mathematics of Operations Research}, 36028 year = {1996}, 36029 volume = {21}, 36030 pages = {513--528} 36031} 36032 36033@InCollection{ robinson:bundle-based, 36034 author = {S. M. Robinson}, 36035 title = {Bundle-Based Decomposition: Conditions for Convergence}, 36036 booktitle = {Analyse Non Lin\'{e}aire}, 36037 year = {1989}, 36038 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 36039 publisher = {Gauthier-Villaars}, 36040 address = {Paris}, 36041 pages = {435--447} 36042} 36043 36044@InCollection{ robinson:bundle-based*1, 36045 author = {S. M. Robinson}, 36046 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 36047 booktitle = {System Modeling and Optimization}, 36048 year = {1986}, 36049 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 36050 publisher = {Springer-Verlag}, 36051 address = {Berlin}, 36052 pages = {751--756}, 36053 volume = {84}, 36054 series = {Lecture Notes in Control and Information Sciences} 36055} 36056 36057@Article{ robinson:continuity, 36058 author = {S. M. Robinson}, 36059 title = {Some Continuity Properties of Polyhedral Multifunctions}, 36060 journal = {Mathematical Programming Study}, 36061 year = {1981}, 36062 volume = {14}, 36063 pages = {206--214} 36064} 36065 36066@Article{ robinson:extension, 36067 author = {S. M. Robinson}, 36068 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 36069 journal = {Numerische Mathematik}, 36070 year = {1972}, 36071 volume = {19}, 36072 pages = {341--347} 36073} 36074 36075@InCollection{ robinson:generalized, 36076 crossref = {bachem.grotschel.ea:mathematical}, 36077 author = {S. M. Robinson}, 36078 title = {Generalized Equations}, 36079 pages = {346--367} 36080} 36081 36082@Article{ robinson:generalized*1, 36083 author = {S. M. Robinson}, 36084 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 36085 journal = {Mathematical Programming Study}, 36086 year = {1979}, 36087 volume = {10}, 36088 pages = {128--141} 36089} 36090 36091@InCollection{ robinson:homeomorphism, 36092 author = {S. M. Robinson}, 36093 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 36094 booktitle = {Optimization and Nonlinear Analysis}, 36095 year = {1992}, 36096 editor = {A. Ioffe and M. Marcus and S. Reich}, 36097 publisher = {Longman}, 36098 address = {Harlow, Essex, England}, 36099 pages = {240--248}, 36100 series = {Pitman Research Notes in Mathematics Series No. 244} 36101} 36102 36103@Article{ robinson:implicit-function, 36104 author = {S. M. Robinson}, 36105 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 36106 journal = {Mathematics of Operations Research}, 36107 year = {1991}, 36108 volume = {16}, 36109 pages = {292--309} 36110} 36111 36112@Article{ robinson:local*1, 36113 author = {S. M. Robinson}, 36114 title = {Local Epi--Continuity and Local Optimization}, 36115 journal = {Mathematical Programming}, 36116 year = {1987}, 36117 volume = {37}, 36118 pages = {208--222} 36119} 36120 36121@Article{ robinson:local*2, 36122 author = {S. M. Robinson}, 36123 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 36124 Nondegeneracy}, 36125 journal = {Mathematical Programming Study}, 36126 year = {1984}, 36127 volume = {22}, 36128 pages = {217--230} 36129} 36130 36131@Article{ robinson:local*3, 36132 author = {S. M. Robinson}, 36133 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 36134 Stability and Sensitivity}, 36135 journal = {Mathematical Programming Study}, 36136 year = {1987}, 36137 volume = {30}, 36138 pages = {45--66} 36139} 36140 36141@Article{ robinson:mathematical, 36142 author = {S. M. Robinson}, 36143 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 36144 journal = {Mathematical Programming}, 36145 year = {1990}, 36146 volume = {48}, 36147 pages = {221--229} 36148} 36149 36150@Article{ robinson:newtons, 36151 author = {S. M. Robinson}, 36152 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 36153 journal = {Set Valued Analysis}, 36154 year = {1994}, 36155 volume = {2}, 36156 pages = {291--305} 36157} 36158 36159@Article{ robinson:nonsingularity, 36160 author = {S. M. Robinson}, 36161 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 36162 journal = {Mathematical Programming}, 36163 year = {1993}, 36164 volume = {62}, 36165 pages = {415--425} 36166} 36167 36168@InCollection{ robinson:nonsmooth, 36169 author = {S. M. Robinson}, 36170 title = {Nonsmooth Continuation for Generalized Equations}, 36171 year = {1997}, 36172 pages = {282--291}, 36173 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 36174 booktitle = {Recent Advances in Optimization}, 36175 series = {Lecture Notes in Economics and Mathematical Systems}, 36176 volume = {452}, 36177 publisher = {Springer-Verlag}, 36178 address = {Heidelberg} 36179} 36180 36181@Article{ robinson:normal, 36182 author = {S. M. Robinson}, 36183 title = {Normal Maps Induced by Linear Transformations}, 36184 journal = {Mathematics of Operations Research}, 36185 year = {1992}, 36186 volume = {17}, 36187 pages = {691--714} 36188} 36189 36190@Article{ robinson:normed, 36191 author = {S. M. Robinson}, 36192 title = {Normed Convex Processes}, 36193 journal = {Transactions of the American Mathematical Society}, 36194 year = {1972}, 36195 volume = {174}, 36196 pages = {127--140} 36197} 36198 36199@Article{ robinson:reduction, 36200 author = {S. M. Robinson}, 36201 title = {A reduction method for variational inequalities}, 36202 journal = {Mathematical Programming}, 36203 year = {1998}, 36204 volume = {80}, 36205 pages = {161--169} 36206} 36207 36208@Article{ robinson:regularity, 36209 author = {S. M. Robinson}, 36210 title = {Regularity and stability for convex multivalued functions}, 36211 journal = {Mathematics of Operations Research}, 36212 year = {1976}, 36213 volume = {1}, 36214 pages = {130--143} 36215} 36216 36217@Unpublished{ robinson:shadow, 36218 author = {S. M. Robinson}, 36219 title = {Shadow {JUNK} for biblio file}, 36220 year = {1800} 36221} 36222 36223@Article{ robinson:shadow*1, 36224 author = {S. M. Robinson}, 36225 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 36226 journal = {Operations Research}, 36227 year = {1993}, 36228 volume = {41}, 36229 pages = {518--535} 36230} 36231 36232@Article{ robinson:shadow*2, 36233 author = {S. M. Robinson}, 36234 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 36235 journal = {Operations Research}, 36236 year = {1993}, 36237 volume = {41}, 36238 pages = {536--548} 36239} 36240 36241@Unpublished{ robinson:stability, 36242 author = {S. M. Robinson}, 36243 title = {Stability {JUNK} for biblio file}, 36244 year = {1800} 36245} 36246 36247@Article{ robinson:stability*1, 36248 author = {S. M. Robinson}, 36249 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 36250 journal = {SIAM Journal on Numerical Analysis}, 36251 year = {1975}, 36252 volume = {12}, 36253 pages = {754--769} 36254} 36255 36256@Article{ robinson:stability*2, 36257 author = {S. M. Robinson}, 36258 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 36259 Nonlinear Systems}, 36260 journal = {SIAM Journal on Numerical Analysis}, 36261 year = {1976}, 36262 volume = {13}, 36263 pages = {497--513} 36264} 36265 36266@Article{ robinson:strongly, 36267 author = {S. M. Robinson}, 36268 title = {Strongly Regular Generalized Equations}, 36269 journal = {Mathematics of Operations Research}, 36270 year = {1980}, 36271 volume = {5}, 36272 pages = {43--62} 36273} 36274 36275@Article{ rockafellar.wets:generalized, 36276 author = {R. T. Rockafellar and R. J.--B. Wets}, 36277 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 36278 Control in Discrete Time}, 36279 journal = {SIAM Journal on Control and Optimization}, 36280 year = {1990}, 36281 volume = {28}, 36282 pages = {810--822} 36283} 36284 36285@Article{ rockafellar.wets:lagrangian, 36286 author = {R. T. Rockafellar and R. J.--B. Wets}, 36287 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 36288 in Stochastic Programming}, 36289 journal = {Mathematical Programming Study}, 36290 year = {1986}, 36291 volume = {28}, 36292 pages = {63--93} 36293} 36294 36295@InCollection{ rockafellar.wets:linear-quadratic, 36296 author = {R. T. Rockafellar and R. J.--B. Wets}, 36297 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 36298 Generation Algorithm}, 36299 booktitle = {Stochastic Optimization}, 36300 publisher = {Springer-Verlag}, 36301 year = {1987}, 36302 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 36303 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 36304 pages = {545--560}, 36305 address = {New York, Berlin} 36306} 36307 36308@Article{ rockafellar.wets:scenarios, 36309 author = {R. T. Rockafellar and R. J.--B. Wets}, 36310 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 36311 journal = {Mathematics of Operations Research}, 36312 year = {1991}, 36313 volume = {10}, 36314 pages = {119--147} 36315} 36316 36317@InProceedings{ rockafellar:applications, 36318 author = {R. T. Rockafellar}, 36319 title = {New Applications of Duality in Convex Programming}, 36320 booktitle = {Proceedings of the Fourth Conference on Probability}, 36321 year = {1971}, 36322 address = {Brasov, Romania} 36323} 36324 36325@Article{ rockafellar:augmented, 36326 author = {R. T. Rockafellar}, 36327 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 36328 journal = {SIAM Journal on Control and Optimization}, 36329 year = {1974}, 36330 volume = {12}, 36331 pages = {268--285} 36332} 36333 36334@Article{ rockafellar:augmented*1, 36335 author = {R. T. Rockafellar}, 36336 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 36337 Convex Programming}, 36338 journal = {Mathematics of Operations Research}, 36339 year = {1976}, 36340 volume = {1}, 36341 pages = {97--116} 36342} 36343 36344@Article{ rockafellar:characterization, 36345 author = {R. T. Rockafellar}, 36346 title = {Characterization of the subdifferentials of convex functions}, 36347 journal = {Pacific Journal of Mathematics}, 36348 year = {1966}, 36349 volume = {17}, 36350 number = {3}, 36351 pages = {497--510} 36352} 36353 36354@Article{ rockafellar:computational, 36355 author = {R. T. Rockafellar}, 36356 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 36357 Programming}, 36358 journal = {Mathematical Programming}, 36359 year = {1990}, 36360 volume = {48}, 36361 pages = {447--474} 36362} 36363 36364@Book{ rockafellar:conjugate, 36365 author = {R. T. Rockafellar}, 36366 title = {Conjugate Duality and Optimization}, 36367 year = {1974}, 36368 publisher = {SIAM}, 36369 address = {Philadelphia, Pennsylvania}, 36370 volume = {16}, 36371 series = {Conference Board of the Mathematical Sciences} 36372} 36373 36374@Book{ rockafellar:convex, 36375 author = {R. T. Rockafellar}, 36376 title = {Convex Analysis}, 36377 year = {1970}, 36378 publisher = {Princeton University Press}, 36379 address = {Princeton, New Jersey} 36380} 36381 36382@Article{ rockafellar:first-, 36383 author = {R. T. Rockafellar}, 36384 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 36385 journal = {Transactions of the American Mathematical Society}, 36386 year = {1988}, 36387 volume = {307}, 36388 pages = {75--108} 36389} 36390 36391@InProceedings{ rockafellar:generalized, 36392 author = {R. T. Rockafellar}, 36393 title = {A Generalized Approach to Linear-Quadratic Programming}, 36394 booktitle = {Proceedings of the International Conference on Numerical Optimization and 36395 Applications}, 36396 year = {1986}, 36397 pages = {58--66}, 36398 note = {(Xi'an, China)} 36399} 36400 36401@InProceedings{ rockafellar:generalized*1, 36402 crossref = {bachem.grotschel.ea:mathematical}, 36403 author = {R. T. Rockafellar}, 36404 title = {Generalized Subgradients in Mathematical Programming}, 36405 pages = {368--390} 36406} 36407 36408@InCollection{ rockafellar:large-scale, 36409 author = {R. T. Rockafellar}, 36410 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 36411 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 36412 chapter = {15}, 36413 year = {1991}, 36414 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 36415 publisher = {SIAM Publications}, 36416 pages = {247--261} 36417} 36418 36419@Article{ rockafellar:linear-quadratic, 36420 author = {R. T. Rockafellar}, 36421 title = {Linear-Quadratic Programming and Optimal Control}, 36422 journal = {SIAM Journal on Control and Optimization}, 36423 year = {1987}, 36424 volume = {25}, 36425 pages = {781--814} 36426} 36427 36428@Article{ rockafellar:maximality, 36429 author = {R. T. Rockafellar}, 36430 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 36431 journal = {Transactions of the American Mathematical Society}, 36432 year = {1970}, 36433 volume = {149}, 36434 pages = {75--88} 36435} 36436 36437@InCollection{ rockafellar:monotone, 36438 author = {R. T. Rockafellar}, 36439 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 36440 crossref = {mangasarian.meyer.ea:nonlinear*3}, 36441 pages = {1--26} 36442} 36443 36444@Article{ rockafellar:monotone*1, 36445 author = {R. T. Rockafellar}, 36446 title = {Monotone Operators and the Proximal Point Algorithm}, 36447 journal = {SIAM Journal on Control and Optimization}, 36448 year = {1976}, 36449 volume = {14}, 36450 pages = {877--898} 36451} 36452 36453@Article{ rockafellar:multiplier, 36454 author = {R. T. Rockafellar}, 36455 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 36456 journal = {Journal of Optimization Theory and Applications}, 36457 year = {1973}, 36458 volume = {12}, 36459 pages = {555--562} 36460} 36461 36462@Article{ rockafellar:multistage, 36463 author = {R. T. Rockafellar}, 36464 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 36465 journal = {Control and Cybernetics}, 36466 year = {1988}, 36467 volume = {17}, 36468 number = {2-3}, 36469 pages = {225--245} 36470} 36471 36472@Book{ rockafellar:network, 36473 author = {R. T. Rockafellar}, 36474 title = {Network Flows and Monotropic Optimization}, 36475 publisher = {John Wiley}, 36476 year = {1984}, 36477 address = {New York} 36478} 36479 36480@Article{ rodrigues:mixed, 36481 author = {H. C. Rodrigues}, 36482 title = {A mixed variational formulation for shape optimization of solids with contact 36483 conditions}, 36484 journal = {Structural Optimization}, 36485 volume = {6}, 36486 year = {1993}, 36487 pages = {19--28} 36488} 36489 36490@Book{ rodrigues:obstacle, 36491 author = {J. F. Rodrigues}, 36492 title = {Obstacle Problems in Mathematical Physics}, 36493 publisher = {Elsevier Publishing Company}, 36494 address = {Amsterdam}, 36495 year = {1987} 36496} 36497 36498@Book{ roos.terlaky.ea:theory, 36499 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 36500 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 36501 publisher = {John Wiley \& Sons}, 36502 year = {1997}, 36503 address = {Chichester} 36504} 36505 36506@TechReport{ rosa:decomposition, 36507 author = {C. H. Rosa}, 36508 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 36509 institution = {IIASA}, 36510 year = {1996}, 36511 number = {WP-96-013}, 36512 address = {A-2361 Laxenburg, Austria} 36513} 36514 36515@Article{ rosen.lane.ea:treatment, 36516 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 36517 title = {Treatment Plan Optimization Using Linear Programming}, 36518 journal = {Medical Physics}, 36519 year = {1990}, 36520 volume = {18}, 36521 number = {2}, 36522 pages = {141--152} 36523} 36524 36525@TechReport{ rosenblatt:perceptron-a, 36526 author = {F. Rosenblatt}, 36527 title = {The perceptron--a perceiving and recognizing automaton}, 36528 institution = {Cornell Aeronautical Laboratory}, 36529 year = {1957}, 36530 month = jan, 36531 address = {Ithaca, New York}, 36532 number = {85-460-1} 36533} 36534 36535@Book{ rosenblatt:principles, 36536 author = {F. Rosenblatt}, 36537 title = {Principles of Neurodynamics}, 36538 year = {1962}, 36539 publisher = {Spartan Books}, 36540 address = {New York} 36541} 36542 36543@InProceedings{ rosenblatt:two, 36544 author = {F. Rosenblatt}, 36545 title = {Two theorems of statistical separability in the perceptron}, 36546 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 36547 year = {1959}, 36548 publisher = {{HMS} Stationery Office}, 36549 address = {London}, 36550 volume = {1} 36551} 36552 36553@Article{ rosenbrock:automatic, 36554 author = {H. H. Rosenbrock}, 36555 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 36556 journal = {Computer Journal}, 36557 year = {1960}, 36558 volume = {3}, 36559 pages = {175--184} 36560} 36561 36562@Article{ roy.mukhopadhyay:pattern, 36563 author = {A. Roy and S. Mukhopadhyay}, 36564 title = {Pattern Classification Using Linear Programming}, 36565 journal = {ORSA Journal on Computing}, 36566 year = {1990}, 36567 volume = {3}, 36568 pages = {66--80} 36569} 36570 36571@Book{ rubinstein:monte, 36572 author = {R. Rubinstein}, 36573 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 36574 Networks}, 36575 publisher = {Wiley}, 36576 address = {New York, NY}, 36577 year = {1986} 36578} 36579 36580@Article{ ruchala.olivera.ea:comparison, 36581 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 36582 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 36583 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 36584 journal = {Physics in Medicine and Biology, forthcoming}, 36585 year = {1999} 36586} 36587 36588@Book{ rudin:principles, 36589 author = {W. Rudin}, 36590 title = {Principles of Mathematical Analysis}, 36591 year = {1976}, 36592 publisher = {McGraw--Hill}, 36593 address = {Tokyo, Japan}, 36594 edition = {Third} 36595} 36596 36597@Book{ rudin:real, 36598 author = {W. Rudin}, 36599 title = {Real and Complex Analysis}, 36600 year = {1974}, 36601 publisher = {McGraw--Hill}, 36602 address = {Tokyo, Japan}, 36603 edition = {Second} 36604} 36605 36606@InProceedings{ rumelhart.hinton.ea:learning, 36607 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 36608 title = {Learning Internal Representations by Error Propagation}, 36609 booktitle = {Parallel Distributed Processing}, 36610 year = {1986}, 36611 editor = {D. E. Rumelhart and J. L. McClelland}, 36612 publisher = {MIT Press}, 36613 address = {Cambridge, Massachusetts}, 36614 pages = {318--362} 36615} 36616 36617@Book{ rumelhart.mcclelland:parallel, 36618 author = {D. E. Rumelhart and J. L. McClelland}, 36619 title = {Parallel Distributed Processing}, 36620 year = {1986}, 36621 publisher = {MIT Press}, 36622 address = {Cambridge, Massachusetts} 36623} 36624 36625@InCollection{ ruszczynski:regularized, 36626 author = {A. Ruszczynski}, 36627 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 36628 year = {1995}, 36629 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 36630 editor = {K. Marti and P. Kall}, 36631 publisher = {Springer-Verlag}, 36632 address = {Berlin}, 36633 volume = {425}, 36634 series = {Lecture Notes in Control and Information Sciences}, 36635 pages = {93--108} 36636} 36637 36638@Article{ rutherford.rutstrom.ea:lacord, 36639 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 36640 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 36641 quantitative}, 36642 journal = {Revue d' Economie du developpement}, 36643 year = {1994} 36644} 36645 36646@InCollection{ rutherford.tarr:blueprints, 36647 author = {T. Rutherford and D. Tarr}, 36648 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 36649 Open Economy}, 36650 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 36651 publisher = {Cambridge University Press}, 36652 year = {1997}, 36653 editor = {R. Baldwin and J. Francois}, 36654 address = {New York} 36655} 36656 36657@Article{ rutherford:applied, 36658 author = {T. F. Rutherford}, 36659 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 36660 Overview of the Modeling Framework and Syntax}, 36661 year = {1999}, 36662 volume = {14}, 36663 pages = {1--46}, 36664 journal = {Computational Economics} 36665} 36666 36667@PhDThesis{ rutherford:applied*1, 36668 author = {T. F. Rutherford}, 36669 title = {Applied General Equilibrium Modeling}, 36670 school = {Stanford University}, 36671 year = {1987} 36672} 36673 36674@Article{ rutherford:extensions, 36675 author = {T. F. Rutherford}, 36676 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 36677 Analysis}, 36678 journal = {Journal of Economic Dynamics and Control}, 36679 volume = {19}, 36680 pages = {1299--1324}, 36681 year = {1995} 36682} 36683 36684@Misc{ rutherford:gnuplot, 36685 author = {T. F. Rutherford}, 36686 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 36687 organization = {Department of Economics, University of Colorado}, 36688 address = {Boulder, Colorado}, 36689 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 36690} 36691 36692@Unpublished{ rutherford:miles, 36693 author = {T. F. Rutherford}, 36694 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 36695 year = {1993}, 36696 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 36697} 36698 36699@TechReport{ rutherford:modeling, 36700 author = {T. F. Rutherford}, 36701 title = {A Modeling System for Applied General Equilibrium Analysis}, 36702 type = {Cowles Foundation Discussion Paper}, 36703 number = {836}, 36704 institution = {Yale University}, 36705 year = {1987} 36706} 36707 36708@TechReport{ rutherford:mpsge, 36709 author = {T. F. Rutherford}, 36710 title = {{MPSGE}}, 36711 institution = {University of Western Ontario}, 36712 year = {1988}, 36713 address = {London, Ontario} 36714} 36715 36716@Article{ rykov:simplex, 36717 author = {A. S. Rykov}, 36718 title = {Simplex Direct Search Algorithms}, 36719 journal = {Automation and Remote Control}, 36720 year = {1980}, 36721 volume = {41}, 36722 pages = {784--793} 36723} 36724 36725@Article{ saad.schultz:gmres, 36726 author = {Y. Saad and M. Schultz}, 36727 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 36728 Linear Systems}, 36729 journal = {SIAM Journal on Scientific and Statistical Computing}, 36730 year = {1986}, 36731 volume = {44}, 36732 pages = {856--869} 36733} 36734 36735@Book{ saad:iterative, 36736 author = {Y. Saad}, 36737 title = {Iterative Methods for Sparse Linear Systems}, 36738 year = {1996}, 36739 publisher = {PWS Publishing Company}, 36740 address = {Boston, Massachusetts} 36741} 36742 36743@Article{ sahni:approximate, 36744 author = {S. Sahni}, 36745 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 36746 journal = {jacm}, 36747 year = {1975}, 36748 volume = {22}, 36749 pages = {115--124} 36750} 36751 36752@InProceedings{ sauer.shepard.ea:comparison, 36753 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 36754 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 36755 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36756 Radiation Therapy, Salt Lake City}, 36757 year = {1997}, 36758 editor = {D. D. Leavitt and G. Starkshall}, 36759 publisher = {Medical Physics Publishing}, 36760 address = {St. Louis, Missouri} 36761} 36762 36763@Article{ sauer.xu:multivariate, 36764 author = {Th. Sauer and Y. Xu}, 36765 title = {On Multivariate {L}agrange Interpolation}, 36766 journal = {Mathematics of Computation}, 36767 year = {1995}, 36768 volume = {64}, 36769 pages = {1147--1170} 36770} 36771 36772@Article{ savelsbergh:preprocessing, 36773 author = {M. W. P. Savelsbergh}, 36774 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 36775 journal = {ORSA Journal on Computing}, 36776 year = {1994}, 36777 volume = {6}, 36778 pages = {445--454} 36779} 36780 36781@Article{ scarf:approximation, 36782 author = {H. E. Scarf}, 36783 title = {The Approximation of Fixed Points of a Continuous Mapping}, 36784 journal = {SIAM Journal on Applied Mathematics}, 36785 year = {1967}, 36786 volume = {15}, 36787 pages = {1328--1343} 36788} 36789 36790@Book{ scarf:computation, 36791 author = {H. E. Scarf}, 36792 title = {The Computation of Economic Equilibria}, 36793 year = {1973}, 36794 publisher = {Yale University Press}, 36795 address = {New Haven, Connecticut} 36796} 36797 36798@TechReport{ scheel.scholtes:mathematical, 36799 author = {H. Scheel and S. Scholtes}, 36800 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 36801 and Sensitivity}, 36802 institution = {Judge Institute of Management Studies, University of Cambridge}, 36803 year = {1998}, 36804 type = {Technical Report}, 36805 address = {Cambridge, England} 36806} 36807 36808@Article{ schlick:modified, 36809 author = {T. Schlick}, 36810 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 36811 journal = {SIAM Journal on Scientific Computing}, 36812 year = {1993}, 36813 volume = {14}, 36814 pages = {424--445} 36815} 36816 36817@Article{ schnabel.eskow:modified, 36818 author = {R. B. Schnabel and E. Eskow}, 36819 title = {A New Modified {C}holesky Factorization}, 36820 journal = {SIAM Journal on Scientific and Statistical Computing}, 36821 year = {1991}, 36822 volume = {11}, 36823 pages = {1136--1158} 36824} 36825 36826@Article{ schneider.zenios:comparative, 36827 author = {M. H. Schneider and S. A. Zenios}, 36828 title = {A Comparative Study of Algorithms for Matrix Balancing}, 36829 journal = {Operations Research}, 36830 year = {1990}, 36831 volume = {38}, 36832 pages = {439--455} 36833} 36834 36835@Book{ scholkopf.burges.ea:advances, 36836 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 36837 title = {Advances in Kernel Methods: Support Vector Machines}, 36838 publisher = {MIT Press}, 36839 address = {Cambridge, MA }, 36840 year = {1998}, 36841 isbn = {0-262-19416-3} 36842} 36843 36844@Article{ scholtes.stohr:exact, 36845 author = {S. Scholtes and M. St{\"{o}}hr}, 36846 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 36847 journal = {SIAM Journal on Control and Optimization}, 36848 volume = {37}, 36849 pages = {617--652}, 36850 year = {1999} 36851} 36852 36853@TechReport{ scholtes:introduction, 36854 author = {S. Scholtes}, 36855 title = {Introduction to piecewise differentiable equations}, 36856 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 36857 Universit{\"{a}}t Karlsruhe}, 36858 year = {1994}, 36859 type = {Preprint}, 36860 number = {No. 53/1994}, 36861 address = {Karlsruhe, Germany} 36862} 36863 36864@Article{ schramm.zowe:version, 36865 author = {H. Schramm and J. Zowe}, 36866 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 36867 Idea, Convergence Analysis, Numerical Results}, 36868 journal = {SIAM Journal on Optimization}, 36869 year = {1992}, 36870 volume = {2}, 36871 pages = {121--152} 36872} 36873 36874@Article{ schultz.meyer:interior, 36875 author = {G. L. Schultz and R. R. Meyer}, 36876 title = {An Interior Point Method for Block Angular Optimization}, 36877 journal = {SIAM Journal on Optimization}, 36878 year = {1991}, 36879 volume = {1}, 36880 pages = {583--602} 36881} 36882 36883@InProceedings{ sekiguchi.sato.ea:ninf, 36884 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 36885 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 36886 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 36887 year = {1996}, 36888 address = {Santa Fe} 36889} 36890 36891@InCollection{ sellami.robinson:homotopies, 36892 author = {H. Sellami and S. M. Robinson}, 36893 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 36894 Inequalities}, 36895 booktitle = {Nonlinear Optimization and Applications}, 36896 editor = {G. Di Pillo and F. Giannessi}, 36897 year = {1996}, 36898 pages = {327--343}, 36899 publisher = {Plenum Press}, 36900 address = {New York} 36901} 36902 36903@Article{ sellami.robinson:implementation, 36904 author = {H. Sellami and S. M. Robinson}, 36905 title = {Implementation of a Continuation Method for Normal Maps}, 36906 journal = {Mathematical Programming}, 36907 year = {1997}, 36908 volume = {76}, 36909 pages = {563--578} 36910} 36911 36912@PhDThesis{ sellami:continuation, 36913 author = {H. Sellami}, 36914 title = {A Continuation Method for Normal Maps}, 36915 school = {University of Wisconsin -- Madison}, 36916 year = {1994}, 36917 address = {Madison, Wisconsin} 36918} 36919 36920@Article{ sellami:homotopy, 36921 author = {H. Sellami}, 36922 title = {A Homotopy Continuation Method for Normal Maps}, 36923 journal = {Mathematical Programming}, 36924 vol = {82}, 36925 year = {1998}, 36926 pages = {317--337} 36927} 36928 36929@Book{ seuss:one, 36930 author = {{Dr.} A. Seuss}, 36931 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 36932 year = {1960}, 36933 publisher = {Beginner Books}, 36934 address = {New York}, 36935 series = {Beginner Books, B13}, 36936 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 36937 Yink, Yop, Gack, and the Zeds} 36938} 36939 36940@Article{ seyfferth.pfeiffer:dynamics, 36941 author = {W. Seyfferth and F. Pfeiffer}, 36942 title = {Dynamics of Assembly Processes With a Manipulator}, 36943 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 36944 and Systems}, 36945 year = {1992}, 36946 pages = {1303--1310} 36947} 36948 36949@Article{ shanno.simantiraki:infeasible, 36950 author = {D. Shanno and E. Simantiraki}, 36951 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 36952 year = {1997}, 36953 journal = {SIAM Journal on Optimization}, 36954 volume = {7}, 36955 pages = {620--640} 36956} 36957 36958@InProceedings{ shanno.simantiraki:interior, 36959 author = {D. Shanno and E. Simantiraki}, 36960 title = {Interior Point Methods for Linear and Nonlinear Programming}, 36961 booktitle = {State of the Art in Numerical Analysis}, 36962 year = {1997}, 36963 editor = {I. S. Duff and G. A. Watson}, 36964 publisher = {Oxford University Press}, 36965 address = {Oxford} 36966} 36967 36968@Article{ shannon:introduction, 36969 author = {R. E. Shannon}, 36970 title = {Introduction to the Art and Science of simulation}, 36971 journal = {WSC98 1998 Winter simulation conference proceedings}, 36972 year = {1998}, 36973 volume = {1}, 36974 pages = {7--14} 36975} 36976 36977@TechReport{ shapiro:concepts, 36978 author = {A. Shapiro}, 36979 title = {On Concepts of Directional Differentiability}, 36980 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 36981 year = {1988}, 36982 address = {Pretoria, South Africa}, 36983 number = {73/88(18)}, 36984 type = {Research Report} 36985} 36986 36987@Book{ shavlik.editors:readings, 36988 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 36989 title = {Readings in Machine Learning}, 36990 year = {1990}, 36991 publisher = {Morgan Kaufman}, 36992 address = {San Mateo, California} 36993} 36994 36995@Article{ shavlik.mooney.ea:symbolic, 36996 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 36997 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 36998 journal = {Machine Learning}, 36999 year = {1991}, 37000 volume = {6}, 37001 pages = {111--143} 37002} 37003 37004@Book{ sheffi:urban, 37005 author = {Y. Sheffi}, 37006 title = {Urban Transportation Networks}, 37007 publisher = {Prentice-Hall, Inc}, 37008 year = {1985}, 37009 address = {Englewood Cliffs, New Jersey} 37010} 37011 37012@Article{ sheng.potra:quadratically, 37013 author = {R. Sheng and F. A. Potra}, 37014 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 37015 Polynomial {CO}mplexity}, 37016 journal = {SIAM Journal on Optimization}, 37017 year = {1997}, 37018 volume = {7}, 37019 pages = {304--317} 37020} 37021 37022@InProceedings{ shepard.angelos.ea:simple, 37023 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 37024 title = {A Simple Model for Examining Radiotherapy Optimization}, 37025 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 37026 Radiation Therapy, Salt Lake City}, 37027 year = {1997}, 37028 editor = {D. D. Leavitt and G. Starkshall}, 37029 publisher = {Medical Physics Publishing}, 37030 address = {St. Louis, Missouri} 37031} 37032 37033@Article{ shepard.ferris.ea:inverse, 37034 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 37035 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 37036 journal = {Medical Physics}, 37037 volume = {27}, 37038 pages = {12}, 37039 year = {2000}, 37040 key = {93} 37041} 37042 37043@Article{ shepard.ferris.ea:optimizing, 37044 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 37045 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 37046 journal = {SIAM Review}, 37047 volume = {41}, 37048 pages = {721--744}, 37049 year = {1999}, 37050 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 37051 key = {68}, 37052 institution = {Computer Sciences Department, University of Wisconsin}, 37053 address = {Madison, Wisconsin}, 37054 number = {98-07}, 37055 type = {Mathematical Programming Technical Report} 37056} 37057 37058@Article{ sherali.shetty:finitely, 37059 author = {H. D. Sherali and C. M. Shetty}, 37060 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 37061 Cuts and Disjunctive Face Cuts}, 37062 journal = {Mathematical Programming}, 37063 year = {1980}, 37064 volume = {19}, 37065 pages = {14--31} 37066} 37067 37068@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 37069 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 37070 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 37071 journal = {Operations Research}, 37072 year = {1983}, 37073 volume = {31}, 37074 pages = {253--276} 37075} 37076 37077@Article{ shi.olafsson.ea:hybrid, 37078 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 37079 title = {A New Hybrid Optimization Algorithm}, 37080 journal = {Computers and Industrial Engineering}, 37081 year = {1999}, 37082 volume = {36}, 37083 pages = {409--426} 37084} 37085 37086@PhDThesis{ shiau:iterative, 37087 author = {T.--H. Shiau}, 37088 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 37089 school = {Computer Sciences Department, University of Wisconsin}, 37090 year = {1983}, 37091 address = {Madison, Wisconsin}, 37092 note = {Technical Report 507} 37093} 37094 37095@InProceedings{ shor:generalized, 37096 crossref = {bachem.grotschel.ea:mathematical}, 37097 author = {N. Z. Shor}, 37098 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 37099 Dilation Operations}, 37100 pages = {501--529} 37101} 37102 37103@Book{ shor:minimization, 37104 author = {N. Z. Shor}, 37105 title = {Minimization Methods for Nondifferentiable Functions}, 37106 year = {1985}, 37107 publisher = {Springer-Verlag}, 37108 address = {Berlin} 37109} 37110 37111@Article{ shoven.whalley:applied, 37112 author = {J. Shoven and J. Whalley}, 37113 title = {Applied General Equilibrium Models of Taxation and International Trade: 37114 Introduction and Survey}, 37115 journal = {Journal of Economic Literature}, 37116 year = {1984}, 37117 volume = {22}, 37118 pages = {1007--1051} 37119} 37120 37121@Article{ shultz.meyer:interior, 37122 author = {G. L. Shultz and R. R. Meyer}, 37123 title = {An Interior Point Method for Block Angular Optimization}, 37124 journal = {SIAM Journal on Optimization}, 37125 year = {1991}, 37126 volume = {1}, 37127 pages = {583--602} 37128} 37129 37130@Article{ shultz.schnabel.ea:family, 37131 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 37132 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 37133 journal = {SIAM Journal on Numerical Analysis}, 37134 year = {1985}, 37135 volume = {22}, 37136 pages = {44--67} 37137} 37138 37139@Article{ sibony:methodes, 37140 author = {M. Sibony}, 37141 title = {Methodes iteratives pur les equations et inequations aux derives partielles 37142 nonlineaires de type monotone}, 37143 journal = {Calcolo}, 37144 year = {1970}, 37145 volume = {7}, 37146 pages = {65--183} 37147} 37148 37149@Article{ sidney:optimal, 37150 author = {J. B. Sidney}, 37151 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 37152 journal = {Operations Research}, 37153 year = {1977}, 37154 volume = {25}, 37155 pages = {62--69} 37156} 37157 37158@Book{ siegel:corba, 37159 author = {J. Siegel}, 37160 title = {{CORBA} - Fundamentals and Programming}, 37161 publisher = {John Wiley \& Sons}, 37162 year = {1996}, 37163 address = {New York, New York} 37164} 37165 37166@TechReport{ simantiraki.shanno:infeasible-interior-point, 37167 author = {E. Simantiraki and D. F. Shanno}, 37168 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 37169 type = {Research Report}, 37170 number = {7-95}, 37171 institution = {Rutgers Center for Operations Research, Rutgers University}, 37172 address = {New Brunswick, New Jersey}, 37173 year = {1995} 37174} 37175 37176@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 37177 author = {E. Simantiraki and D. F. Shanno}, 37178 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 37179 Problems}, 37180 crossref = {ferris.pang:complementarity}, 37181 pages = {386--404} 37182} 37183 37184@Book{ simpson:artificial, 37185 author = {P. K. Simpson}, 37186 title = {Artificial Neural Systems}, 37187 year = {1990}, 37188 publisher = {Pergamon Press}, 37189 address = {New York} 37190} 37191 37192@Article{ smeers:computable, 37193 author = {Y. Smeers}, 37194 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 37195 and Gas Markets}, 37196 journal = {The Energy Journal}, 37197 year = {1997}, 37198 optkey = {}, 37199 optvolume = {18}, 37200 optnumber = {}, 37201 optmonth = {}, 37202 optpages = {1--32}, 37203 optnote = {}, 37204 optannote = {} 37205} 37206 37207@Article{ smith:design, 37208 author = {F. W. Smith}, 37209 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 37210 Procedures}, 37211 journal = {IEEE Transactions on Computers}, 37212 year = {1969}, 37213 volume = {18}, 37214 pages = {367--372} 37215} 37216 37217@Article{ smith:existence, 37218 author = {M. J. Smith}, 37219 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 37220 journal = {Transportation Research}, 37221 year = {1979}, 37222 volume = {13B}, 37223 pages = {295--304} 37224} 37225 37226@Article{ smith:existence*1, 37227 author = {M. J. Smith}, 37228 title = {The existence and calculation of traffic equilibria}, 37229 journal = {Transportation Research}, 37230 volume = {17B}, 37231 year = {1983}, 37232 pages = {291--303} 37233} 37234 37235@Article{ smith:pattern, 37236 author = {F. W. Smith}, 37237 title = {Pattern Classifier Design by Linear Programming}, 37238 journal = {IEEE Transactions on Computers}, 37239 year = {1968}, 37240 volume = {C-17}, 37241 pages = {367--372} 37242} 37243 37244@Article{ solodov.svaiter:projection, 37245 author = {M. V. Solodov and B. F. Svaiter}, 37246 title = {A New Projection Method for Variational Inequality Problems}, 37247 journal = {SIAM Journal on Control and Optimization}, 37248 volume = {37}, 37249 pages = {765--776}, 37250 year = {1999} 37251} 37252 37253@Article{ solodov.tseng:modified, 37254 author = {M. V. Solodov and P. Tseng}, 37255 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 37256 year = {1996}, 37257 journal = {SIAM Journal on Control and Optimization}, 37258 pages = {1814--1830}, 37259 volume = {34} 37260} 37261 37262@Article{ solodov:stationary, 37263 author = {M. V. Solodov}, 37264 title = {Stationary Points of Bound Constrained Minimization Reformulations of 37265 Complementarity Problems}, 37266 journal = {Journal of Optimization Theory and Applications, forthcoming}, 37267 year = {1997} 37268} 37269 37270@Article{ spendley.hext.ea:sequential, 37271 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 37272 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 37273 Operation}, 37274 journal = {Technometrics}, 37275 year = {1962}, 37276 pages = {441--461}, 37277 volume = {4} 37278} 37279 37280@Article{ spingarn:applications, 37281 author = {J. E. Spingarn}, 37282 title = {Applications of the Method of Partial Inverses to Convex Programming}, 37283 journal = {Mathematical Programming}, 37284 year = {1985}, 37285 volume = {32}, 37286 pages = {199--223} 37287} 37288 37289@Book{ srinivasan.whalley:general, 37290 author = {T. Srinivasan and J. Whalley}, 37291 title = {General Equilibrium Trade Policy Modelling}, 37292 publisher = {MIT Press}, 37293 year = {1986}, 37294 address = {Boston} 37295} 37296 37297@Book{ stackelberg:theory, 37298 author = {H. Van Stackelberg}, 37299 title = {The Theory of Market Economy}, 37300 publisher = {Oxford University Press}, 37301 year = {1952} 37302} 37303 37304@Article{ stavroulakis.panagiotopoulos.ea:rigid, 37305 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 37306 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 37307 Applications}, 37308 journal = {Computers \& Structures}, 37309 volume = {40}, 37310 year = {1991}, 37311 pages = {599--614} 37312} 37313 37314@Article{ stavroulakis:optimal, 37315 author = {G. E. Stavroulakis}, 37316 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 37317 optimal control problem for variational inequalities}, 37318 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 37319 year = {1996} 37320} 37321 37322@Article{ stavroulakis:optimal*1, 37323 author = {G. E. Stavroulakis}, 37324 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 37325 journal = {Archives of Applied Mechanics, forthcoming}, 37326 year = {1996} 37327} 37328 37329@Book{ steenbrink:optimization, 37330 author = {P. A. Steenbrink}, 37331 title = {Optimization of Transport Networks}, 37332 publisher = {John Wiley \& Sons}, 37333 address = {London, England}, 37334 year = {1974} 37335} 37336 37337@Article{ stephens:asymptotic, 37338 author = {M. A. Stephens}, 37339 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 37340 journal = {Annals of Statistics}, 37341 year = {1976}, 37342 volume = {4}, 37343 pages = {357--369} 37344} 37345 37346@Article{ stephens:edf, 37347 author = {M. A. Stephens}, 37348 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 37349 journal = {Journal of the American Statistical Association}, 37350 year = {1974}, 37351 volume = {69}, 37352 pages = {730--737} 37353} 37354 37355@Article{ stevens:location, 37356 author = {B. H. Stevens}, 37357 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 37358 journal = {Papers of the Regional Science Association}, 37359 year = {1968}, 37360 volume = {21}, 37361 pages = {19--34} 37362} 37363 37364@Article{ stewart.trinkle:implicit, 37365 author = {D. E. Stewart and J. C. Trinkle}, 37366 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 37367 Collisions and {C}oulomb Friction}, 37368 journal = {International Journal for Numerical Methods in Engineering}, 37369 year = {1996}, 37370 volume = {39}, 37371 pages = {2673--2691} 37372} 37373 37374@Book{ stoer.bulirsch:introduction, 37375 author = {J. Stoer and R. Bulirsch}, 37376 title = {Introduction to Numerical Analysis}, 37377 year = {1980}, 37378 publisher = {Springer-Verlag}, 37379 address = {New York} 37380} 37381 37382@Article{ stoer:complexity, 37383 author = {J. Stoer}, 37384 title = {The complexity of an infeasible interior--point path--following method for the 37385 solution of linear programs}, 37386 journal = {Optimization Methods and Software}, 37387 year = {1994}, 37388 volume = {3}, 37389 pages = {1--12} 37390} 37391 37392@Article{ stone:cross-validatory, 37393 author = {M. Stone}, 37394 title = {Cross-validatory choice and assessment of statistical predictions}, 37395 journal = {Journal of the Royal Statistical Society}, 37396 year = {1974}, 37397 volume = {36}, 37398 pages = {111--147} 37399} 37400 37401@Article{ stone.smith.ea:inverse, 37402 author = {R. A. Stone and V. Smith and L. Verhey}, 37403 title = {Inverse Planning for the {G}amma {K}nife}, 37404 journal = {Medical Physics}, 37405 year = {1993}, 37406 volume = {20}, 37407 pages = {865} 37408} 37409 37410@Book{ strang:linear, 37411 author = {G. Strang}, 37412 title = {Linear Algebra and its Applications}, 37413 year = {1980}, 37414 publisher = {Academic Press}, 37415 address = {New York}, 37416 edition = {Second} 37417} 37418 37419@InProceedings{ street.wolberg.ea:nuclear, 37420 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 37421 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 37422 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 37423 year = {1993}, 37424 publisher = {SPIE--The International Society for Optical Engineering}, 37425 address = {San Jose, California}, 37426 pages = {861--870}, 37427 volume = {1905} 37428} 37429 37430@Article{ subramanian:gauss-newton, 37431 author = {P. K. Subramanian}, 37432 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 37433 journal = {Journal of Optimization Theory and Applications}, 37434 year = {1993}, 37435 volume = {77}, 37436 pages = {467--482} 37437} 37438 37439@PhDThesis{ subramanian:iterative, 37440 author = {P. K. Subramanian}, 37441 title = {Iterative Methods of Solution for Complementarity Problems}, 37442 year = {1985}, 37443 address = {Madison, Wisconsin}, 37444 school = {Computer Sciences Department, University of Wisconsin} 37445} 37446 37447@TechReport{ subramanian:note, 37448 author = {P. K. Subramanian}, 37449 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 37450 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 37451 year = {1985}, 37452 address = {Madison, Wisconsin}, 37453 number = {2844}, 37454 type = {Technical Summary Report} 37455} 37456 37457@TechReport{ suh.gucht:distributed, 37458 author = {J. Y. Suh and D. Van Gucht}, 37459 title = {Distributed Genetic Algorithms}, 37460 institution = {Computer Science Department, Indiana University}, 37461 year = {1987}, 37462 address = {Bloomington}, 37463 number = {225} 37464} 37465 37466@Article{ sun.natori.ea:computational, 37467 author = {S. M. Sun and M. C. Natori and K. C. Park}, 37468 title = {A Computational Procedure for Flexible Beams with Frictional Contact 37469 Constraints}, 37470 journal = {International Journal for Numerical Methods in Engineering}, 37471 volume = {36}, 37472 pages = {3781--3800}, 37473 year = {1993} 37474} 37475 37476@Article{ sun.qi:ncp-functions, 37477 author = {D. Sun and L. Qi}, 37478 title = {On {NCP}-Functions}, 37479 journal = {Computational Optimization and Applications, forthcoming}, 37480 year = {1998} 37481} 37482 37483@Article{ sun.womersley:unconstrained, 37484 author = {D. Sun and R. S. Womersley}, 37485 title = {A new unconstrained differentiable merit function for box constrained variational 37486 inequality problems and a damped {G}auss-{N}ewton method}, 37487 journal = {SIAM Journal on Optimization}, 37488 year = {1999}, 37489 volume = {9}, 37490 pages = {388--413} 37491} 37492 37493@Article{ sun:class, 37494 author = {D. Sun}, 37495 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 37496 journal = {Journal of Optimization Theory and Applications}, 37497 year = {1996}, 37498 volume = {91}, 37499 pages = {123--140} 37500} 37501 37502@PhDThesis{ sun:monotropic, 37503 author = {J. Sun}, 37504 title = {On Monotropic Piecewise Quadratic Programming}, 37505 school = {University of Washington}, 37506 year = {1986}, 37507 address = {Seattle, Washington} 37508} 37509 37510@Article{ sun:thermal, 37511 author = {D. C. Sun}, 37512 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 37513 journal = {Journal of Applied Mechanics}, 37514 volume = {58}, 37515 pages = {141--153}, 37516 year = {1991} 37517} 37518 37519@Article{ sundararaghavan.ahmed:minimizing, 37520 author = {P. S. Sundararaghavan and M. U. Ahmed}, 37521 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 37522 Scheduling}, 37523 journal = {Naval Research Logistics Quarterly}, 37524 year = {1984}, 37525 volume = {31}, 37526 pages = {325--333} 37527} 37528 37529@TechReport{ sznajder.gowda:generalizations, 37530 author = {R. Sznajder and M. S. Gowda}, 37531 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 37532 horizontal {LCP}s}, 37533 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 37534 year = {1992}, 37535 address = {Catonsville, Maryland}, 37536 number = {92--16}, 37537 type = {Research Report} 37538} 37539 37540@Article{ sznajder.gowda:nondegeneracy, 37541 author = {R. Sznajder and M. S. Gowda}, 37542 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 37543 journal = {Mathematics of Operations Research}, 37544 year = {1998}, 37545 volume = {23}, 37546 pages = {221--238} 37547} 37548 37549@Article{ taji.fukushima.ea:globally, 37550 author = {K. Taji and M. Fukushima and T. Ibaraki}, 37551 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 37552 Inequalities}, 37553 journal = {Mathematical Programming}, 37554 year = {1993}, 37555 volume = {58}, 37556 pages = {369--383} 37557} 37558 37559@Article{ taji.fukushima:optimization, 37560 author = {K. Taji and M. Fukushima}, 37561 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 37562 Problem}, 37563 journal = {Journal of the Operations Research Society of Japan}, 37564 year = {1994}, 37565 volume = {37}, 37566 pages = {310--331} 37567} 37568 37569@Article{ talbot.patterson.ea:comparative, 37570 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 37571 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 37572 journal = {Management Science}, 37573 year = {1986}, 37574 volume = {32}, 37575 pages = {430--454} 37576} 37577 37578@Article{ talman.yamamoto:simplicial, 37579 author = {A. J. J. Talman and Y. Yamamoto}, 37580 title = {A {S}implicial Algorithm for Stationary Point Problems}, 37581 journal = {Mathematics of Operations Research}, 37582 year = {1989}, 37583 volume = {14}, 37584 pages = {383--399} 37585} 37586 37587@InProceedings{ tanese:distributed, 37588 crossref = {schaeffer:third}, 37589 author = {R. Tanese}, 37590 title = {Distributed Genetic Algorithms}, 37591 pages = {434--439} 37592} 37593 37594@InProceedings{ tanese:parallel, 37595 crossref = {grefenstette:genetic}, 37596 author = {R. Tanese}, 37597 title = {Parallel Genetic Algorithms for a Hypercube}, 37598 pages = {177--183} 37599} 37600 37601@Article{ teboulle:entropic, 37602 author = {M. Teboulle}, 37603 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 37604 year = {1992}, 37605 journal = {Mathematics of Operations Research}, 37606 volume = {17}, 37607 pages = {670--690} 37608} 37609 37610@Article{ thuente:duality, 37611 author = {D. J. Thuente}, 37612 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 37613 journal = {Operations Research}, 37614 year = {1980}, 37615 volume = {28}, 37616 pages = {1005--1011} 37617} 37618 37619@Book{ tikhonov.arsenin:solutions, 37620 author = {A. N. Tikhonov and V. Y. Arsenin}, 37621 title = {Solutions of Ill--Posed Problems}, 37622 year = {1977}, 37623 publisher = {John Wiley \& Sons}, 37624 address = {New York} 37625} 37626 37627@InProceedings{ tin-loi.ferris:complementarity, 37628 author = {F. Tin-Loi and M. C. Ferris}, 37629 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 37630 booktitle = {Computational Mechanics for the Next Millenium}, 37631 key = {79}, 37632 pages = {1029--1036}, 37633 year = {1999}, 37634 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 37635 volume = {2}, 37636 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 37637 Mechanics}, 37638 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 37639 publisher = {Elsevier Science Ltd}, 37640 type = {Mathematical Programming Technical Report}, 37641 institution = {Computer Sciences Department, University of Wisconsin}, 37642 address = {Madison, Wisconsin}, 37643 number = {99-02} 37644} 37645 37646@InProceedings{ tin-loi.ferris:holonomic, 37647 author = {F. Tin-Loi and M. C. Ferris}, 37648 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 37649 booktitle = {Advances in Fracture Research}, 37650 year = {1997}, 37651 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 37652 volume = {2}, 37653 publisher = {Pergamon Press}, 37654 pages = {2183--2190}, 37655 key = {53} 37656} 37657 37658@InProceedings{ tin-loi.ferris:simple, 37659 author = {F. Tin-Loi and M. C. Ferris}, 37660 title = {A Simple Mathematical Programming Method for a Structural Identification 37661 Problem}, 37662 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 37663 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 37664 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 37665 publisher = {Techno-Press}, 37666 address = {Korea}, 37667 year = {1997}, 37668 pages = {511--518}, 37669 key = {59} 37670} 37671 37672@Article{ tin-loi.misa:large, 37673 author = {F. Tin-Loi and J. S. Misa}, 37674 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 37675 journal = {International Journal for Numerical Methods in Engineering}, 37676 volume = {39}, 37677 pages = {741--762}, 37678 year = {1996} 37679} 37680 37681@Article{ tin-loi.pang:elastoplastic, 37682 author = {F. Tin-Loi and J. S. Pang}, 37683 title = {Elastoplastic analysis of structures with nonlinear hardening}, 37684 journal = {Computer Methods in Applied Mechanics and Engineering}, 37685 volume = {107}, 37686 year = {1993}, 37687 pages = {299--312} 37688} 37689 37690@Article{ tin-loi.vimonsatit:nonlinear, 37691 author = {F. Tin-Loi and V. Vimonsatit}, 37692 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 37693 journal = {Engineering Structures}, 37694 volume = {18}, 37695 year = {1996}, 37696 pages = {115--124} 37697} 37698 37699@Article{ tobin:uniqueness, 37700 author = {R. L. Tobin}, 37701 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 37702 journal = {Annals of Operations Research}, 37703 volume = {34}, 37704 year = {1992}, 37705 pages = {21--36} 37706} 37707 37708@Article{ tobin:variable, 37709 author = {R. L. Tobin}, 37710 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 37711 Problem}, 37712 journal = {Mathematical Programming}, 37713 year = {1988}, 37714 volume = {40}, 37715 pages = {33--51} 37716} 37717 37718@Article{ todd.burrell:extension, 37719 author = {M. J. Todd and B. P. Burrell}, 37720 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 37721 Variables}, 37722 journal = {Algorithmica}, 37723 year = {1986}, 37724 volume = {1}, 37725 pages = {409--424} 37726} 37727 37728@Book{ todd:computation, 37729 author = {M. J. Todd}, 37730 title = {Computation of Fixed Points and Applications}, 37731 publisher = {Springer-Verlag}, 37732 year = {1976}, 37733 volume = {124}, 37734 series = {Lecture Notes in Economics and Mathematical Systems}, 37735 address = {Heidelberg} 37736} 37737 37738@Article{ todd:note, 37739 author = {M. J. Todd}, 37740 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 37741 Production}, 37742 journal = {Journal of Mathematical Economics}, 37743 year = {1976}, 37744 volume = {6}, 37745 pages = {135--144} 37746} 37747 37748@Article{ toint:assesment, 37749 author = {Ph. L. Toint}, 37750 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37751 Optimization}, 37752 year = {1996}, 37753 journal = {SIAM Journal on Scientific Computing}, 37754 volume = {17}, 37755 pages = {725=-739} 37756} 37757 37758@TechReport{ toint:assesment*1, 37759 author = {Ph. L. Toint}, 37760 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37761 Optimization: The Complete Numerical Results}, 37762 institution = {Department of Mathematics, FUNDP}, 37763 year = {1994}, 37764 number = {94/15}, 37765 address = {Namur, Belgium} 37766} 37767 37768@Article{ toint:global, 37769 author = {Ph. L. Toint}, 37770 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 37771 in a {H}ilbert Space}, 37772 journal = {IMA Journal of Numerical Analysis}, 37773 year = {1988}, 37774 volume = {8}, 37775 pages = {231--252} 37776} 37777 37778@Article{ toint:non-monotone, 37779 author = {Ph. L. Toint}, 37780 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 37781 Convex Constraints}, 37782 year = {1997}, 37783 journal = {Mathematical Programming}, 37784 volume = {77}, 37785 pages = {69--94} 37786} 37787 37788@InCollection{ toint:transportation, 37789 author = {Ph. L. Toint}, 37790 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 37791 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 37792 Management}, 37793 publisher = {Springer-Verlag}, 37794 series = {NATO ASI Series F}, 37795 year = {1997}, 37796 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 37797} 37798 37799@Article{ tomlin.welch:finding, 37800 author = {J. Tomlin and J. Welch}, 37801 title = {Finding Duplicate Rows in a Linear Programming Model}, 37802 journal = {Operations Research Letters}, 37803 year = {1986}, 37804 volume = {5}, 37805 number = {1}, 37806 pages = {7--11} 37807} 37808 37809@Article{ torczon:convergence, 37810 author = {V. Torczon}, 37811 title = {On the Convergence of the Multidirectional Search Algorithm}, 37812 journal = {SIAM Journal on Optimization}, 37813 year = {1991}, 37814 volume = {1}, 37815 pages = {123--145} 37816} 37817 37818@Article{ torczon:convergence*1, 37819 author = {V. Torczon}, 37820 title = {On the Convergence of Pattern Search Algorithms}, 37821 journal = {SIAM Journal on Optimization}, 37822 year = {1997}, 37823 volume = {7}, 37824 pages = {1--25} 37825} 37826 37827@Misc{ torma.rutherford:general, 37828 author = {H. Torma and T. Rutherford}, 37829 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 37830 year = {1992}, 37831 howpublished = {Working Paper 15/1992}, 37832 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 37833} 37834 37835@Article{ trinkle.pang.ea:dynamic, 37836 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 37837 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 37838 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 37839 year = {1997}, 37840 pages = {267--279}, 37841 volume = {77} 37842} 37843 37844@InProceedings{ trinkle.pang:dynamic, 37845 author = {J. C. Trinkle and J. S. Pang}, 37846 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 37847 book = {{IEEE} International Conference on Robotics and Automation}, 37848 pages = {2276--2281}, 37849 year = {1997} 37850} 37851 37852@TechReport{ tseng.bertsekas:convergence, 37853 author = {P. Tseng and D. P. Bertsekas}, 37854 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 37855 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 37856 Technology}, 37857 year = {1990}, 37858 type = {technical report}, 37859 number = {LIDS-P-1995}, 37860 address = {Cambridge, MA} 37861} 37862 37863@Article{ tseng.yamashita.ea:equivalence, 37864 author = {P. Tseng and N. Yamashita and M. Fukushima}, 37865 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 37866 Approach}, 37867 year = {1996}, 37868 journal = {SIAM Journal on Optimization}, 37869 volume = {6}, 37870 pages = {446--460} 37871} 37872 37873@Article{ tseng:applications, 37874 author = {P. Tseng}, 37875 title = {Applications of a splitting algorithm to decomposition in convex programming and 37876 variational inequalities}, 37877 journal = {SIAM Journal on Control and Optimization}, 37878 year = {1991}, 37879 volume = {29}, 37880 pages = {119--138} 37881} 37882 37883@Article{ tseng:dual, 37884 author = {P. Tseng}, 37885 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 37886 Constraints: a Unified Approach}, 37887 journal = {SIAM Journal on Control and Optimization}, 37888 year = {1990}, 37889 volume = {28}, 37890 pages = {214--242} 37891} 37892 37893@Article{ tseng:dual*1, 37894 author = {P. Tseng}, 37895 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 37896 Unified Approach}, 37897 journal = {SIAM Journal on Control and Optimization}, 37898 year = {1990}, 37899 volume = {28}, 37900 pages = {214--242} 37901} 37902 37903@Article{ tseng:dual*2, 37904 author = {P. Tseng}, 37905 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 37906 journal = {Mathematical Programming}, 37907 year = {1993}, 37908 volume = {59}, 37909 pages = {231--248} 37910} 37911 37912@Article{ tseng:fortified-descent, 37913 author = {P. Tseng}, 37914 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 37915 journal = {SIAM Journal on Optimization}, 37916 volume = {10}, 37917 pages = {269--288}, 37918 year = {2000} 37919} 37920 37921@Article{ tseng:growth, 37922 author = {P. Tseng}, 37923 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 37924 Problem}, 37925 journal = {Journal of Optimization Theory and Applications}, 37926 volume = {89}, 37927 year = {1996}, 37928 pages = {17--37} 37929} 37930 37931@Unpublished{ tseng:matlab, 37932 author = {P. Tseng}, 37933 title = {Matlab Implementations of Complementarity Codes}, 37934 year = {1995}, 37935 note = {Private Communication} 37936} 37937 37938@Article{ ursescu:multifunctions, 37939 author = {C. Ursescu}, 37940 title = {Multifunctions with closed convex graph}, 37941 journal = {Czech. Math. J.}, 37942 year = {1975}, 37943 volume = {35}, 37944 pages = {438--441} 37945} 37946 37947@TechReport{ vaidya:algorithm, 37948 author = {P. M. Vaidya}, 37949 title = {An Algorithm for Linear Programming which Requires 37950 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 37951 institution = {AT\&T Bell Laboratories}, 37952 year = {1987}, 37953 address = {Murray Hill, New Jersey} 37954} 37955 37956@Article{ val:unloading, 37957 author = {P. Du Val}, 37958 title = {The Unloading Problem for Plane Curves}, 37959 journal = {American Journal of Mathematics}, 37960 year = {1940}, 37961 volume = {62}, 37962 pages = {307--311} 37963} 37964 37965@InCollection{ valentine:problem, 37966 author = {F. A. Valentine}, 37967 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 37968 Conditions}, 37969 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 37970 year = {1937}, 37971 publisher = {University of Chicago Press}, 37972 address = {Chicago}, 37973 pages = {407--448} 37974} 37975 37976@Article{ valle.poch.ea:comparison, 37977 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 37978 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 37979 Flow-Injection Systems}, 37980 journal = {Analytica Chimica Acta}, 37981 year = {1990}, 37982 volume = {241}, 37983 pages = {31--42} 37984} 37985 37986@Article{ vandenberghe.demoor.ea:generalized, 37987 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 37988 title = {The generalized linear complementarity problem applied to the complete analysis 37989 of resistive piecewise-linear circuits}, 37990 journal = {IEEE Transactions on Circuits and Systems}, 37991 volume = {36}, 37992 year = {1989}, 37993 pages = {1382--1391} 37994} 37995 37996@Article{ vanderbei.meketon.ea:modification, 37997 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 37998 title = {A Modification of {K}armarkar's Algorithm}, 37999 journal = {Algorithmica}, 38000 year = {1986}, 38001 volume = {1}, 38002 pages = {395--407} 38003} 38004 38005@Article{ vanderbei:affine-scaling, 38006 author = {R. J. Vanderbei}, 38007 title = {Affine--Scaling for Linear Programs with Free Variables}, 38008 journal = {Mathematical Programming}, 38009 year = {1989}, 38010 volume = {43}, 38011 pages = {31--44} 38012} 38013 38014@Article{ vanroy.wolsey:solving, 38015 author = {T. J. Van~Roy and L. A. Wolsey}, 38016 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 38017 journal = {Operations Research}, 38018 volume = {35}, 38019 pages = {45--57}, 38020 year = {1987} 38021} 38022 38023@Book{ vapnik:nature, 38024 author = {V. N. Vapnik}, 38025 title = {The Nature of Statistical Learning Theory}, 38026 publisher = {John Wiley \& Sons}, 38027 address = {New York}, 38028 year = {1996} 38029} 38030 38031@Book{ varian:microeconomic, 38032 author = {Hal R. Varian}, 38033 title = {Microeconomic Analysis}, 38034 year = {1978}, 38035 publisher = {W.W. Norton \& Company}, 38036 address = {New York, New York} 38037} 38038 38039@Article{ verhey:immobilizing, 38040 author = {L. J. Verhey}, 38041 title = {Immobilizing and Positioning Patients for Radiotherapy}, 38042 journal = {Seminars in Radiation Oncology}, 38043 year = {1995}, 38044 volume = {5}, 38045 number = {2}, 38046 pages = {100--113} 38047} 38048 38049@Article{ vinante.pintos:differentiable, 38050 author = {C. Vinante and S. Pintos}, 38051 title = {On Differentiable Exact Penalty Functions}, 38052 journal = {Journal of Optimization Theory and Applications}, 38053 year = {1986}, 38054 volume = {50}, 38055 pages = {479--493} 38056} 38057 38058@Article{ vlach:scheduling, 38059 author = {M. Vlach}, 38060 title = {On Scheduling with Earliness and Tardiness Penalties}, 38061 journal = {Methods of Operations Research}, 38062 year = {1983}, 38063 volume = {45}, 38064 pages = {367--375} 38065} 38066 38067@InCollection{ wacker:summary, 38068 author = {H.--J. Wacker}, 38069 title = {A Summary of the Developments on Imbedding Methods}, 38070 booktitle = {Continuation Methods}, 38071 year = {1978}, 38072 editor = {H.--J. Wacker}, 38073 publisher = {Academic Press}, 38074 address = {New York}, 38075 pages = {1--35} 38076} 38077 38078@Article{ wakefield.tin-loi:large, 38079 author = {R. R. Wakefield and F. Tin-Loi}, 38080 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 38081 Formulation}, 38082 journal = {Computer Methods in Applied Mechanics and Engineering}, 38083 volume = {84}, 38084 year = {1990}, 38085 pages = {229--242} 38086} 38087 38088@Article{ wakefield.tin-loi:large*1, 38089 author = {R. R. Wakefield and F. Tin-Loi}, 38090 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 38091 Approach}, 38092 journal = {International Journal Mechanical Science}, 38093 volume = {33}, 38094 year = {1991}, 38095 pages = {379--391} 38096} 38097 38098@Article{ walker:implementation, 38099 author = {H. F. Walker}, 38100 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 38101 journal = {SIAM Journal on Scientific Computing}, 38102 volume = {9}, 38103 year = {1988}, 38104 pages = {152--163} 38105} 38106 38107@Book{ wall.schwartz:programming, 38108 author = {L. Wall and R. L. Schwartz}, 38109 title = {Programming Perl}, 38110 publisher = {O'Reilly and Associates, Inc.}, 38111 address = {Sebastopol, CA}, 38112 year = {1991} 38113} 38114 38115@Book{ walras:elements, 38116 author = {L. Walras}, 38117 title = {Elements of Pure Economics}, 38118 publisher = {Allen and Unwin}, 38119 year = {1954}, 38120 address = {London} 38121} 38122 38123@Article{ wang.monteiro.ea:interior, 38124 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 38125 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 38126 journal = {Mathematical Programming}, 38127 volume = {74}, 38128 pages = {159--196}, 38129 year = {1996} 38130} 38131 38132@Article{ wardi:stochastic, 38133 author = {Y. Wardi}, 38134 title = {A Stochastic Steepest-Descent Algorithm}, 38135 journal = {Journal of Optimization Theory and Applications}, 38136 year = {1988}, 38137 volume = {59}, 38138 pages = {307--323} 38139} 38140 38141@Article{ wardi:stochastic*1, 38142 author = {Y. Wardi}, 38143 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 38144 journal = {Journal of Optimization Theory and Applications}, 38145 year = {1990}, 38146 volume = {64}, 38147 pages = {399--417} 38148} 38149 38150@Article{ wardrop:theoretical, 38151 author = {J. G. Wardrop}, 38152 title = {Some Theoretical Aspects of Road Traffic Research}, 38153 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 38154 year = {1952}, 38155 pages = {325--378} 38156} 38157 38158@Article{ warga:minimizing, 38159 author = {J. Warga}, 38160 title = {Minimizing certain convex functions}, 38161 journal = {Journal of SIAM on Applied Mathematics}, 38162 year = {1963}, 38163 volume = {11}, 38164 pages = {588--593} 38165} 38166 38167@Article{ watson.billups.ea:hompack, 38168 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 38169 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 38170 Algorithms}, 38171 journal = {{ACM} Transactions on Mathematical Software}, 38172 year = {1987}, 38173 volume = {13}, 38174 pages = {281--310} 38175} 38176 38177@Article{ watson.billups.ea:slow, 38178 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 38179 title = {Slow Viscous Flow in a Syringe}, 38180 journal = {Journal of Biomechanical Engineering}, 38181 year = {1986}, 38182 volume = {108}, 38183 pages = {317--323} 38184} 38185 38186@Article{ watson:discrete, 38187 author = {G. A. Watson}, 38188 title = {Discrete $\ell_1$ approximation by rational functions}, 38189 journal = {IMA Journal of Numerical Analysis}, 38190 year = {1984}, 38191 volume = {4}, 38192 pages = {275--288} 38193} 38194 38195@Article{ watson:solving, 38196 author = {L. T. Watson}, 38197 title = {Solving the nonlinear complementarity problem by a homotopy method}, 38198 journal = {SIAM Journal on Control and Optimization}, 38199 year = {1979}, 38200 volume = {17}, 38201 pages = {36--46} 38202} 38203 38204@Article{ webb:optimum, 38205 author = {S. Webb}, 38206 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 38207 Heterogeneity}, 38208 journal = {Physics in Medicine and Biology}, 38209 year = {1994}, 38210 volume = {39}, 38211 pages = {1895--1914} 38212} 38213 38214@Book{ webb:physics, 38215 author = {S. Webb}, 38216 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 38217 publisher = {Institute of Physics Publishing Ltd.}, 38218 year = {1997}, 38219 optaddress = {Philadelphia} 38220} 38221 38222@InBook{ webb:theory, 38223 author = {S. Webb}, 38224 editor = {E. Sternick}, 38225 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 38226 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 38227 publisher = {Advanced Medical Publishing}, 38228 year = {1997} 38229} 38230 38231@Book{ weiss.kulikowski:computer, 38232 author = {S. M. Weiss and C. A. Kulikowski}, 38233 title = {Computer Systems that Learn}, 38234 year = {1991}, 38235 publisher = {Morgan Kaufmann Publishers, Inc}, 38236 address = {San Mateo, California} 38237} 38238 38239@PhDThesis{ werbos:beyond, 38240 author = {P. J. Werbos}, 38241 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 38242 Sciences}, 38243 year = {1974}, 38244 school = {Harvard University} 38245} 38246 38247@InCollection{ wets:convergence, 38248 author = {R. J.-B. Wets}, 38249 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 38250 Problems}, 38251 booktitle = {Variational Inequalites and Complementarity Problems}, 38252 year = {1980}, 38253 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 38254 publisher = {John Wiley \& Sons}, 38255 address = {New York}, 38256 pages = {375--403} 38257} 38258 38259@InCollection{ wets:large, 38260 author = {R. J.-B. Wets}, 38261 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 38262 booktitle = {Numerical Techniques for Stochastic Optimization}, 38263 publisher = {Springer-Verlag}, 38264 year = {1988}, 38265 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 38266 address = {Berlin}, 38267 pages = {65--93} 38268} 38269 38270@Article{ white:asymptotic, 38271 author = {H. White}, 38272 title = {Some asymptotic results for learning in single hidden-layer feedforward network 38273 models}, 38274 journal = {Journal of the American Stattistical Association}, 38275 year = {1989}, 38276 volume = {84}, 38277 number = {408}, 38278 pages = {1003--1013} 38279} 38280 38281@Article{ white:learning, 38282 author = {H. White}, 38283 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 38284 journal = {Neural Computation}, 38285 year = {1989}, 38286 volume = {1}, 38287 pages = {425--461} 38288} 38289 38290@InProceedings{ whitley.starkweather.ea:scheduling, 38291 crossref = {schaeffer:third}, 38292 author = {D. Whitley and T. Starkweather and D. Fuquay}, 38293 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 38294 Operator}, 38295 pages = {133--140} 38296} 38297 38298@Book{ williams:model, 38299 author = {H. P. Williams}, 38300 title = {Model Building in Mathematical Programming}, 38301 publisher = {John Wiley \& Sons}, 38302 year = {1990}, 38303 edition = {Third} 38304} 38305 38306@Book{ wilmott.dewynne.ea:option, 38307 author = {P. Wilmott and J. Dewynne and S. Howison}, 38308 title = {Option Pricing}, 38309 publisher = {Oxford Financial Press}, 38310 year = {1993}, 38311 address = {Oxford, England} 38312} 38313 38314@PhDThesis{ wilson:simplicial, 38315 author = {R. B. Wilson}, 38316 title = {A Simplicial Algorithm for Concave Programming}, 38317 year = {1963}, 38318 address = {Boston, MA}, 38319 school = {Graduate School of Business Administration, Harvard University} 38320} 38321 38322@TechReport{ wolberg.bennett.ea:breast, 38323 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 38324 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 38325 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 38326 Wisconsin}, 38327 year = {1992}, 38328 address = {Madison, WI 53706}, 38329 type = {Manuscript} 38330} 38331 38332@Article{ wolberg.mangasarian:multisurface, 38333 author = {W. H. Wolberg and O. L. Mangasarian}, 38334 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 38335 Cytology}, 38336 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 38337 year = {1990}, 38338 volume = {87}, 38339 pages = {9193--9196} 38340} 38341 38342@Unpublished{ wolberg.mangasarian:wbcd, 38343 author = {W. H. Wolberg and O. L. Mangasarian}, 38344 title = {{WBCD: Wisconsin Breast Cancer Database}}, 38345 year = {1991}, 38346 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 38347 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 38348} 38349 38350@Article{ wolberg.street.ea:breast, 38351 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38352 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 38353 journal = {Analytical and Quantitative Cytology and Histology}, 38354 year = {1993}, 38355 volume = {15}, 38356 number = {6}, 38357 pages = {396--404} 38358} 38359 38360@Unpublished{ wolberg.street.ea:wdbc, 38361 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38362 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 38363 year = {1995}, 38364 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38365 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 38366} 38367 38368@Unpublished{ wolberg.street.ea:wpbc, 38369 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38370 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 38371 year = {1995}, 38372 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38373 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 38374} 38375 38376@Book{ wolsey:integer, 38377 author = {L. A. Wolsey}, 38378 title = {Integer Programming}, 38379 publisher = {John Wiley \& Sons}, 38380 year = {1998}, 38381 address = {New York, NY} 38382} 38383 38384@Article{ womersley:local, 38385 author = {R. S. Womersley}, 38386 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 38387 journal = {Mathematical Programming}, 38388 year = {1985}, 38389 volume = {32}, 38390 pages = {69--89} 38391} 38392 38393@Article{ woo.sanders.ea:peacock, 38394 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 38395 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 38396 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38397 year = {1994}, 38398 volume = {29}, 38399 number = {1}, 38400 pages = {213--214} 38401} 38402 38403@Article{ wright.ralph:superlinear, 38404 author = {S. J. Wright and D. Ralph}, 38405 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 38406 Problems}, 38407 year = {1996}, 38408 journal = {Mathematics of Operations Research}, 38409 volume = {21}, 38410 pages = {815--838} 38411} 38412 38413@TechReport{ wright.zhang:superquadratic, 38414 author = {S. J. Wright and Y. Zhang}, 38415 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 38416 problems}, 38417 institution = {Argonne National Laboratory}, 38418 year = {1994}, 38419 annote = {revised}, 38420 number = {MCS--P418--0294}, 38421 address = {Argonne, Illinois}, 38422 type = {Preprint} 38423} 38424 38425@TechReport{ wright:dynfgm, 38426 author = {S. E. Wright}, 38427 title = {{DYNFGM}: Dynamic Finite Generation Method}, 38428 institution = {Department of Mathematics, University of Washington}, 38429 year = {1989}, 38430 address = {Seattle, Washington} 38431} 38432 38433@Article{ wright:infeasible-interior-point, 38434 author = {S. J. Wright}, 38435 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 38436 journal = {Mathematical Programming}, 38437 volume = {67}, 38438 pages = {29--51}, 38439 year = {1994} 38440} 38441 38442@Article{ wright:path-following, 38443 author = {S. J. Wright}, 38444 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 38445 Complementarity Problems}, 38446 journal = {Optimization Methods and Software}, 38447 year = {1993}, 38448 volume = {2}, 38449 pages = {79--106} 38450} 38451 38452@TechReport{ wright:path-following*1, 38453 author = {S. J. Wright}, 38454 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 38455 Problems}, 38456 institution = {Argonne National Laboratory}, 38457 year = {1993}, 38458 number = {MCS--P401--1293}, 38459 address = {Argonne, Illinois} 38460} 38461 38462@Book{ wright:primal-dual, 38463 author = {S. J. Wright}, 38464 title = {Primal--Dual Interior--Point Methods}, 38465 year = {1997}, 38466 publisher = {SIAM}, 38467 address = {Philadelphia, Pennsylvania} 38468} 38469 38470@TechReport{ wright:reduced, 38471 author = {S. J. Wright}, 38472 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 38473 institution = {Argonne National Laboratory}, 38474 year = {2000}, 38475 number = {MCS--P808--0400}, 38476 address = {Argonne, Illinois} 38477} 38478 38479@Article{ wright:solution, 38480 author = {S. J. Wright}, 38481 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 38482 journal = {Parallel Computing}, 38483 year = {1990}, 38484 volume = {16}, 38485 pages = {221--238} 38486} 38487 38488@Article{ wu.bourland:morphology, 38489 author = {Q. J. Wu and J. D. Bourland}, 38490 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 38491 isocenters}, 38492 journal = {Medical Physics}, 38493 year = {1999}, 38494 volume = {26}, 38495 number = {10}, 38496 pages = {2151--2160} 38497} 38498 38499@Misc{ wunderling:soplex, 38500 author = {R. Wunderling}, 38501 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 38502 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 38503} 38504 38505@Article{ xiao.harker:nonsmooth, 38506 author = {B. Xiao and P. T. Harker}, 38507 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 38508 journal = {Mathematical Programming}, 38509 year = {1994}, 38510 volume = {65}, 38511 pages = {151--194} 38512} 38513 38514@Article{ xiao.harker:nonsmooth*1, 38515 author = {B. Xiao and P. T. Harker}, 38516 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 38517 Results}, 38518 journal = {Mathematical Programming}, 38519 year = {1994}, 38520 volume = {65}, 38521 pages = {195--216} 38522} 38523 38524@Article{ xiao.zhou:nonmonotone, 38525 author = {Y. Xiao and F. J. Zhou}, 38526 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 38527 Minimization}, 38528 journal = {Computing}, 38529 year = {1992}, 38530 volume = {48}, 38531 pages = {303--317} 38532} 38533 38534@TechReport{ xiao:global, 38535 author = {B. Xiao}, 38536 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 38537 {B}-differentiable equation approach}, 38538 type = {{Ph.D. Thesis}}, 38539 year = {1990}, 38540 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 38541 address = {Philadelphia, PA} 38542} 38543 38544@Article{ xu.burke:polynomial, 38545 author = {S. Xu and J. V. Burke}, 38546 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 38547 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 38548 year = {1999}, 38549 journal = {Mathematical Programming}, 38550 volume = {86}, 38551 pages = {91--104} 38552} 38553 38554@TechReport{ xu:global, 38555 author = {S. Xu}, 38556 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 38557 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 38558 institution = {Department of Mathematics, University of Washington}, 38559 year = {1996}, 38560 type = {Technical Report}, 38561 address = {Seattle, WA} 38562} 38563 38564@Article{ yajima.konno:efficient, 38565 author = {Y. Yajima and H. Konno}, 38566 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 38567 Problems}, 38568 journal = {Journal of Global Optimization}, 38569 year = {1991}, 38570 volume = {1:1}, 38571 pages = {155--171} 38572} 38573 38574@Article{ yamamoto:path-following, 38575 author = {Y. Yamamoto}, 38576 title = {A Path--Following Algorithm for Stationary Point Problems}, 38577 journal = {Journal of Operations Society of Japan}, 38578 year = {1987}, 38579 volume = {30}, 38580 pages = {181--198} 38581} 38582 38583@Article{ yamashita.fukushima:modified, 38584 author = {N. Yamashita and M. Fukushima}, 38585 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 38586 Complementarity Problems}, 38587 journal = {Mathematical Programming}, 38588 year = {1997}, 38589 volume = {76}, 38590 pages = {469--492} 38591} 38592 38593@Article{ yamashita.fukushima:stationary, 38594 author = {N. Yamashita and M. Fukushima}, 38595 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 38596 Problems}, 38597 journal = {Journal of Optimization Theory and Applications}, 38598 volume = {84}, 38599 pages = {653--663}, 38600 year = {1995} 38601} 38602 38603@Article{ yamashita.taji.ea:unconstrained, 38604 author = {N. Yamashita and K. Taji and M. Fukushima}, 38605 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 38606 journal = {Journal of Optimization Theory and Applications}, 38607 year = {1997}, 38608 volume = {92}, 38609 pages = {439--456} 38610} 38611 38612@TechReport{ yamashita:properties, 38613 author = {N. Yamashita}, 38614 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 38615 Complementarity Problem}, 38616 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 38617 year = {1996}, 38618 type = {Technical Report}, 38619 address = {Kyoto, Japan} 38620} 38621 38622@Article{ yang.mackie.ea:investigation, 38623 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 38624 Thomadsen}, 38625 title = {An investigation of tomotherapy beam delivery}, 38626 journal = {Medical Physics}, 38627 year = {1997}, 38628 volume = {24}, 38629 number = {3}, 38630 pages = {425--436} 38631} 38632 38633@Article{ yan.shu.ea:clinical, 38634 author = {Y. Yan and H. Shu and X. Bao}, 38635 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 38636 Treatmen System}, 38637 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38638 year = {1997}, 38639 volume = {39}, 38640 pages = {247--254} 38641} 38642 38643@Article{ yau.gao:obstacle, 38644 author = {S. T. Yau and Y. Gao}, 38645 title = {Obstacle problem for von {K}arm\'an equations}, 38646 journal = {Advances in Applied Mathematics}, 38647 volume = {13}, 38648 year = {1992}, 38649 pages = {123--141} 38650} 38651 38652@Article{ ye.tse:extension, 38653 author = {Y. Ye and E. Tse}, 38654 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 38655 Programming}, 38656 journal = {Mathematical Programming}, 38657 year = {1989}, 38658 volume = {44} 38659} 38660 38661@Article{ ye:affine, 38662 author = {Y. Ye}, 38663 title = {On affine scaling algorithms for nonconvex quadratic programming}, 38664 journal = {Mathematical Programming}, 38665 year = {1992}, 38666 volume = {56}, 38667 pages = {285--300} 38668} 38669 38670@PhDThesis{ ye:interior, 38671 author = {Y. Ye}, 38672 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 38673 Programming}, 38674 year = {1987}, 38675 address = {Stanford, California}, 38676 school = {Department of Engineering--Economic Systems, Stanford University} 38677} 38678 38679@Book{ ye:interior*1, 38680 author = {Y. Ye}, 38681 title = {Interior-Point Algorithms: Theory and Analysis}, 38682 publisher = {John Wiley \& Sons}, 38683 year = {1997}, 38684 address = {New York, NY} 38685} 38686 38687@Article{ yu:convergence, 38688 author = {W. --C. Yu}, 38689 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 38690 journal = {Scientia Sinica, Special issue of Mathematics}, 38691 year = {1979}, 38692 volume = {1}, 38693 pages = {68--77} 38694} 38695 38696@Article{ yu.schell:genetic, 38697 author = {Y. Yu and M. C. Schell}, 38698 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 38699 journal = {Medical Physics}, 38700 year = {1996}, 38701 volume = {23}, 38702 pages = {2085--2091} 38703} 38704 38705@Article{ yuan:superlinear, 38706 author = {Y. Yuan}, 38707 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 38708 Optimization}, 38709 journal = {Mathematical Programming}, 38710 year = {1985}, 38711 volume = {31}, 38712 pages = {269--285} 38713} 38714 38715@Book{ zangwill:nonlinear, 38716 author = {W. I. Zangwill}, 38717 title = {Nonlinear Programming: {A} Unified Approach}, 38718 year = {1969}, 38719 publisher = {Prentice-Hall, Inc}, 38720 address = {Englewood Cliffs, New Jersey} 38721} 38722 38723@TechReport{ zangwill:nonlinear*1, 38724 author = {W. I. Zangwill}, 38725 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 38726 institution = {Center for Research in Management Science, University of California}, 38727 year = {1965}, 38728 address = {Berkeley}, 38729 number = {131}, 38730 type = {Working Paper} 38731} 38732 38733@Article{ zangwill:nonlinear*2, 38734 author = {W. I. Zangwill}, 38735 title = {Nonlinear Programming via Penalty Functions}, 38736 journal = {Management Science}, 38737 year = {1967}, 38738 volume = {13}, 38739 pages = {344--358} 38740} 38741 38742@TechReport{ zenios.censor:massively, 38743 author = {S. A. Zenios and Y. Censor}, 38744 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 38745 Problems}, 38746 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 38747 year = {1990}, 38748 type = {report}, 38749 number = {89-09-10}, 38750 address = {Philadelphia, PA} 38751} 38752 38753@Article{ zenios.lasken:nonlinear, 38754 author = {S. A. Zenios and R. A. Lasken}, 38755 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 38756 journal = {Annals of Operations Research}, 38757 year = {1988}, 38758 volume = {14}, 38759 pages = {147--163} 38760} 38761 38762@Article{ zenios.mulvey:distributed, 38763 author = {S. A. Zenios and J. M. Mulvey}, 38764 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 38765 journal = {Parallel Computing}, 38766 year = {1988}, 38767 volume = {6}, 38768 pages = {43--56} 38769} 38770 38771@TechReport{ zenios.neilsen:massively, 38772 author = {S. A. Zenios and S. Neilsen}, 38773 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 38774 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38775 year = {1990}, 38776 type = {report}, 38777 number = {90-03-01}, 38778 address = {Philadelphia, PA} 38779} 38780 38781@TechReport{ zenios.qi.ea:comparative, 38782 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 38783 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 38784 Nonlinear Network Optimization}, 38785 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38786 year = {1990}, 38787 type = {report}, 38788 number = {89-10-02}, 38789 address = {Philadelphia, PA} 38790} 38791 38792@Article{ zhang.kim.ea:improved, 38793 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 38794 title = {An Improved Successive Linear Programming Algorithm}, 38795 year = {1985}, 38796 journal = {Management Science}, 38797 volume = {31}, 38798 pages = {1312--1331} 38799} 38800 38801@Article{ zhang.tapia.ea:superlinear, 38802 author = {Y. Zhang and R. A. Tapia and F. Potra}, 38803 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 38804 of problems}, 38805 journal = {SIAM Journal on Optimization}, 38806 year = {1993}, 38807 volume = {3}, 38808 number = {?}, 38809 pages = {413--422}, 38810} 38811 38812@Article{ zhang.tapia:superlinearly, 38813 author = {Y. Zhang and R. A. Tapia}, 38814 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 38815 linear programming}, 38816 journal = {SIAM Journal on Optimization}, 38817 year = {1993}, 38818 volume = {3}, 38819 pages = {118--133} 38820} 38821 38822@TechReport{ zhang.zhang:superlinear, 38823 author = {Y. Zhang and D. Zhang}, 38824 title = {Superlinear convergence of infeasible interior-point methods for linear 38825 programming}, 38826 institution = {Department of Mathematics and Statistics, University of Maryland}, 38827 year = {1992}, 38828 number = {92-15}, 38829 address = {Baltimore County, Maryland} 38830} 38831 38832@Article{ zhang:convergence, 38833 author = {Yin Zhang}, 38834 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 38835 Horizontal Linear Complementarity Problem}, 38836 journal = {SIAM Journal on Optimization}, 38837 year = {1994}, 38838 volume = {4}, 38839 pages = {208--227} 38840} 38841 38842@Article{ zhang:convergence*1, 38843 author = {Y. Zhang}, 38844 title = {On the convergence of a class of infeasible interior-point methods for the 38845 horizontal linear complementarity problem}, 38846 journal = {SIAM Journal on Optimization}, 38847 year = {1994}, 38848 volume = {4}, 38849 pages = {208--227} 38850} 38851 38852@Article{ zhu.rockafellar:primal-dual, 38853 author = {C. Y. Zhu and R. T. Rockafellar}, 38854 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 38855 Programming}, 38856 journal = {SIAM Journal on Optimization}, 38857 year = {1993}, 38858 volume = {3}, 38859 pages = {751--783} 38860} 38861 38862@Article{ zhu:modified, 38863 author = {C. Y. Zhu}, 38864 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 38865 journal = {Computational Optimization and Applications}, 38866 year = {1992}, 38867 volume = {2}, 38868 pages = {182--205} 38869} 38870 38871@Article{ zhu:primal-dual, 38872 author = {C. Y. Zhu}, 38873 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 38874 Programming}, 38875 journal = {SIAM Journal on Optimization}, 38876 year = {1995}, 38877 volume = {5}, 38878 pages = {114--128} 38879} 38880 38881@Book{ zoutendijk:methods, 38882 author = {G. Zoutendijk}, 38883 title = {Methods of Feasible Directions}, 38884 year = {1960}, 38885 publisher = {Elsevier Publishing Company}, 38886 address = {Amsterdam} 38887} 38888 38889@Article{ zowe.kurcyusz:regularity, 38890 author = {J. Zowe and S. Kurcyusz}, 38891 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 38892 journal = {Applied Mathematics and Optimization}, 38893 year = {1979}, 38894 volume = {5}, 38895 pages = {49--62} 38896} 38897 38898@InProceedings{ zowe:nondifferentiable, 38899 author = {J. Zowe}, 38900 title = {Nondifferentiable Optimization}, 38901 booktitle = {Computational Mathematical Programming}, 38902 year = {1985}, 38903 editor = {K. Schittkowski}, 38904 publisher = {Springer-Verlag}, 38905 address = {Berlin} 38906} 38907 38908@Proceedings{ bachem.grotschel.ea:mathematical, 38909 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 38910 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 38911 year = {1983}, 38912 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 38913 publisher = {Springer Verlag}, 38914 address = {Berlin} 38915} 38916 38917@Proceedings{ belew.booker:fourth, 38918 year = {1991}, 38919 editor = {R. K. Belew and L. B. Booker}, 38920 publisher = {Morgan Kaufmann Publishers, Inc}, 38921 address = {San Mateo, California}, 38922 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 38923} 38924 38925@Proceedings{ coleman.li:large-scale, 38926 year = {1990}, 38927 editor = {T. F. Coleman and Y. Li}, 38928 publisher = {SIAM}, 38929 address = {Philadelphia, Pennsylvania}, 38930 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 38931 University, Ithaca, New York, October 19-20, 1989}, 38932 booktitle = {Large-Scale Numerical Optimization} 38933} 38934 38935@Book{ davis:genetic, 38936 title = {Genetic Algorithms and Simulated Annealing}, 38937 year = {1987}, 38938 editor = {L. D. Davis}, 38939 publisher = {Pitman}, 38940 address = {London}, 38941 booktitle = {Genetic Algorithms and Simulated Annealing} 38942} 38943 38944@Proceedings{ ferris.pang:complementarity, 38945 title = {Complementarity and Variational Problems: State of the Art}, 38946 booktitle = {Complementarity and Variational Problems: State of the Art}, 38947 year = {1997}, 38948 key = {57}, 38949 editor = {M. C. Ferris and J. S. Pang}, 38950 publisher = {SIAM Publications}, 38951 address = {Philadelphia, Pennsylvania} 38952} 38953 38954@Proceedings{ ferris.mangasarian.ea:complementarity, 38955 title = {Complementarity: Applications, Algorithms and Extensions}, 38956 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 38957 year = {2001}, 38958 key = {95}, 38959 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 38960 publisher = {Kluwer Academic Publishers}, 38961 address = {Dordrecht, The Netherlands} 38962} 38963 38964@Proceedings{ florian:traffic, 38965 title = {Traffic Equilibrium Methods}, 38966 year = {1976}, 38967 editor = {M. Florian}, 38968 publisher = {Springer-Verlag}, 38969 address = {Berlin} 38970} 38971 38972@Proceedings{ grefenstette:genetic, 38973 title = {Genetic Algorithms and their Applications: Proceedings of the Second 38974 International Conference on Genetic Algorithms}, 38975 year = {1987}, 38976 editor = {J. J. Grefenstette}, 38977 publisher = {Lawrence Erlbaum Associates}, 38978 address = {Hillsdale, New Jersey}, 38979 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 38980 International Conference on Genetic Algorithms} 38981} 38982 38983@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 38984 booktitle = {Nonlinear Programming}, 38985 volume = {2}, 38986 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38987 publisher = {Academic Press}, 38988 address = {New York}, 38989 year = {1975} 38990} 38991 38992@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 38993 booktitle = {Nonlinear Programming}, 38994 volume = {3}, 38995 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38996 publisher = {Academic Press}, 38997 address = {London}, 38998 year = {1978} 38999} 39000 39001@Proceedings{ robinson:local, 39002 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 39003 Regularity}, 39004 year = {1983}, 39005 editor = {V. Pereyra and A. Reinoza}, 39006 publisher = {Springer-Verlag}, 39007 address = {Berlin}, 39008 author = {S. M. Robinson}, 39009 pages = {240--251}, 39010 series = {Numerical Methods: Proceedings, Caracas 1982} 39011} 39012 39013@Proceedings{ schaeffer:third, 39014 year = {1989}, 39015 editor = {J. D. Schaeffer}, 39016 publisher = {Morgan Kaufmann Publishers, Inc}, 39017 address = {San Mateo, California}, 39018 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 39019} 39020 39021@Book{ vanderbei:linear, 39022 author = {R. J. Vanderbei}, 39023 title = {Linear Programming: Foundations and Extensions}, 39024 year = {1997}, 39025 publisher = {Kluwer Academic Publishers}, 39026 address = {Boston, Massachusetts} 39027} 39028 39029@Book{ dfobook, 39030 title = {Introduction to Derivative-Free Optimization}, 39031 publisher = {Society for Industrial and Applied Mathematics}, 39032 year = {2009}, 39033 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 39034 series = {MPS/SIAM Series on Optimization}, 39035 address = {Philadelphia, PA, USA}, 39036 isbn = {0-89871-460-5} 39037} 39038 39039@Article{ unedf0, 39040 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 39041 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 39042 title = {Nuclear Energy Density Optimization}, 39043 journal = {Physical Review C}, 39044 year = {2010}, 39045 volume = {82}, 39046 number = {2}, 39047 pages = {024313}, 39048 doi = {10.1103/PhysRevC.82.024313} 39049} 39050 39051@Article{ hestenes1969multiplier, 39052 title = {Multiplier and gradient methods}, 39053 author = {Hestenes, Magnus R}, 39054 journal = {Journal of optimization theory and applications}, 39055 volume = {4}, 39056 number = {5}, 39057 pages = {303--320}, 39058 year = {1969}, 39059 publisher = {Springer} 39060} 39061 39062@Article{ powell1969method, 39063 title = {A method for nonlinear constraints in minimization problems}, 39064 author = {Powell, Michael JD}, 39065 journal = {Optimization}, 39066 pages = {283--298}, 39067 year = {1969}, 39068 publisher = {Academic Press} 39069} 39070 39071@Book{ nocedal2006numerical, 39072 title = {Numerical optimization}, 39073 author = {Jorge Nocedal and Stephen Wright}, 39074 year = {2006}, 39075 publisher = {Springer Science \& Business Media} 39076} 39077 39078@Article{ rockafellar1974augmented, 39079 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 39080 author = {Rockafellar, R Tyrrell}, 39081 journal = {SIAM Journal on Control}, 39082 volume = {12}, 39083 number = {2}, 39084 pages = {268--285}, 39085 year = {1974}, 39086 publisher = {SIAM} 39087} 39088 39089@Article{ bacuta2006, 39090 title = {A unified approach for Uzawa algorithms}, 39091 author = {Constantin Bacuta}, 39092 journal = {SIAM Journal on Numerical Analysis}, 39093 volume = {44}, 39094 number = {6}, 39095 pages = {2633--2649}, 39096 year = {2006} 39097} 39098 39099@Article{ manteuffelrugesouthworth2018, 39100 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 39101 (AIR)}, 39102 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 39103 journal = {SIAM Journal on Scientific Computing}, 39104 volume = {40}, 39105 number = {6}, 39106 pages = {A4105--A4130}, 39107 year = {2018} 39108} 39109 39110@Article{ manteuffelmunzenmaierrugesouthworth2019, 39111 title = {Nonsymmetric reduction-based algebraic multigrid}, 39112 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 39113 journal = {SIAM Journal on Scientific Computing}, 39114 volume = {41}, 39115 number = {5}, 39116 pages = {S242--S268}, 39117 year = {2019} 39118} 39119 39120@PhDThesis{ sivas2021, 39121 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 39122 author = {Abdullah Ali Sivas}, 39123 department = {Applied Mathematics}, 39124 institution = {University of Waterloo}, 39125 year = {2021} 39126} 39127 39128@Article{ brookshughes1982, 39129 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 39130 with particular emphasis on the incompressible {Navier-Stokes} equations}, 39131 author = {Alexander N Brooks and Thomas JR Hughes}, 39132 journal = {Computer methods in applied mechanics and engineering}, 39133 volume = {32}, 39134 number = {1-3}, 39135 pages = {199--259}, 39136 year = {1982}, 39137 publisher = {Elsevier} 39138} 39139 39140@InProceedings{ suhisaac2020, 39141 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 39142 author = {Hansol Suh and Tobin Isaac}, 39143 booktitle = {SC20: International Conference for High Performance Computing, Networking, 39144 Storage and Analysis}, 39145 pages = {1--12}, 39146 year = {2020}, 39147 organization = {IEEE} 39148} 39149 39150@Misc{ alauzet2010, 39151 title = {Metric-Based Anisotropic Mesh Adaptation}, 39152 author = {Fr\'{e}d\'{e}ric Alauzet}, 39153 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 39154 year = {2010} 39155} 39156 39157@Article{ chan1994qmrcgs, 39158 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 39159 systems}, 39160 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 39161 and Tong, Charles H}, 39162 journal = {SIAM Journal on Scientific Computing}, 39163 volume = {15}, 39164 number = {2}, 39165 pages = {338--347}, 39166 year = {1994}, 39167 publisher = {SIAM} 39168} 39169 39170@Article{ ghai2019comparison, 39171 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 39172 nonsymmetric linear systems}, 39173 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 39174 journal = {Numerical Linear Algebra with Applications}, 39175 volume = {26}, 39176 number = {1}, 39177 pages = {e2215}, 39178 year = {2019}, 39179 publisher = {Wiley Online Library} 39180} 39181 39182@Article{ mishrasalacknepley2022, 39183 title = {On the order of accuracy for finite difference approximations of partial 39184 differential equations using stencil composition}, 39185 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 39186 journal = {International Journal on Numerical Methods in Engineering}, 39187 note = {Submitted}, 39188 year = {2022} 39189} 39190 39191@Article{ nathawaniknepley2022, 39192 title = {Droplet formation simulation using mixed finite elements}, 39193 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39194 journal = {Physics of Fluids}, 39195 volume = {34}, 39196 pages = {064105}, 39197 doi = {10.1063/5.0089752}, 39198 year = {2022} 39199} 39200 39201@InProceedings{ nathawaniknepley2022b, 39202 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 39203 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39204 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 39205 (ICCFD11)}, 39206 editor = {Christoph Brehm and Shishir Pandya}, 39207 number = {4103}, 39208 year = {2022} 39209} 39210 39211@Article{ nathawaniknepley2023, 39212 title = {A one-dimensional mathematical model for shear-induced droplet formation in co-flowing fluids}, 39213 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39214 journal = {Theoretical and Computational Fluid Dynamics}, 39215 url = {https://rdcu.be/dFtlR}, 39216 doi = {10.1007/s00162-024-00690-5}, 39217 year = {2024} 39218} 39219 39220@InProceedings{ georgalisnathawaniknepleypatra2023, 39221 title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, 39222 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 39223 Patra}, 39224 booktitle = {AIAA SciTech 2024}, 39225 note = {Accepted}, 39226 year = {2023} 39227} 39228 39229@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 39230 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 39231 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 39232 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 39233 Thompson and Junchao Zhang}, 39234 doi = {10.48550/ARXIV.2204.01722}, 39235 url = {https://arxiv.org/abs/2204.01722}, 39236 publisher = {arXiv}, 39237 note = {Submitted}, 39238 year = {2022} 39239} 39240 39241@InCollection{ mayknepley2023, 39242 title = {Numerical Modeling of Subduction}, 39243 author = {Dave A. May and Matthew G. Knepley}, 39244 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 39245 editor = {João C. Duarte}, 39246 pages = {539-571}, 39247 isbn = {978-0-323-85733-8}, 39248 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 39249 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 39250 year = {2023} 39251} 39252 39253@Article{ adamsknepley2023, 39254 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 39255 plasmas in {PETSc}}, 39256 author = {Mark F. Adams and Matthew G. Knepley}, 39257 url = {https://arxiv.org/abs/2302.10242}, 39258 note = {In preparation}, 39259 year = {2023}, 39260 petsc_uses = {DMPlex} 39261} 39262 39263@Article{ finnknepleypusztayadams2023, 39264 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 39265 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 39266 url = {https://arxiv.org/abs/2303.12620}, 39267 journal = {Communications in Applied Mathematics and Computational Science}, 39268 volume = {18}, 39269 number = {1}, 39270 pages = {135--152}, 39271 doi = {10.2140/camcos.2023.18.135}, 39272 year = {2023} 39273} 39274 39275@Article{ hamhaplaknepleymitchellsagiyama2024, 39276 title = {Efficient N-to-M Checkpointing Algorithm for Finite Element Simulations}, 39277 author = {David A. Ham and Vaclav Hapla and Matthew G. Knepley and Lawrence Mitchell and Koki Sagiyama}, 39278 journal = {SIAM Journal on Scientific Computing}, 39279 note = {Under review}, 39280 url = {https://arXiv.org/abs/2401.05868}, 39281 year = {2024}, 39282 petsc_uses = {DMPlex} 39283} 39284 39285@Article{ eggersdupont1994, 39286 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 39287 equation}, 39288 author = {Jens Eggers and Todd F. Dupont}, 39289 journal = {Journal of fluid mechanics}, 39290 volume = {262}, 39291 pages = {205--221}, 39292 year = {1994}, 39293 publisher = {Cambridge University Press} 39294} 39295 39296@PhDThesis{ pusztaythesis2023, 39297 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 39298 author = {Joseph V. Pusztay}, 39299 type = {{PhD} thesis}, 39300 school = {University at Buffalo, Department of Computer Science and Engineering}, 39301 address = {Buffalo, NY}, 39302 month = may, 39303 year = {2022} 39304} 39305 39306@PhDThesis{ finnthesis2023, 39307 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 39308 System}, 39309 author = {Daniel S. Finn}, 39310 type = {{PhD} thesis}, 39311 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39312 Engineering}, 39313 address = {Buffalo, NY}, 39314 month = may, 39315 year = {2023} 39316} 39317 39318@PhDThesis{ nathawanithesis2023, 39319 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 39320 author = {Darsh Kiritbhai Nathawani}, 39321 type = {{PhD} thesis}, 39322 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39323 Engineering}, 39324 address = {Buffalo, NY}, 39325 month = may, 39326 year = {2023} 39327} 39328 39329@article{MckayEriksonKozdon2019, 39330 title = {A computational method for earthquake cycles within anisotropic media}, 39331 author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, 39332 journal = {Geophysical Journal International}, 39333 volume = {219}, 39334 number = {2}, 39335 pages = {816--833}, 39336 year = {2019}, 39337} 39338 39339@article{EricksonOReillyNordstrom2019, 39340 title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, 39341 author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, 39342 journal = {Journal of Scientific Computing}, 39343 volume = {81}, 39344 pages = {2356--2387}, 39345 year = {2019}, 39346} 39347 39348@article{KozdonEricksonWilcox2021, 39349 title = {Hybridized summation-by-parts finite difference methods}, 39350 author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, 39351 journal = {Journal of Scientific Computing}, 39352 volume = {87}, 39353 number = {3}, 39354 pages = {85}, 39355 year = {2021}, 39356} 39357 39358@article{SEAS2022, 39359 title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, 39360 author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, 39361 journal = {Journal of Geophysical Research: Solid Earth}, 39362 volume = {127}, 39363 number = {3}, 39364 pages = {e2021JB023519}, 39365 year = {2022}, 39366} 39367 39368@article{EricksonKozdonHarvey2022, 39369 title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, 39370 author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, 39371 journal = {Journal of Scientific Computing}, 39372 volume = {93}, 39373 number = {1}, 39374 pages = {17}, 39375 year = {2022}, 39376} 39377 39378@article{RuckerEriksonKarlstromLeeGopalakrishnan2022, 39379 title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, 39380 author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, 39381 journal = {Journal of Geophysical Research: Solid Earth}, 39382 volume = {127}, 39383 number = {9}, 39384 pages = {e2022JB024506}, 39385 year = {2022}, 39386} 39387 39388@article{HarveyEriksonKozdon2023, 39389 title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, 39390 author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, 39391 journal = {Journal of Geophysical Research: Solid Earth}, 39392 pages = {e2022JB025357}, 39393 year = {2023}, 39394} 39395 39396@article{SEAS2023, 39397 title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, 39398 author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, 39399 journal = {Bulletin of the Seismological Society of America}, 39400 volume = {113}, 39401 number = {2}, 39402 pages = {499--523}, 39403 year = {2023}, 39404} 39405 39406@article{ErwayMarcia2017, 39407 title = {On solving large-scale limited-memory quasi-{N}ewton equations}, 39408 author = {Erway, Jennifer B and Marcia, Roummel F}, 39409 journal = {Linear Algebra and its Applications}, 39410 volume = {515}, 39411 pages = {196--225}, 39412 year = {2017}, 39413 publisher = {Elsevier}, 39414} 39415
