1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@article{veldhuizen1984d, 20 title = {{D}-stability and {K}aps-{R}entrop-methods}, 21 author = {Veldhuizen, M van}, 22 journal = {Computing}, 23 volume = {32}, 24 number = {3}, 25 pages = {229--237}, 26 year = {1984}, 27 publisher = {Springer} 28} 29 30@article{shampine1982implementation, 31 title = {Implementation of {R}osenbrock methods}, 32 author = {Shampine, Lawrence F}, 33 journal = {ACM Transactions on Mathematical Software (TOMS)}, 34 volume = {8}, 35 number = {2}, 36 pages = {93--113}, 37 year = {1982}, 38 publisher = {ACM New York, NY, USA} 39} 40 41@book{wanner1996solving, 42 title = {Solving ordinary differential equations {II}}, 43 author = {Wanner, Gerhard and Hairer, Ernst}, 44 volume = {375}, 45 year = {1996}, 46 publisher = {Springer Berlin Heidelberg New York} 47} 48 49@article{kaps1979generalized, 50 title = {Generalized {R}unge--{K}utta methods of order four with stepsize control for stiff ordinary differential equations}, 51 author = {Kaps, Peter and Rentrop, Peter}, 52 journal = {Numerische Mathematik}, 53 volume = {33}, 54 pages = {55--68}, 55 year = {1979}, 56 publisher = {Springer} 57} 58 59@book{butcher2016numerical, 60 title = {Numerical methods for ordinary differential equations}, 61 author = {Butcher, John Charles}, 62 year = {2016}, 63 publisher = {John Wiley \& Sons} 64} 65 66@article{chung1993, 67 author = {Chung, J. and Hulbert, G. M.}, 68 title = {A Time Integration Algorithm for Structural Dynamics With Improved Numerical Dissipation: The Generalized-alpha Method}, 69 journal = {Journal of Applied Mechanics}, 70 volume = {60}, 71 number = {2}, 72 pages = {371-375}, 73 year = {1993}, 74 month = {06}, 75 issn = {0021-8936}, 76 doi = {10.1115/1.2900803}, 77 url = {https://doi.org/10.1115/1.2900803}, 78 eprint = {https://asmedigitalcollection.asme.org/appliedmechanics/article-pdf/60/2/371/5463014/371\_1.pdf}, 79} 80 81@article{hosea1996analysis, 82 title = {Analysis and implementation of {TR-BDF2}}, 83 author = {Hosea, ME and Shampine, LF}, 84 journal = {Applied Numerical Mathematics}, 85 volume = {20}, 86 number = {1-2}, 87 pages = {21--37}, 88 year = {1996}, 89 publisher = {Elsevier} 90} 91 92@article{kennedy2019diagonally, 93 title = {Diagonally implicit {R}unge--{K}utta methods for stiff {ODE}s}, 94 author = {Kennedy, Christopher A and Carpenter, Mark H}, 95 journal = {Applied Numerical Mathematics}, 96 volume = {146}, 97 pages = {221--244}, 98 year = {2019}, 99 publisher = {Elsevier} 100} 101 102@inproceedings{xu2017adaptive, 103 title = {Adaptive relaxed {ADMM}: Convergence theory and practical implementation}, 104 author = {Xu, Zheng and Figueiredo, Mario AT and Yuan, Xiaoming and Studer, Christoph and Goldstein, Tom}, 105 booktitle = {Proceedings of the IEEE conference on computer vision and pattern recognition}, 106 pages = {7389--7398}, 107 year = {2017} 108} 109 110@article{hindmarsh1996time, 111 title = {Time-step limits for stable solutions of the ice-sheet equation}, 112 author = {Hindmarsh, Richard CA and Payne, Antony J}, 113 journal = {Annals of Glaciology}, 114 volume = {23}, 115 pages = {74--85}, 116 year = {1996}, 117 publisher = {Cambridge University Press} 118} 119 120@article{benson2006flexible, 121 title = {Flexible complementarity solvers for large-scale applications}, 122 author = {Benson, Steven J and Munson, Todd S}, 123 journal = {Optimization Methods and Software}, 124 volume = {21}, 125 number = {1}, 126 pages = {155--168}, 127 year = {2006}, 128 publisher ={Taylor \& Francis} 129} 130 131@article{byrd1994representations, 132 title = {Representations of quasi-{N}ewton matrices and their use in limited memory methods}, 133 author = {Byrd, Richard H and Nocedal, Jorge and Schnabel, Robert B}, 134 journal = {Mathematical Programming}, 135 volume = {63}, 136 number = {1-3}, 137 pages = {129--156}, 138 year = {1994}, 139 publisher = {Springer} 140} 141 142@article{gilbert1989some, 143 title = {Some numerical experiments with variable-storage quasi-{N}ewton algorithms}, 144 author = {Gilbert, Jean Charles and Lemar{\'e}chal, Claude}, 145 journal = {Mathematical programming}, 146 volume = {45}, 147 number = {1-3}, 148 pages = {407--435}, 149 year = {1989}, 150 publisher = {Springer} 151} 152 153@inproceedings{dener2019accelerating, 154 title = {Accelerating limited-memory quasi-{N}ewton convergence for large-scale optimization}, 155 author = {Dener, Alp and Munson, Todd}, 156 booktitle = {Computational Science--ICCS 2019: 19th International Conference, Faro, Portugal, June 12--14, 2019, Proceedings, Part III 19}, 157 pages = {495--507}, 158 year = {2019}, 159 organization = {Springer} 160} 161 162@article{park2021linear, 163 title = {Linear and nonlinear solvers for simulating multiphase flow within large-scale engineered subsurface systems}, 164 author = {Park, Heeho D and Hammond, Glenn E and Valocchi, Albert J and LaForce, Tara}, 165 journal = {Advances in Water Resources}, 166 volume = {156}, 167 pages = {104029}, 168 year = {2021}, 169 publisher = {Elsevier} 170} 171 172@inproceedings{va1981design, 173 title = {Design of optimally smoothing multi-stage schemes for the {E}uler equations}, 174 author = {Van Leer, Bram and Tai, Chang-Hsien and Powell, Kenneth}, 175 booktitle = {9th Computational Fluid Dynamics Conference}, 176 pages = {1933}, 177 year = {1981} 178} 179 180@article{pierce1997preconditioned, 181 title = {Preconditioned multigrid methods for compressible flow calculations on stretched meshes}, 182 author = {Pierce, Niles A and Giles, Michael B}, 183 journal = {Journal of Computational Physics}, 184 volume = {136}, 185 number = {2}, 186 pages = {425--445}, 187 year = {1997}, 188 publisher = {Elsevier} 189} 190 191@article{kong2016highly, 192 title = {A highly scalable multilevel {S}chwarz method with boundary geometry preserving coarse spaces for {3D} elasticity problems on domains with complex geometry}, 193 author = {Kong, Fande and Cai, Xiao-Chuan}, 194 journal = {SIAM Journal on Scientific Computing}, 195 volume = {38}, 196 number = {2}, 197 pages = {C73--C95}, 198 year = {2016}, 199 publisher = {SIAM} 200} 201 202@inproceedings{gutierrez2017accommodating, 203 title = {Accommodating thread-level heterogeneity in coupled parallel applications}, 204 author = {Guti{\'e}rrez, Samuel K and Davis, Kei and Arnold, Dorian C and Baker, Randal S and Robey, Robert W and McCormick, Patrick and 205 Holladay, Daniel and Dahl, Jon A and Zerr, R Joe and Weik, Florian and others}, 206 booktitle = {2017 {IEEE} International Parallel and Distributed Processing Symposium ({IPDPS})}, 207 pages = {469--478}, 208 year = {2017}, 209 organization = {IEEE} 210} 211 212@article{heroux2011bi, 213 title = {Bi-modal MPI and MPI+ threads computing on scalable multicore systems}, 214 author = {Heroux, Michael A and Brightwell, R and Wolf, Michael M}, 215 journal = {IJHPCA (Submitted)}, 216 year = {2011} 217} 218 219@inproceedings{bozdaug2005parallel, 220 title = {A parallel distance-2 graph coloring algorithm for distributed memory computers}, 221 author = {Bozda{\u{g}}, Doruk and Catalyurek, Umit and Gebremedhin, Assefaw H and Manne, Fredrik and Boman, Erik G and {\"O}zg{\"u}ner, F{\"u}sun}, 222 booktitle = {International conference on high performance computing and communications}, 223 pages = {796--806}, 224 year = {2005}, 225 organization = {Springer} 226} 227 228@article{dohrmann2009overlapping, 229 title = {An overlapping {S}chwarz algorithm for almost incompressible elasticity}, 230 author = {Dohrmann, Clark R and Widlund, Olof B}, 231 journal = {SIAM journal on numerical analysis}, 232 volume = {47}, 233 number = {4}, 234 pages = {2897--2923}, 235 year = {2009}, 236 publisher = {SIAM} 237} 238 239@article{dohrmann2008domain, 240 title = {Domain decomposition for less regular subdomains: Overlapping {S}chwarz in two dimensions}, 241 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 242 journal = {SIAM journal on numerical analysis}, 243 volume = {46}, 244 number = {4}, 245 pages = {2153--2168}, 246 year = {2008}, 247 publisher = {SIAM} 248} 249 250@incollection{dohrmann2008family, 251 title = {A family of energy minimizing coarse spaces for overlapping {S}chwarz preconditioners}, 252 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 253 booktitle = {Domain decomposition methods in science and engineering XVII}, 254 pages = {247--254}, 255 year = {2008}, 256 publisher = {Springer} 257} 258 259@book{dohrmann2008extending, 260 title = {Extending theory for domain decomposition algorithms to irregular subdomains}, 261 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 262 year = {2008}, 263 publisher = {Springer} 264} 265 266@article{dryja1994schwarz, 267 title = {{S}chwarz analysis of iterative substructuring algorithms for elliptic problems in three dimensions}, 268 author = {Dryja, Maksymilian and Smith, Barry F and Widlund, Olof B}, 269 journal = {SIAM journal on numerical analysis}, 270 volume = {31}, 271 number = {6}, 272 pages = {1662--1694}, 273 year = {1994}, 274 publisher = {SIAM} 275} 276 277@book{smith1990domain, 278 title = {Domain decomposition algorithms for the partial differential equations of linear elasticity}, 279 author = {Smith, Barry F}, 280 year = {1990}, 281 publisher = {New York University} 282} 283 284@article{bramble1989construction, 285 title = {The construction of preconditioners for elliptic problems by substructuring. {IV}}, 286 author = {Bramble, James H and Pasciak, Joseph E and Schatz, Alfred H}, 287 journal = {Mathematics of Computation}, 288 volume = {53}, 289 number = {187}, 290 pages = {1--24}, 291 year = {1989} 292} 293 294@article{kaczmarz1937angenaherte, 295 title = {Angenaherte auflosung von systemen linearer gleichungen}, 296 author = {Kaczmarz, Stefan}, 297 journal = {Bull. Int. Acad. Pol. Sic. Let., Cl. Sci. Math. Nat.}, 298 pages = {355--357}, 299 year = {1937} 300} 301 302@article{nataf2022recent, 303 title = {Recent advances in domain decomposition methods for large-scale saddle point problems}, 304 author = {Nataf, Fr{\'e}d{\'e}ric and Tournier, Pierre-Henri}, 305 journal = {Comptes Rendus. M{\'e}canique}, 306 volume = {350}, 307 number = {S1}, 308 pages = {1--15}, 309 year = {2022} 310} 311 312@article{al2022robustpd, 313 title = {A robust algebraic multilevel domain decomposition preconditioner for sparse symmetric positive definite matrices}, 314 author = {Al Daas, Hussam and Jolivet, Pierre}, 315 journal = {SIAM Journal on Scientific Computing}, 316 volume = {44}, 317 number = {4}, 318 pages = {A2582--A2598}, 319 year = {2022}, 320 publisher = {SIAM} 321} 322 323@article{al2022robust, 324 title = {A robust algebraic domain decomposition preconditioner for sparse normal equations}, 325 author = {Al Daas, Hussam and Jolivet, Pierre and Scott, Jennifer A}, 326 journal = {SIAM Journal on Scientific Computing}, 327 volume = {44}, 328 number = {3}, 329 pages = {A1047--A1068}, 330 year = {2022}, 331 publisher = {SIAM} 332} 333 334@article{al2021multilevel, 335 title = {A multilevel {S}chwarz preconditioner based on a hierarchy of robust coarse spaces}, 336 author = {Al Daas, Hussam and Grigori, Laura and Jolivet, Pierre and Tournier, Pierre-Henri}, 337 journal = {SIAM Journal on Scientific Computing}, 338 volume = {43}, 339 number = {3}, 340 pages = {A1907--A1928}, 341 year = {2021}, 342 publisher = {SIAM} 343} 344 345@book{dolean2015introduction, 346 title = {An introduction to domain decomposition methods: algorithms, theory, and parallel implementation}, 347 author = {Dolean, Victorita and Jolivet, Pierre and Nataf, Fr{\'e}d{\'e}ric}, 348 year = {2015}, 349 publisher = {SIAM} 350} 351 352@article{spillane2011robust, 353 title = {A robust two-level domain decomposition preconditioner for systems of {PDE}s}, 354 author = {Spillane, Nicole and Dolean, Victorita and Hauret, Patrice and Nataf, Fr{\'e}d{\'e}ric and Pechstein, Clemens and Scheichl, Robert}, 355 journal = {Comptes Rendus Mathematique}, 356 volume = {349}, 357 number = {23-24}, 358 pages = {1255--1259}, 359 year = {2011}, 360 publisher = {Elsevier} 361} 362 363@article{kong2020highly, 364 title = {A Highly Parallel Multilevel {N}ewton--{K}rylov--{S}chwarz Method with Subspace-Based Coarsening and 365 Partition-Based Balancing for the Multigroup Neutron Transport Equation on Three-Dimensional Unstructured Meshes}, 366 author = {Kong, Fande and Wang, Yaqi and Gaston, Derek R and Permann, Cody J and Slaughter, Andrew E and Lindsay, 367 Alexander D and DeHart, Mark D and Martineau, Richard C}, 368 journal = {SIAM Journal on Scientific Computing}, 369 volume = {42}, 370 number = {5}, 371 pages = {C193--C220}, 372 year = {2020}, 373 publisher = {SIAM} 374} 375 376@article{ipsen2001note, 377 title = {A note on preconditioning nonsymmetric matrices}, 378 author = {Ipsen, Ilse CF}, 379 journal = {SIAM Journal on Scientific Computing}, 380 volume = {23}, 381 number = {3}, 382 pages = {1050--1051}, 383 year = {2001}, 384 publisher = {SIAM} 385} 386 387@article{murphy2000note, 388 title = {A note on preconditioning for indefinite linear systems}, 389 author = {Murphy, Malcolm F and Golub, Gene H and Wathen, Andrew J}, 390 journal = {SIAM Journal on Scientific Computing}, 391 volume = {21}, 392 number = {6}, 393 pages = {1969--1972}, 394 year = {2000}, 395 publisher = {SIAM} 396} 397 398@article{oliphant1961implicit, 399 title = {An implicit, numerical method for solving two-dimensional time-dependent diffusion problems}, 400 author = {Oliphant, Thomas A}, 401 journal = {Quarterly of Applied mathematics}, 402 volume = {19}, 403 number = {3}, 404 pages = {221--229}, 405 year = {1961} 406} 407 408@article{dupont1968approximate, 409 title = {An approximate factorization procedure for solving self-adjoint elliptic difference equations}, 410 author = {Dupont, Todd and Kendall, Richard P and Rachford, Jr, HH}, 411 journal = {SIAM Journal on Numerical Analysis}, 412 volume = {5}, 413 number = {3}, 414 pages = {559--573}, 415 year = {1968}, 416 publisher = {SIAM} 417} 418 419@inproceedings{manteuffel1979shifted, 420 title = {Shifted incomplete {C}holesky factorization}, 421 author = {Manteuffel, Thomas A}, 422 booktitle = {Sparse Matrix Proceedings 1978}, 423 pages = {41--61}, 424 year = {1979}, 425 organization = {SIAM, Philadelphia, PA} 426} 427 428@incollection{chan1997approximate, 429 title = {Approximate and incomplete factorizations}, 430 author = {Chan, Tony F and Van Der Vorst, Henk A}, 431 booktitle = {Parallel numerical algorithms}, 432 pages = {167--202}, 433 year = {1997}, 434 publisher = {Springer} 435} 436 437@article{mandel2008multispace, 438 title = {Multispace and multilevel {BDDC}}, 439 author = {Mandel, Jan and Soused{\'\i}k, Bed{\v{r}}ich and Dohrmann, Clark R}, 440 journal = {Computing}, 441 volume = {83}, 442 number = {2-3}, 443 pages = {55--85}, 444 year = {2008}, 445 publisher = {Springer} 446} 447 448@article{klawonn2006dual, 449 title = {Dual-primal {FETI} methods for linear elasticity}, 450 author = {Klawonn, Axel and Widlund, Olof B}, 451 journal = {Communications on Pure and Applied Mathematics: A Journal Issued by the Courant Institute of Mathematical Sciences}, 452 volume = {59}, 453 number = {11}, 454 pages = {1523--1572}, 455 year = {2006}, 456 publisher = {Wiley Online Library} 457} 458 459@article{dohrmann2007approximate, 460 title = {An approximate {BDDC} preconditioner}, 461 author = {Dohrmann, Clark R}, 462 journal = {Numerical Linear Algebra with Applications}, 463 volume = {14}, 464 number = {2}, 465 pages = {149--168}, 466 year = {2007}, 467 publisher = {Wiley Online Library} 468} 469 470@book{dryja1987additive, 471 title = {An additive variant of the {S}chwarz alternating method for the case of many subregions}, 472 author = {Dryja, Maksymilian and Widlund, Olof}, 473 year = {1987}, 474 publisher = {Ultracomputer Research Laboratory, Univ., Courant Inst. of Mathematical~…} 475} 476 477@article{couturier2016tsirm, 478 title = {{TSIRM}: A two-stage iteration with least-squares residual minimization algorithm to solve large sparse linear and nonlinear systems}, 479 author = {Couturier, Rapha{\"e}l and Khodja, Lilia Ziane and Guyeux, Christophe}, 480 journal = {Journal of Computational Science}, 481 volume = {17}, 482 pages = {535--546}, 483 year = {2016}, 484 publisher = {Elsevier} 485} 486 487@article{chan1998transpose, 488 title = {Transpose-free formulations of Lanczos-type methods for nonsymmetric linear systems}, 489 author = {Chan, Tony F and De Pillis, Lisette and Van Der Vorst, Henk}, 490 journal = {Numerical Algorithms}, 491 volume = {17}, 492 pages = {51--66}, 493 year = {1998}, 494 publisher = {Springer} 495} 496 497@article{catabriga2006performance, 498 title = {Performance of {LCD} iterative method in the finite element and finite difference solution of convection--diffusion equations}, 499 author = {Catabriga, L and Valli, AMP and Melotti, BZ and Pessoa, LM and Coutinho, ALGA}, 500 journal = {Communications in numerical methods in engineering}, 501 volume = {22}, 502 number = {6}, 503 pages = {643--656}, 504 year = {2006}, 505 publisher = {Wiley Online Library} 506} 507 508@article{catabriga2004evaluating, 509 title = {Evaluating the {LCD} algorithm for solving linear systems of equations arising from implicit {SUPG} formulation of compressible flows}, 510 author = {Catabriga, Lucia and Coutinho, Alvaro LGA and Franca, Leopoldo P}, 511 journal = {International Journal for Numerical Methods in Engineering}, 512 volume = {60}, 513 number = {9}, 514 pages = {1513--1534}, 515 year = {2004}, 516 publisher = {Wiley Online Library} 517} 518 519@article{dai2004study, 520 title = {Study on semi-conjugate direction methods for non-symmetric systems}, 521 author = {Dai, Yu-Hong and Yuan, Jinyun}, 522 journal = {International journal for numerical methods in engineering}, 523 volume = {60}, 524 number = {8}, 525 pages = {1383--1399}, 526 year = {2004}, 527 publisher = {Wiley Online Library} 528} 529 530@article{yuan2004semi, 531 title = {Semi-conjugate direction methods for real positive definite systems}, 532 author = {Yuan, JY and Golub, Gene H and Plemmons, Robert J and Cecilio, WAG}, 533 journal = {BIT Numerical Mathematics}, 534 volume = {44}, 535 pages = {189--207}, 536 year = {2004}, 537 publisher = {Springer} 538} 539 540@article{ji2017breakdown, 541 title = {A breakdown-free block conjugate gradient method}, 542 author = {Ji, Hao and Li, Yaohang}, 543 journal = {BIT Numerical Mathematics}, 544 volume = {57}, 545 pages = {379--403}, 546 year = {2017}, 547 publisher = {Springer} 548} 549 550@inproceedings{jolivet2016block, 551 title = {Block iterative methods and recycling for improved scalability of linear solvers}, 552 author = {Jolivet, Pierre and Tournier, Pierre-Henri}, 553 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 554 pages = {190--203}, 555 year = {2016}, 556 organization = {IEEE} 557} 558 559@article{calandra2013modified, 560 title = {A modified block flexible {GMRES} method with deflation at each iteration for the solution of non-{H}ermitian linear systems with multiple right-hand sides}, 561 author = {Calandra, Henri and Gratton, Serge and Lago, Rafael and Vasseur, Xavier and Carvalho, Luiz Mariano}, 562 journal = {SIAM Journal on Scientific Computing}, 563 volume = {35}, 564 number = {5}, 565 pages = {S345--S367}, 566 year = {2013}, 567 publisher = {SIAM} 568} 569 570@article{o1980block, 571 title = {The block conjugate gradient algorithm and related methods}, 572 author = {O'Leary, Dianne P}, 573 journal = {Linear algebra and its applications}, 574 volume = {29}, 575 pages = {293--322}, 576 year = {1980}, 577 publisher = {Elsevier} 578} 579 580@article{erhel1996restarted, 581 title = {Restarted {GMRES} preconditioned by deflation}, 582 author = {Erhel, Jocelyne and Burrage, Kevin and Pohl, Bert}, 583 journal = {Journal of computational and applied mathematics}, 584 volume = {69}, 585 number = {2}, 586 pages = {303--318}, 587 year = {1996}, 588 publisher = {Elsevier} 589} 590 591@article{bai1994newton, 592 title = {A {N}ewton basis {GMRES} implementation}, 593 author = {Bai, Zhaojun and Hu, Dan and Reichel, Lothar}, 594 journal = {IMA Journal of Numerical Analysis}, 595 volume = {14}, 596 number = {4}, 597 pages = {563--581}, 598 year = {1994}, 599 publisher = {Oxford University Press} 600} 601 602@article{sidje1997alternatives, 603 title = {Alternatives for parallel Krylov subspace basis computation}, 604 author = {Sidje, Roger B}, 605 journal = {Numerical linear algebra with applications}, 606 volume = {4}, 607 number = {4}, 608 pages = {305--331}, 609 year = {1997}, 610 publisher = {Wiley Online Library} 611} 612 613@inproceedings{mohiyuddin2009minimizing, 614 title = {Minimizing communication in sparse matrix solvers}, 615 author = {Mohiyuddin, Marghoob and Hoemmen, Mark and Demmel, James and Yelick, Katherine}, 616 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage and Analysis}, 617 pages = {1--12}, 618 year = {2009} 619} 620 621@article{demmel2012communication, 622 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 623 author = {Demmel, James and Grigori, Laura and Hoemmen, Mark and Langou, Julien}, 624 journal = {SIAM Journal on Scientific Computing}, 625 volume = {34}, 626 number = {1}, 627 pages = {A206--A239}, 628 year = {2012}, 629 publisher = {SIAM} 630} 631 632@article{philippe2012generation, 633 title = {On the generation of {K}rylov subspace bases}, 634 author = {Philippe, Bernard and Reichel, Lothar}, 635 journal = {Applied Numerical Mathematics}, 636 volume = {62}, 637 number = {9}, 638 pages = {1171--1186}, 639 year = {2012}, 640 publisher = {Elsevier} 641} 642 643@article{wakam2013memory, 644 title = {Memory efficient hybrid algebraic solvers for linear systems arising from compressible flows}, 645 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Pacull, Fran{\c{c}}ois}, 646 journal = {Computers \& Fluids}, 647 volume = {80}, 648 pages = {158--167}, 649 year = {2013}, 650 publisher = {Elsevier} 651} 652 653@misc{wakam2011parallelism, 654 title = {Parallelism and robustness in {GMRES} with the {N}ewton basis and the deflated restarting}, 655 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Erhel, Jocelyne}, 656 year = {2011}, 657 url = {https://hal.inria.fr/inria-00638247/en} 658} 659 660@article{tu2015feti, 661 title = {A {FETI-DP} type domain decomposition algorithm for three-dimensional incompressible {S}tokes equations}, 662 author = {Tu, Xuemin and Li, Jing}, 663 journal = {SIAM Journal on Numerical Analysis}, 664 volume = {53}, 665 number = {2}, 666 pages = {720--742}, 667 year = {2015}, 668 publisher = {SIAM} 669} 670 671@article{farhat2001feti, 672 title = {{FETI-DP}: a dual--primal unified {FETI} method—part {I}: A faster alternative to the two-level {FETI} method}, 673 author = {Farhat, Charbel and Lesoinne, Michel and LeTallec, Patrick and Pierson, Kendall and Rixen, Daniel}, 674 journal = {International journal for numerical methods in engineering}, 675 volume = {50}, 676 number = {7}, 677 pages = {1523--1544}, 678 year = {2001}, 679 publisher = {Wiley Online Library} 680} 681 682@article{lottes2023optimal, 683 title = {Optimal polynomial smoothers for multigrid {V}-cycles}, 684 author = {Lottes, James}, 685 journal = {Numerical Linear Algebra with Applications}, 686 volume = {30}, 687 number = {6}, 688 pages = {e2518}, 689 year = {2023}, 690 publisher = {Wiley Online Library} 691} 692 693@article{phillips2022optimal, 694 title = {Optimal {C}hebyshev Smoothers and One-sided {V}-cycles}, 695 author = {Phillips, Malachi and Fischer, Paul}, 696 journal = {arXiv preprint arXiv:2210.03179}, 697 year = {2022} 698} 699 700@incollection{toint1981towards, 701 title = {Towards an efficient sparsity exploiting {N}ewton method for minimization}, 702 author = {Toint, Philippe}, 703 booktitle = {Sparse matrices and their uses}, 704 pages = {57--88}, 705 year = {1981}, 706 publisher = {Academic press} 707} 708 709@article{cools2019numerically, 710 title = {Numerically stable recurrence relations for the communication hiding pipelined conjugate gradient method}, 711 author = {Cools, Siegfried and Cornelis, Jeffrey and Vanroose, Wim}, 712 journal = {IEEE Transactions on Parallel and Distributed Systems}, 713 volume = {30}, 714 number = {11}, 715 pages = {2507--2522}, 716 year = {2019}, 717 publisher = {IEEE} 718} 719 720@article{cornelis2018communication, 721 title = {The communication-hiding conjugate gradient method with deep pipelines}, 722 author = {Cornelis, Jeffrey and Cools, Siegfried and Vanroose, Wim}, 723 journal = {arXiv preprint arXiv:1801.04728}, 724 year = {2018} 725} 726 727@article{d1993conjugate, 728 title = {Conjugate gradient algorithms with reduced synchronization overhead on distributed memory multiprocessors}, 729 author = {D’Azevedo, EF and Eijkhout, VL and Romine, CH}, 730 journal = {Computer Science Technical Report CS-93-185, University of Tennessee, Knoxville}, 731 year = {1993} 732} 733 734@book{malek2014preconditioning, 735 title = {Preconditioning and the conjugate gradient method in the context of solving {PDEs}}, 736 author = {M{\'a}lek, Josef and Strako{\v{s}}, Zden{\v{e}}k}, 737 year = {2014}, 738 publisher = {SIAM} 739} 740 741@book{fokkema1996enhanced, 742 title = {Enhanced implementation of {BiCGstab}(l) for solving linear systems of equations}, 743 author = {Fokkema, Diederik R}, 744 year = {1996}, 745 publisher = {Citeseer} 746} 747 748@article{sleijpen1994bicgstab, 749 title = {{BiCGstab}(l) and other hybrid {Bi-CG} methods}, 750 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A and Fokkema, Diederik R}, 751 journal = {Numerical Algorithms}, 752 volume = {7}, 753 pages = {75--109}, 754 year = {1994}, 755 publisher = {Springer} 756} 757 758@article{sleijpen1995overview, 759 title = {An overview of approaches for the stable computation of hybrid {BiCG} methods}, 760 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A}, 761 journal = {Applied numerical mathematics}, 762 volume = {19}, 763 number = {3}, 764 pages = {235--254}, 765 year = {1995}, 766 publisher = {Elsevier} 767} 768 769@article{fischer1998projection, 770 title = {Projection techniques for iterative solution of Ax= b with successive right-hand sides}, 771 author = {Fischer, Paul F}, 772 journal = {Computer methods in applied mechanics and engineering}, 773 volume = {163}, 774 number = {1-4}, 775 pages = {193--204}, 776 year = {1998}, 777 publisher = {Elsevier} 778} 779 780@article{maskery2018insights, 781 title = {Insights into the mechanical properties of several triply periodic minimal surface lattice structures 782 made by polymer additive manufacturing}, 783 author = {Maskery, Ian and Sturm, Logan and Aremu, Adedeji O and Panesar, Ajit and Williams, 784 Christopher B and Tuck, Christopher J and Wildman, Ricky D and Ashcroft, Ian A and Hague, Richard JM}, 785 journal = {Polymer}, 786 volume = {152}, 787 pages = {62--71}, 788 year = {2018}, 789 publisher = {Elsevier} 790} 791 792@book{karniadakis2005spectral, 793 title = {Spectral/hp element methods for computational fluid dynamics}, 794 author = {Karniadakis, George and Sherwin, Spencer J}, 795 year = {2005}, 796 publisher = {Oxford University Press, USA} 797} 798 799@article{golub1969calculation, 800 title = {Calculation of {G}auss quadrature rules}, 801 author = {Golub, Gene H and Welsch, John H}, 802 journal = {Mathematics of computation}, 803 volume = {23}, 804 number = {106}, 805 pages = {221--230}, 806 year = {1969} 807} 808 809@article{soderlind2006adaptive, 810 title = {Adaptive time-stepping and computational stability}, 811 author = {S{\"o}derlind, Gustaf and Wang, Lina}, 812 journal = {Journal of Computational and Applied Mathematics}, 813 volume = {185}, 814 number = {2}, 815 pages = {225--243}, 816 year = {2006}, 817 publisher = {Elsevier} 818} 819 820@article{soderlind2003digital, 821 title = {Digital filters in adaptive time-stepping}, 822 author = {S{\"o}derlind, Gustaf}, 823 journal = {{ACM} Transactions on Mathematical Software ({TOMS})}, 824 volume = {29}, 825 number = {1}, 826 pages = {1--26}, 827 year = {2003}, 828 publisher = {ACM New York, NY, USA} 829} 830 831@article{volkwein2013proper, 832 title = {Proper orthogonal decomposition: Theory and reduced-order modelling}, 833 author = {Volkwein, Stefan}, 834 journal = {Lecture Notes, University of Konstanz}, 835 volume = {4}, 836 number = {4}, 837 pages = {1--29}, 838 year = {2013}, 839 url = {http://www.math.uni-konstanz.de/numerik/personen/volkwein/teaching/POD-Book.pdf} 840} 841 842@article{frisvad2012building, 843 title = {Building an orthonormal basis from a {3D} unit vector without normalization}, 844 author = {Frisvad, Jeppe Revall}, 845 journal = {Journal of Graphics Tools}, 846 volume = {16}, 847 number = {3}, 848 pages = {151--159}, 849 year = {2012}, 850 publisher = {Taylor \& Francis} 851} 852 853@article{constantinescu2007multirate, 854 title = {Multirate timestepping methods for hyperbolic conservation laws}, 855 author = {Constantinescu, Emil M and Sandu, Adrian}, 856 journal = {Journal of Scientific Computing}, 857 volume = {33}, 858 number = {3}, 859 pages = {239--278}, 860 year = {2007}, 861 publisher = {Springer} 862} 863 864@article{liu2022newton, 865 title = {A {N}ewton-{MR} algorithm with complexity guarantees for nonconvex smooth unconstrained optimization}, 866 author = {Liu, Yang and Roosta, Fred}, 867 journal = {arXiv preprint arXiv:2208.07095}, 868 year = {2022} 869} 870 871@article{choi2011minres, 872 title = {{MINRES-QLP}: A {K}rylov subspace method for indefinite or singular symmetric systems}, 873 author = {Choi, Sou-Cheng T and Paige, Christopher C and Saunders, Michael A}, 874 journal = {SIAM Journal on Scientific Computing}, 875 volume = {33}, 876 number = {4}, 877 pages = {1810--1836}, 878 year = {2011}, 879 publisher = {SIAM} 880} 881 882@article{chen2020predict, 883 title = {Predict-and-recompute conjugate gradient variants}, 884 author = {Chen, Tyler and Carson, Erin}, 885 journal = {SIAM Journal on Scientific Computing}, 886 volume = {42}, 887 number = {5}, 888 pages = {A3084--A3108}, 889 year = {2020}, 890 publisher = {SIAM} 891} 892 893@article{cools2018analyzing, 894 title = {Analyzing the effect of local rounding error propagation on the maximal attainable accuracy of the pipelined conjugate gradient method}, 895 author = {Cools, Siegfried and Yetkin, Emrullah Fatih and Agullo, Emmanuel and Giraud, Luc and Vanroose, Wim}, 896 journal = {SIAM Journal on Matrix Analysis and Applications}, 897 volume = {39}, 898 number = {1}, 899 pages = {426--450}, 900 year = {2018}, 901 publisher = {SIAM} 902} 903 904@inproceedings{tiwari2020pipelined, 905 title = {Pipelined preconditioned conjugate gradient methods for distributed memory systems}, 906 author = {Tiwari, Manasi and Vadhiyar, Sathish}, 907 booktitle = {2020 IEEE 27th International Conference on High Performance Computing, Data, and Analytics (HiPC)}, 908 pages = {151--160}, 909 year = {2020}, 910 organization = {IEEE} 911} 912 913@article{nash1984newton, 914 title = {Newton-type minimization via the {L}anczos method}, 915 author = {Nash, Stephen G}, 916 journal = {SIAM Journal on Numerical Analysis}, 917 volume = {21}, 918 number = {4}, 919 pages = {770--788}, 920 year = {1984}, 921 publisher = {SIAM} 922} 923 924@inproceedings{eller2016scalable, 925 title = {Scalable non-blocking preconditioned conjugate gradient methods}, 926 author = {Eller, Paul R and Gropp, William}, 927 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 928 pages = {204--215}, 929 year = {2016}, 930 organization = {IEEE} 931} 932 933@article{gould1999solving, 934 title = {Solving the trust-region subproblem using the Lanczos method}, 935 author = {Gould, Nicholas IM and Lucidi, Stefano and Roma, Massimo and Toint, Philippe L}, 936 journal = {SIAM Journal on Optimization}, 937 volume = {9}, 938 number = {2}, 939 pages = {504--525}, 940 year = {1999}, 941 publisher = {SIAM} 942} 943 944@article{cools2017communication, 945 title = {The communication-hiding pipelined {BiCGstab} method for the parallel solution of large unsymmetric linear systems}, 946 author = {Cools, Siegfried and Vanroose, Wim}, 947 journal = {Parallel Computing}, 948 volume = {65}, 949 pages = {1--20}, 950 year = {2017}, 951 publisher = {Elsevier} 952} 953 954@Misc{moabwebsite, 955 key = {MOAB}, 956 title = {{MOAB} Website}, 957 howpublished = {\url{https://www.mcs.anl.gov/~fathom/moab-docs/html/contents.html}}, 958 year = {2023} 959} 960 961@book{deuflhard2011, 962 title = {{N}ewton Methods for Nonlinear Problems}, 963 author = {Peter Deuflhard}, 964 volume = {35}, 965 year = {2011}, 966 isbn = {978-3-642-23898-7}, 967 doi = {10.1007/978-3-642-23899-4}, 968 publisher = {Springer-Verlag}, 969 address = {Berlin, Heidelberg} 970} 971 972@article{ketcheson2010runge, 973 title = {{R}unge--{K}utta methods with minimum storage implementations}, 974 author = {Ketcheson, David I}, 975 journal = {Journal of Computational Physics}, 976 volume = {229}, 977 number = {5}, 978 pages = {1763--1773}, 979 year = {2010}, 980 publisher = {Elsevier} 981} 982 983@article{WalkerNi2011, 984 title = {{A}nderson acceleration for fixed-point iterations}, 985 author = {Homer F Walker and Peng Ni}, 986 journal = {SIAM Journal on Numerical Analysis}, 987 volume = {49}, 988 number = {4}, 989 pages = {1715--1735}, 990 year = {2011}, 991 publisher = {SIAM} 992} 993 994@article{Hua2007, 995 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 996 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 997 journal = {AIChE Journal}, 998 volume = {53}, 999 number = {10}, 1000 pages = {2534--2548}, 1001 year = {2007}, 1002 publisher = {Wiley Online Library} 1003} 1004 1005@Article{ openblas, 1006 title = {{OpenBLAS}: A High Performance {BLAS} Library on {L}oongson {3A} {CPU}}, 1007 journal = {Journal of Software}, 1008 volume = {22}, 1009 pages = {208--216}, 1010 year = {2011}, 1011 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 1012 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 1013} 1014 1015@Misc{ openblas-website, 1016 title = {{OpenBLAS}}, 1017 key = {OpenBLAS}, 1018 howpublished = {\url{https://www.openblas.net}} 1019} 1020 1021@Misc{ openacc-website, 1022 title = {{OpenACC}}, 1023 key = {OpenACC}, 1024 howpublished = {\url{https://www.openacc.org}} 1025} 1026 1027@Misc{ bueler2020petsc, 1028 title = {{PETSc} for Partial Differential Equations: Numerical Solutions in {C} and {P}ython}, 1029 author = {Bueler, Ed}, 1030 year = {2020}, 1031 publisher = {SIAM}, 1032 petsc_uses = {KSP} 1033} 1034 1035@TechReport{ petscforgpuexascale, 1036 title = {Toward Performance-Portable {PETSc} for {GPU}-based Exascale Systems}, 1037 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1038 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 1039 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1040 institution = {Argonne National Laboratory}, 1041 number = {ANL/MCS-P9401-1020}, 1042 note = {\url{https://arxiv.org/abs/2011.00715}}, 1043 year = {2020}, 1044 petsc_uses = {KSP} 1045} 1046 1047@Article{ mills2021, 1048 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 1049 journal = {Parallel Computing}, 1050 volume = {108}, 1051 pages = {102831}, 1052 year = {2021}, 1053 issn = {0167-8191}, 1054 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 1055 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 1056 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1057 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 1058 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 1059} 1060 1061@Article{ rupp:2016:pis:2988256.2907944, 1062 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 1063 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 1064 journal = {ACM Trans. Math. Softw.}, 1065 issue_date = {September 2016}, 1066 volume = {43}, 1067 number = {2}, 1068 month = aug, 1069 year = {2016}, 1070 issn = {0098-3500}, 1071 pages = {11:1--11:27}, 1072 articleno = {11}, 1073 numpages = {27}, 1074 doi = {10.1145/2907944}, 1075 acmid = {2907944}, 1076 publisher = {ACM}, 1077 address = {New York, NY, USA}, 1078 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 1079 gradient method}, 1080 petsc_uses = {KSP} 1081} 1082 1083@Article{ dalcin2011parallel, 1084 title = {Parallel distributed computing using python}, 1085 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 1086 journal = {Advances in Water Resources}, 1087 volume = {34}, 1088 number = {9}, 1089 pages = {1124--1139}, 1090 year = {2011}, 1091 publisher = {Elsevier}, 1092 petsc_uses = {KSP} 1093} 1094 1095@Article{ mendezpongaortiz2018, 1096 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 1097 author = {JP Mendez and M Ponga and M Ortiz}, 1098 journal = {Journal of the Mechanics and Physics of Solids}, 1099 year = {2018}, 1100 petsc_uses = {KSP} 1101} 1102 1103@TechReport{ morgan2020evaluation, 1104 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 1105 System: Part 1: Vector Node Performance}, 1106 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 1107 year = {2020}, 1108 institution = {Argonne National Laboratory}, 1109 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 1110 petsc_uses = {KSP} 1111} 1112 1113@TechReport{ pdeconstrainedspectraladjoints, 1114 title = {PDE constrained optimization, error estimation and control with spectral elements 1115 using PETSc and TAO}, 1116 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 1117 type = {Preprint}, 1118 number = {ANL/MCS-P9031-1117}, 1119 institution = {ANL}, 1120 month = nov, 1121 year = {2017}, 1122 petsc_uses = {KSP} 1123} 1124 1125@InProceedings{ asc2013, 1126 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 1127 title = {Evaluation of overlapping restricted additive {S}chwarz preconditioning for 1128 parallel solution of very large power flow problems}, 1129 booktitle = {HiPCNA-PG’13}, 1130 year = {2013}, 1131 petsc_uses = {KSP} 1132} 1133 1134@InProceedings{ as2013, 1135 author = {S. Abhyankar and B. F. Smith}, 1136 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 1137 Smart Grid Applications}, 1138 booktitle = {Proceedings of the IEEE PES General Meeting}, 1139 year = {2013}, 1140 petsc_uses = {KSP} 1141} 1142 1143@TechReport{ tspaper, 1144 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 1145 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 1146 Barry F. Smith}, 1147 type = {Preprint}, 1148 number = {ANL/MCS-P5061-0114}, 1149 institution = {ANL}, 1150 month = jan, 1151 year = {2014}, 1152 petsc_uses = {KSP} 1153} 1154 1155@TechReport{ abhyankaretal2018, 1156 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 1157 and Barry F. Smith and Hong Zhang}, 1158 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 1159 journal = {arXiv e-preprints}, 1160 eprint = {1806.01437}, 1161 archiveprefix = {arXiv}, 1162 year = {2018}, 1163 petsc_uses = {KSP} 1164} 1165 1166@Article{ zhang2021cams, 1167 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 1168 author = {Hong Zhang and Emil M. Constantinescu}, 1169 journal = {arXiv e-preprints}, 1170 eprint = {2202.11890}, 1171 archiveprefix = {arXiv}, 1172 year = {2022}, 1173 petsc_uses = {KSP} 1174} 1175 1176@InProceedings{ zhangconstantinescu2021b, 1177 title = {Revolve-based adjoint checkpointing for multistage time integration}, 1178 author = {Hong Zhang and Emil M. Constantinescu}, 1179 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 1180 month = jun, 1181 year = {2021}, 1182 petsc_uses = {KSP} 1183} 1184 1185@Article{ zhang2022tsadjoint, 1186 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 1187 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 1188 Sensitivity Analysis}}, 1189 journal = {SIAM Journal on Scientific Computing}, 1190 volume = {44}, 1191 number = {1}, 1192 pages = {C1-C24}, 1193 year = {2022}, 1194 doi = {10.1137/21M140078X}, 1195 petsc_uses = {KSP} 1196} 1197 1198@TechReport{ bb2008, 1199 author = {Tomasz Blachowicz and Bartlomiej Baron}, 1200 title = {A graphical extension for the Windows version of the Parallel Finite Element 1201 Micromagnetics Package (MagParExt)}, 1202 url = {http://arxiv.org/abs/0807.2655}, 1203 year = {2008}, 1204 petsc_uses = {KSP} 1205} 1206 1207@Article{ jacvgv2008, 1208 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 1209 and J L Vicent}, 1210 title = {Field induced vortex dynamics in magnetic {Ni} nanotriangles}, 1211 journal = {Nanotechnology}, 1212 volume = {19}, 1213 year = {2008}, 1214 doi = {10.1088/0957-4484/19/28/285717}, 1215 petsc_uses = {KSP} 1216} 1217 1218@Article{ yjdwh2008, 1219 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1220 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1221 journal = {Journal of the Magnetics Society of Japan}, 1222 volume = {32}, 1223 year = {2008}, 1224 pages = {50-53}, 1225 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 1226 petsc_uses = {KSP} 1227} 1228 1229@Article{ mtrtrsa2008, 1230 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 1231 Schrefl and M. Albrecht}, 1232 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 1233 journal = {J. Appl. Phys.}, 1234 volume = {103}, 1235 year = {2008}, 1236 doi = {10.1063/1.2894587}, 1237 petsc_uses = {KSP} 1238} 1239 1240@InProceedings{ tmrttsa2008, 1241 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 1242 Schrefl and M. Albrecht}, 1243 title = {Patterning of magnetic films by focused ion beam irradiation}, 1244 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 1245 year = {2008}, 1246 petsc_uses = {KSP} 1247} 1248 1249@Article{ yjdbh2007, 1250 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 1251 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 1252 factor for the single-phase soft magnetic films}, 1253 journal = {J. Magn. Magn. Mater.}, 1254 volume = {320}, 1255 number = {7}, 1256 pages = {1393-1397}, 1257 doi = {10.1016/j.jmmm.2007.11.025}, 1258 petsc_uses = {KSP} 1259} 1260 1261@Article{ lxky2007, 1262 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 1263 title = {Micromagnetic simulation and experimental study on microwave permeability of 1264 nano-magnetic films}, 1265 journal = {Transactions of Nonferrous Metals Society of China}, 1266 year = {2007}, 1267 pages = {756-759}, 1268 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 1269 petsc_uses = {KSP} 1270} 1271 1272@Article{ yjdwh2008a, 1273 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1274 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1275 journal = {Journal of the Magnetics Society of Japan}, 1276 volume = {32}, 1277 year = {2008}, 1278 pages = {50-53}, 1279 doi = {10.3379/msjmag.32.50}, 1280 petsc_uses = {KSP} 1281} 1282 1283@Article{ lylw2007, 1284 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 1285 title = {Micromagnetic study of magnetization reversal in patterned {DyFeCo} thin films}, 1286 journal = {Phys. Stat. Sol.}, 1287 volume = {204}, 1288 number = {12}, 1289 pages = {4049-4052}, 1290 year = {2007}, 1291 doi = {10.1002/pssa.200777359}, 1292 petsc_uses = {KSP} 1293} 1294 1295@InProceedings{ sg2007, 1296 author = {Simon Greaves}, 1297 title = {Micromagnetic Simulations of Magnetic Recording Media}, 1298 booktitle = {High Performance Computing on Vector Systems 2007}, 1299 doi = {10.1007/978-3-540-74384-2_17}, 1300 petsc_uses = {KSP} 1301} 1302 1303@Article{ bsc2007, 1304 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 1305 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm {NiFe} Nanorings}, 1306 journal = {IEEE Trans. Magn.}, 1307 volume = {43}, 1308 year = {2007}, 1309 pages = {2884-2886}, 1310 doi = {10.1109/TMAG.2007.892867}, 1311 petsc_uses = {KSP} 1312} 1313 1314@Article{ ffbf, 1315 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 1316 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 1317 Micromagnetic Simulations: Nmag.}, 1318 journal = {IEEE Trans. Magn. Volume}, 1319 volume = {43}, 1320 pages = {2896-2898}, 1321 doi = {10.1109/TMAG.2007.893843}, 1322 petsc_uses = {KSP} 1323} 1324 1325@InBook{ dfssfs2006, 1326 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 1327 chapter = {Computational Aspects of Micromagnetics}, 1328 title = {The Science of Hysteresis}, 1329 editor = { G. Bertotti and I. Mayergoyz}, 1330 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 1331 petsc_uses = {KSP} 1332} 1333 1334@InBook{ fss, 1335 author = {J. Fidler and T. Schrefl and W. Scholz}, 1336 chapter = {Computational Micromagnetics}, 1337 title = {Handbook of Theoretical and Computational Nanotechnology}, 1338 editor = {M. Rieth and W. Schommers}, 1339 url = {http://www.amazon.com/gp/product/158883042X}, 1340 petsc_uses = {KSP} 1341} 1342 1343@InBook{ shbsef, 1344 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 1345 Josef Fidler}, 1346 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 1347 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 1348 editor = {Helmut Kronmueller and Stuart Parkin}, 1349 doi = {10.1002/9780470022184.hmm203}, 1350 petsc_uses = {KSP} 1351} 1352 1353@InBook{ sfs, 1354 author = {D. Suess and J. Fidler and T. Schrefl}, 1355 chapter = {Micromagnetic Simulation of magnetic materials}, 1356 title = {Handbook of Magnetic Materials}, 1357 editor = {K. H. J. Buschow}, 1358 url = {http://www.amazon.com/gp/product/0444518509}, 1359 petsc_uses = {KSP} 1360} 1361 1362@Article{ fsxzs, 1363 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 1364 Sharma}, 1365 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 1366 Recording.}, 1367 journal = {IEEE Trans. Magn. Volume}, 1368 volume = {43}, 1369 pages = {2175-2177}, 1370 doi = {10.1109/TMAG.2007.893122}, 1371 petsc_uses = {KSP} 1372} 1373 1374@Article{ sb2006, 1375 author = {W. Scholz and S. Batra}, 1376 title = {Effect of write current waveform on magnetization and head field dynamics of 1377 perpendicular recording heads}, 1378 journal = {IEEE Trans. Magn.}, 1379 volume = {42}, 1380 year = {2006}, 1381 pages = {2264--2266}, 1382 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 1383 petsc_uses = {KSP} 1384} 1385 1386@Article{ bsr2006, 1387 author = {S. Batra and W. Scholz and T. Roscamp}, 1388 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 1389 recording system}, 1390 journal = {J. Appl. Phys.}, 1391 volume = {99}, 1392 year = {2006}, 1393 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 1394 petsc_uses = {KSP} 1395} 1396 1397@InProceedings{ japios2006, 1398 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 1399 Subramanian}, 1400 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 1401 in systems with cubic and uniaxial anisotropy.}, 1402 booktitle = {Intermag 2006 Conference}, 1403 petsc_uses = {KSP} 1404} 1405 1406@Article{ kbmb2006, 1407 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 1408 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 1409 Perpendicular Recording Heads}, 1410 journal = {IEEE Trans. Magn.}, 1411 volume = {42}, 1412 year = {2006}, 1413 pages = {2428--2430}, 1414 doi = {10.1109/TMAG.2006.879430}, 1415 petsc_uses = {KSP} 1416} 1417 1418@Article{ cclcw2006, 1419 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 1420 title = {Control of Domain Wall Motion in Permalloy Ring}, 1421 journal = {IEEE Trans. Magn.}, 1422 volume = {42}, 1423 year = {2006}, 1424 pages = {2960--2962}, 1425 doi = {10.1109/TMAG.2006.878414}, 1426 petsc_uses = {KSP} 1427} 1428 1429@Article{ bfmfzczg2007, 1430 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 1431 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 1432 title = {Micromagnetic modelling of ferromagnetic cones}, 1433 journal = {J. Magn. Magn. Mater.}, 1434 volume = {312}, 1435 year = {2007}, 1436 pages = {234-238}, 1437 url = {http://eprints.soton.ac.uk/45900/}, 1438 petsc_uses = {KSP} 1439} 1440 1441@PhDThesis{ rb2005, 1442 author = {Richard Boardman}, 1443 title = {Computer simulation studies of magnetic nanostructures}, 1444 school = {Computational Engineering and Design Group, School of Engineering Sciences, 1445 University of Southampton, United Kingdom}, 1446 year = {2005}, 1447 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 1448 petsc_uses = {KSP} 1449} 1450 1451@InProceedings{ cwwy2006, 1452 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 1453 title = {MPI Performance Analysis Tools on Blue Gene/L}, 1454 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 1455 year = {2006}, 1456 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 1457 petsc_uses = {KSP} 1458} 1459 1460@InProceedings{ ch2006, 1461 author = {I.-H. Chung and J.K. Hollingsworth}, 1462 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 1463 Programs}, 1464 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 1465 pages = {45--56}, 1466 doi = {10.1109/HPDC.2006.1652135}, 1467 petsc_uses = {KSP} 1468} 1469 1470@Article{ lkpl2005, 1471 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1472 title = {Multibit {MRAM} using a pair of memory cells}, 1473 journal = {IEEE Trans. Magn.}, 1474 volume = {41}, 1475 year = {2005}, 1476 pages = {2670-2672}, 1477 doi = {10.1109/TMAG.2005.855288}, 1478 petsc_uses = {KSP} 1479} 1480 1481@Article{ gscn2005, 1482 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 1483 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 1484 journal = {Phys. Rev. B}, 1485 volume = {71}, 1486 year = {2005}, 1487 doi = {10.1103/PhysRevB.71.144407}, 1488 petsc_uses = {KSP} 1489} 1490 1491@PhDThesis{ mda, 1492 author = {Massimiliano d'Aquino}, 1493 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 1494 school = { Universita di Napoli Federico II.}, 1495 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 1496 petsc_uses = {KSP} 1497} 1498 1499@TechReport{ ssdfssf2003, 1500 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 1501 Stehno and J. Fidler}, 1502 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 1503 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 1504 petsc_uses = {KSP} 1505} 1506 1507@InProceedings{ sb2006a, 1508 author = {W. Scholz and S. Batra}, 1509 title = {Effect of write current waveform on magnetization and head field dynamics of 1510 perpendicular recording heads}, 1511 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 1512 petsc_uses = {KSP} 1513} 1514 1515@Article{ scholz-batra1, 1516 author = {W. Scholz and S. Batra}, 1517 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 1518 Recording}, 1519 journal = {IEEE Trans. Magn.}, 1520 note = {submitted}, 1521 year = {2005}, 1522 petsc_uses = {KSP} 1523} 1524 1525@Article{ scholz-batra2, 1526 author = {W. Scholz and S. Batra}, 1527 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 1528 journal = {IEEE Trans. Magn.}, 1529 volume = {41}, 1530 year = {2005}, 1531 pages = {702-706}, 1532 petsc_uses = {KSP} 1533} 1534 1535@Article{ daquino-scholz1, 1536 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1537 title = {Micromagnetic Analysis of Fast Precessional Switching}, 1538 journal = {J. Magn. Magn. Mater.}, 1539 volume = {290-291}, 1540 year = {2005}, 1541 pages = {510-513}, 1542 petsc_uses = {KSP} 1543} 1544 1545@Article{ aq-scholz-fid, 1546 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1547 title = {Numerical and analytical study of fast precessional switching}, 1548 journal = {J. Appl. Phys.}, 1549 volume = {95}, 1550 year = {2004}, 1551 pages = {7055-7057}, 1552 petsc_uses = {KSP} 1553} 1554 1555@InProceedings{ gar-tabik-gar, 1556 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 1557 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 1558 Scatterers}, 1559 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 1560 (PDP'04)}, 1561 year = {2004}, 1562 pages = {80--}, 1563 petsc_uses = {KSP} 1564} 1565 1566@InProceedings{ aq-scholz-mia, 1567 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 1568 title = {Analysis of fast precessional switching in magnetic thin films}, 1569 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 1570 year = {2004}, 1571 pages = {257-260}, 1572 petsc_uses = {KSP} 1573} 1574 1575@Article{ scholz-fid-seus, 1576 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 1577 Dittrich and V. Tsiantos}, 1578 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 1579 Axes}, 1580 journal = {J. Magn. Magn. Mater.}, 1581 year = {2004}, 1582 pages = {1524-1525}, 1583 petsc_uses = {KSP} 1584} 1585 1586@Article{ boardman-zimmerman, 1587 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 1588 Peter de Groot}, 1589 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 1590 journal = {Journal of Applied Physics}, 1591 year = {2005}, 1592 petsc_uses = {KSP} 1593} 1594 1595@Article{ lim-kim-park, 1596 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1597 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 1598 journal = {IEEE Trans. Magn.}, 1599 note = {submitted}, 1600 petsc_uses = {KSP} 1601} 1602 1603@Article{ scholz-suess2, 1604 author = {W. Scholz and D. Suess and T. Schrefl and J. Fidler}, 1605 title = {Micromagnetic simulation of magnetization reversal in small particles with 1606 surface anisotropy}, 1607 journal = {J. Appl. Phys.}, 1608 volume = {95}, 1609 year = {2004}, 1610 pages = {6807-6809}, 1611 petsc_uses = {KSP} 1612} 1613 1614@Article{ scholz-schrefl1, 1615 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 1616 Tsiantos}, 1617 title = {Micromagnetic simulation of the pinning and depinning process in permanent 1618 magnets}, 1619 journal = {IEEE Trans. Magn.}, 1620 volume = {39}, 1621 year = {2003}, 1622 pages = {2920-2922}, 1623 petsc_uses = {KSP} 1624} 1625 1626@Article{ scholz-guslienko, 1627 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 1628 W. Chantrell and J. Fidler}, 1629 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 1630 nanodots}, 1631 journal = {J. Magn. Magn. Mater.}, 1632 volume = {266}, 1633 year = {2003}, 1634 pages = {155-163}, 1635 petsc_uses = {KSP} 1636} 1637 1638@Article{ scholz1, 1639 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 1640 Forster and V. Tsiantos}, 1641 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1642 journal = {Comp. Mat. Sci}, 1643 year = {2003}, 1644 pages = {366--383}, 1645 volume = {28}, 1646 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 1647 petsc_uses = {KSP} 1648} 1649 1650@PhDThesis{ scholz2, 1651 author = {W. Scholz}, 1652 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1653 school = {Vienna University of Technology, Vienna, Austria}, 1654 year = {2003}, 1655 petsc_uses = {KSP} 1656} 1657 1658@Article{ scholz3, 1659 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 1660 Forster and J. Fidler}, 1661 title = {Implementation of a high performance parallel finite element micromagnetics 1662 package}, 1663 journal = {J. Magn. Magn. Mater.}, 1664 year = {2004}, 1665 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 1666 petsc_uses = {KSP} 1667} 1668 1669% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1670@InBook{ zhanggladwell1, 1671 author = {W. Zhang and I. Gladwell}, 1672 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 1673 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 1674 year = {2000}, 1675 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 1676 Physics, vol. 552}, 1677 publisher = {Springer}, 1678 pages = {4190-}, 1679 petsc_uses = {KSP} 1680} 1681 1682@Article{ wolf1, 1683 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 1684 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 1685 thin films}, 1686 journal = {Phil. Mag. A}, 1687 year = {2003}, 1688 lab = {ANL}, 1689 petsc_uses = {KSP} 1690} 1691 1692@Article{ wolf2, 1693 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 1694 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 1695 grain-boundary properties}, 1696 journal = {Computational Materials Science}, 1697 year = {2001}, 1698 volume = {23}, 1699 pages = {15--32}, 1700 lab = {ANL}, 1701 petsc_uses = {KSP} 1702} 1703 1704@Article{ wolf3, 1705 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 1706 title = {Role of grain rotation in grain growth by mesoscale simulation}, 1707 journal = {Phil. Mag. A}, 1708 year = {2002}, 1709 volume = {82}, 1710 pages = {1271--1297}, 1711 lab = {ANL}, 1712 petsc_uses = {KSP} 1713} 1714 1715% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1716@Article{ saut, 1717 author = { Olivier Saut}, 1718 title = {Bidimensional Study of the {M}axwell-{B}loch Model in a Nonlinear Crystal}, 1719 journal = {SIAM Journal on Scientific Computing}, 1720 year = {2004}, 1721 note = {submitted}, 1722 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 1723 petsc_uses = {KSP} 1724} 1725 1726% LiteralHTML: 1727% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 1728% LiteralHTML: 1729@InBook{ khanallorenziayachepennec2016, 1730 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 1731 of Brain Deformation in {Alzheimer's} Disease}, 1732 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 1733 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 1734 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 1735 Miller}, 1736 pages = {167--176}, 1737 isbn = {978-3-319-28329-6}, 1738 doi = {10.1007/978-3-319-28329-6_15}, 1739 publisher = {Springer International Publishing}, 1740 year = {2016}, 1741 petsc_uses = {KSP} 1742} 1743 1744@Article{ ataseven, 1745 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 1746 title = {Parallel implementation of the accelerated {BEM} approach for {EMSI} of the human 1747 brain}, 1748 journal = {Medical and Biological Engineering and Computing}, 1749 month = feb, 1750 year = {2008}, 1751 doi = {10.1007/s11517-008-0316-0}, 1752 petsc_uses = {KSP} 1753} 1754 1755@Article{ dennis-eberhart-03, 1756 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 1757 pages = {832-840}, 1758 volume = {125}, 1759 number = {6}, 1760 title = {Finite-element simulation of cooling of realistic {3-D} human head and neck}, 1761 journal = {J Biomech Eng}, 1762 year = {2003}, 1763 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 1764 petsc_uses = {KSP} 1765} 1766 1767@Conference{ gu7174parallel, 1768 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 1769 frequency-domain small animal optical tomography}}, 1770 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 1771 booktitle = {Proc. of SPIE Vol}, 1772 volume = {7174}, 1773 number = {717406}, 1774 pages = {1}, 1775 petsc_uses = {KSP} 1776} 1777 1778@Article{ barchanski2005using, 1779 title = {{Using domain decomposition techniques for the calculation of low-frequency 1780 electric current densities in high-resolution 3D human anatomy models}}, 1781 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 1782 T.}, 1783 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 1784 and Electronic Engineering}, 1785 volume = {24}, 1786 number = {2}, 1787 pages = {458--467}, 1788 issn = {0332-1649}, 1789 year = {2005}, 1790 publisher = {Emerald Group Publishing Limited}, 1791 petsc_uses = {KSP} 1792} 1793 1794@Article{ motrescurienen05, 1795 author = {V. C. Motrescu and U. van Rienen}, 1796 pages = {227--231}, 1797 volume = {3}, 1798 title = {Computation of currents induced by {ELF} electric fields in anisotropic human 1799 tissues using the Finite Integration Technique}, 1800 journal = {Advances in Radio Science}, 1801 year = {2005}, 1802 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 1803 petsc_uses = {KSP} 1804} 1805 1806@Article{ motrescurienen04, 1807 author = {V. C. Motrescu and U. van Rienen}, 1808 pages = {309--313}, 1809 volume = {2}, 1810 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 1811 Integration Technique (FIT)}, 1812 journal = {Advances in Radio Science}, 1813 year = {2004}, 1814 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 1815 petsc_uses = {KSP} 1816} 1817 1818@InProceedings{ dbl2, 1819 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 1820 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 1821 booktitle = {ECCOMAS2000}, 1822 year = {2000}, 1823 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 1824 petsc_uses = {KSP} 1825} 1826 1827@Unpublished{ cell, 1828 title = {Parallel Simulation Engines for Whole-Cell Models}, 1829 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 1830 Weber}, 1831 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 1832 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 1833 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 1834 year = {2001}, 1835 petsc_uses = {KSP} 1836} 1837 1838@Article{ barker2010two, 1839 title = {Two-level {N}ewton and hybrid {S}chwarz preconditioners for fluid-structure 1840 interaction}, 1841 author = {Barker, A.T. and Cai, X.C.}, 1842 journal = {SIAM Journal on Scientific Computing}, 1843 volume = {32}, 1844 number = {4}, 1845 pages = {2395--2417}, 1846 year = {2010}, 1847 publisher = {Society for Industrial and Applied Mathematics}, 1848 petsc_uses = {KSP} 1849} 1850 1851@Article{ barker2010scalable, 1852 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 1853 with application to blood flow modeling}, 1854 author = {Barker, A.T. and Cai, X.C.}, 1855 journal = {Journal of Computational Physics}, 1856 volume = {229}, 1857 number = {3}, 1858 pages = {642--659}, 1859 year = {2010}, 1860 publisher = {Elsevier}, 1861 petsc_uses = {KSP} 1862} 1863 1864@Article{ barker2009nks, 1865 title = {{NKS} for fully coupled fluid-structure interaction with application}, 1866 author = {Barker, A.T. and Cai, X.C.}, 1867 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 1868 pages = {275--282}, 1869 year = {2009}, 1870 publisher = {Springer}, 1871 petsc_uses = {KSP} 1872} 1873 1874@Article{ mirams2013, 1875 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 1876 and Yi Cui and Gary R Mirams}, 1877 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 1878 to predict {QT} interval changes in the rabbit ventricular wedge}, 1879 journal = {Journal of pharmacological and toxicological methods}, 1880 volume = {68}, 1881 number = {1}, 1882 pages = {88--96}, 1883 year = {2013}, 1884 doi = {10.1016/j.vascn.2013.04.004}, 1885 petsc_uses = {KSP} 1886} 1887 1888% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1889% LiteralHTML: <center><img alt="" 1890% LiteralHTML: src="images/spine0l.jpg"></center></p> 1891% LiteralHTML: <center><img alt="" 1892% LiteralHTML: src="images/vertebra.jpg"></center></p> 1893% LiteralHTML:<font color="#FF0000"> 1894% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 1895% LiteralHTML:Understanding bone mechanical properties and how they may lead to 1896% LiteralHTML:fractures is thus an important medical research activity. PETSc and 1897% LiteralHTML:Prometheus have been used for extremely large scale finite element 1898% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 1899% LiteralHTML:team of doctors and computational scientists. This computation was 1900% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 1901% LiteralHTML:with over 4000 processors.</p> 1902% LiteralHTML: </font> 1903@Article{ arbenz2008scalable, 1904 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 1905 analysis of human bone structures}, 1906 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 1907 journal = {International Journal for Numerical Methods in Engineering}, 1908 volume = {73}, 1909 number = {7}, 1910 pages = {927--947}, 1911 year = {2008}, 1912 publisher = {Wiley Online Library}, 1913 petsc_uses = {KSP} 1914} 1915 1916@InProceedings{ adams-04, 1917 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1918 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 1919 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 1920 half a billion degrees of freedom}, 1921 note = {Gordon Bell Award}, 1922 year = {2004}, 1923 petsc_uses = {KSP} 1924} 1925 1926@InProceedings{ adams-03b, 1927 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1928 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 1929 Whole Bone Micro-Mechanics on the {IBM SP}}, 1930 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 1931 year = {2003}, 1932 petsc_uses = {KSP} 1933} 1934 1935@InProceedings{ oghattas2002, 1936 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 1937 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 1938 booktitle = {Procceedings of SC2002}, 1939 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 1940 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 1941 by time-dependent PDEs, and scalability results for an inverse wave propagation 1942 problem of determining the material field of an acoustic medium. Using the 1943 algorithm, they solved a synthetic inverse wave propagation problem though a 1944 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 1945 processors.}, 1946 year = {2002}, 1947 petsc_uses = {KSP} 1948} 1949 1950% LiteralHTML: <a name="biology:cardiology"> 1951% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1952% LiteralHTML: <center><img alt="" 1953% LiteralHTML: src="images/heart.jpg"> 1954% LiteralHTML: <img alt="" 1955% LiteralHTML: src="images/pump.jpg"></center></p> 1956% LiteralHTML: 1957% LiteralHTML:<font color="#FF0000"> 1958% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 1959% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 1960% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 1961% LiteralHTML: through the heart. PETSc has been used by several research groups to 1962% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 1963% LiteralHTML: fully understand the developments of arrhthmias.</p> 1964% LiteralHTML:</font> 1965@InProceedings{ oghattas2000, 1966 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1967 Walkington}, 1968 title = {A Parallel Dynamic-Mesh {L}agrangian Method for Simulation of Flows with Dynamic 1969 Interfaces}, 1970 booktitle = {Procceedings of SC2000}, 1971 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1972 note = {Blood flow modeling at the microscale including effects on individual blood 1973 cells, for designing heart assist pumps, etc.}, 1974 year = {2000}, 1975 petsc_uses = {KSP} 1976} 1977 1978@InBook{ cfps2006, 1979 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1980 editor = {A. Quarteroni et al.}, 1981 title = {Complex Systems in Biomedicine}, 1982 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1983 publisher = {Springer-Verlag}, 1984 pages = {187--241}, 1985 year = {2006}, 1986 petsc_uses = {KSP} 1987} 1988 1989@InProceedings{ cfpst2007, 1990 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 1991 title = {Determining recovery times from transmembrane action potentials and unipolar 1992 electrograms in normal heart tissue}, 1993 booktitle = {FIMH07}, 1994 publisher = {Springer-Verlag}, 1995 volume = {4466}, 1996 pages = {139--149}, 1997 year = {2007}, 1998 petsc_uses = {KSP} 1999} 2000 2001@Article{ seemann2010framework, 2002 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 2003 Equations Using PETSc}}, 2004 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 2005 D{\\"o}ssel, O.}, 2006 journal = {Progress in Industrial Mathematics at ECMI 2008}, 2007 pages = {363--369}, 2008 year = {2010}, 2009 publisher = {Springer}, 2010 petsc_uses = {KSP} 2011} 2012 2013@InProceedings{ pft2005, 2014 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 2015 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 2016 Intramural Heterogeneity}, 2017 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 2018 pages = {267--277}, 2019 editors = {A. Frangi et al.}, 2020 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 2021 year = {2005}, 2022 petsc_uses = {KSP} 2023} 2024 2025@Article{ bgcp2005, 2026 author = {Boyce E. Griffith and Charles S. Peskin}, 2027 title = {On the order of accuracy of the immersed boundary method: Higher order 2028 convergence rates for sufficiently smooth problems}, 2029 journal = {Journal of Computational Physics}, 2030 year = {2005}, 2031 volume = {208}, 2032 pages = {75--105}, 2033 petsc_uses = {KSP} 2034} 2035 2036@Article{ griffith2007adaptive, 2037 title = {An adaptive, formally second order accurate version of the immersed boundary 2038 method}, 2039 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 2040 journal = {Journal of Computational Physics}, 2041 volume = {223}, 2042 number = {1}, 2043 pages = {10--49}, 2044 year = {2007}, 2045 publisher = {Elsevier}, 2046 petsc_uses = {KSP} 2047} 2048 2049@PhDThesis{ griffith05, 2050 author = {Boyce Griffith}, 2051 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 2052 parallel version of the immersed boundary method}, 2053 school = {New York University}, 2054 year = {2005}, 2055 petsc_uses = {KSP} 2056} 2057 2058@PhDThesis{ murillo, 2059 author = {Maria S. Murillo}, 2060 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 2061 Differential Equations with an Application in Computational Biology}, 2062 school = {University of Colorado at Boulder}, 2063 year = {2002}, 2064 petsc_uses = {KSP} 2065} 2066 2067@Article{ spv2004, 2068 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 2069 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 2070 journal = {IEEE Trans. Biomed. Eng}, 2071 year = {2004}, 2072 volume = {51}, 2073 pages = {1960--1968}, 2074 petsc_uses = {KSP} 2075} 2076 2077@Article{ vphl2003, 2078 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 2079 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 2080 journal = {J. Electrocardiol.}, 2081 year = {2003}, 2082 volume = {36}, 2083 pages = {69--74}, 2084 petsc_uses = {KSP} 2085} 2086 2087@InProceedings{ spbv2003, 2088 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and E.J. Vigmond}, 2089 title = {Preconditioning Techniques for the Bidomain Equations}, 2090 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2091 Methods}, 2092 pages = {571--580}, 2093 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2094 note = {}, 2095 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2096 year = {2003}, 2097 petsc_uses = {KSP} 2098} 2099 2100@Article{ franz-pavir-04, 2101 author = {P. Colli Franzone and L.~F. Pavarino}, 2102 title = {A parallel solver for reaction-diffusion systems in computational 2103 electrocardiology}, 2104 journal = {Mathematical Models and Methods in Applied Sciences}, 2105 year = {2004}, 2106 volume = {14}, 2107 number = {6}, 2108 pages = {883--912}, 2109 petsc_uses = {KSP} 2110} 2111 2112@Article{ franz-pavir-05, 2113 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2114 title = {Simulating patterns of excitation, repolarization and action potential 2115 durationwith cardiac Bidomain and Monodomain models}, 2116 journal = {Mathematical Biosciences}, 2117 year = {2005}, 2118 volume = {197}, 2119 number = {1}, 2120 pages = {35--66}, 2121 petsc_uses = {KSP} 2122} 2123 2124@Article{ franz-pavir-06, 2125 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2126 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 2127 the dispersion of cardiac repolarization and action potential duration: a 2128 simulation study}, 2129 journal = {Mathematical Biosciences}, 2130 year = {2006}, 2131 volume = {204}, 2132 number = {1}, 2133 pages = {132--165}, 2134 petsc_uses = {KSP} 2135} 2136 2137@InProceedings{ colli-franz-sim, 2138 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 2139 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 2140 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 2141 Mediterranean Conference on Medical and Biological Engineering}, 2142 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 2143 year = {2004}, 2144 petsc_uses = {KSP} 2145} 2146 2147@InProceedings{ pf2003, 2148 author = {Luca F. Pavarino and Piero Colli Franzone}, 2149 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 2150 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2151 Methods}, 2152 pages = {669--776}, 2153 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2154 note = {}, 2155 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2156 year = {2003}, 2157 petsc_uses = {KSP} 2158} 2159 2160@Article{ maria-is04, 2161 author = {Maria Murillo and Xiao-Chuan Cai}, 2162 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 2163 activity of the heart}, 2164 journal = {Numerical Linear Algebra with Applications}, 2165 year = {2004}, 2166 volume = {11}, 2167 pages = {261 - 277}, 2168 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 2169 petsc_uses = {KSP} 2170} 2171 2172@Article{ murli2007monitoring, 2173 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 2174 Imaging in a Grid computing PSE}}, 2175 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 2176 and Lapegna, M.}, 2177 journal = {Grid-Based Problem Solving Environments}, 2178 pages = {421--432}, 2179 year = {2007}, 2180 publisher = {Springer}, 2181 petsc_uses = {KSP} 2182} 2183 2184@Article{ carracciuolo:2006:tpc, 2185 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 2186 title = {Towards a parallel component for imaging in {PETSc} programming environment: a case 2187 study in {3-D} echocardiography}, 2188 journal = {Parallel Comput.}, 2189 volume = {32}, 2190 issue = {1}, 2191 month = jan, 2192 year = {2006}, 2193 issn = {0167-8191}, 2194 pages = {67--83}, 2195 numpages = {17}, 2196 doi = {10.1016/j.parco.2005.09.001}, 2197 acmid = {1141218}, 2198 publisher = {Elsevier Science Publishers B. V.}, 2199 address = {Amsterdam, The Netherlands, The Netherlands}, 2200 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 2201 component}, 2202 petsc_uses = {KSP} 2203} 2204 2205@Article{ damore2011integration, 2206 title = {Integration of emerging computer technologies for an efficient image sequences 2207 analysis}, 2208 journal = {Integrated Computer-Aided Engineering }, 2209 volume = {18}, 2210 number = {4}, 2211 pages = {365 - 378}, 2212 year = {2011}, 2213 note = {}, 2214 issn = {1875-8835}, 2215 doi = {10.3233/ICA-2011-0382}, 2216 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 2217 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 2218 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 2219 petsc_uses = {KSP} 2220} 2221 2222@InProceedings{ eth_biwi_00721, 2223 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and G. 2224 Székely}, 2225 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 2226 a {S}chur Complement Preconditioner}, 2227 booktitle = {Euro-Par 2009 Parallel Processing}, 2228 year = {2009}, 2229 month = aug, 2230 pages = {747-759}, 2231 volume = {5704}, 2232 editor = {H. Sips and D. Epema and H.-X. Lin}, 2233 series = {Lecture Notes in Computer Science}, 2234 publisher = {Springer}, 2235 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 2236 parallel Krylov solver}, 2237 petsc_uses = {KSP} 2238} 2239 2240% LiteralHTML: <a name="biology:imagingandsurgery"> 2241% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 2242% LiteralHTML: <center><img alt="" 2243% LiteralHTML: src="images/brain.jpg"></center> 2244@Article{ ganser2004deformable, 2245 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 2246 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 2247 journal = {Medical Image Analysis}, 2248 volume = {8}, 2249 number = {1}, 2250 pages = {3--22}, 2251 year = {2004}, 2252 publisher = {Elsevier}, 2253 petsc_uses = {KSP} 2254} 2255 2256@Unpublished{ taccsurgery, 2257 title = {{TACC} supercomputer performs laser cancer surgery on canine}, 2258 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 2259 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 2260 Austin performed laser surgery on a dog in Houston without the intervention of a 2261 surgeon. The treatment was developed collaboratively by computational experts from 2262 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 2263 leading technologists from the M.D. Anderson Cancer Center in Houston, and 2264 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 2265 state-of-the-art thermal imaging technology, and advanced computational methods, 2266 dynamic, data-driven treatments are being pursued as a minimally invasive 2267 alternative to the standard treatment of cancer.}, 2268 petsc_uses = {KSP} 2269} 2270 2271@Article{ ffhbresso2008, 2272 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 2273 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 2274 Tinsley Oden}, 2275 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 2276 journal = {Engineering with Computers}, 2277 note = {Special issue on Computational Bioengineering}, 2278 year = {2008}, 2279 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 2280 petsc_uses = {KSP} 2281} 2282 2283@TechReport{ dobbhbbbdeffghkkps2008, 2284 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 2285 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 2286 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 2287 and S. Prudhomme and R. J. Stafford}, 2288 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 2289 Cancer}, 2290 year = {2008}, 2291 institution = {University of Texas at Austin}, 2292 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 2293 petsc_uses = {KSP} 2294} 2295 2296@Article{ ogdb2004, 2297 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 2298 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 2299 journal = {Physics in Medicine and Biology}, 2300 year = {2004}, 2301 volume = {49}, 2302 pages = {2955--2947}, 2303 petsc_uses = {KSP} 2304} 2305 2306@InProceedings{ majumdar11, 2307 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 2308 Baldridge and P. Krysl}, 2309 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 2310 booktitle = {ICCS 2005}, 2311 pages = {672--679}, 2312 editor = {V.S. Sunderam et al.}, 2313 year = {2005}, 2314 petsc_uses = {KSP} 2315} 2316 2317@Conference{ sermesant-etal:03, 2318 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 2319 Ayache, H.}, 2320 title = {A parallel implementation of non-rigid registration using a volumetric 2321 biomechanical model}, 2322 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 2323 address = {Philadelphia, PA, USA}, 2324 publisher = {Springer-Verlag}, 2325 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2326 series = {Lecture Notes in Computer Science}, 2327 volume = {2717}, 2328 pages = {398-407}, 2329 date = {june 23-24}, 2330 year = {2003}, 2331 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 2332 petsc_uses = {KSP} 2333} 2334 2335@Conference{ sermesant-etal:04, 2336 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 2337 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 2338 title = {A Novel Nonrigid Registration Algorithm And Applications}, 2339 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 2340 address = {Philadelphia, PA, USA}, 2341 publisher = {Springer-Verlag}, 2342 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2343 series = {Lecture Notes in Computer Science}, 2344 volume = {2208}, 2345 pages = {923}, 2346 year = {2003}, 2347 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 2348 petsc_uses = {KSP} 2349} 2350 2351@Article{ warfield-haker-talos-05, 2352 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 2353 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 2354 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 2355 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 2356 title = {Capturing intraoperative deformations: research experience at {B}righam and {W}omen's 2357 hospital}, 2358 journal = {Medical Image Analysis}, 2359 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 2360 year = {2005}, 2361 petsc_uses = {KSP} 2362} 2363 2364@Article{ brain3, 2365 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 2366 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 2367 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 2368 Deformation during Image Guided Neurosurgery}, 2369 journal = {Computing and Visualization in Science}, 2370 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 2371 year = {2002}, 2372 petsc_uses = {KSP} 2373} 2374 2375@Article{ brain2, 2376 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 2377 Kikinis and Simon K. Warfield}, 2378 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 2379 Element Biomechanical Model}, 2380 journal = {IEEE Transactions on Medical Imaging}, 2381 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 2382 year = {2001}, 2383 petsc_uses = {KSP} 2384} 2385 2386@InProceedings{ brain1, 2387 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 2388 Ferenc A. Jolesz and Ron Kikinis}, 2389 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 2390 Guided Neurosurgery}, 2391 booktitle = {Proceedings of SC2000}, 2392 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 2393 year = {2000}, 2394 petsc_uses = {KSP} 2395} 2396 2397@Article{ vanne06, 2398 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 2399 M. Lassas and M. Kalke}, 2400 title = {Parallelized {B}ayesian inversion for three-dimensional dental {X}-ray imaging}, 2401 journal = {IEEE Transactions on Medical Imaging}, 2402 volume = {25}, 2403 number = {2}, 2404 month = feb, 2405 year = {2006}, 2406 pages = {218--228}, 2407 petsc_uses = {KSP} 2408} 2409 2410@InProceedings{ knepleybardhan2015, 2411 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 2412 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 2413 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 2414 Exposition}, 2415 volume = {9}, 2416 pages = {V009T12A04}, 2417 doi = {10.1115/IMECE2015-53579}, 2418 year = {2015}, 2419 petsc_uses = {KSP} 2420} 2421 2422@InProceedings{ bardhanknepley2015, 2423 title = {Multiscale models and approximation algorithms for protein electrostatics}, 2424 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 2425 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 2426 volume = {61}, 2427 pages = {163--174}, 2428 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 2429 doi = {10.2495/BEM380131}, 2430 publisher = {WIT Press}, 2431 year = {2015}, 2432 petsc_uses = {KSP} 2433} 2434 2435% LiteralHTML: 2436% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 2437% LiteralHTML: 2438@InProceedings{ adamsbrennanknepleywang2022, 2439 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 2440 quench plasmas}, 2441 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 2442 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 2443 (IPDPS '22)}, 2444 doi = {10.1109/IPDPS53621.2022.00020}, 2445 year = {2022}, 2446 petsc_uses = {DMPlex} 2447} 2448 2449@Misc{ adamsknepleybrennan2021, 2450 title = {Runaway Electron Generation with High-Performance, Structure Preserving 2451 Discretization of {F}okker--{P}lank--{L}andau}, 2452 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 2453 year = {2021}, 2454 petsc_uses = {KSP} 2455} 2456 2457@Article{ adamshirvijokiknepleybrownisaacmills2017, 2458 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 2459 Architectures}, 2460 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 2461 Isaac and Richard Mills}, 2462 journal = {SIAM Journal on Scientific Computing}, 2463 volume = {39}, 2464 number = {6}, 2465 pages = {C452--C465}, 2466 doi = {10.1137/17M1118828}, 2467 eprint = {1702.08880}, 2468 year = {2017}, 2469 petsc_uses = {KSP} 2470} 2471 2472@Article{ pusztayknepleyadams2022, 2473 title = {Conservative Projection Between {FEM} and Particle Bases}, 2474 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 2475 journal = {SIAM Journal on Scientific Computing}, 2476 volume = {44}, 2477 number = {4}, 2478 pages = {C310--C319}, 2479 doi = {10.1137/21M145407}, 2480 year = {2022} 2481} 2482 2483@Article{ hirvijoki2017, 2484 author = {Eero Hirvijoki and Mark F. Adams}, 2485 title = {Conservative discretization of the {Landau} collision integral}, 2486 journal = {Physics of Plasmas}, 2487 volume = {24}, 2488 number = {3}, 2489 pages = {032121}, 2490 doi = {10.1063/1.4979122}, 2491 year = {2017}, 2492 petsc_uses = {KSP} 2493} 2494 2495@Article{ mollenadamsknepleyhagerchang2021, 2496 title = {Implementation of higher-order velocity mapping between marker particles and grid 2497 in the particle-in-cell code {XGC}}, 2498 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 2499 S. Chang}, 2500 journal = {Journal of Plasma Physics}, 2501 volume = {87}, 2502 number = {2}, 2503 pages = {905870229}, 2504 eprint = {2012.11764}, 2505 doi = {10.1017/S0022377821000441}, 2506 year = {2021}, 2507 petsc_uses = {KSP} 2508} 2509 2510@Article{ lsmh2014, 2511 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 2512 title = {Comparison of particle trajectories and collision operators for collisional 2513 transport in nonaxisymmetric plasmas}, 2514 journal = { Physics of Plasmas}, 2515 volume = {21}, 2516 year = {2014}, 2517 petsc_uses = {KSP} 2518} 2519 2520@Article{ lpcep2014, 2521 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 2522 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 2523 pedestal}, 2524 journal = {Plasma Physics and Controlled Fusion}, 2525 volume = {56}, 2526 year = {2014}, 2527 petsc_uses = {KSP} 2528} 2529 2530@Article{ facets-scidac08, 2531 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 2532 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 2533 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 2534 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 2535 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 2536 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 2537 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 2538 Stotler and A. Pigarov}, 2539 journal = {J. Phys.: Conf. Ser.}, 2540 volume = {125}, 2541 year = {2008}, 2542 pages = {012040}, 2543 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 2544 petsc_uses = {KSP} 2545} 2546 2547@Article{ facets-scidac09, 2548 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 2549 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 2550 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 2551 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 2552 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 2553 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 2554 and A. Pigarov and H. Zhang}, 2555 journal = {J. Phys.: Conf. Ser.}, 2556 volume = {180}, 2557 year = {2009}, 2558 pages = {012056}, 2559 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 2560 petsc_uses = {KSP} 2561} 2562 2563@InProceedings{ facets-scidac10, 2564 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 2565 {FACETS} Code}, 2566 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 2567 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 2568 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 2569 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 2570 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 2571 Pigarov and H. Zhang}, 2572 booktitle = {Proceedings of SciDAC 2010 Conference}, 2573 year = {2010}, 2574 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 2575 petsc_uses = {KSP} 2576} 2577 2578@InProceedings{ facets-fec2010, 2579 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 2580 the {FACETS} Framework}, 2581 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 2582 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 2583 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 2584 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 2585 Republic of Korea}, 2586 year = {2010}, 2587 petsc_uses = {KSP} 2588} 2589 2590@InProceedings{ facets-epdp2010, 2591 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 2592 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 2593 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 2594 Groebner and S. Balay and L. McInnes and H. Zhang}, 2595 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 2596 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 2597 year = {2010}, 2598 petsc_uses = {KSP} 2599} 2600 2601@Article{ carlssoncary09, 2602 author = {Johan Carlsson, John R. Cary}, 2603 title = {The hypersecant {J}acobian approximation for quasi-{N}ewton solves of sparse 2604 nonlinear systems}, 2605 journal = {arXiv}, 2606 year = {2009}, 2607 note = {http://arxiv.org/abs/0905.1054}, 2608 url = {http://arxiv.org/pdf/0905.1054v1}, 2609 petsc_uses = {KSP} 2610} 2611 2612@InProceedings{ oshahjs2006, 2613 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 2614 S.J. Janhunen and T.P. Kiviniemi}, 2615 title = {Performance enhancements to {ELMFIRE} gyrokinetic code leading to new ranges of 2616 application}, 2617 booktitle = {33rd EPS Conference on Plasma Phys.}, 2618 year = {2006}, 2619 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 2620 note = {European fusion code}, 2621 petsc_uses = {KSP} 2622} 2623 2624@Article{ zhu2006, 2625 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 2626 title = {Intermediate nonlinear evolution of the {P}arker instability: Formation of 2627 convection-induced discontinuities and absence of finite-time singularities}, 2628 journal = {Phys. Rev. Lett.}, 2629 volume = {96}, 2630 number = {065001}, 2631 year = {2006}, 2632 doi = {10.1103/PhysRevLett.96.065001}, 2633 petsc_uses = {KSP} 2634} 2635 2636@InProceedings{ ppc2005, 2637 author = {B. Philip and M. Pernice and L.Chacon}, 2638 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 2639 Refinement}, 2640 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 2641 methods}, 2642 year = {2005}, 2643 lab = {LANL}, 2644 petsc_uses = {KSP} 2645} 2646 2647@Article{ pp2005, 2648 author = {M. Pernice and B. Philip}, 2649 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 2650 Refinement}, 2651 year = {2005}, 2652 journal = {SIAM J. of Sci. Comput.}, 2653 lab = {LANL}, 2654 petsc_uses = {KSP} 2655} 2656 2657@Article{ gt2004, 2658 author = {A. H. Glasser and X. Z. Tang}, 2659 title = {The {SEL} macroscopic modeling code}, 2660 year = {2004}, 2661 journal = {Computer Physics Communications}, 2662 pages = {237--243}, 2663 volume = {164}, 2664 lab = {LANL}, 2665 petsc_uses = {KSP} 2666} 2667 2668@Article{ nl2006, 2669 author = {Y. Nishimura and Z.Lin}, 2670 title = {A finite element mesh in a tokamak edge geometry}, 2671 year = {2006}, 2672 journal = {Contributions to Plasma Physics}, 2673 volume = {22}, 2674 lab = {PPPL}, 2675 petsc_uses = {KSP} 2676} 2677 2678@Article{ nlle2004, 2679 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 2680 title = {A finite element {P}oisson solver for gyrokinetic particle simulations in a global 2681 field aligned mesh}, 2682 year = {2006}, 2683 journal = {J. Comput. Phys.}, 2684 volume = {214}, 2685 pages = {657}, 2686 lab = {PPPL}, 2687 petsc_uses = {KSP} 2688} 2689 2690@InProceedings{ lnlle2004, 2691 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 2692 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 2693 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2694 year = {2004}, 2695 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 2696 lab = {PPPL}, 2697 petsc_uses = {KSP} 2698} 2699 2700@InProceedings{ nlclew2004, 2701 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 2702 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 2703 model}, 2704 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2705 year = {2004}, 2706 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 2707 lab = {PPPL}, 2708 petsc_uses = {KSP} 2709} 2710 2711@Article{ tb1, 2712 author = {X.~Z.~Tang and A.~H.~Boozer}, 2713 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 2714 plasma}, 2715 journal = {Physics of Plasmas}, 2716 year = {2004}, 2717 pages = {171--185}, 2718 volume = {11}, 2719 lab = {LANL}, 2720 petsc_uses = {KSP} 2721} 2722 2723@Unpublished{ nlcw, 2724 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 2725 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 2726 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 2727 Albuquerque, New Mexico, October 2003}, 2728 year = {2003}, 2729 petsc_uses = {KSP} 2730} 2731 2732@TechReport{ tang2001, 2733 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 2734 Strauss}, 2735 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 2736 year = {2001}, 2737 institution = {Princeton Plasma Physics Laboratory}, 2738 number = {PPPL-3532}, 2739 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 2740 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 2741 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 2742 March 12-14, 2001.}, 2743 lab = {PPPL}, 2744 petsc_uses = {KSP} 2745} 2746 2747% LiteralHTML: 2748% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 2749% LiteralHTML: 2750@Article{ valerathomasgarciacastillo2019, 2751 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 2752 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 2753 Coastal Ocean Model}, 2754 journal = {Journal of Marine Science and Engineering}, 2755 volume = {7}, 2756 number = {6}, 2757 article-number= {185}, 2758 url = {https://www.mdpi.com/2077-1312/7/6/185}, 2759 issn = {2077-1312}, 2760 doi = {10.3390/jmse7060185}, 2761 year = {2019}, 2762 petsc_uses = {KSP} 2763} 2764 2765@Article{ furuichimat2015, 2766 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 2767 thermal convection simulation surrounded by free surface}, 2768 author = {Mikito Furuichi and Dave A May}, 2769 journal = {Computer Physics Communications}, 2770 volume = {192}, 2771 pages = {1--11}, 2772 year = {2015}, 2773 petsc_uses = {KSP} 2774} 2775 2776@Article{ sharplesmoresivelicjadamecmay2016, 2777 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 2778 model}, 2779 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 2780 Dave A May}, 2781 journal = {Physics of the Earth and Planetary Interiors}, 2782 volume = {252}, 2783 pages = {77--90}, 2784 year = {2016}, 2785 petsc_uses = {KSP} 2786} 2787 2788@Article{ spiegelmanmaywilson2016, 2789 title = {On the solvability of incompressible {S}tokes with viscoplastic rheologies in 2790 geodynamics}, 2791 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 2792 journal = {Geochemistry, Geophysics, Geosystems}, 2793 volume = {17}, 2794 number = {6}, 2795 pages = {2213--2238}, 2796 year = {2016}, 2797 petsc_uses = {KSP} 2798} 2799 2800@Article{ buiteretal2016, 2801 title = {Benchmarking numerical models of brittle thrust wedges}, 2802 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 2803 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 2804 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 2805 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 2806 journal = {Journal of structural geology}, 2807 volume = {92}, 2808 pages = {140--177}, 2809 year = {2016}, 2810 petsc_uses = {KSP} 2811} 2812 2813@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 2814 title = {Modular and flexible spectral-element waveform modelling in two and three 2815 dimensions}, 2816 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 2817 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 2818 journal = {Geophysical Journal International}, 2819 volume = {216}, 2820 number = {3}, 2821 pages = {1675--1692}, 2822 doi = {10.1093/gji/ggy469}, 2823 year = {2019}, 2824 petsc_uses = {KSP} 2825} 2826 2827@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 2828 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 2829 Modeling}, 2830 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 2831 Martin van Driel and Lion Krischer and Andreas Fichtner}, 2832 journal = {SIAM Journal on Scientific Computing}, 2833 volume = {43}, 2834 number = {2}, 2835 pages = {C127--C153}, 2836 eprint = {http://arxiv.org/abs/2004.08729}, 2837 doi = {10.1137/20M1332748}, 2838 year = {2021}, 2839 petsc_uses = {KSP} 2840} 2841 2842@Article{ parsani2021, 2843 title = {High-order accurate entropy-stable discontinuous collocated {G}alerkin methods with 2844 the summation-by-parts property for compressible {CFD} frameworks: Scalable {SSDC} 2845 algorithms and flow solver}, 2846 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 2847 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 2848 journal = {Journal of Computational Physics}, 2849 volume = {424}, 2850 pages = {109844}, 2851 issn = {0021-9991}, 2852 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 2853 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 2854 year = {2021}, 2855 petsc_uses = {KSP} 2856} 2857 2858@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 2859 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 2860 governed by {PDEs}}, 2861 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 2862 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 2863 journal = {SIAM Journal of Scientific Computing}, 2864 volume = {42}, 2865 number = {5}, 2866 pages = {A3397--A3426}, 2867 year = {2020} 2868} 2869 2870@Article{ zampinibouakaramturkiyyahkniokeyes2022, 2871 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 2872 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 2873 Keyes}, 2874 journal = {Advances on Computational Mathematics}, 2875 note = {In press}, 2876 year = {2022} 2877} 2878 2879@Article{ dassizampiniscacchi2022, 2880 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 2881 discretizations of elliptic equations in mixed form}, 2882 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 2883 journal = {Computer Methods in Applied Mechanics and Engineering}, 2884 volume = {391}, 2885 pages = {114620}, 2886 year = {2022} 2887} 2888 2889@Article{ youngoppenheimdimant2017, 2890 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 2891 title = {Hybrid simulations of coupled {F}arley-{B}uneman/gradient drift instabilities in the 2892 equatorial E region ionosphere}, 2893 journal = {Journal of Geophysical Research: Space Physics}, 2894 volume = {122}, 2895 number = {5}, 2896 issn = {2169-9402}, 2897 doi = {10.1002/2017JA024161}, 2898 pages = {5768--5781}, 2899 year = {2017}, 2900 petsc_uses = {KSP} 2901} 2902 2903@Article{ rioussetpatylillisfillingimenglandwithershale2013, 2904 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in {M}ars' 2905 dynamo region}, 2906 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 2907 and Scott L England and Paul G Withers and John P M Hale}, 2908 journal = {Journal of Geophysical Research: Space Physics}, 2909 volume = {118}, 2910 number = {6}, 2911 pages = {3647--3659}, 2912 year = {2013}, 2913 publisher = {Wiley Online Library}, 2914 petsc_uses = {KSP} 2915} 2916 2917@Article{ chien2016representation, 2918 title = {Representation of topography by partial steps using the immersed boundary method 2919 in a vector vorticity equation model (VVM)}, 2920 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 2921 journal = {Journal of Advances in Modeling Earth Systems}, 2922 year = {2016}, 2923 publisher = {Wiley Online Library}, 2924 petsc_uses = {KSP} 2925} 2926 2927@Article{ berger2015parallel, 2928 title = {Parallel preconditioners for monolithic solution of shear bands}, 2929 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 2930 journal = {Journal of Computational Physics}, 2931 year = {2015}, 2932 publisher = {Elsevier}, 2933 petsc_uses = {KSP} 2934} 2935 2936@Article{ may2015496, 2937 title = {A scalable, matrix-free multigrid preconditioner for finite element 2938 discretizations of heterogeneous {S}tokes flow }, 2939 journal = {Computer Methods in Applied Mechanics and Engineering }, 2940 volume = {290}, 2941 number = {0}, 2942 pages = {496--523}, 2943 year = {2015}, 2944 issn = {0045-7825}, 2945 doi = {10.1016/j.cma.2015.03.014}, 2946 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 2947 petsc_uses = {KSP} 2948} 2949 2950@Article{ isaacknepley2017, 2951 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 2952 author = {Tobin Isaac and Matthew G. Knepley}, 2953 journal = {ArXiv e-prints}, 2954 eprint = {1508.02470}, 2955 year = {2017}, 2956 note = {\url{http://arxiv.org/abs/1508.02470}}, 2957 petsc_uses = {DMPlex} 2958} 2959 2960@Article{ knepleylangegorman2017, 2961 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 2962 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 2963 journal = {ArXiv e-prints}, 2964 eprint = {1506.06194}, 2965 year = {2017}, 2966 note = {\url{http://arxiv.org/abs/1506.06194}}, 2967 petsc_uses = {DMPlex} 2968} 2969 2970@Article{ langemitchellknepleygorman2015, 2971 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2972 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2973 journal = {SIAM Journal on Scientific Computing}, 2974 volume = {38}, 2975 number = {5}, 2976 pages = {S143--S155}, 2977 eprint = {http://arxiv.org/abs/1506.07749}, 2978 doi = {10.1137/15M1026092}, 2979 year = {2016}, 2980 petsc_uses = {DMPlex} 2981} 2982 2983@InProceedings{ langeknepleygorman2015, 2984 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 2985 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 2986 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 2987 month = apr, 2988 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 2989 year = {2015}, 2990 petsc_uses = {DMPlex} 2991} 2992 2993@InProceedings{ wallworkknepleybarralpiggott2022, 2994 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 2995 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 2996 Piggott}, 2997 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 2998 editor = {Trevor Robinson}, 2999 month = jan, 3000 address = {Seattle, WA}, 3001 pages = {1--5}, 3002 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 3003 year = {2022}, 3004 petsc_uses = {DMPlex} 3005} 3006 3007@InProceedings{ timalsinaknepley2023, 3008 title = {Tetrahedralization of a Hexahedral Mesh}, 3009 author = {Aman Timalsina and Matthew G. Knepley}, 3010 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 3011 year = {2023}, 3012 petsc_uses = {DMPlex} 3013} 3014 3015@Article{ farrellknepleywechsungmitchell2020, 3016 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 3017 methods}, 3018 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 3019 Wechsung}, 3020 journal = {ACM Transaction on Mathematical Software}, 3021 eprint = {http://arxiv.org/abs/1912.08516}, 3022 volume = {47}, 3023 number = {3}, 3024 pages = {1--22}, 3025 issn = {0098-3500}, 3026 doi = {10.1145/3445791}, 3027 publisher = {Association for Computing Machinery}, 3028 issue_date = {September 2021}, 3029 year = {2021}, 3030 petsc_uses = {KSP,DMPlex} 3031} 3032 3033@Article{ laakmann2022augmented, 3034 title = {An augmented Lagrangian preconditioner for the magnetohydrodynamics equations at high Reynolds and coupling numbers}, 3035 author = {Fabian Laakmann and Patrick E Farrell and Lawrence Mitchell}, 3036 journal = {SIAM Journal on Scientific Computing}, 3037 volume = {44}, 3038 number = {4}, 3039 pages = {B1018--B1044}, 3040 year = {2022} 3041} 3042 3043@Article{ papadopoulosfarrellsurowiec2021, 3044 title = {Computing multiple solutions of topology optimization problems}, 3045 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E and Surowiec, Thomas M}, 3046 journal = {SIAM Journal on Scientific Computing}, 3047 volume = {43}, 3048 number = {3}, 3049 pages = {A1555--A1582}, 3050 year = {2021} 3051} 3052 3053@Article{ jiangzhanghuschneiderzorinpanozzo2021, 3054 title = {Bijective and coarse high-order tetrahedral meshes}, 3055 author = {Jiang, Zhongshi and Zhang, Ziyi and Hu, Yixin and Schneider, Teseo and Zorin, Denis and Panozzo, Daniele}, 3056 journal = {ACM Transactions on Graphics (TOG)}, 3057 volume = {40}, 3058 number = {4}, 3059 pages = {1--16}, 3060 year = {2021} 3061} 3062 3063@Article{ abumaclachlanfarrell2023, 3064 title = {Monolithic multigrid for implicit {Runge--Kutta} discretizations of incompressible fluid flow}, 3065 author = {Abu-Labdeh, Razan and MacLachlan, Scott and Farrell, Patrick E}, 3066 journal = {Journal of Computational Physics}, 3067 volume = {478}, 3068 pages = {111961}, 3069 year = {2023} 3070} 3071 3072@Article{ farrellkirbymarchena2021, 3073 title = {{Irksome}: Automating {Runge--Kutta} time-stepping for finite element methods}, 3074 author = {Farrell, Patrick E and Kirby, Robert C and Marchena-Menendez, Jorge}, 3075 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3076 volume = {47}, 3077 number = {4}, 3078 pages = {1--26}, 3079 year = {2021} 3080} 3081 3082@Article{ farrellgazca2020, 3083 title = {An augmented Lagrangian preconditioner for implicitly constituted non-Newtonian incompressible flow}, 3084 author = {Farrell, Patrick E and Gazca-Orozco, Pablo Alexei}, 3085 journal = {SIAM Journal on Scientific Computing}, 3086 volume = {42}, 3087 number = {6}, 3088 pages = {B1329--B1349}, 3089 year = {2020} 3090} 3091 3092@Article{ farrellmitchellscottwechsung2022, 3093 title = {Robust multigrid methods for nearly incompressible elasticity using macro elements}, 3094 author = {Farrell, Patrick E and Mitchell, Lawrence and Scott, L Ridgway and Wechsung, Florian}, 3095 journal = {IMA Journal of Numerical Analysis}, 3096 volume = {42}, 3097 number = {4}, 3098 pages = {3306--3329}, 3099 year = {2022} 3100} 3101 3102@Article{ shihstadlerwechsung2022, 3103 title = {Robust multigrid techniques for augmented Lagrangian preconditioning of incompressible Stokes equations with extreme viscosity variations}, 3104 author = {Shih, Yu-hsuan and Stadler, Georg and Wechsung, Florian}, 3105 journal = {SIAM Journal on Scientific Computing}, 3106 volume = {45}, 3107 number = {3}, 3108 pages = {S27--S53}, 3109 year = {2022} 3110} 3111 3112@Article{ adlerhehumaclachlanohm2022, 3113 title = {Monolithic multigrid for a reduced-quadrature discretization of poroelasticity}, 3114 author = {Adler, James H and He, Yunhui and Hu, Xiaozhe and MacLachlan, Scott and Ohm, Peter}, 3115 journal = {SIAM Journal on Scientific Computing}, 3116 volume = {45}, 3117 number = {3}, 3118 pages = {S54--S81}, 3119 year = {2022} 3120} 3121 3122@Article{ xiafarrellwechsung2021, 3123 title = {Augmented Lagrangian preconditioners for the Oseen--Frank model of nematic and cholesteric liquid crystals}, 3124 author = {Xia, Jingmin and Farrell, Patrick E and Wechsung, Florian}, 3125 journal = {BIT Numerical Mathematics}, 3126 volume = {61}, 3127 pages = {607--644}, 3128 year = {2021} 3129} 3130 3131@Article{ budisahukuchtamardalzikatanov2023, 3132 title = {Algebraic multigrid methods for metric-perturbed coupled problems}, 3133 author = {Budisa, Ana and Hu, Xiaozhe and Kuchta, Miroslav and Mardal, Kent-Andre and Zikatanov, Ludmil Tomov}, 3134 journal = {arXiv preprint arXiv:2305.06073}, 3135 year = {2023} 3136} 3137 3138@Article{ laakmannhufarrell2023, 3139 title = {Structure-preserving and helicity-conserving finite element approximations and preconditioning for the Hall MHD equations}, 3140 author = {Laakmann, Fabian and Hu, Kaibo and Farrell, Patrick E}, 3141 journal = {Journal of Computational Physics}, 3142 volume = {492}, 3143 pages = {112410}, 3144 year = {2023} 3145} 3146 3147@Article{ hongkrauskuchtalymberymardalrognes2022, 3148 title = {Robust approximation of generalized Biot-Brinkman problems}, 3149 author = {Hong, Qingguo and Kraus, Johannes and Kuchta, Miroslav and Lymbery, Maria and Mardal, Kent-Andr{\'e} and Rognes, Marie E}, 3150 journal = {Journal of Scientific Computing}, 3151 volume = {93}, 3152 number = {3}, 3153 pages = {77}, 3154 year = {2022} 3155} 3156 3157@Article{ boonkuchtamardalruiz2021, 3158 title = {Robust preconditioners for perturbed saddle-point problems and conservative discretizations of {Biot's} equations utilizing total pressure}, 3159 author = {Boon, Wietse M and Kuchta, Miroslav and Mardal, Kent-Andre and Ruiz-Baier, Ricardo}, 3160 journal = {SIAM Journal on Scientific Computing}, 3161 volume = {43}, 3162 number = {4}, 3163 pages = {B961--B983}, 3164 year = {2021} 3165} 3166 3167@Article{ papadopoulosfarrell2023, 3168 title = {Preconditioners for computing multiple solutions in three-dimensional fluid topology optimization}, 3169 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E}, 3170 journal = {SIAM Journal on Scientific Computing}, 3171 volume = {45}, 3172 number = {6}, 3173 pages = {B853--B883}, 3174 year = {2023} 3175} 3176 3177@Article{ farrellhamdanmaclachlan2022, 3178 title = {A new mixed finite-element method for H2 elliptic problems}, 3179 author = {Farrell, Patrick E and Hamdan, Abdalaziz and MacLachlan, Scott P}, 3180 journal = {Computers \& Mathematics with Applications}, 3181 volume = {128}, 3182 pages = {300--319}, 3183 year = {2022} 3184} 3185 3186@Article{ harpertuminaro2023, 3187 title = {Compression and Reduced Representation Techniques for Patch-Based Relaxation}, 3188 author = {Harper, Graham and Tuminaro, Ray}, 3189 journal = {arXiv preprint arXiv:2306.10025}, 3190 year = {2023} 3191} 3192 3193@Article{ kirbykernell2021, 3194 title = {Preconditioning mixed finite elements for tide models}, 3195 author = {Kirby, Robert C and Kernell, Tate}, 3196 journal = {Computers \& Mathematics with Applications}, 3197 volume = {82}, 3198 pages = {212--227}, 3199 year = {2021} 3200} 3201 3202@Book{ xia2023, 3203 title = {Computing and Analysing Energy Minimisation Problems in Liquid Crystals: Implementation Using Firedrake}, 3204 author = {Xia, Jingmin}, 3205 year = {2023}, 3206 publisher = {World Scientific} 3207} 3208 3209@PhDThesis{ leveque2022, 3210 title = {Preconditioned iterative methods for optimal control problems with time-dependent PDEs as constraints}, 3211 author = {Leveque, Santolo}, 3212 school = {The University of Edinburgh}, 3213 year = {2022} 3214} 3215 3216@PhDThesis{ brubeck2022, 3217 title = {Optimal-complexity and robust multigrid methods for high-order FEM}, 3218 author = {Pablo D. Brubeck}, 3219 school = {Oxford University}, 3220 year = {2022} 3221} 3222 3223@Misc{ firedrakeproject, 3224 title = {{The {F}iredrake project}}, 3225 author = {David A Ham and Firedrake Team}, 3226 url = {http://firedrakeproject.org}, 3227 year = {2022}, 3228 petsc_uses = {KSP} 3229} 3230 3231@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 3232 title = {Firedrake: automating the finite element method by composing abstractions}, 3233 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 3234 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 3235 and Paul HJ Kelly}, 3236 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3237 volume = {43}, 3238 number = {3}, 3239 pages = {24}, 3240 year = {2016}, 3241 petsc_uses = {KSP} 3242} 3243 3244@Article{ mitchellmuller2016, 3245 title = {High level implementation of geometric multigrid solvers for finite element 3246 problems: Applications in atmospheric modelling}, 3247 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 3248 journal = {Journal of Computational Physics}, 3249 volume = {327}, 3250 pages = {1--18}, 3251 year = {2016}, 3252 petsc_uses = {KSP} 3253} 3254 3255@Article{ mcraeberceamitchellhamcotter2016, 3256 title = {Automated generation and symbolic manipulation of tensor product finite 3257 elements}, 3258 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 3259 and Colin J Cotter}, 3260 journal = {SIAM Journal on Scientific Computing}, 3261 volume = {38}, 3262 number = {5}, 3263 pages = {S25--S47}, 3264 year = {2016}, 3265 petsc_uses = {KSP} 3266} 3267 3268@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 3269 title = {A structure-exploiting numbering algorithm for finite elements on extruded 3270 meshes, and its performance evaluation in {Firedrake}}, 3271 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 3272 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 3273 journal = {Geoscientific Model Development}, 3274 volume = {9}, 3275 number = {10}, 3276 pages = {3803--3815}, 3277 doi = {10.5194/gmd-9-3803-2016}, 3278 year = {2016}, 3279 petsc_uses = {KSP} 3280} 3281 3282@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 3283 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 3284 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 3285 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 3286 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 3287 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 3288 publisher = {Springer Berlin Heidelberg}, 3289 pages = {279--289}, 3290 isbn = {978-3-642-38750-0}, 3291 doi = {10.1007/978-3-642-38750-0_21}, 3292 year = {2013}, 3293 petsc_uses = {KSP} 3294} 3295 3296@Article{ kirbymitchell2017, 3297 title = {Solver composition across the {PDE}/linear algebra barrier}, 3298 author = {Robert C Kirby and Lawrence Mitchell}, 3299 journal = {arXiv preprint arXiv:1706.01346}, 3300 year = {2017}, 3301 petsc_uses = {KSP} 3302} 3303 3304@Article{ saibaba2012application, 3305 title = {Application of hierarchical matrices to linear inverse problems in 3306 geostatistics}, 3307 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 3308 Peter K and Darve, Eric F}, 3309 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 3310 volume = {67}, 3311 number = {5}, 3312 pages = {857}, 3313 year = {2012}, 3314 petsc_uses = {KSP} 3315} 3316 3317@Article{ collignonkausmayfernandez14, 3318 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 3319 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 3320 journal = {Geochem Geophy Geosy}, 3321 year = {2014}, 3322 petsc_uses = {KSP} 3323} 3324 3325@Article{ fernandezkaus14, 3326 author = {Fern\'andez, N. and Kaus, B.}, 3327 title = {Fold interaction and wavelength selection in {3D} models of multilayer detachment 3328 folding}, 3329 journal = {Tectonophysics}, 3330 year = {2014}, 3331 petsc_uses = {KSP} 3332} 3333 3334@Article{ baumannkauspopov14, 3335 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 3336 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 3337 journal = {Tectonophysics}, 3338 year = {2014}, 3339 petsc_uses = {KSP} 3340} 3341 3342@Article{ lechmannschmalholzhetenyimaykaus14, 3343 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 3344 J. P.}, 3345 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 3346 of the modern {India-Asia} collisional system with {3-D} numerical models}, 3347 journal = { Journal of Geophysical Research - Solid Earth}, 3348 year = {2014}, 3349 petsc_uses = {KSP} 3350} 3351 3352@InBook{ fernandezkaus14b, 3353 author = {Fern\'andez N. and Kaus B.J.P.}, 3354 title = {Analytical and numerical investigation of {3D} multilayer detachment}, 3355 booktitle = {Mathematics of Planet Earth}, 3356 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 3357 and Dur\'an J.J. and Vargas-Guzman J.A.}, 3358 publisher = {Springer}, 3359 year = {2014}, 3360 petsc_uses = {KSP} 3361} 3362 3363@Article{ hossein-hsueh-etal-2014a, 3364 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 3365 journal = {J. Mech. Phys. Solids}, 3366 pages = {320--348}, 3367 title = {Effective toughness of heterogeneous media}, 3368 volume = {71}, 3369 year = {2014}, 3370 petsc_uses = {KSP} 3371} 3372 3373@Unpublished{ leon-baldelli-bourdin-2014a, 3374 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 3375 month = aug, 3376 note = {Submitted.}, 3377 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 3378 year = {2014}, 3379 petsc_uses = {KSP} 3380} 3381 3382@Article{ leon-baldelli-babadjian-etal-2013a, 3383 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 3384 Maurini, C.}, 3385 journal = {J. Mech. Phys. Solids}, 3386 pages = {15-32}, 3387 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 3388 volume = {70}, 3389 year = {2014}, 3390 petsc_uses = {KSP} 3391} 3392 3393@Article{ mesgarnejad-bourdin-etal-2014a, 3394 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 3395 journal = {Comp. Methods Appl. Mech. Engng.}, 3396 title = {Validation simulations for the variational approach to fracture}, 3397 volume = {Submitted}, 3398 year = {2014}, 3399 petsc_uses = {KSP} 3400} 3401 3402@InProceedings{ bourdin-chukwudozie-etal-2013a, 3403 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3404 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 3405 University, Stanford, CA}, 3406 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 3407 Fracturing Under In-Situ Stresses}, 3408 year = {2013}, 3409 petsc_uses = {KSP} 3410} 3411 3412@Article{ maurini-bourdin-etal-2012a, 3413 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 3414 journal = {Int. J. Fracture}, 3415 number = {1-2}, 3416 pages = {75-91}, 3417 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 3418 capillary tube: experiments and numerical simulations using a two-dimensional 3419 variational approach}, 3420 volume = {184}, 3421 year = {2013}, 3422 petsc_uses = {KSP} 3423} 3424 3425@Article{ mesgarnejad-bourdin-etal-2013a, 3426 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 3427 journal = {J. Mech. Phys Solids}, 3428 number = {11}, 3429 pages = {2360--2379}, 3430 title = {A variational approach to the fracture of brittle thin films under out of plane 3431 loading}, 3432 volume = {61}, 3433 year = {2013}, 3434 petsc_uses = {KSP} 3435} 3436 3437@InProceedings{ bourdin-chukwudozie-etal-2012a, 3438 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3439 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 3440 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 3441 volume = {SPE 159154}, 3442 year = {2012}, 3443 petsc_uses = {KSP} 3444} 3445 3446@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 3447 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 3448 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 3449 Langtangen}, 3450 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 3451 journal = {Advances in Water Resources}, 3452 volume = {51}, 3453 number = {0}, 3454 pages = {405--437}, 3455 year = {2013}, 3456 note = {35th Year Anniversary Issue}, 3457 issn = {0309-1708}, 3458 doi = {10.1016/j.advwatres.2012.05.008}, 3459 petsc_uses = {KSP} 3460} 3461 3462@Article{ scheltingamyerspietrzak10, 3463 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 3464 title = {A finite element sea ice model of the {C}anadian Arctic Archipelago}, 3465 journal = {Ocean Dynamics}, 3466 volume = {60}, 3467 number = {6}, 3468 pages = {1539-1558}, 3469 year = {2010}, 3470 issn = {1616-7341}, 3471 doi = {10.1007/s10236-010-0356-5}, 3472 publisher = {Springer-Verlag}, 3473 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 3474 Archipelago; Freshwater flux}, 3475 language = {English}, 3476 petsc_uses = {KSP} 3477} 3478 3479@InBook{ destefanoandreasisecchi13, 3480 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 3481 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 3482 inversions}, 3483 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 3484 chapter = {626}, 3485 pages = {3226--3230}, 3486 doi = {10.1190/segam2013-0244.1}, 3487 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 3488 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 3489 petsc_uses = {KSP} 3490} 3491 3492@Article{ pourhiethuetmaylabroussejolivet12, 3493 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 3494 title = {Kinematic interpretation of the {3D} shapes of metamorphic core complexes}, 3495 journal = {Geochem. Geophys. Geosyst.}, 3496 volume = {13}, 3497 pages = {Q09002}, 3498 year = {2012}, 3499 doi = {10.1029/2012GC004271}, 3500 petsc_uses = {KSP} 3501} 3502 3503@Article{ lechmannmaykausschmalholz11, 3504 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 3505 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 3506 collision}, 3507 journal = {Geophysical Journal International}, 3508 volume = {187}, 3509 pages = {10--33}, 3510 year = {2011}, 3511 doi = {10.1111/j.1365-246X.2011.05164.x}, 3512 petsc_uses = {KSP} 3513} 3514 3515@Article{ stefano:r69, 3516 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 3517 Virgilio and Fred F. Snyder}, 3518 collaboration = {}, 3519 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 3520 application to subsalt imaging}, 3521 publisher = {SEG}, 3522 year = {2011}, 3523 journal = {Geophysics}, 3524 volume = {76}, 3525 number = {3}, 3526 pages = {R69-R80}, 3527 keywords = {geophysical image processing; inverse problems; seismology}, 3528 doi = {10.1190/1.3554652}, 3529 petsc_uses = {KSP} 3530} 3531 3532@Article{ stefano:806, 3533 author = {Michele De Stefano}, 3534 collaboration = {}, 3535 title = {Simultaneous joint inversion for susceptibility and velocity}, 3536 publisher = {SEG}, 3537 year = {2011}, 3538 journal = {SEG Technical Program Expanded Abstracts}, 3539 volume = {30}, 3540 number = {1}, 3541 pages = {806-810}, 3542 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 3543 doi = {10.1190/1.3628198}, 3544 petsc_uses = {KSP} 3545} 3546 3547@Article{ mayknepley2011, 3548 author = {Dave A. May and Matthew G. Knepley}, 3549 title = {Optimal, scalable forward models for computing gravity anomalies}, 3550 journal = {Geophysical Journal International}, 3551 volume = {187}, 3552 number = {1}, 3553 pages = {161--177}, 3554 url = {http://arxiv.org/abs/1107.5951}, 3555 note = {\url{http://arxiv.org/abs/1107.5951}}, 3556 year = {2011}, 3557 petsc_uses = {KSP} 3558} 3559 3560@InProceedings{ bourdinknepleymaurini2010, 3561 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3562 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 3563 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 3564 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 3565 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 3566 address = {Stanford, CA}, 3567 year = {2010}, 3568 petsc_uses = {KSP} 3569} 3570 3571@InProceedings{ bourdinknepleymaurini2010b, 3572 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3573 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 3574 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 3575 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 3576 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 3577 address = {Sacramento, CA}, 3578 year = {2010}, 3579 petsc_uses = {KSP} 3580} 3581 3582@Article{ chen2007full, 3583 title = {Full {3D} tomography for the crustal structure of the {Los Angeles} region}, 3584 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 3585 journal = {Bulletin of the Seismological Society of America}, 3586 volume = {97}, 3587 number = {4}, 3588 pages = {1094}, 3589 year = {2007}, 3590 publisher = {Seismol Soc America}, 3591 petsc_uses = {KSP} 3592} 3593 3594@Article{ brown2010ens, 3595 author = {Brown, Jed}, 3596 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 3597 Zürich, Switzerland}, 3598 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 3599 journal = {Journal of Scientific Computing}, 3600 publisher = {Springer Netherlands}, 3601 issn = {0885-7474}, 3602 keyword = {Mathematics and Statistics}, 3603 pages = {48-63}, 3604 volume = {45}, 3605 issue = {1}, 3606 doi = {10.1007/s10915-010-9396-8}, 3607 year = {2010}, 3608 petsc_uses = {KSP} 3609} 3610 3611@PhDThesis{ brown2011, 3612 title = {Computational methods for ice flow simulation}, 3613 author = {Jed Brown}, 3614 school = {ETH Z{\"u}rich}, 3615 year = {2011}, 3616 petsc_uses = {KSP} 3617} 3618 3619@Article{ brown2013tmeice, 3620 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 3621 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 3622 journal = {SIAM Journal on Scientific Computing}, 3623 volume = {35}, 3624 number = {2}, 3625 year = {2013}, 3626 pages = {359--375}, 3627 doi = {10.1137/110834512}, 3628 note = {Also preprint ANL/MCS-P743-1298}, 3629 petsc_uses = {KSP} 3630} 3631 3632@InProceedings{ brown2013quasinewton, 3633 author = {Jed Brown and Peter Brune}, 3634 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 3635 methods}, 3636 year = {2013}, 3637 booktitle = {International Conference on Mathematics and Computational Methods Applied to 3638 Nuclear Science and Engineering}, 3639 pages = {2554--2565}, 3640 petsc_uses = {KSP} 3641} 3642 3643@Misc{ spiegelman-siampp10, 3644 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 3645 Earth Geodynamics}, 3646 author = {Marc Spiegelman}, 3647 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 3648 Computing}, 3649 year = {2010}, 3650 petsc_uses = {KSP} 3651} 3652 3653@Article{ schauer2011a, 3654 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 3655 Quintana-Ort\'{\i}}, 3656 title = {Large scale simulation of wave propagation in soils interacting with structures 3657 using {FEM} and {SBFEM}}, 3658 journal = {Journal of Computational Acoustics}, 3659 volume = {19}, 3660 number = {1}, 3661 pages = {75--93}, 3662 year = {2011}, 3663 doi = {10.1142/S0218396X11004316}, 3664 petsc_uses = {KSP} 3665} 3666 3667@Misc{ bsa2010, 3668 author = {J. Brown and B. Smith and A. Ahmadia}, 3669 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 3670 note = {submitted to SIAM Journal on Scientific Computing}, 3671 year = {2012}, 3672 petsc_uses = {KSP} 3673} 3674 3675@Article{ kellerkatz2016, 3676 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 3677 author = {Tobias Keller and Richard F. Katz}, 3678 journal = {Journal of Petrology}, 3679 doi = {10.1093/petrology/egw030}, 3680 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 3681 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 3682 year = {2016}, 3683 petsc_uses = {KSP} 3684} 3685 3686@Article{ weatherley12, 3687 author = {S. Weatherley and R.F. Katz}, 3688 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 3689 mantle}, 3690 journal = {Geochem.\ Geophys.\ Geosys.}, 3691 year = {2012}, 3692 volume = {13}, 3693 number = {1}, 3694 pages = {Q0AC18}, 3695 doi = {10.1029/2011GC003989}, 3696 petsc_uses = {KSP} 3697} 3698 3699@Article{ katz12, 3700 author = {R.F. Katz and S. Weatherley}, 3701 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 3702 journal = {Earth\ Planet.\ Sci.\ Lett.}, 3703 year = {2012}, 3704 doi = {10.1016/j.epsl.2012.04.042}, 3705 volume = {335-336}, 3706 pages = {226-237}, 3707 petsc_uses = {KSP} 3708} 3709 3710@Article{ katz10b, 3711 author = {R.F. Katz}, 3712 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 3713 journal = {Geochem.\ Geophys.\ Geosys.}, 3714 volume = {10}, 3715 number = {Q0AC07}, 3716 year = {2010}, 3717 doi = {10.1029/2010GC003282}, 3718 petsc_uses = {KSP} 3719} 3720 3721@Article{ england10, 3722 author = {P.C. England and R.F. Katz}, 3723 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 3724 journal = {Nature}, 3725 year = {2010}, 3726 volume = {467}, 3727 pages = {700--703}, 3728 doi = {10.1038/nature09417}, 3729 petsc_uses = {KSP} 3730} 3731 3732@Article{ weatherley10, 3733 author = {S. Weatherley and R.F. Katz}, 3734 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 3735 journal = {Geochem.\ Geophys.\ Geosys.}, 3736 year = {2010}, 3737 volume = {11}, 3738 number = {10}, 3739 doi = {10.1029/2010GC003192}, 3740 petsc_uses = {KSP} 3741} 3742 3743@Article{ katz10, 3744 author = {R.F. Katz and M.G. Worster}, 3745 title = {The stability of ice-sheet grounding lines}, 3746 journal = {Proc.~Roy.~Soc.~A}, 3747 year = {2010}, 3748 volume = {466}, 3749 pages = {1597--1620}, 3750 doi = {10.1098/rspa.2009.0434}, 3751 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 3752 petsc_uses = {KSP} 3753} 3754 3755@Article{ kyrkesmith2013stress, 3756 title = {Stress balances of ice streams in a vertically integrated, higher-order 3757 formulation}, 3758 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 3759 journal = {Journal of Glaciology}, 3760 volume = {59}, 3761 number = {215}, 3762 pages = {449--466}, 3763 year = {2013}, 3764 doi = {10.3189/2013JoG12J140}, 3765 petsc_uses = {KSP} 3766} 3767 3768@Article{ takei2013anisotropy1, 3769 author = {Takei Y. and R.F. Katz}, 3770 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 3771 Governing equations and linearised analysis}}, 3772 journal = {J.\ Fluid\ Mech.}, 3773 year = {2013}, 3774 volume = {734}, 3775 pages = {424-455}, 3776 doi = {10.1017/jfm.2013.482}, 3777 petsc_uses = {KSP} 3778} 3779 3780@Article{ katz2013anisotropy2, 3781 author = {Katz R.F. and Y. Takei}, 3782 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 3783 Numerical solutions of the full equations}}, 3784 journal = {J.\ Fluid\ Mech.}, 3785 year = {2013}, 3786 volume = {734}, 3787 pages = {456-485}, 3788 doi = {10.1017/jfm.2013.483}, 3789 petsc_uses = {KSP} 3790} 3791 3792@Article{ kyrke-smith2014subglacial, 3793 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 3794 title = {Subglacial hydrology and the formation of ice streams}, 3795 journal = {Proc.\ Roy.\ Soc.\ A}, 3796 year = {2014}, 3797 volume = {470}, 3798 number = {2161}, 3799 doi = {10.1098/rspa.2013.0494}, 3800 petsc_uses = {KSP} 3801} 3802 3803@Article{ spiegelmanwilsonvankeken2013, 3804 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 3805 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 3806 multi-physics problems in the solid Earth sciences}}, 3807 journal = {AGU Fall Meeting Abstracts}, 3808 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 3809 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 3810 year = {2013}, 3811 month = dec, 3812 pages = {A2208}, 3813 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 3814 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 3815 petsc_uses = {KSP} 3816} 3817 3818@Article{ bueler2009shallow, 3819 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 3820 ice sheet model}}, 3821 author = {Ed Bueler and Jed Brown}, 3822 journal = {Journal of Geophysical Research-Earth Surface}, 3823 volume = {114}, 3824 number = {F3}, 3825 pages = {F03008}, 3826 year = {2009}, 3827 publisher = {American Geophysical Union}, 3828 petsc_uses = {KSP} 3829} 3830 3831@Article{ bueler2007est, 3832 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 3833 effective tools for verification}}, 3834 author = {Ed Bueler and Jed Brown and Craig Lingle}, 3835 journal = {J. Glaciol}, 3836 volume = {53}, 3837 pages = {499--516}, 3838 year = {2007}, 3839 petsc_uses = {KSP} 3840} 3841 3842@Article{ bueler2007fcv, 3843 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 3844 simulations}}, 3845 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 3846 journal = {Ann. Glaciol}, 3847 volume = {46}, 3848 pages = {97--105}, 3849 year = {2007}, 3850 petsc_uses = {KSP} 3851} 3852 3853@Article{ bueler2005iso, 3854 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 3855 Latrice N. Bowman}, 3856 title = {Exact solutions and numerical verification for isothermal ice sheets}, 3857 journal = {J. Glaciol.}, 3858 volume = {51}, 3859 number = {173}, 3860 pages = {291--306}, 3861 year = {2005}, 3862 petsc_uses = {KSP} 3863} 3864 3865@Article{ chao2008programming, 3866 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 3867 author = {Chao-fan, Z. and Yao-lin, S.}, 3868 journal = {Earthquake}, 3869 year = {2008}, 3870 petsc_uses = {KSP} 3871} 3872 3873@Article{ marti2014, 3874 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 3875 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 3876 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 3877 title = {Full sphere hydrodynamic and dynamo benchmarks}, 3878 journal = {Geophysical Journal International}, 3879 year = {2014}, 3880 doi = {10.1093/gji/ggt518}, 3881 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 3882 petsc_uses = {KSP} 3883} 3884 3885@InProceedings{ ganfulukyangxueyang2013, 3886 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 3887 Guangwen}, 3888 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 3889 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 3890 Field-Programmable Custom Computing Machines}, 3891 series = {FCCM '13}, 3892 pages = {230--}, 3893 year = {2013}, 3894 isbn = {978-0-7695-4969-9}, 3895 doi = {10.1109/FCCM.2013.26}, 3896 acmid = {2495688}, 3897 publisher = {IEEE Computer Society}, 3898 petsc_uses = {KSP} 3899} 3900 3901@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 3902 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 3903 Xiaomeng Huang and Guangwen Yang}, 3904 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 3905 Conference on}, 3906 title = {A highly-efficient and green data flow engine for solving {E}uler atmospheric 3907 equations}, 3908 year = {2014}, 3909 month = sep, 3910 pages = {1-6}, 3911 doi = {10.1109/FPL.2014.6927462}, 3912 petsc_uses = {KSP} 3913} 3914 3915%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 3916%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 3917%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 3918@Article{ aagaardknepleywilliams13, 3919 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 3920 Models of Quasi-static and Dynamic Crustal Deformation}, 3921 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 3922 journal = {Journal of Geophysical Research: Solid Earth}, 3923 volume = {118}, 3924 number = {6}, 3925 pages = {3059--3079}, 3926 issn = {2169-9356}, 3927 doi = {10.1002/jgrb.50217}, 3928 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 3929 year = {2013}, 3930 petsc_uses = {KSP} 3931} 3932 3933@InProceedings{ aagaardknepleywilliams11, 3934 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3935 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3936 Deformation}, 3937 booktitle = {Eos Transactions of the AGU}, 3938 organization = {American Geophysical Union}, 3939 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 3940 year = {2011}, 3941 petsc_uses = {KSP} 3942} 3943 3944@InProceedings{ knepley10b, 3945 author = {Matthew G. {Knepley}}, 3946 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 3947 booktitle = {Eos Transactions of the AGU}, 3948 organization = {American Geophysical Union}, 3949 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 3950 year = {2010}, 3951 petsc_uses = {KSP} 3952} 3953 3954@InProceedings{ mayknepleygurnis09, 3955 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 3956 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 3957 booktitle = {Eos Transactions of the AGU}, 3958 organization = {American Geophysical Union}, 3959 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 3960 year = {2009}, 3961 petsc_uses = {KSP} 3962} 3963 3964@InProceedings{ yuenknepleyerlebacherwright09, 3965 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 3966 title = {The Coming Role of {GPU} in Computational Geodynamics}, 3967 booktitle = {Eos Transactions of the AGU}, 3968 organization = {American Geophysical Union}, 3969 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 3970 year = {2009}, 3971 petsc_uses = {KSP} 3972} 3973 3974@InProceedings{ aagaardknepleywilliams08, 3975 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 3976 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3977 Deformation}, 3978 booktitle = {Eos Transactions of the AGU}, 3979 organization = {American Geophysical Union}, 3980 volume = {89}, 3981 number = {53}, 3982 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 3983 year = {2007}, 3984 petsc_uses = {KSP} 3985} 3986 3987@InProceedings{ aagaardknepleywilliams07, 3988 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3989 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3990 Deformation}, 3991 booktitle = {Eos Transactions of the AGU}, 3992 organization = {American Geophysical Union}, 3993 volume = {88}, 3994 number = {52}, 3995 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 3996 year = {2007}, 3997 petsc_uses = {KSP} 3998} 3999 4000@InProceedings{ aagaardknepleywilliams05, 4001 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 4002 title = {Development of software for studying earthquakes across multiple spatial and 4003 temporal scales by coupling quasi-static and dynamic simulations}, 4004 booktitle = {Eos Transactions of the AGU}, 4005 organization = {American Geophysical Union}, 4006 volume = {86}, 4007 number = {52}, 4008 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 4009 year = {2005}, 4010 petsc_uses = {KSP} 4011} 4012 4013@InProceedings{ williamsgablehagermeadeaagaardknepley08, 4014 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 4015 Brad Aagaard and Matthew G. Knepley}, 4016 title = {Modeling of Multiple Earthquake Cycles in {S}outhern {C}alifornia Using the {SCEC} 4017 Community Fault Model}, 4018 booktitle = {Proceedings of Geosciences '08}, 4019 address = {Wellington, NZ}, 4020 month = nov, 4021 year = {2008}, 4022 petsc_uses = {KSP} 4023} 4024 4025@TechReport{ zhang07, 4026 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 4027 Tsunamis}, 4028 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 4029 type = {Preprint}, 4030 number = {ANL/MCS-P1459-0907}, 4031 institution = {ANL}, 4032 month = sep, 4033 year = {2007}, 4034 petsc_uses = {KSP} 4035} 4036 4037@Article{ katz08b, 4038 author = {Richard F. Katz}, 4039 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 4040 focusing at mid-ocean ridges}, 4041 journal = {J. Petrology}, 4042 year = {2008}, 4043 volume = {49}, 4044 pages = {2099--2121}, 4045 doi = {10.1093/petrology/egn058}, 4046 petsc_uses = {KSP} 4047} 4048 4049@Article{ hgrhkjvv2008, 4050 title = {On preconditioning for a parallel solution of the {R}ichards equation}, 4051 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 4052 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 4053 journal = {Computers and Geosciences}, 4054 volume = {34}, 4055 pages = {1958--1963}, 4056 year = {2008}, 4057 petsc_uses = {KSP} 4058} 4059 4060@Article{ maymoresi2008, 4061 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 4062 computational geodynamics}, 4063 journal = {Physics of the Earth and Planetary Interiors}, 4064 volume = {171}, 4065 number = {1-4}, 4066 pages = {33--47}, 4067 year = {2008}, 4068 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 4069 Applications}, 4070 issn = {0031-9201}, 4071 doi = {10.1016/j.pepi.2008.07.036}, 4072 author = {Dave A. May and Louis Moresi}, 4073 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 4074 petsc_uses = {KSP} 4075} 4076 4077@Article{ kausmuhlhausmay2010, 4078 title = {A stabilization algorithm for geodynamic numerical simulations with a free 4079 surface}, 4080 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 4081 journal = {Physics of the Earth and Planetary Interiors}, 4082 volume = {181}, 4083 number = {1}, 4084 pages = {12--20}, 4085 year = {2010}, 4086 petsc_uses = {KSP} 4087} 4088 4089@Article{ duretzmaygeryatackley2011, 4090 title = {Discretization errors and free surface stabilization in the finite difference and 4091 marker-in-cell method for applied geodynamics: A numerical study}, 4092 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 4093 journal = {Geochemistry, Geophysics, Geosystems}, 4094 volume = {12}, 4095 number = {7}, 4096 year = {2011}, 4097 petsc_uses = {KSP} 4098} 4099 4100@Article{ furuichimaytackley2011, 4101 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 4102 {Schur} complement approach with mixed precision arithmetic}, 4103 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 4104 journal = {Journal of Computational Physics}, 4105 volume = {230}, 4106 number = {24}, 4107 pages = {8835--8851}, 4108 year = {2011}, 4109 petsc_uses = {KSP} 4110} 4111 4112@Article{ kellermaykaus2013, 4113 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 4114 lithosphere and crust}, 4115 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 4116 journal = {Geophysical Journal International}, 4117 volume = {195}, 4118 number = {3}, 4119 pages = {1406--1442}, 4120 year = {2013}, 4121 petsc_uses = {KSP} 4122} 4123 4124@Article{ schellartfreemanstegmanmoresimay2007, 4125 title = {Evolution and diversity of subduction zones controlled by slab width}, 4126 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 4127 May}, 4128 journal = {Nature}, 4129 volume = {446}, 4130 number = {7133}, 4131 pages = {308--311}, 4132 year = {2007}, 4133 petsc_uses = {KSP} 4134} 4135 4136@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 4137 title = {A comparison of numerical surface topography calculations in geodynamic 4138 modelling: an evaluation of the sticky air method}, 4139 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 4140 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 4141 journal = {Geophysical Journal International}, 4142 volume = {189}, 4143 number = {1}, 4144 pages = {38--54}, 4145 year = {2012}, 4146 petsc_uses = {KSP} 4147} 4148 4149@Article{ stegmanfreemanschellartmoresimay2006, 4150 title = {Influence of trench width on subduction hinge retreat rates in {3-D} models of slab 4151 rollback}, 4152 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 4153 May}, 4154 journal = {Geochemistry, Geophysics, Geosystems}, 4155 volume = {7}, 4156 number = {3}, 4157 year = {2006}, 4158 petsc_uses = {KSP} 4159} 4160 4161@InProceedings{ may2014ptatin, 4162 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 4163 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 4164 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 4165 Computing, Networking, Storage and Analysis}}, 4166 organization = {ACM}, 4167 pages = {274--284}, 4168 year = {2014}, 4169 doi = {10.1109/SC.2014.28}, 4170 petsc_uses = {KSP} 4171} 4172 4173@Article{ maybrownpourhiet2015, 4174 title = {A scalable, matrix-free multigrid preconditioner for finite element 4175 discretizations of heterogeneous {Stokes} flow}, 4176 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 4177 journal = {Computer Methods in Applied Mechanics and Engineering}, 4178 volume = {290}, 4179 pages = {496--523}, 4180 year = {2015}, 4181 doi = {10.1016/j.cma.2015.03.014}, 4182 petsc_uses = {KSP} 4183} 4184 4185@Article{ duretzmayyamato2016, 4186 title = {A free surface capturing discretization for the staggered grid finite difference 4187 scheme}, 4188 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 4189 journal = {Geophysical Journal International}, 4190 volume = {204}, 4191 number = {3}, 4192 pages = {1518--1530}, 4193 year = {2016}, 4194 petsc_uses = {KSP} 4195} 4196 4197@Article{ rhebergenwellskatzwathen2014, 4198 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 4199 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 4200 journal = {SIAM J. Sci. Comput.}, 4201 volume = {36}, 4202 pages = {A1960--A1977}, 4203 year = {2014}, 4204 petsc_uses = {KSP} 4205} 4206 4207@Article{ katz08a, 4208 author = {R.F. Katz and M.G. Worster}, 4209 title = {Simulation of directional solidification, thermochemical convection, and chimney 4210 formation in a {H}ele-{S}haw cell}, 4211 journal = {J. Comp. Phys.}, 4212 volume = {227}, 4213 pages = {9823-9840}, 4214 year = {2008}, 4215 doi = {10.1016/j.jcp.2008.06.039}, 4216 petsc_uses = {KSP} 4217} 4218 4219@Article{ aabg2007, 4220 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 4221 title = {Full waveform inversion for seismic velocity and anelastic losses in 4222 heterogeneous structures}, 4223 journal = {Bulletin of Seismological Society of America}, 4224 year = {2007}, 4225 volume = {97}, 4226 pages = {1990--2008}, 4227 petsc_uses = {KSP} 4228} 4229 4230@Article{ katz2006, 4231 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 4232 title = {The dynamics of melt and shear localization in partially molten aggregates}, 4233 journal = {Nature}, 4234 year = {2006}, 4235 volume = {442}, 4236 pages = {676--679}, 4237 month = aug, 4238 day = {10}, 4239 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 4240 petsc_uses = {KSP} 4241} 4242 4243@InProceedings{ mqrs2003, 4244 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 4245 year = {2003}, 4246 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 4247 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 4248 Sozopol, Bulgaria, June 4-8, 2003}, 4249 petsc_uses = {KSP} 4250} 4251 4252@InProceedings{ lichtner1, 4253 author = {Chuan Lu and Peter C. Lichtner}, 4254 year = {2005}, 4255 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 4256 Geologic Media}, 4257 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 4258 lab = {LANL}, 4259 petsc_uses = {KSP} 4260} 4261 4262@Article{ hammondlichtnermills2014, 4263 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 4264 Example with {PFLOTRAN}}, 4265 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 4266 journal = {Water Resources Research}, 4267 volume = {50}, 4268 number = {1}, 4269 pages = {208--228}, 4270 doi = {10.1002/2012WR013483}, 4271 year = {2014}, 4272 petsc_uses = {KSP} 4273} 4274 4275@Article{ smw2003, 4276 author = {R. Scheichl and R. Masson and J. Wendebourg}, 4277 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 4278 journal = {Computational Geosciences}, 4279 year = {2003}, 4280 volume = {7}, 4281 pages = {295--318}, 4282 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 4283 petsc_uses = {KSP} 4284} 4285 4286@Article{ kees-miller-03, 4287 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 4288 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 4289 journal = {Computational Geosciences}, 4290 year = {2003}, 4291 volume = {7}, 4292 pages = {91--114}, 4293 petsc_uses = {KSP} 4294} 4295 4296@Article{ bk2003, 4297 author = {JN Buur and T Kuehnel}, 4298 title = {Improving depth imaging by automated model updating}, 4299 journal = {The Leading Edge}, 4300 year = {2003}, 4301 volume = {22}, 4302 pages = {310-318}, 4303 petsc_uses = {KSP} 4304} 4305 4306@Article{ frederickbuffett2016, 4307 title = {Submarine groundwater discharge as a possible formation mechanism for 4308 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 4309 author = {Jennifer M. Frederick and Bruce A. Buffett}, 4310 journal = {Journal of Geophysical Research: Solid Earth}, 4311 volume = {121}, 4312 number = {3}, 4313 pages = {1383--1404}, 4314 issn = {2169-9356}, 4315 doi = {10.1002/2015JB012627}, 4316 year = {2016}, 4317 petsc_uses = {KSP} 4318} 4319 4320% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4321% LiteralHTML:<font color="#FF0000"> 4322% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 4323% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 4324% LiteralHTML:variety of these simulations.</p> 4325% LiteralHTML:</font> 4326% LiteralHTML: 4327@InProceedings{ appelbe1, 4328 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4329 year = {2003}, 4330 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 4331 computational methodology}, 4332 page = {781}, 4333 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 4334 Proceedings}, 4335 publisher = {Springer-Verlag}, 4336 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 4337 petsc_uses = {KSP} 4338} 4339 4340% LiteralHTML:<a name="katz"> 4341@InProceedings{ gd1, 4342 author = {Guillaume Dumont and Michel Kern}, 4343 title = {Parallelization of a {3D} Seismic Migration Code with {PETSc}}, 4344 year = {1999}, 4345 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 4346 Computing}, 4347 petsc_uses = {KSP} 4348} 4349 4350% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 4351% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 4352% LiteralHTML:<font color="#FF0000"> 4353% LiteralHTML: Figures from the work of Richard Katz 4354@PhDThesis{ katzthesis, 4355 author = {R.F. Katz}, 4356 title = {The deep roots of volcanoes: models of magma dynamics with applications to 4357 subduction zones}, 4358 school = {Columbia University}, 4359 year = {2005}, 4360 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 4361 petsc_uses = {KSP} 4362} 4363 4364@InCollection{ knepleykatzsmith06, 4365 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 4366 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 4367 USA}, 4368 title = {Developing a Geodynamics Simulator with {PETSc}}, 4369 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 4370 series = {Lecture Notes in Computational Science and Engineering}, 4371 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 4372 publisher = {Springer Berlin Heidelberg}, 4373 isbn = {978-3-540-31619-0}, 4374 keyword = {Mathematics and Statistics}, 4375 pages = {413-438}, 4376 volume = {51}, 4377 doi = {10.1007/3-540-31619-1_12}, 4378 year = {2006}, 4379 petsc_uses = {KSP} 4380} 4381 4382@Article{ katz04, 4383 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 4384 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 4385 the global mid-ocean ridge system}, 4386 journal = {Geophys.\ Res.\ Letts.}, 4387 year = {2004}, 4388 volume = {31}, 4389 pages = {L15605}, 4390 petsc_uses = {KSP} 4391} 4392 4393@Article{ katz07, 4394 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 4395 Ethan Coon}, 4396 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 4397 Toolkit for Scientific Computation}}, 4398 journal = {Phys. Earth Planet. In.}, 4399 volume = {163}, 4400 pages = {52--68}, 4401 year = {2007}, 4402 petsc_uses = {KSP} 4403} 4404 4405@Article{ williams2006development, 4406 title = {{Development of a package for modeling stress in the lithosphere}}, 4407 author = {Williams, CA}, 4408 journal = {Eos Trans. AGU}, 4409 volume = {87}, 4410 pages = {36}, 4411 year = {2006}, 4412 petsc_uses = {KSP} 4413} 4414 4415@Article{ goverswortel05, 4416 author = {R. Govers and M.J.R. Wortel}, 4417 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 4418 journal = {Earth and Planetary Science Letters}, 4419 volume = {236/1-2}, 4420 pages = {505-523}, 4421 year = {2005}, 4422 petsc_uses = {KSP} 4423} 4424 4425@InProceedings{ snark2, 4426 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4427 year = {2002}, 4428 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 4429 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 4430 petsc_uses = {KSP} 4431} 4432 4433@Article{ snark1, 4434 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 4435 Tan and Feng Wang}, 4436 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 4437 journal = {Submitted to Pure and Applied Geosciences}, 4438 petsc_uses = {KSP} 4439} 4440 4441@InProceedings{ earthquake2003, 4442 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 4443 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 4444 Tiankai Tu}, 4445 year = {2003}, 4446 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 4447 booktitle = {Proceedings of SC2003}, 4448 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 4449 petsc_uses = {KSP} 4450} 4451 4452@InProceedings{ stefano12, 4453 author = {Michele De Stefano}, 4454 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 4455 booktitle = {PIERS Proceedings}, 4456 month = aug, 4457 address = {Moscow, RUSSIA}, 4458 pages = {491--495}, 4459 year = {2012}, 4460 petsc_uses = {KSP} 4461} 4462 4463%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 4464 4465% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4466% LiteralHTML: <center><img alt="" 4467% LiteralHTML: src="images/ocean.jpg"></center></p> 4468@Article{ khatiwala07, 4469 author = {Khatiwala, S.}, 4470 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 4471 journal = {Glob. Biogeochem. Cycles}, 4472 volume = {21}, 4473 doi = {10.1029/2007GB002923}, 4474 year = {2007}, 4475 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 4476} 4477 4478@Article{ dks2004, 4479 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 4480 journal = {Ocean Modelling}, 4481 year = {2004}, 4482 volume = {6(2)}, 4483 pages = {125-150}, 4484 title = {A finite-element Ocean Model: Principles and Evaluation}, 4485 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 4486 petsc_uses = {KSP} 4487} 4488 4489@Article{ danilov1, 4490 author = {S. Danilov and G. Kivman and J. Schroter}, 4491 year = {2004}, 4492 title = {Evaluation of an eddy-permitting finite-element ocean model in the {N}orth 4493 {A}tlantic}, 4494 journal = {Ocean Modelling}, 4495 petsc_uses = {KSP} 4496} 4497 4498@Article{ nerger1, 4499 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 4500 year = {2004}, 4501 title = {Data Assimilation with the Ensemble {K}alman Filter and the {SEIK} Filter applied to 4502 a Finite Element Model of the {N}orth {A}tlantic}, 4503 journal = {Journal of marine systems}, 4504 petsc_uses = {KSP} 4505} 4506 4507@Conference{ rakowsky2003self, 4508 title = {{A self-adaptive finite element model of the atmosphere}}, 4509 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 4510 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 4511 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 4512 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 4513 pages = {279}, 4514 isbn = {981238376X}, 4515 year = {2003}, 4516 organization = {World Scientific Pub Co}, 4517 petsc_uses = {KSP} 4518} 4519 4520@Article{ lauter3, 4521 author = {M. Lauter}, 4522 year = {2004}, 4523 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4524 AtmosphArenmodell}, 4525 journal = {Berichte zur Polar- und Meeresforschung}, 4526 petsc_uses = {KSP} 4527} 4528 4529@Article{ lauter2, 4530 author = {M. Lauter and D. Handorf and K. Dethloff}, 4531 year = {2004}, 4532 title = {Unsteady analytical solutions of the spherical shallow water equations}, 4533 journal = {Journal of computational physics}, 4534 petsc_uses = {KSP} 4535} 4536 4537@PhDThesis{ lauter1, 4538 author = {M. Lauter}, 4539 year = {2004}, 4540 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4541 AtmosphArenmodell}, 4542 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 4543 petsc_uses = {KSP} 4544} 4545 4546@Article{ frickenhaus1, 4547 author = {S. Frickenhaus and W. Hiller and M. Best}, 4548 year = {2005}, 4549 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 4550 parallel numerical atmosphere and ocean models}, 4551 journal = {Ocean Modelling}, 4552 volume = {10}, 4553 pages = {185--191}, 4554 petsc_uses = {KSP} 4555} 4556 4557@Article{ 0266-5611-24-3-034015, 4558 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 4559 title = {A {N}ewton-{CG} method for large-scale three-dimensional elastic full-waveform 4560 seismic inversion}, 4561 journal = {Inverse Problems}, 4562 volume = {24}, 4563 number = {3}, 4564 pages = {034015 (26pp)}, 4565 url = {http://stacks.iop.org/0266-5611/24/034015}, 4566 year = {2008}, 4567 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 4568 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 4569 iterations with inner conjugate gradient linear iterations, globalized by an 4570 Armijo backtracking line search, solved on a sequence of finer grids and higher 4571 frequencies to remain in the vicinity of the global optimum, inexactly terminated 4572 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 4573 variation operator to capture sharp interfaces, finely discretized by finite 4574 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 4575 implemented in matrix-free fashion with adjoint-based computation of reduced 4576 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 4577 waveform storage, and partitioned spatially across processors to parallelize the 4578 solutions of the forward and adjoint wave equations and the evaluation of 4579 gradient-like information. Several numerical examples demonstrate the grid 4580 independence of linear and nonlinear iterations, the effectiveness of the 4581 preconditioner, the ability to solve inverse problems with up to 17 million 4582 inversion parameters on up to 2048 processors, the effectiveness of multiscale 4583 continuation in keeping iterates in the basin of attraction of the global minimum, 4584 and the ability to fit the observational data while reconstructing the model with 4585 reasonable resolution and capturing sharp interfaces.}, 4586 petsc_uses = {KSP} 4587} 4588 4589% LiteralHTML: 4590% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 4591% LiteralHTML: 4592% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4593% LiteralHTML:<font color="#FF0000"> 4594% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 4595% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 4596% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 4597% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 4598% LiteralHTML:for a variety of these simulations.</p> 4599% LiteralHTML:</font> 4600% LiteralHTML: 4601@Article{ mills2009modeling, 4602 title = {Modeling subsurface reactive flows using leadership-class computing}, 4603 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4604 Mahinthakumar, G.K. and Smith, B.F.}, 4605 journal = {Journal of Physics: Conference Series}, 4606 volume = {180}, 4607 pages = {012062}, 4608 year = {2009}, 4609 publisher = {IOP Publishing}, 4610 petsc_uses = {KSP} 4611} 4612 4613@Conference{ mills2007simulating, 4614 title = {{Simulating subsurface flow and transport on ultrascale computers using 4615 PFLOTRAN}}, 4616 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 4617 booktitle = {Journal of Physics: Conference Series}, 4618 volume = {78}, 4619 pages = {012051}, 4620 year = {2007}, 4621 organization = {IOP Publishing}, 4622 petsc_uses = {KSP} 4623} 4624 4625@InProceedings{ mills2009, 4626 title = {Modeling subsurface reactive flows using leadership-class computing}, 4627 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4628 Mahinthakmuar, G. and Smith, B.}, 4629 booktitle = {Journal of Physics: Conference Series}, 4630 volume = {180}, 4631 pages = {102062}, 4632 year = {2009}, 4633 organization = {IOP Publishing}, 4634 petsc_uses = {KSP} 4635} 4636 4637@Article{ guo2013parallel, 4638 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 4639 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 4640 }, 4641 journal = {Advances in Water Resources }, 4642 volume = {53}, 4643 number = {0}, 4644 pages = {101 - 108}, 4645 year = {2013}, 4646 note = {}, 4647 issn = {0309-1708}, 4648 doi = {10.1016/j.advwatres.2012.10.010}, 4649 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 4650 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 4651 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 4652 preconditioner}, 4653 petsc_uses = {KSP} 4654} 4655 4656@Unpublished{ stomp, 4657 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 4658 url = {http://stomp.pnl.gov/}, 4659 petsc_uses = {KSP} 4660} 4661 4662@InProceedings{ htfc2003, 4663 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 4664 title = {Methods and Experiences For Parallelizing Flood Models}, 4665 year = {2003}, 4666 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 4667 European PVM/MPI User's Group Meeting}, 4668 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 4669 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 4670 petsc_uses = {KSP} 4671} 4672 4673@InProceedings{ hulchy-tran-astalos-fmsip, 4674 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 4675 D.Froehlich}, 4676 title = {Flood Modeling System and Its Parallelization}, 4677 year = {2002}, 4678 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 4679 Engineering}, 4680 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 4681 petsc_uses = {KSP} 4682} 4683 4684@InProceedings{ gy1, 4685 author = {J. P. Gwo and G. T. Yeh}, 4686 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 4687 Transport at Watershed Scale}, 4688 year = {2004}, 4689 booktitle = {The International Conference on Computational Methods}, 4690 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 4691 petsc_uses = {KSP} 4692} 4693 4694@Conference{ cheng2009efficient, 4695 title = {{An efficient parallel method for large-scale groundwater flow equation based on 4696 PETSc}}, 4697 author = {Cheng, T. and Ji, X. and Wang, Q.}, 4698 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 4699 Conference on}, 4700 pages = {190--193}, 4701 organization = {IEEE}, 4702 petsc_uses = {KSP} 4703} 4704 4705@Unpublished{ sfrsm, 4706 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 4707 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 4708 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 4709 its linear solves}, 4710 petsc_uses = {KSP} 4711} 4712 4713% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4714@InProceedings{ bart_omar:sc05, 4715 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 4716 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 4717 title = {Dynamic data driven inversion for terascale simulations: real-time 4718 indentification of airborne contaminants}, 4719 booktitle = {Proceedings of SC2005}, 4720 organization = {IEEE/ACM}, 4721 address = {Seattle, WA}, 4722 year = {2005}, 4723 month = nov, 4724 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 4725 lab = {SNL}, 4726 petsc_uses = {KSP} 4727} 4728 4729@InProceedings{ anton-krassimir-lscc, 4730 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 4731 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 4732 Simulations}, 4733 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 4734 volume = {2907}, 4735 year = {2003}, 4736 publisher = {Springer-Verlag}, 4737 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 4738 petsc_uses = {KSP} 4739} 4740 4741@InProceedings{ aa2001, 4742 author = {Anton Antonov}, 4743 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 4744 year = {2001}, 4745 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 4746 Sozopol, Bulgaria}, 4747 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 4748 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 4749 petsc_uses = {KSP} 4750} 4751 4752% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4753@Article{ grassley-simmons-kercher-00, 4754 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 4755 year = {2000}, 4756 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 4757 reactive transport models}, 4758 journal = {Applied Geochemistry}, 4759 volume = {17}, 4760 pages = {699--708}, 4761 lab = {LLNL} 4762} 4763 4764@Article{ glassey-nitao-03, 4765 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 4766 and Carl I. Steefel and James R. Kercher}, 4767 year = {2003}, 4768 title = {The impact of climate change on vadose zone pore waters and its implication for 4769 long-term monitoring}, 4770 journal = {Computers and Geosciences}, 4771 volume = {29}, 4772 pages = {399-411}, 4773 lab = {LLNL}, 4774 petsc_uses = {KSP} 4775} 4776 4777@Article{ steefel-depaolo-lichtner-05, 4778 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 4779 year = {2005}, 4780 title = {Reactive transport modeling: An essential tool and a new research approach for 4781 the Earth sciences}, 4782 journal = {Earth and Planetary Science Letters}, 4783 lab = {LLNL,LANL}, 4784 petsc_uses = {KSP} 4785} 4786 4787% LiteralHTML:<a name="scalinglarge"> 4788% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4789% LiteralHTML: <center><img alt="" 4790% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 4791% LiteralHTML:<font color="#FF0000"> 4792% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 4793@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 4794 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 4795 Strategies for Large-Scale Numerical Simulations}, 4796 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 4797 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 4798 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 4799 Large-Scale Systems (scalA)}, 4800 pages = {65-72}, 4801 doi = {10.1109/ScalA.2018.00012}, 4802 month = nov, 4803 year = {2018}, 4804 petsc_uses = {KSP} 4805} 4806 4807@Article{ km2004, 4808 author = {A. Keese and H. G. Matthies}, 4809 journal = {Computers and Structures}, 4810 year = {2005}, 4811 volume = {83}, 4812 pages = {1033--1047}, 4813 title = {Hierarchical parallelisation for the solution of stochastic finite element 4814 equations}, 4815 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 4816 petsc_uses = {KSP} 4817} 4818 4819@Unpublished{ hvl2002, 4820 title = {Numerical Modeling of {NAPL} Source Zone Treatment}, 4821 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 4822 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 4823 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 4824 year = {2002}, 4825 lab = {LANL}, 4826 petsc_uses = {KSP} 4827} 4828 4829@PhDThesis{ hammond2003, 4830 author = {Glenn E. Hammond}, 4831 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 4832 Transport on Supercomputers}, 4833 school = {University of Illinois at Urbana-Champaign}, 4834 year = {2003}, 4835 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 4836 petsc_uses = {KSP} 4837} 4838 4839@Unpublished{ uk, 4840 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 4841 Scale Environmental Flows and Transport Processes}, 4842 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 4843 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 4844 buildings and in Green Bay. Used PETSc for its linear solvers}, 4845 year = {1999}, 4846 petsc_uses = {KSP} 4847} 4848 4849@InProceedings{ hammond2002, 4850 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 4851 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 4852 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 4853 year = {2002}, 4854 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 4855 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 4856 Resources, Delft, The Netherlands.}, 4857 lab = {LANL}, 4858 petsc_uses = {KSP} 4859} 4860 4861@TechReport{ steefel1, 4862 author = {C. I. Steefel}, 4863 title = {Software for modeling multicomponent, multidimensional reactive transport}, 4864 year = {2001}, 4865 institution = {Lawrence Livermore National Laboratory}, 4866 number = {UCRL-MA-143182}, 4867 lab = {LLNL}, 4868 petsc_uses = {KSP} 4869} 4870 4871@Article{ steefel2, 4872 author = {C. I. Steefel and A. C. Lasaga}, 4873 title = {A coupled model for transport of multiple chemical-species and kinetic 4874 precipitation dissolution reactions with application to reactive flow in 4875 single-phase hydrothermal systems}, 4876 journal = {Americal Journal of Science}, 4877 year = {1994}, 4878 pages = {529-592}, 4879 volume = {294}, 4880 number = {5}, 4881 petsc_uses = {KSP} 4882} 4883 4884@TechReport{ steefel3, 4885 author = {C. I. Steefel and S. B. Yabusaki}, 4886 title = {{OS3D/GIMRT}, Software for Multicomponent-Multidimensional reactive transport: 4887 User's manual and programmer's guide}, 4888 year = {1996}, 4889 institution = {Pacific Northwest National Laboratory}, 4890 number = {PNNL-11166}, 4891 lab = {PNNL}, 4892 petsc_uses = {KSP} 4893} 4894 4895@Article{ 2005hvl, 4896 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 4897 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 4898 preconditioning to biogeochemical transport}, 4899 journal = {Advances in Water Resources}, 4900 year = {2005}, 4901 pages = {359--376}, 4902 volume = {28}, 4903 url = { 4904 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 4905 lab = {LANL}, 4906 petsc_uses = {KSP} 4907} 4908 4909@Article{ wang-zabar-05, 4910 author = {J Wang and N Zabaras}, 4911 journal = {Int. J. Heat and Mass Transfer}, 4912 title = {A Markov random field model of contamination source identification in porous 4913 media flow}, 4914 year = {2005}, 4915 petsc_uses = {KSP} 4916} 4917 4918@InBook{ kp1, 4919 author = {Jong G. Kim and Hyoung W. Park}, 4920 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 4921 Media}, 4922 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 4923 title = {Lecture Notes in Computer Science}, 4924 publisher = {Springer-Verlag}, 4925 volume = {3044}, 4926 year = {2004}, 4927 petsc_uses = {KSP} 4928} 4929 4930@Article{ 2001agusm...h32a06k, 4931 author = {{Kim}, J.~G. and {Kim}, J.}, 4932 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 4933 journal = {AGU Spring Meeting Abstracts}, 4934 year = {2001}, 4935 pages = {32-+}, 4936 petsc_uses = {KSP} 4937} 4938 4939@Article{ lzb2005, 4940 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 4941 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 4942 journal = {Journal of Hydraulic Engineering}, 4943 year = {2005}, 4944 volume = {131}, 4945 number = {4}, 4946 pages = {247--258}, 4947 petsc_uses = {KSP} 4948} 4949 4950@Article{ rao2005, 4951 author = {Prasada Rao}, 4952 title = {A parallel {RMA2} model for simulating large-scale free surface flows}, 4953 journal = {Environmental Modelling and Software}, 4954 year = {2005}, 4955 pages = {47--53}, 4956 petsc_uses = {KSP} 4957} 4958 4959@InProceedings{ pr1, 4960 author = {Prasada Rao}, 4961 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 4962 Hydrodynamic Flows}, 4963 year = {2003}, 4964 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 4965 Conference}, 4966 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 4967 petsc_uses = {KSP} 4968} 4969 4970@InProceedings{ lichtner2004, 4971 author = {Peter C. Lichtner and Andrew Wolfsberg}, 4972 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 4973 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 4974 Challenge Supercomputing Problem}, 4975 year = {2004}, 4976 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 4977 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 4978 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 4979 lab = {LANL}, 4980 petsc_uses = {KSP} 4981} 4982 4983% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4984@Article{ aba01:petsc-app, 4985 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 4986 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 4987 journal = {Int. J. High Performance Computing Applications}, 4988 year = {2001}, 4989 volume = {15}, 4990 number = {1}, 4991 pages = {13--21}, 4992 petsc_uses = {KSP} 4993} 4994 4995@PhDThesis{ tjb200, 4996 author = {Thomas James Byer}, 4997 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 4998 Facilities}, 4999 school = {Stanford}, 5000 year = {2000}, 5001 petsc_uses = {KSP} 5002} 5003 5004@InProceedings{ puchyr2006, 5005 author = {Peter J. Puchyr}, 5006 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 5007 {Win32} Cluster}, 5008 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 5009 note = {Paper number CIPC2006-207}, 5010 year = {2006}, 5011 petsc_uses = {KSP} 5012} 5013 5014@InProceedings{ texas98, 5015 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 5016 and G. A. Pope}, 5017 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 5018 Simulation}, 5019 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 5020 Symposium}, 5021 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 5022 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 5023 year = {1998}, 5024 petsc_uses = {KSP} 5025} 5026 5027% LiteralHTML: 5028% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 5029% LiteralHTML: 5030@Article{ farrellmitchellscottwechsung2021, 5031 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 5032 stationary incompressible {Navier-Stokes} equations}, 5033 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 5034 Wechsung}, 5035 journal = {The SMAI journal of computational mathematics}, 5036 volume = {7}, 5037 pages = {75--96}, 5038 year = {2021}, 5039 petsc_uses = {KSP} 5040} 5041 5042@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 5043 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 5044 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 5045 P MacLachlan and Ray S Tuminaro}, 5046 journal = {SIAM Journal on Scientific Computing}, 5047 number = {0}, 5048 pages = {S70--S91}, 5049 year = {2021}, 5050 petsc_uses = {KSP} 5051} 5052 5053@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 5054 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 5055 hyperelasticity}, 5056 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 5057 Oyar\'ua and Ricardo Ruiz-Baier}, 5058 journal = {Computer Methods in Applied Mechanics and Engineering}, 5059 volume = {374}, 5060 pages = {113562}, 5061 issn = {0045-7825}, 5062 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 5063 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 5064 year = {2021}, 5065 petsc_uses = {KSP} 5066} 5067 5068@Article{ farrellmitchellwechsung2018, 5069 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 5070 {Navier-Stokes} equations at high {Reynolds} number}, 5071 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 5072 journal = {SIAM Journal on Scientific Computing}, 5073 volume = {41}, 5074 number = {5}, 5075 eprint = {1810.03315}, 5076 pages = {A3073-A3096}, 5077 year = {2019}, 5078 petsc_uses = {KSP} 5079} 5080 5081@Article{ hevuikklaij2017, 5082 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 5083 discretized by a finite volume method}, 5084 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 5085 journal = {Journal of Numerical Mathematics}, 5086 volume = {25}, 5087 number = {2}, 5088 pages = {89--105}, 5089 year = {2017}, 5090 petsc_uses = {KSP} 5091} 5092 5093@InProceedings{ zou2015newton, 5094 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 5095 appearance/disappearance}, 5096 author = {Zou, L and Zhao, H and Zhang, H}, 5097 booktitle = {ANS 2015 Annual Meeting, June}, 5098 volume = {7}, 5099 number = {11}, 5100 year = {2015}, 5101 petsc_uses = {KSP} 5102} 5103 5104@Article{ guermond2009nonlinear, 5105 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 5106 Fourier/finite element technique and an interior penalty method}, 5107 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 5108 journal = {Journal of computational physics}, 5109 volume = {228}, 5110 number = {8}, 5111 pages = {2739--2757}, 5112 year = {2009}, 5113 publisher = {Elsevier}, 5114 petsc_uses = {KSP} 5115} 5116 5117@Article{ erzincanlisahin2015, 5118 title = {The numerical simulation of the wing kinematics effects on near wake topology and 5119 aerodynamic performance in hovering {D}rosophila flight}, 5120 author = {Belkis Erzincanli and Mehmet Sahin}, 5121 journal = {Computers \& Fluids}, 5122 volume = {122}, 5123 pages = {90--110}, 5124 year = {2015}, 5125 publisher = {Elsevier}, 5126 petsc_uses = {KSP} 5127} 5128 5129@Article{ ekensahin2015, 5130 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 5131 structure interaction problems}, 5132 author = {Ali Eken and Mehmet Sahin}, 5133 journal = {International Journal for Numerical Methods in Fluids}, 5134 year = {2015}, 5135 publisher = {Wiley Online Library}, 5136 petsc_uses = {KSP} 5137} 5138 5139@Article{ hwangsucai2015, 5140 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 5141 for transonic full potential equation}, 5142 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 5143 journal = {Computers \& Fluids}, 5144 volume = {110}, 5145 number = {30}, 5146 pages = {96--107}, 5147 year = {2015}, 5148 doi = {10.1016/j.compfluid.2014.04.005}, 5149 petsc_uses = {KSP} 5150} 5151 5152@Article{ yanghwangcai2016, 5153 title = {Nonlinear Preconditioning Techniques for Full-Space {L}agrange--{N}ewton Solution of 5154 {PDE}-Constrained Optimization Problems}, 5155 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 5156 journal = {SIAM Journal on Scientific Computing}, 5157 volume = {38}, 5158 number = {5}, 5159 pages = {A2756--A2778}, 5160 year = {2016}, 5161 petsc_uses = {KSP} 5162} 5163 5164@Article{ khanaidun2011, 5165 author = {Irfan Khan and Cyrus K. Aidun}, 5166 title = {Direct numerical simulation of saturated deformable porous media using parallel 5167 hybrid Lattice-{B}oltzmann and finite element method}, 5168 journal = {Int. J. Numer. Meth. Eng.}, 5169 volume = {86}, 5170 pages = {1379--1395}, 5171 year = {2011}, 5172 petsc_uses = {KSP} 5173} 5174 5175@Article{ khanaidun2014, 5176 author = {Irfan Khan and Cyrus K. Aidun}, 5177 title = {Modeling the deformation of saturate porous media using direct numerical 5178 simulation}, 5179 journal = {Int. J. Multiphase Flow}, 5180 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 5181 year = {2014}, 5182 petsc_uses = {KSP} 5183} 5184 5185@Article{ mofidi2014simulations, 5186 author = {A. Mofidi and P. M. Carrica}, 5187 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 5188 and Propeller}, 5189 journal = {Computers and Fluids}, 5190 pages = {191--203}, 5191 year = {2014}, 5192 petsc_uses = {KSP} 5193} 5194 5195@Article{ paik2014fluidstructure, 5196 author = {K. Paik and P. M. Carrica}, 5197 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 5198 Surface in a Rolling Tank}, 5199 journal = {Ocean Engineering}, 5200 pages = {201--212}, 5201 year = {2014}, 5202 petsc_uses = {KSP} 5203} 5204 5205@Article{ castro2013bubble, 5206 author = {A. M. Castro and P. M. Carrica}, 5207 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 5208 evaluation and numerical issues}, 5209 journal = {International Journal of Multiphase Flow 57}, 5210 pages = {131--150}, 5211 year = {2013}, 5212 petsc_uses = {KSP} 5213} 5214 5215@Article{ carrica2013turn, 5216 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 5217 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 5218 Dynamic Overset Grids}, 5219 journal = {Journal of Marine Science and Technology}, 5220 pages = {166--181}, 5221 year = {2013}, 5222 petsc_uses = {KSP} 5223} 5224 5225@Article{ castro2013eulerian, 5226 author = {A. M. Castro and P. M. Carrica}, 5227 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 5228 {Athena} {R}/V,}, 5229 journal = {International Shipbuilding Progress}, 5230 pages = {403--433}, 5231 year = {2013}, 5232 petsc_uses = {KSP} 5233} 5234 5235@Article{ chase2013overset, 5236 author = {N. Chase and T. Michael and P. M. Carrica}, 5237 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 5238 {Maneuvering} {Conditions}}, 5239 journal = {International Shipbuilding Progress}, 5240 pages = {171--205}, 5241 year = {2013}, 5242 petsc_uses = {KSP} 5243} 5244 5245@Article{ sadathosseini2013wu, 5246 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 5247 Stern}, 5248 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 5249 Free Surge Conditions in Short and Long Head Waves}, 5250 journal = {Ocean Engineering}, 5251 volume = {59}, 5252 pages = {240--273}, 5253 year = {2013}, 5254 petsc_uses = {KSP} 5255} 5256 5257@Article{ chase2013cfd, 5258 author = {N. Chase and P. M. Carrica}, 5259 title = {{CFD} Simulations of a Submarine Propeller and Application to Self-Propulsion of a 5260 Submarine}, 5261 journal = {Ocean Engineering}, 5262 pages = {68--80}, 5263 year = {2013}, 5264 petsc_uses = {KSP} 5265} 5266 5267@Article{ carrica2012cfd, 5268 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 5269 title = {{CFD} Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 5270 of Moving Rudders and Rotating Propellers}, 5271 journal = {Computers and Fluids 53}, 5272 pages = {117--132}, 5273 year = {2012}, 5274 petsc_uses = {KSP} 5275} 5276 5277@Article{ sakamoto2012urans, 5278 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5279 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 5280 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 5281 publisher = {Journal of Marine Science and Technology}, 5282 pages = {422--445}, 5283 year = {2012}, 5284 petsc_uses = {KSP} 5285} 5286 5287@Article{ sakamoto2012uransb, 5288 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5289 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 5290 Analysis and Validation of Local Flow Characteristics}, 5291 journal = {Journal of Marine Science and Technology}, 5292 pages = {446--468}, 5293 year = {2012}, 5294 petsc_uses = {KSP} 5295} 5296 5297@Article{ li2012dynamic, 5298 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 5299 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 5300 journal = {Renewable Energy}, 5301 pages = {285--298}, 5302 year = {2012}, 5303 petsc_uses = {KSP} 5304} 5305 5306@Article{ huang2012a, 5307 author = {J. Huang and P. M. Carrica and F. Stern}, 5308 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 5309 journal = {International Journal for Numerical Methods in Fluids}, 5310 pages = {160--180}, 5311 year = {2012}, 5312 petsc_uses = {KSP} 5313} 5314 5315@Article{ huang2012b, 5316 author = {J. Huang and P. M. Carrica and F. Stern}, 5317 title = {A geometry-based level set method for curvilinear overset grids with application 5318 to ship hydrodynamics}, 5319 journal = {International Journal for Numerical Methods in Fluids}, 5320 pages = {494--521}, 5321 year = {2012}, 5322 petsc_uses = {KSP} 5323} 5324 5325@Article{ carrica2011computations, 5326 author = {P. M. Carrica and H. Fu and F. Stern}, 5327 title = {Computations of self-propulsion free to sink and trim and of motions in head 5328 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 5329 journal = {Applied Ocean Research}, 5330 pages = {309--320}, 5331 year = {2011}, 5332 petsc_uses = {KSP} 5333} 5334 5335@Article{ bhushan2011scalability, 5336 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 5337 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 5338 Using {CFDShip}-Iowa}, 5339 journal = {International Journal of High Performance Computing Applications}, 5340 pages = {466--487}, 5341 year = {2011}, 5342 petsc_uses = {KSP} 5343} 5344 5345@Article{ castro2011full, 5346 author = {A. M. Castro and P. M. Carrica and F. Stern}, 5347 title = {Full scale self-propulsion computations using discretized propeller for the 5348 {KRISO} container ship {KCS}}, 5349 journal = {Computers and Fluids}, 5350 pages = {35--47}, 5351 year = {2011}, 5352 petsc_uses = {KSP} 5353} 5354 5355@Article{ kandasamy2011multifidelity, 5356 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5357 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5358 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing {C}atamaran 5359 for Low Wake}, 5360 journal = {Journal of Marine Science and Technology}, 5361 pages = {143--156}, 5362 year = {2011}, 5363 petsc_uses = {KSP} 5364} 5365 5366@Article{ kandasamy2011cfd, 5367 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5368 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5369 title = {{CFD} Validation Studies for a High-speed Foil-assisted Semi-planing {C}atamaran}, 5370 journal = {Journal of Marine Science and Technology}, 5371 pages = {157--167}, 5372 year = {2011}, 5373 petsc_uses = {KSP} 5374} 5375 5376@Article{ sadathosseini2011cfd, 5377 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 5378 and S. Yamamura and A. Mastuda}, 5379 title = {{CFD} System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 5380 Periodic Motion and Broaching}, 5381 journal = {Ocean Engineering}, 5382 pages = {88--110}, 5383 year = {2011}, 5384 petsc_uses = {KSP} 5385} 5386 5387@Article{ mosaviraad2010development, 5388 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 5389 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 5390 with Comparison to Regular Wave and Transient Wave Group Procedures Using 5391 {URANS}}, 5392 journal = {Ocean Engineering}, 5393 pages = {653--666}, 5394 year = {2010}, 5395 petsc_uses = {KSP} 5396} 5397 5398@Article{ carrica2010largescale, 5399 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5400 Stern}, 5401 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5402 Heave Problems for a Surface Combatant}, 5403 journal = {Computers and Fluids}, 5404 pages = {1095--1111}, 5405 year = {2010}, 5406 petsc_uses = {KSP} 5407} 5408 5409@Article{ carrica2010selfpropulsion, 5410 author = {P. M. Carrica and A. M. Castro and F. Stern}, 5411 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 5412 with Dynamic Overset Grids}, 5413 journal = {Journal of Marine Science and Technology}, 5414 pages = {316--330}, 5415 year = {2010}, 5416 petsc_uses = {KSP} 5417} 5418 5419@Article{ ismail2010evaluation, 5420 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 5421 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 5422 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 5423 journal = {International Journal of Numerical Methods in Fluids}, 5424 pages = {850--886}, 5425 year = {2010}, 5426 petsc_uses = {KSP} 5427} 5428 5429@Article{ kandasamy2010integral, 5430 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 5431 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 5432 journal = {Journal of Fluids Engineering}, 5433 pages = {101103}, 5434 year = {2010}, 5435 petsc_uses = {KSP} 5436} 5437 5438@Article{ kirk:2014de, 5439 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 5440 title = {{Modeling hypersonic entry with the fully-implicit {N}avier--{S}tokes (FIN-S) 5441 stabilized finite element flow solver}}, 5442 journal = {Computers {\&} Fluids}, 5443 year = {2014}, 5444 volume = {92}, 5445 number = {0}, 5446 pages = {281--292}, 5447 month = mar, 5448 petsc_uses = {KSP} 5449} 5450 5451@Article{ carracciuolo20111382, 5452 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 5453 in high performance computing environment}, 5454 journal = {Journal of Non-Newtonian Fluid Mechanics }, 5455 volume = {166}, 5456 number = {23--24}, 5457 pages = {1382--1395}, 5458 year = {2011}, 5459 issn = {0377-0257}, 5460 doi = {10.1016/j.jnnfm.2011.08.014}, 5461 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 5462 Maffettone and A. Murli}, 5463 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 5464 method, High performance computing}, 5465 petsc_uses = {KSP} 5466} 5467 5468@Article{ bungartzgatzhammerliebmehlneckel11, 5469 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 5470 Miriam and Neckel, Tobias}, 5471 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 5472 journal = {Computational Mechanics}, 5473 volume = {48}, 5474 number = {3}, 5475 pages = {365-376}, 5476 year = {2011}, 5477 issn = {0178-7675}, 5478 doi = {10.1007/s00466-011-0626-1}, 5479 publisher = {Springer-Verlag}, 5480 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 5481 Thermohydraulics; Two-phase flow}, 5482 language = {English}, 5483 petsc_uses = {KSP} 5484} 5485 5486@Article{ bpr:cfl, 5487 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 5488 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 5489 Equations}}, 5490 journal = {International Journal for Numerical Methods in Fluids}, 5491 year = {2009}, 5492 volume = {59}, 5493 number = {1}, 5494 pages = {1--18}, 5495 doi = {10.1002/fld.1798}, 5496 petsc_uses = {KSP} 5497} 5498 5499@InBook{ bonfiglioli_campobasso_carpentieri_2010, 5500 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 5501 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 5502 preconditioned newton-krylov solver}, 5503 publisher = {Curran Associates}, 5504 year = {2010}, 5505 url = {http://www.proceedings.com/05932.html}, 5506 petsc_uses = {KSP} 5507} 5508 5509@Article{ bonfiglioli_rans_2005, 5510 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 5511 Bernardo}, 5512 title = {RANS simulations of a junction flow}, 5513 journal = {International Journal of Computational Fluid Dynamics}, 5514 volume = {19}, 5515 number = {2}, 5516 pages = {179-189}, 5517 year = {2005}, 5518 doi = {10.1080/10618560410001729126}, 5519 petsc_uses = {KSP} 5520} 5521 5522@InCollection{ bonfiglioli__carpentieri_rans_2008, 5523 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 5524 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 5525 Italy}, 5526 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 5527 Equations Using Fluctuation Splitting Schemes}, 5528 booktitle = {Numerical Mathematics and Advanced Applications}, 5529 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 5530 publisher = {Springer Berlin Heidelberg}, 5531 isbn = {978-3-540-69777-0}, 5532 pages = {151-158}, 5533 doi = {10.1007/978-3-540-69777-0_17}, 5534 year = {2008}, 5535 petsc_uses = {KSP} 5536} 5537 5538@InCollection{ bonfiglioli__carpentieri_ens_2007, 5539 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 5540 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 5541 Italy}, 5542 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 5543 Problems on Unstructured Grids}, 5544 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 5545 series = {Lecture Notes in Computer Science}, 5546 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 5547 publisher = {Springer Berlin / Heidelberg}, 5548 isbn = {978-3-540-75754-2}, 5549 pages = {676-685}, 5550 volume = {4699}, 5551 doi = {10.1007/978-3-540-75755-9_83}, 5552 year = {2007}, 5553 petsc_uses = {KSP} 5554} 5555 5556@Article{ terrelscottknepleykirby08, 5557 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 5558 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 5559 journal = {BIT}, 5560 volume = {48}, 5561 number = {2}, 5562 year = {2008}, 5563 petsc_uses = {KSP} 5564} 5565 5566@Article{ martamadermartinsweidealonso07, 5567 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 5568 J. Alonso}, 5569 title = {A methodology for the development of discrete adjoint solvers using automatic 5570 differentiation tools}, 5571 journal = {Computational Fluid Dyanmics}, 5572 volume = {21}, 5573 pages = {307--327}, 5574 year = {2007}, 5575 petsc_uses = {KSP} 5576} 5577 5578@TechReport{ avb2008, 5579 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 5580 title = {Variational Space-time (Dis)continuous {G}alerkin Method for Linear Free Surface 5581 Waves}, 5582 year = {2008}, 5583 institution = {University of Twente, the Netherlands}, 5584 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 5585 petsc_uses = {KSP} 5586} 5587 5588@InProceedings{ bdsm2005, 5589 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 5590 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 5591 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 5592 year = {2005}, 5593 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 5594 petsc_uses = {KSP} 5595} 5596 5597@InProceedings{ ms2006, 5598 author = {S. Muller and Y. Stiriba}, 5599 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 5600 STEADY COMPRESSIBLE FLOWS}, 5601 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 5602 year = {2006}, 5603 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 5604 petsc_uses = {KSP} 5605} 5606 5607@Article{ araujoteixeiracunhagroth08, 5608 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 5609 title = {Parallel three-dimensional simulation of the injection molding process}, 5610 journal = {International Journal for Numerical Methods in Fluids}, 5611 year = {2008}, 5612 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 5613 petsc_uses = {KSP} 5614} 5615 5616@PhDThesis{ a2008, 5617 author = {A. Cubero}, 5618 title = {a parallel coupled algorithm for collocated grids and its application to Large 5619 Eddy Simulation of a turbulent wake}, 5620 school = {University of Zaragoza (Spain)}, 5621 year = {2008}, 5622 petsc_uses = {KSP} 5623} 5624 5625@Article{ afa2007, 5626 author = {A. Cubero and N. Fueyo}, 5627 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 5628 journal = {Numerical Heat Transfer, part B-Fundamentals}, 5629 volume = {56}, 5630 number = {6}, 5631 pages = {507--529}, 5632 year = {2007}, 5633 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 5634 petsc_uses = {KSP} 5635} 5636 5637@TechReport{ af2007, 5638 title = {Preconditioning based on a partially implicit implementation of Momentum 5639 Interpolation for coupled solvers}, 5640 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 5641 year = {2007}, 5642 author = {A. Cubero and N. Fueyo}, 5643 petsc_uses = {KSP} 5644} 5645 5646@InCollection{ dwight2004, 5647 author = {Richard Dwight}, 5648 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 5649 booktitle = {Computational Fluid Dynamics 2006}, 5650 editor = {H. Deconinck and E. Dick}, 5651 publisher = {Springer}, 5652 year = {2006}, 5653 url = {http://www.maths.man.ac.uk/\~{ 5654 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 5655 petsc_uses = {KSP} 5656} 5657 5658@InProceedings{ dwight2006, 5659 author = {Richard Dwight and Joel Brezillon}, 5660 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 5661 Optimization}, 5662 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 5663 AIAA-2006-0690}, 5664 year = {2006}, 5665 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 5666 petsc_uses = {KSP} 5667} 5668 5669@PhDThesis{ dwight2006a, 5670 author = {Richard Dwight}, 5671 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 5672 and Adjoint Methods on Unstructured Grids}, 5673 school = {School of Mathematics, University of Manchester}, 5674 year = {2006}, 5675 url = {http://www.maths.man.ac.uk/\~{ 5676 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 5677 petsc_uses = {KSP} 5678} 5679 5680@InProceedings{ lhdfrh, 5681 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 5682 W. Hiller}, 5683 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 5684 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 5685 March, 10-14, 2003, Munich University of Technology, German}, 5686 year = {2003}, 5687 petsc_uses = {KSP} 5688} 5689 5690@InProceedings{ brios-ying-2002, 5691 author = {George Biros and Lexing Ying and Denis Zorin}, 5692 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 5693 {Navier-Stokes} equations}, 5694 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 5695 year = {2002}, 5696 petsc_uses = {KSP} 5697} 5698 5699@InProceedings{ mohsen-straatman-ins, 5700 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 5701 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 5702 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 5703 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 5704 Systems and Applications}, 5705 pages = {11--16}, 5706 year = {2005}, 5707 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 5708 petsc_uses = {KSP} 5709} 5710 5711@TechReport{ bonglioli-icnmfd98, 5712 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 5713 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 5714 institution = {Universita della Basilicata via della Tecnica 3}, 5715 year = {1996}, 5716 author = {A. Bonglioli}, 5717 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 5718 petsc_uses = {KSP} 5719} 5720 5721@Article{ deng-piquet-ctf, 5722 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 5723 title = {A new fully coupled method for computing turbulent flows}, 5724 journal = {Computers and Fluids}, 5725 volume = {30}, 5726 pages = {445--472}, 5727 year = {2001}, 5728 petsc_uses = {KSP} 5729} 5730 5731@InProceedings{ knepleysarinsameh99b, 5732 title = {Multilevel Preconditioning for Parallel {CFD}}, 5733 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 5734 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 5735 Problems In Industrial Applications}, 5736 address = {Minneapolis, MN}, 5737 year = {1999}, 5738 petsc_uses = {KSP} 5739} 5740 5741@InProceedings{ garbey1, 5742 author = {M. Garbey and B. Hadri and W. Shyy.}, 5743 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 5744 Problems on the Grid}, 5745 booktitle = {Aerospace Sciences Meeting and Exhibit}, 5746 note = {Paper No. 2005-1386}, 5747 year = {2005}, 5748 petsc_uses = {KSP} 5749} 5750 5751@Article{ carrica2007unsteady, 5752 title = {An unsteady single-phase level set method for viscous free surface flows}, 5753 author = {Carrica, PM and Wilson, RV and Stern, F.}, 5754 journal = {International Journal for Numerical Methods in Fluids}, 5755 volume = {53}, 5756 number = {2}, 5757 pages = {229--256}, 5758 year = {2007}, 5759 publisher = {Chichester; New York: Wiley, c1981-}, 5760 petsc_uses = {KSP} 5761} 5762 5763@Article{ pctw2004, 5764 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 5765 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 5766 Spillways}, 5767 journal = {Journal of Hydraulic Research}, 5768 note = {accepted for publication}, 5769 year = {2004}, 5770 petsc_uses = {KSP} 5771} 5772 5773@Article{ wcs2004, 5774 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 5775 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 5776 Combatant}, 5777 journal = {Computers and Fluids}, 5778 note = {in press}, 5779 year = {2004}, 5780 petsc_uses = {KSP} 5781} 5782 5783@Article{ cws2005, 5784 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 5785 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 5786 journal = {Computers and Fluids}, 5787 note = {accepted for publication}, 5788 year = {2005}, 5789 petsc_uses = {KSP} 5790} 5791 5792@Article{ chndss2010, 5793 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5794 Stern}, 5795 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5796 Heave Problems for a Surface Combatant}, 5797 journal = {Computers and Fluids}, 5798 year = {2010}, 5799 volume = {39}, 5800 number = {7}, 5801 pages = {1095--1111}, 5802 petsc_uses = {KSP} 5803} 5804 5805@InProceedings{ chnkss2008, 5806 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5807 Stern}, 5808 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 5809 Grids}, 5810 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 5811 year = {2008}, 5812 petsc_uses = {KSP} 5813} 5814 5815@MastersThesis{ mtj, 5816 author = {M. T. Jozkowski}, 5817 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 5818 About Submerged Bodies}, 5819 school = {The Pennsylvania State University}, 5820 year = {2005}, 5821 petsc_uses = {KSP} 5822} 5823 5824@Article{ pp, 5825 author = {E. G. Paterson and L. J. Peltier}, 5826 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 5827 Wakes}, 5828 journal = {ASME Journal of Fluids Engineering}, 5829 note = {In press}, 5830 year = {2005}, 5831 petsc_uses = {KSP} 5832} 5833 5834@Article{ eps, 5835 author = {B. A. Edge and E. G. Paterson and G. Settles}, 5836 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 5837 journal = {ASME Journal of Fluids Engineering}, 5838 note = {In press}, 5839 year = {2005}, 5840 petsc_uses = {KSP} 5841} 5842 5843@InProceedings{ rp, 5844 author = {B. Racine and E. G. Paterson}, 5845 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 5846 Using Unsteady {RANS} {CFD}}, 5847 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 5848 year = {2005}, 5849 petsc_uses = {KSP} 5850} 5851 5852@InProceedings{ etpp, 5853 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 5854 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 5855 and DES}, 5856 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5857 year = {2004}, 5858 petsc_uses = {KSP} 5859} 5860 5861@InProceedings{ pp8, 5862 author = {E. G. Paterson and L. J. Peltier}, 5863 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 5864 refinement grids and detached-eddy simulation}, 5865 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5866 year = {2004}, 5867 petsc_uses = {KSP} 5868} 5869 5870@InProceedings{ mzwp, 5871 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 5872 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 5873 booktitle = {25th Symposium on Naval Hydrodynamics}, 5874 year = {2004}, 5875 petsc_uses = {KSP} 5876} 5877 5878@InProceedings{ ppph, 5879 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 5880 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 5881 booktitle = {25th Symposium on Naval Hydrodynamics}, 5882 year = {2004}, 5883 petsc_uses = {KSP} 5884} 5885 5886@InProceedings{ ppd, 5887 author = {E. G. Paterson and L. J. Peltier}, 5888 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 5889 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 5890 year = {2004}, 5891 petsc_uses = {KSP} 5892} 5893 5894@InProceedings{ bp, 5895 author = {W. J. Baker and E. G. and Paterson}, 5896 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 5897 Control Wing}, 5898 booktitle = {NASA/ONR Workshop on Circulation Control}, 5899 year = {2004}, 5900 petsc_uses = {KSP} 5901} 5902 5903@InProceedings{ pb, 5904 author = {E. G. Paterson and W. J. Baker}, 5905 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 5906 booktitle = {NASA/ONR Workshop on Circulation Control}, 5907 year = {2004}, 5908 petsc_uses = {KSP} 5909} 5910 5911@InProceedings{ pb3, 5912 author = {E. G. Paterson and W. J. Baker}, 5913 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 5914 Surfaces}, 5915 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 5916 year = {2004}, 5917 petsc_uses = {KSP} 5918} 5919 5920@InProceedings{ gid1, 5921 author = {G. Frank and J. D'Elia}, 5922 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 5923 year = {2004}, 5924 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 5925 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 5926 petsc_uses = {KSP} 5927} 5928 5929@InBook{ b1, 5930 author = {A.Bonfiglioli}, 5931 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 5932 year = {2001}, 5933 title = {Science and Supercomputing at CINECA}, 5934 pages = {397--400}, 5935 petsc_uses = {KSP} 5936} 5937 5938@InProceedings{ b2004, 5939 author = {L. A. Barba}, 5940 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 5941 fully meshless formulation}, 5942 year = {2004}, 5943 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 5944 note = {Submitted}, 5945 petsc_uses = {KSP} 5946} 5947 5948@InProceedings{ bl2004, 5949 author = {L. A. Barba and A. Leonard}, 5950 title = {Computation of Viscous Vortices with Fully Meshless Method}, 5951 year = {2004}, 5952 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 5953 note = {Submitted}, 5954 petsc_uses = {KSP} 5955} 5956 5957@Article{ vws1, 5958 author = {B. G. M. Van Wachem and J. C. Schouten}, 5959 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 5960 Velocity}, 5961 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 5962 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 5963 Netherlands}, 5964 journal = {AIChE}, 5965 volumne = {48}, 5966 number = {12}, 5967 month = dec, 5968 year = {2002}, 5969 petsc_uses = {KSP} 5970} 5971 5972@TechReport{ lbam1, 5973 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 5974 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 5975 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 5976 di Bari Italy}, 5977 year = {2002}, 5978 number = {25/02}, 5979 petsc_uses = {KSP} 5980} 5981 5982@Article{ kees_miller_02, 5983 author = {C. E. Kees and C. T. Miller}, 5984 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 5985 journal = {Advances in Water Resources}, 5986 year = {2002}, 5987 volume = {25}, 5988 number = {2}, 5989 pages = {159-177.}, 5990 petsc_uses = {KSP} 5991} 5992 5993@InProceedings{ lepotmeersessers2001, 5994 author = {I. Lepot and F. Meers and J.A. Essers}, 5995 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 5996 Unstructured Meshes}, 5997 year = {2001}, 5998 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 5999 url = {http://www.ulg.ac.be/aerodyn}, 6000 petsc_uses = {KSP} 6001} 6002 6003@InProceedings{ knepley98, 6004 author = {Matthew Knepley and Denis Vanderstraeten}, 6005 title = {Parallel Building Blocks for Finite Element Simulations: Application to 6006 Solid-Liquid Mixture Flows}, 6007 booktitle = {Proceedings of Parallel CFD'97}, 6008 publisher = {Elsevier}, 6009 pages = {281--287}, 6010 year = {1998}, 6011 petsc_uses = {KSP} 6012} 6013 6014@InProceedings{ pcfd97, 6015 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6016 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 6017 publisher = {Elsevier}, 6018 year = {1998}, 6019 booktitle = {Proceedings of Parallel CFD'97}, 6020 pages = {333-344}, 6021 petsc_uses = {KSP} 6022} 6023 6024@InProceedings{ knepleysamehsari98, 6025 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6026 title = {Parallel Simulation of Particulate Flows}, 6027 booktitle = {Solving Irregularly Structured Problems in Parallel}, 6028 editors = {A. Ferreira et al}, 6029 year = {1998}, 6030 series = {Lecture Notes in Computer Science}, 6031 volume = {1457}, 6032 pages = {226--237}, 6033 petsc_uses = {KSP} 6034} 6035 6036@Article{ gkmt98, 6037 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6038 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 6039 Implicit {CFD}}, 6040 journal = {Int. J. High Performance Computing Applications}, 6041 year = {2000}, 6042 volume = {14}, 6043 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 6044 pages = {102-136}, 6045 petsc_uses = {KSP} 6046} 6047 6048@InProceedings{ agkks-sc99, 6049 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 6050 Smith}, 6051 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 6052 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 6053 editor = {}, 6054 publisher = {}, 6055 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 6056 year = {1999}, 6057 note = {Winner of Gordon Bell Special Prize at SC 99}, 6058 petsc_uses = {KSP} 6059} 6060 6061@Article{ gkks01, 6062 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6063 title = {High Performance Parallel Implicit {CFD}}, 6064 journal = {Journal of Parallel Computing}, 6065 year = {2001}, 6066 volume = {27}, 6067 pages = {337-362}, 6068 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 6069 petsc_uses = {KSP} 6070} 6071 6072@Article{ cristea-sofonea-02, 6073 author = {Artur Cristea and Victor Sofonea}, 6074 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 6075 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6076 Sciences, Information Sciences}, 6077 volume = {3}, 6078 number = {3}, 6079 year = {2002}, 6080 petsc_uses = {KSP} 6081} 6082 6083@Article{ cristea2, 6084 author = {Artur Cristea and Victor Sofonea}, 6085 title = {Two component lattice Boltzmann model with flux limiter techniques}, 6086 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6087 Sciences, Information Sciences}, 6088 volume = {4}, 6089 number = {1}, 6090 year = {2003}, 6091 pages = {59--64}, 6092 petsc_uses = {KSP} 6093} 6094 6095@Article{ cristea1, 6096 author = {Artur Cristea and Victor Sofonea}, 6097 title = {Two component lattice Boltzmann model with flux limiters}, 6098 journal = {Central European Journal of Physics}, 6099 volume = {2}, 6100 number = {2}, 6101 year = {2004}, 6102 pages = {382--396}, 6103 petsc_uses = {KSP} 6104} 6105 6106@Article{ sofnea-lamura1, 6107 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 6108 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 6109 systems}, 6110 journal = {Physical Review E}, 6111 volume = {70}, 6112 number = {4}, 6113 year = {2004}, 6114 pages = {046702-1 / 046702-9}, 6115 petsc_uses = {KSP} 6116} 6117 6118@InProceedings{ gkks01b, 6119 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6120 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 6121 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 6122 Mechanics}, 6123 editor = {}, 6124 location = {Cambridge, MA}, 6125 year = {2001}, 6126 month = jun, 6127 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 6128 petsc_uses = {KSP} 6129} 6130 6131@InProceedings{ gkks00, 6132 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6133 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 6134 Code}, 6135 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 6136 (HiPC '2000)}, 6137 editor = {}, 6138 location = {Bangalore, India}, 6139 year = {2000}, 6140 pages = {395--404}, 6141 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 6142 petsc_uses = {KSP} 6143} 6144 6145@InProceedings{ gkks-sc00, 6146 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6147 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 6148 booktitle = {Proceedings of SC2000}, 6149 editor = {}, 6150 publisher = {IEEE Computer Society}, 6151 year = {2000}, 6152 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 6153 petsc_uses = {KSP} 6154} 6155 6156@InProceedings{ knepleysamehsarin99, 6157 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6158 title = {Design of Large Scale Parallel Simulations}, 6159 booktitle = {Proceedings of Parallel CFD'99}, 6160 editors = {A. {Ecer et al.}}, 6161 publisher = {Elsevier}, 6162 year = {1999}, 6163 petsc_uses = {KSP} 6164} 6165 6166@InProceedings{ gkks-pcfd99, 6167 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 6168 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 6169 booktitle = {Proceedings of Parallel CFD'99}, 6170 editors = {A. {Ecer et al.}}, 6171 publisher = {Elsevier}, 6172 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 6173 year = {1999}, 6174 petsc_uses = {KSP} 6175} 6176 6177@InProceedings{ kks97, 6178 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6179 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 6180 Parallelization of an Unstructured Grid Incompressible Flow Code}, 6181 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 6182 Methods}, 6183 editor = {J. Mandel et al.}, 6184 pages = {311--319}, 6185 publisher = {Wiley}, 6186 note = {}, 6187 year = {1997}, 6188 petsc_uses = {KSP} 6189} 6190 6191@InProceedings{ kks99, 6192 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6193 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 6194 Incompressible Flows on Unstructured Grids}, 6195 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6196 Methods}, 6197 editors = {C.-H. {Lai et al.}}, 6198 publisher = {Domain Decomposition Press, Bergen}, 6199 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 6200 year = {1999}, 6201 petsc_uses = {KSP} 6202} 6203 6204@InCollection{ kks97_cfd, 6205 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 6206 title = {Perspectives for {CFD} on Petaflops Systems}, 6207 booktitle = {CFD Review 1998}, 6208 editor = {M. Hafez and K. Oshima}, 6209 publisher = {World Scientific, Singapore}, 6210 pages = {1079--1096}, 6211 note = {}, 6212 year = {1998}, 6213 petsc_uses = {KSP} 6214} 6215 6216@Article{ hm99, 6217 author = {P. D. Hovland and L. C. McInnes}, 6218 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 6219 {PETSc}}, 6220 year = {2000}, 6221 journal = {Parallel Computing}, 6222 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 6223 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 6224 petsc_uses = {KSP} 6225} 6226 6227@InProceedings{ cruzbarbaknepley08, 6228 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 6229 title = {Fast Multipole Method for particle interactions: an open source parallel library 6230 component}, 6231 booktitle = {Proceedings of ParCFD2008}, 6232 year = {2008}, 6233 editor = {Tromeur-Dervout et. al.}, 6234 publisher = {Elsevier}, 6235 petsc_uses = {KSP} 6236} 6237 6238@Article{ hwangcai05, 6239 author = {F.-N. Hwang and X.-C. Cai}, 6240 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 6241 for incompressible {Navier-Stokes} equations}, 6242 journal = {J. Comput. Phys.}, 6243 volume = {204}, 6244 year = {2005}, 6245 pages = {666--691}, 6246 petsc_uses = {KSP} 6247} 6248 6249@Article{ barbaleonard07, 6250 author = {Lorena A Barba and Anthony Leonard}, 6251 title = {Emergence and evolution of tripole vortices from net-circulation initial 6252 conditions}, 6253 journal = {Phys. Fluids}, 6254 volume = {19}, 6255 pages = {017101}, 6256 year = {2007}, 6257 doi = {10.1063/1.2409734}, 6258 petsc_uses = {KSP} 6259} 6260 6261@Article{ barba07, 6262 author = {Lorena A Barba}, 6263 title = {Non-shielded multipolar vortices at high Reynolds number}, 6264 journal = {Phys. Rev. E}, 6265 volume = {73}, 6266 pages = {065303}, 6267 year = {2006}, 6268 doi = {10.1103/PhysRevE.73.065303}, 6269 petsc_uses = {KSP} 6270} 6271 6272@Article{ schofield2010multi, 6273 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 6274 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 6275 Lowrie, R.B. and Swartz, B.K.}, 6276 journal = {International Journal for Numerical Methods in Fluids}, 6277 volume = {63}, 6278 number = {8}, 6279 pages = {931--952}, 6280 year = {2010}, 6281 publisher = {Wiley Online Library}, 6282 petsc_uses = {KSP} 6283} 6284 6285% LiteralHTML: 6286% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 6287% LiteralHTML: 6288% LiteralHTML: article{DeGersem99, 6289% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 6290% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 6291% LiteralHTML: } 6292@Article{ nagler2014, 6293 title = {Sound transmission through a poroelastic layered panel}, 6294 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 6295 journal = {Computational Mechanics}, 6296 volume = {53}, 6297 number = {4}, 6298 pages = {549--560}, 6299 issn = {1432-0924}, 6300 doi = {10.1007/s00466-013-0916-x}, 6301 year = {2014}, 6302 petsc_uses = {KSP} 6303} 6304 6305@Article{ sheikh2013, 6306 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 6307 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 6308 deflation}, 6309 journal = {Numerical Linear Algebra with Applications}, 6310 volume = {20}, 6311 number = {4}, 6312 issn = {1099-1506}, 6313 doi = {10.1002/nla.1882}, 6314 pages = {645--662}, 6315 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 6316 analysis}, 6317 year = {2013}, 6318 petsc_uses = {KSP} 6319} 6320 6321@InProceedings{ silence, 6322 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 6323 Fuenmayor}, 6324 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 6325 Application to the study of acoustic behaviour of silencers}, 6326 year = {2004}, 6327 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 6328 (ECCOMAS)}, 6329 petsc_uses = {KSP} 6330} 6331 6332@Article{ degersem99, 6333 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 6334 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 6335 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 6336 journal = {COMPEL}, 6337 year = {1999}, 6338 volume = {18}, 6339 number = {3}, 6340 pages = {298--310}, 6341 bibdate = {}, 6342 petsc_uses = {KSP} 6343} 6344 6345@InProceedings{ widlund-wave-98, 6346 author = {Olof B. Widlund}, 6347 title = {Schwarz Methods for {H}elmholtz's Equation}, 6348 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6349 editor = {John A. DeSanto}, 6350 year = {1998}, 6351 publisher = {SIAM}, 6352 pages = {620--622}, 6353 address = {Philadelphia}, 6354 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6355 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6356 petsc_uses = {KSP} 6357} 6358 6359@InProceedings{ toselli-wave-98, 6360 author = {Andrea Toselli}, 6361 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 6362 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6363 editor = {John A. DeSanto}, 6364 year = {1998}, 6365 publisher = {SIAM}, 6366 address = {Philadelphia}, 6367 pages = {540--542}, 6368 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6369 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6370 petsc_uses = {KSP} 6371} 6372 6373@InProceedings{ mcinnes-wave-98, 6374 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 6375 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 6376 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6377 editor = {John A. DeSanto}, 6378 year = {1998}, 6379 publisher = {SIAM}, 6380 address = {Philadelphia}, 6381 pages = {623--625}, 6382 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6383 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6384 petsc_uses = {KSP} 6385} 6386 6387@InProceedings{ mska98, 6388 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 6389 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 6390 Parallel Computation of {H}elmholtz Problems}, 6391 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6392 editor = {J. Mandel et al.}, 6393 publisher = {AMS}, 6394 pages = {349--357}, 6395 year = {1998}, 6396 petsc_uses = {KSP} 6397} 6398 6399@InProceedings{ ccew98, 6400 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 6401 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 6402 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6403 editor = {J. Mandel et al.}, 6404 publisher = {AMS}, 6405 pages = {437-445}, 6406 year = {1998}, 6407 petsc_uses = {KSP} 6408} 6409 6410@InProceedings{ ra98a, 6411 author = {R. Susan-Resiga and H. M. Atassi}, 6412 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 6413 Problems}, 6414 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 6415 publisher = {AIAA}, 6416 pages = {86-96}, 6417 note = {AIAA paper 98-2218}, 6418 year = {1998}, 6419 petsc_uses = {KSP} 6420} 6421 6422@InProceedings{ ar98c, 6423 author = {H. M. Atassi and R. Susan-Resiga}, 6424 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 6425 General Formulation}, 6426 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6427 publisher = {ASME}, 6428 note = {NCA-25}, 6429 pages = {375-379}, 6430 year = {1998}, 6431 petsc_uses = {KSP} 6432} 6433 6434@InProceedings{ ra98b, 6435 author = {R. Susan-Resiga and H. M. Atassi}, 6436 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 6437 Numerical Implementation and Applications}, 6438 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6439 publisher = {ASME}, 6440 note = {NCA-25}, 6441 pages = {381 -388}, 6442 year = {1998}, 6443 petsc_uses = {KSP} 6444} 6445 6446@InProceedings{ cai-dd10-98, 6447 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 6448 Widlund}, 6449 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 6450 booktitle = {Domain Decomposition Methods 10}, 6451 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 6452 series = {Contemporary Mathematics}, 6453 volume = {218}, 6454 publisher = {American Mathematical Society}, 6455 address = {Providence, Rhode Island}, 6456 year = {1998}, 6457 pages = {437--445}, 6458 petsc_uses = {KSP} 6459} 6460 6461@InProceedings{ alghamdi2011petclaw, 6462 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 6463 booktitle = {Proceedings of SpringSim 2011}, 6464 publisher = {ACM}, 6465 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 6466 Kyle T. Mandli and Lisandro Dalcin}, 6467 year = {2011}, 6468 petsc_uses = {KSP} 6469} 6470 6471@Article{ pyclaw2012, 6472 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 6473 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 6474 Emmett}, 6475 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 6476 journal = {SIAM Journal on Scientific Computing}, 6477 volume = {34}, 6478 number = {4}, 6479 pages = {C210--C231}, 6480 note = {\url{http://arxiv.org/abs/1111.6583}}, 6481 year = {2012}, 6482 petsc_uses = {KSP} 6483} 6484 6485% LiteralHTML: 6486% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 6487% LiteralHTML: 6488@Article{ sojkahorakhaplacermak2018, 6489 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 6490 decomposition method}, 6491 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 6492 journal = {Applied Mathematics and Computation}, 6493 volume = {319}, 6494 pages = {586--597}, 6495 year = {2018}, 6496 petsc_uses = {KSP} 6497} 6498 6499@Article{ chencai2014, 6500 title = {A parallel two-level domain decomposition based one-shot method for shape 6501 optimization problems}, 6502 author = {Rongliang Chen and Xiao‐Chuan Cai}, 6503 journal = {International Journal for Numerical Methods in Engineering}, 6504 volume = {99}, 6505 number = {13}, 6506 year = {2014}, 6507 doi = {10.1002/nme.4711}, 6508 petsc_uses = {KSP} 6509} 6510 6511@PhDThesis{ prudencio2005, 6512 author = {Ernesto Prudencio}, 6513 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 6514 for Optimization Problems Constrained by Partial Differential Equations}, 6515 school = {University of Colorado, Boulder}, 6516 year = {2005}, 6517 petsc_uses = {KSP} 6518} 6519 6520@Article{ prudenciocai2007, 6521 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 6522 for {PDE}-constrained optimization}, 6523 author = {Ernesto Prudencio and X. C. Cai}, 6524 journal = {SIAM J. Sci. Comp.}, 6525 volume = {29}, 6526 number = {3}, 6527 pages = {964--985}, 6528 year = {2007}, 6529 petsc_uses = {KSP} 6530} 6531 6532@Article{ prudenciobyrdcai2006, 6533 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6534 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 6535 {PDE}-constrained Optimization Problems}, 6536 journal = {SIAM J. Sci. Comp.}, 6537 volume = {27}, 6538 pages = {1305--1328}, 6539 year = {2006}, 6540 petsc_uses = {KSP} 6541} 6542 6543@InProceedings{ prudenciobyrdcai2004, 6544 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 6545 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6546 booktitle = {VECPAR 2004}, 6547 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 6548 publisher = {Springer}, 6549 pages = {569--582}, 6550 year = {2004}, 6551 petsc_uses = {KSP} 6552} 6553 6554@Article{ belhamadia-fortin-pcp, 6555 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 6556 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 6557 journal = {Journal of Computational Physics}, 6558 volume = {201}, 6559 pages = {753-770}, 6560 year = {2004}, 6561 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 6562 petsc_uses = {KSP} 6563} 6564 6565@Article{ biros00, 6566 author = {George Biros and Omar Ghattas}, 6567 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 6568 journal = {SIAG-Opt Views and News}, 6569 volume = {11}, 6570 number = {2}, 6571 year = {2000}, 6572 month = aug, 6573 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 6574 petsc_uses = {KSP} 6575} 6576 6577@Article{ bmm01, 6578 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 6579 journal = {ACM Transactions on Mathematical Software}, 6580 title = {A case study in the performance and scalability of optimization algorithms}, 6581 year = {2001}, 6582 volume = {27}, 6583 number = {3}, 6584 pages = {361--376}, 6585 petsc_uses = {KSP} 6586} 6587 6588@InProceedings{ oghattas1999, 6589 author = {George Biros and Omar Ghattas}, 6590 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 6591 incompressible flows}, 6592 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 6593 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 6594 year = {1999}, 6595 petsc_uses = {KSP} 6596} 6597 6598@InProceedings{ hkms00, 6599 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 6600 PDE-constrained Optimization}, 6601 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 6602 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 6603 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 6604 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 6605 Hasco\"{e}t and Uwe Naumann}, 6606 publisher = {Springer}, 6607 year = {2002}, 6608 petsc_uses = {KSP} 6609} 6610 6611% old version: replace with biros2005pln1 6612@TechReport{ bg011, 6613 author = {George Biros and Omar Ghattas}, 6614 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 6615 Part I: The Krylov-Schur Solver}, 6616 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6617 year = {2001}, 6618 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 6619 petsc_uses = {KSP} 6620} 6621 6622% old version: replace with biros2005pln2 6623@TechReport{ bg012, 6624 author = {George Biros and Omar Ghattas}, 6625 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 6626 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 6627 Optimal Control of Steady Viscous Flows}, 6628 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6629 year = {2001}, 6630 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 6631 petsc_uses = {KSP} 6632} 6633 6634% LiteralHTML: 6635% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 6636% LiteralHTML: 6637@InProceedings{ ly2003, 6638 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 6639 title = {A New Parallel Kernel-independent Fast Multipole Method}, 6640 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 6641 year = {2003}, 6642 note = {Winner of the Best Student Paper at SC2003}, 6643 petsc_uses = {KSP} 6644} 6645 6646@Article{ yokotabarbaknepley10, 6647 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 6648 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 6649 journal = {Computer Methods in Applied Mechanics and Engineering}, 6650 volume = {199}, 6651 number = {25-28}, 6652 pages = {1793--1804}, 6653 url = {http://arxiv.org/abs/0909.5413v1}, 6654 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 6655 year = {2010}, 6656 petsc_uses = {KSP} 6657} 6658 6659@Article{ cruzknepleybarba10, 6660 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 6661 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 6662 journal = {International Journal of Numerical Methods in Engineering}, 6663 volume = {85}, 6664 number = {4}, 6665 pages = {403--428}, 6666 url = {http://arxiv.org/abs/0905.2637}, 6667 note = {\url{http://arxiv.org/abs/0905.2637}}, 6668 year = {2010}, 6669 petsc_uses = {KSP} 6670} 6671 6672% LiteralHTML: 6673% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 6674% LiteralHTML: 6675@Article{ buchanpainumplebysmedleystevenson2012, 6676 title = {A sub-grid scale finite element agglomeration multigrid method with application 6677 to the Boltzmann transport equation}, 6678 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 6679 journal = {International Journal for Numerical Methods in Engineering}, 6680 volume = {92}, 6681 number = {3}, 6682 pages = {318--342}, 6683 year = {2012}, 6684 publisher = {Wiley Online Library}, 6685 petsc_uses = {KSP} 6686} 6687 6688@Article{ magoulesahamedsuzuki2015, 6689 title = {Green computing on graphics processing units}, 6690 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 6691 journal = {Concurrency and Computation: Practice and Experience}, 6692 year = {2015}, 6693 publisher = {Wiley Online Library}, 6694 petsc_uses = {KSP} 6695} 6696 6697@InProceedings{ yanrhodes11, 6698 author = {Yan, Baoqiang and Rhodes, Philip J.}, 6699 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 6700 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 6701 series = {ICPP '11}, 6702 pages = {355--364}, 6703 year = {2011}, 6704 isbn = {978-0-7695-4510-3}, 6705 numpages = {10}, 6706 doi = {10.1109/ICPP.2011.70}, 6707 acmid = {2066965}, 6708 publisher = {IEEE Computer Society}, 6709 address = {Washington, DC, USA}, 6710 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 6711 petsc_uses = {KSP} 6712} 6713 6714@Article{ hakansson2013mdstochasticliouville, 6715 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 6716 Stulz, Eugen}, 6717 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 6718 equation study}, 6719 journal = {Phys. Chem. Chem. Phys.}, 6720 year = {2013}, 6721 volume = {15}, 6722 issue = {26}, 6723 pages = {10930-10941}, 6724 publisher = {The Royal Society of Chemistry}, 6725 doi = {10.1039/C3CP50788B}, 6726 petsc_uses = {KSP} 6727} 6728 6729@Article{ hakansson2011stochasticliouville, 6730 author = {Hakansson, Par and Nair, Prasanth B.}, 6731 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 6732 form}, 6733 journal = {Phys. Chem. Chem. Phys.}, 6734 year = {2011}, 6735 volume = {13}, 6736 issue = {20}, 6737 pages = {9578-9589}, 6738 publisher = {The Royal Society of Chemistry}, 6739 doi = {10.1039/C1CP20400A}, 6740 petsc_uses = {KSP} 6741} 6742 6743@InProceedings{ wang:lee:scidac2011, 6744 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 6745 McInnes and Todd Munson and Barry Smith}, 6746 title = {A Differential Variational Inequality Approach for the Simulation of 6747 Heterogeneous Materials}, 6748 booktitle = {Proceedings of SciDAC 2011 Conference}, 6749 year = {2011}, 6750 petsc_uses = {KSP} 6751} 6752 6753@Article{ bourdinlarsenrichardson2011, 6754 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 6755 title = {A time-discrete model for dynamic fracture based on crack regularization}, 6756 journal = {International Journal of Fracture}, 6757 volume = {168}, 6758 issue = {2}, 6759 pages = {133--143}, 6760 doi = {10.1007/s10704-010-9562-x}, 6761 year = {2011}, 6762 petsc_uses = {KSP} 6763} 6764 6765@Article{ bourdinfrancfortmarigo2008, 6766 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 6767 title = {The Variational Approach to Fracture}, 6768 journal = {J. Elasticity}, 6769 volume = {91}, 6770 issue = {1}, 6771 pages = {1--148}, 6772 doi = {10.1007/s10659-007-9107-3}, 6773 year = {2008}, 6774 petsc_uses = {KSP} 6775} 6776 6777@Article{ lahtinen2008spectrum, 6778 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 6779 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 6780 J.K.}, 6781 journal = {Annals of Physics}, 6782 volume = {323}, 6783 number = {9}, 6784 pages = {2286--2310}, 6785 year = {2008}, 6786 publisher = {Elsevier}, 6787 petsc_uses = {KSP} 6788} 6789 6790@InProceedings{ roark2004discriminative, 6791 title = {Discriminative language modeling with conditional random fields and the 6792 perceptron algorithm}, 6793 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 6794 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 6795 Linguistics}, 6796 pages = {47}, 6797 year = {2004}, 6798 organization = {Association for Computational Linguistics}, 6799 petsc_uses = {KSP} 6800} 6801 6802@Article{ roark2007discriminative, 6803 title = {Discriminative n-gram language modeling}, 6804 author = {Roark, B. and Saraclar, M. and Collins, M.}, 6805 journal = {Computer Speech \& Language}, 6806 volume = {21}, 6807 number = {2}, 6808 pages = {373--392}, 6809 year = {2007}, 6810 publisher = {Elsevier}, 6811 petsc_uses = {KSP} 6812} 6813 6814@Conference{ garcia2011parallel, 6815 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 6816 nanodevice simulators}}, 6817 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 6818 Aldegunde, M.}, 6819 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 6820 pages = {1--4}, 6821 organization = {IEEE}, 6822 petsc_uses = {KSP} 6823} 6824 6825@Conference{ wesley2006parallel, 6826 title = {{A parallel artificial neural network implementation}}, 6827 author = {Wesley-Smith, I.}, 6828 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 6829 year = {2006}, 6830 petsc_uses = {KSP} 6831} 6832 6833@Article{ hcsw1, 6834 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 6835 title = {Parallel {N}ewton--{K}rylov--{S}chwarz algorithms for the three-dimensional 6836 {P}oisson--{B}oltzmann equation in numerical simulation of colloidal particle 6837 interactions}, 6838 journal = {Computer Physics Communications}, 6839 volumne = {181}, 6840 year = {2010}, 6841 pages = {1529--1537}, 6842 petsc_uses = {KSP} 6843} 6844 6845@Article{ hh1, 6846 author = {C.-Y. Huang and F.-N. Hwang}, 6847 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 6848 bifurcation analysis of incompressible sudden expansion flows}, 6849 journal = {Applied Numerical Mathematics}, 6850 volume = {60}, 6851 year = {2010}, 6852 pages = {738--751}, 6853 petsc_uses = {KSP} 6854} 6855 6856@Article{ hwhw1, 6857 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 6858 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 6859 polynomial eigenvalue problems in quantum dot simulation}, 6860 journal = {Journal of Computational Physics}, 6861 volume = {229}, 6862 year = {2010}, 6863 pages = {2932--2947}, 6864 petsc_uses = {KSP} 6865} 6866 6867@Article{ wei2011parallel, 6868 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 6869 Application in Quantum Dot Simulation}}, 6870 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 6871 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 6872 pages = {157--164}, 6873 year = {2011}, 6874 publisher = {Springer}, 6875 petsc_uses = {KSP} 6876} 6877 6878@Article{ flores2007sequential, 6879 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 6880 equation using second-degree iterative methods}}, 6881 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 6882 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 6883 pages = {426--438}, 6884 year = {2007}, 6885 publisher = {Springer}, 6886 petsc_uses = {KSP} 6887} 6888 6889@InProceedings{ gordonbell09, 6890 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 6891 Siegel and Won Sik Yang}, 6892 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 6893 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 6894 note = {{SC'09 Gordon Bell} Prize Finalist}, 6895 year = {2009}, 6896 petsc_uses = {KSP} 6897} 6898 6899@Article{ knepleykarpeevdavidovitseisenberggillespie10, 6900 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 6901 Eisenberg and Dirk Gillespie}, 6902 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 6903 Dimensions: Ionic Solutions}, 6904 journal = {Journal of Physical Chemistry}, 6905 volume = {132}, 6906 number = {12}, 6907 pages = {124101--124111}, 6908 url = {http://arxiv.org/abs/0910.1531}, 6909 year = {2010}, 6910 petsc_uses = {KSP} 6911} 6912 6913@Article{ knepleykarpeeveisenberggillespie09, 6914 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 6915 D.}, 6916 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 6917 Functional Theory Approach}}, 6918 journal = {Biophysical Journal}, 6919 month = feb, 6920 volume = {96}, 6921 pages = {661}, 6922 doi = {10.1016/j.bpj.2008.12.3494}, 6923 year = {2009}, 6924 petsc_uses = {KSP} 6925} 6926 6927@Article{ scx2008, 6928 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 6929 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 6930 CONCRETE}, 6931 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 6932 volume = {3}, 6933 number = {4}, 6934 year = {2006}, 6935 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 6936 petsc_uses = {KSP} 6937} 6938 6939@TechReport{ kdgs2008, 6940 year = {2008}, 6941 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 6942 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 6943 Chips}, 6944 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 6945 Stortia}, 6946 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 6947 petsc_uses = {KSP} 6948} 6949 6950@Article{ springerlink:10.1007/s10915-011-9551-x, 6951 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 6952 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 6953 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 6954 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 6955 Coupled FEM/SBFEM Approach}, 6956 journal = {Journal of Scientific Computing}, 6957 publisher = {Springer Netherlands}, 6958 issn = {0885-7474}, 6959 keyword = {Mathematics and Statistics}, 6960 pages = {1-22}, 6961 doi = {10.1007/s10915-011-9551-x}, 6962 petsc_uses = {KSP} 6963} 6964 6965@TechReport{ jj2007, 6966 author = {Boris Jeremic and Guanzhou Jie}, 6967 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 6968 Problems Report}, 6969 institution = {UCD CompGeoMech 02--2007}, 6970 year = {2007}, 6971 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 6972 petsc_uses = {KSP} 6973} 6974 6975@Unpublished{ kuiper08, 6976 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 6977 author = {Rolf Kuiper}, 6978 institution = {Max-Planck-Institute for Astronomy}, 6979 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 6980 year = {2008}, 6981 petsc_uses = {KSP} 6982} 6983 6984@Article{ williamson2012multidimensional, 6985 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 6986 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 6987 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 6988 journal = {Journal of Nuclear Materials}, 6989 volume = {423}, 6990 number = {1}, 6991 pages = {149--163}, 6992 year = {2012}, 6993 publisher = {Elsevier}, 6994 petsc_uses = {KSP} 6995} 6996 6997@InProceedings{ kucukboyaci2015cobra, 6998 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 6999 analysis}, 7000 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 7001 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 7002 Nuclear Applications and the Monte Carlo Method}, 7003 pages = {1--18}, 7004 year = {2015}, 7005 petsc_uses = {KSP} 7006} 7007 7008@Article{ hales2012solving, 7009 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 7010 {K}rylov Method}, 7011 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 7012 M.R.}, 7013 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 7014 volume = {84}, 7015 number = {2}, 7016 pages = {123--153}, 7017 year = {2012}, 7018 publisher = {Tech Science Press}, 7019 petsc_uses = {KSP} 7020} 7021 7022@InProceedings{ srksyp2008, 7023 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 7024 Palmiotti}, 7025 title = {Fast reactor core simulations using the {UNIC} code}, 7026 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 7027 Power: A Sustainable Resource}, 7028 year = {2008}, 7029 petsc_uses = {KSP} 7030} 7031 7032@InProceedings{ psrlkssl2007, 7033 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 7034 Siegel and B. Smith and E. E. Lewis}, 7035 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 7036 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7037 Supercomputing in Nuclear Applications}, 7038 year = {2007}, 7039 petsc_uses = {KSP} 7040} 7041 7042@InProceedings{ sprkssl2007, 7043 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 7044 Smith and E. E. Lewis}, 7045 title = {{PNFE} Component of the {UNIC} Code}, 7046 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7047 Supercomputing in Nuclear Applications}, 7048 year = {2007}, 7049 petsc_uses = {KSP} 7050} 7051 7052@InProceedings{ dc-oop-03, 7053 author = {H. Digonnet and T. Coupez}, 7054 title = {Object-oriented programming for fast-and-easy development of parallel 7055 applications in forming processes simulation}, 7056 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 7057 Mechanics}, 7058 year = {2003}, 7059 petsc_uses = {KSP} 7060} 7061 7062@InProceedings{ dc-cfm-03, 7063 author = {H. Digonnet and T. Coupez}, 7064 title = {Calcul parallele en mise en forme des materiaux}, 7065 booktitle = {XVIeme Congres Francais de Mecanique}, 7066 year = {2003}, 7067 petsc_uses = {KSP} 7068} 7069 7070@InProceedings{ dsc-pcsev-04, 7071 author = {H. Digonnet and L. Silva and T. Coupez}, 7072 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 7073 booktitle = {Proceedings of ECCOMAS 2004}, 7074 year = {2004}, 7075 petsc_uses = {KSP} 7076} 7077 7078@InProceedings{ dsc-pca3fs-04, 7079 author = {H. Digonnet and L. Silva and T. Coupez}, 7080 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 7081 booktitle = {Proceedings of WCCM VI}, 7082 year = {2004}, 7083 petsc_uses = {KSP} 7084} 7085 7086@InProceedings{ dbcs-cpaac-05, 7087 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 7088 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 7089 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 7090 year = {2005}, 7091 petsc_uses = {KSP} 7092} 7093 7094@Article{ sz2010, 7095 author = {B. Smith and H. Zhang}, 7096 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 7097 Performance}, 7098 journal = {International Journal of High Performance Computing Applications}, 7099 volume = {25}, 7100 number = {4}, 7101 pages = {386--391}, 7102 year = {2011}, 7103 petsc_uses = {KSP} 7104} 7105 7106@Article{ zssz2006, 7107 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 7108 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 7109 journal = {TOMS}, 7110 url = {http://math.nist.gov/toms/Current.html#v33n2}, 7111 volumne = {33}, 7112 number = {2}, 7113 year = {2007}, 7114 petsc_uses = {KSP} 7115} 7116 7117@Article{ gs2006, 7118 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 7119 title = {The detachment of a viscous drop in a viscous solution in the presence of a 7120 soluble surfactant}, 7121 journal = {Phys. Fluids}, 7122 volume = {18}, 7123 year = {2006}, 7124 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 7125 petsc_uses = {KSP} 7126} 7127 7128@Article{ jmemsci, 7129 author = {Bo Zhou and Adam Powell}, 7130 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 7131 of Polymeric Membranes in 2D and 3D}, 7132 journal = {J. Membrane Sci.}, 7133 volume = {268}, 7134 number = {2}, 7135 pages = {150--164}, 7136 year = {2006}, 7137 month = jan, 7138 day = {15}, 7139 doi = {10.1016/j.memsci.2005.05.030}, 7140 petsc_uses = {KSP} 7141} 7142 7143@InProceedings{ vbde2002, 7144 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 7145 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 7146 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 7147 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7148 year = {2002}, 7149 petsc_uses = {KSP} 7150} 7151 7152@InProceedings{ wid2005, 7153 author = {Alexander I. Bobenko and Peter Schrader}, 7154 title = {Discrete Willmore Flow}, 7155 booktitle = {Eurographics Symposium on Geometry Processing}, 7156 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 7157 year = {2005}, 7158 editor = {M. Desbrun and H. Pottmann}, 7159 petsc_uses = {KSP} 7160} 7161 7162@Article{ stj2003, 7163 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 7164 journal = {International Journal for Numerical Methods in Fluids}, 7165 volume = {41}, 7166 issue = {4}, 7167 title = {A numerical method for inverse design based on the inverse Euler equations}, 7168 year = {2003}, 7169 pages = {339--355}, 7170 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 7171 petsc_uses = {KSP} 7172} 7173 7174@PhDThesis{ as2001, 7175 author = {ANDREA SCASCIGHINI}, 7176 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 7177 Inverse Euler Equations}, 7178 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 7179 year = {2001}, 7180 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 7181 petsc_uses = {KSP} 7182} 7183 7184@Article{ hb2005, 7185 author = {E. McKay Hyde and Oscar P. Bruno}, 7186 journal = {Journal of Computational Physics}, 7187 volume = {202}, 7188 title = {A fast, higher-order solver for scattering by penetrable bodies in three 7189 dimensions}, 7190 year = {2005}, 7191 pages = {236--261}, 7192 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 7193 petsc_uses = {KSP} 7194} 7195 7196@MastersThesis{ d2002, 7197 author = {Matthew F Dixon}, 7198 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 7199 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 7200 school = {READING UNIVERSITY}, 7201 year = {2002}, 7202 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 7203 petsc_uses = {KSP} 7204} 7205 7206@TechReport{ gzb, 7207 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 7208 title = {Fast Parallel PageRank: A Linear System Approach}, 7209 institution = {Stanford University}, 7210 year = {2004}, 7211 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 7212 petsc_uses = {KSP} 7213} 7214 7215@PhDThesis{ yergeau-99, 7216 author = {Daniel W. Yergeau}, 7217 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 7218 SEMICONDUCTORS}, 7219 school = {Stanford}, 7220 year = {1999}, 7221 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 7222 petsc_uses = {KSP} 7223} 7224 7225@InProceedings{ rathkopf-miller-00, 7226 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 7227 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 7228 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 7229 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 7230 year = {2000}, 7231 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 7232 Physics and Mathematics and Computation into the Next Millennium}, 7233 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 7234 lab = {LLNL}, 7235 petsc_uses = {KSP} 7236} 7237 7238@Article{ bonfi-palma-pas-05, 7239 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 7240 journal = {Journal of Turbomachinery}, 7241 volume = {127}, 7242 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 7243 year = {2005}, 7244 pages = {395-401}, 7245 petsc_uses = {KSP} 7246} 7247 7248@InProceedings{ fettig-sobh-05, 7249 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 7250 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 7251 year = {2005}, 7252 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 7253 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 7254 petsc_uses = {KSP} 7255} 7256 7257@TechReport{ melnikov-matagne-05, 7258 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 7259 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 7260 title = {Spin configurations in circular and rectangular vertical quantum dots in a 7261 magnetic field: Three-dimensional self-consistent simulation}, 7262 year = {2005}, 7263 number = {Arxiv preprint cond-mat/0506585}, 7264 url = {http://arxiv.org/pdf/cond-mat/0506585}, 7265 petsc_uses = {KSP} 7266} 7267 7268@InProceedings{ richard-smedley-03, 7269 author = {Richard P. Smedley-Stevenson}, 7270 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 7271 year = {2003}, 7272 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 7273 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 7274 petsc_uses = {KSP} 7275} 7276 7277@Article{ guan-godoy-ravaioli-03, 7278 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 7279 journal = {Journal of Computational Electronics}, 7280 volume = {2}, 7281 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 7282 for Transport in a Silicon Quantum Wire Structure}, 7283 year = {2003}, 7284 pages = {335--339}, 7285 petsc_uses = {KSP} 7286} 7287 7288@Article{ ovtchinnikovcai04, 7289 author = {S. Ovtchinnikov and X.-C. Cai}, 7290 journal = {Numer. Lin. Alg. Applics}, 7291 volume = {11}, 7292 title = {One-level {N}ewton--{K}rylov--{S}chwarz algorithm for unsteady nonlinear radiation 7293 diffusion problem}, 7294 year = {2004}, 7295 pages = {867--881}, 7296 petsc_uses = {KSP} 7297} 7298 7299@Article{ mixedstress, 7300 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 7301 author = {Adam Powell and David Dussault}, 7302 journal = {Appl. Numer. Anal. Comp. Math.}, 7303 volume = {2}, 7304 number = {1}, 7305 year = {2005}, 7306 pages = {157--166}, 7307 petsc_uses = {KSP} 7308} 7309 7310@Article{ dhh2005, 7311 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 7312 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 7313 journal = {International Journal for Computation and Mathematics in Electrical and 7314 Electronic Engineering (COMPEL)}, 7315 year = {2005}, 7316 petsc_uses = {KSP} 7317} 7318 7319@Article{ dhh2004, 7320 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 7321 title = {Finite element modelling of ion convection by electrostatic forces}, 7322 journal = {IEE Proceedings Science, Measurement and Technology}, 7323 year = {2004}, 7324 volume = {151}, 7325 number = {6}, 7326 petsc_uses = {KSP} 7327} 7328 7329@Article{ adams-07b, 7330 author = {Adams M.F.}, 7331 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 7332 Frequency Response Analysis in Solid Mechanics}, 7333 journal = {Computional Mechanics}, 7334 year = {2007}, 7335 volume = {39}, 7336 number = {4}, 7337 pages = {497-507}, 7338 petsc_uses = {KSP} 7339} 7340 7341@InProceedings{ wc2004, 7342 author = {A. Wheelock and D. Cooke}, 7343 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 7344 Dimensions}, 7345 year = {2004}, 7346 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 7347 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 7348 petsc_uses = {KSP} 7349} 7350 7351@InProceedings{ allard-gouranton-ipts2002, 7352 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 7353 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 7354 year = {2002}, 7355 booktitle = {Immersive Projection Technology Symposium}, 7356 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 7357 petsc_uses = {KSP} 7358} 7359 7360@Article{ icc, 7361 author = {D Ioan and G Ciuprina and C Ciobotaru}, 7362 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 7363 journal = {IEEE Transactions on Magnetics}, 7364 year = {2000}, 7365 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 7366 petsc_uses = {KSP} 7367} 7368 7369@InProceedings{ hs1, 7370 author = {Brian J. Henz and Dale R. Shires}, 7371 title = {Development and Performance Analysis of a Parallel Finite Element Application 7372 Implemented in an Object-Oriented Programming Framework}, 7373 year = {2003}, 7374 booktitle = {PDPTA 2003}, 7375 pages = {1286-1292}, 7376 note = {Resin Transfer Modeling}, 7377 petsc_uses = {KSP} 7378} 7379 7380@TechReport{ b2000, 7381 author = {Rickard Bergstrom}, 7382 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 7383 year = {2000}, 7384 institution = {Chalmers}, 7385 number = {2000-05}, 7386 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 7387 petsc_uses = {KSP} 7388} 7389 7390@Article{ fs2004, 7391 author = {Petri Fast and Michael J. Shelley}, 7392 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 7393 Shaw Flow}, 7394 journal = {Journal of Computational Physics}, 7395 year = {2004}, 7396 volume = {195}, 7397 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 7398 pages = {117-142}, 7399 petsc_uses = {KSP} 7400} 7401 7402@MastersThesis{ wallach, 7403 author = {Hanna Wallach}, 7404 title = {Efficient Training of Conditional Random Fields}, 7405 school = {University of Edinburgh}, 7406 year = {2002}, 7407 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 7408 }osborne/msc-projects/wallach.ps.gz}, 7409 petsc_uses = {KSP} 7410} 7411 7412@Article{ something, 7413 author = {T Rylander and A Bondeson}, 7414 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 7415 equations}, 7416 journal = {Journal of Computational Physics}, 7417 year = {2002}, 7418 volume = {179}, 7419 pages = {426-438}, 7420 petsc_uses = {KSP} 7421} 7422 7423@TechReport{ uf1, 7424 author = {Uwe Fabricius}, 7425 title = {Comparison of two implementations of {AMG}-preconditioned {CG} considering an 7426 electrostatic problem}, 7427 year = {2004}, 7428 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 7429 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 7430 number = {04-1}, 7431 petsc_uses = {KSP} 7432} 7433 7434@InBook{ sg1, 7435 author = {Natalia Seoane and A.J.Garca-Loureiro}, 7436 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 7437 Equation}, 7438 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 7439 title = {Lecture Notes in Computer Science}, 7440 publisher = {Springer-Verlag}, 7441 volume = {3037}, 7442 year = {2004}, 7443 petsc_uses = {KSP} 7444} 7445 7446@Article{ nikyilmazgivisheikhipope10, 7447 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 7448 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 7449 journal = {AIAA Journal}, 7450 volume = {48}, 7451 number = {7}, 7452 pages = {1513--1522}, 7453 year = {2010}, 7454 petsc_uses = {KSP} 7455} 7456 7457@Article{ nikyilmazsheikhigivi10, 7458 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 7459 title = {Grid Resolution Effects on VSFMDF/LES}, 7460 journal = {Flow, Turbulence and Combustion}, 7461 doi = {10.1007/s10494-010-9272-5}, 7462 year = {2010}, 7463 petsc_uses = {KSP} 7464} 7465 7466@Article{ idema2013towards, 7467 title = {Towards faster solution of large power flow problems}, 7468 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 7469 and van der Sluis, Lou}, 7470 journal = {Power Systems, IEEE Transactions on}, 7471 volume = {28}, 7472 number = {4}, 7473 pages = {4918--4925}, 7474 year = {2013}, 7475 publisher = {IEEE}, 7476 petsc_uses = {KSP} 7477} 7478 7479@Article{ 6026245, 7480 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 7481 journal = {Power Systems, IEEE Transactions on}, 7482 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 7483 year = {2012}, 7484 month = feb, 7485 volume = {27}, 7486 number = {1}, 7487 pages = {390-396}, 7488 doi = {10.1109/TPWRS.2011.2165860}, 7489 issn = {0885-8950}, 7490 petsc_uses = {KSP} 7491} 7492 7493@Book{ idema2014computational, 7494 title = {Computational Methods in Power System Analysis}, 7495 author = {Idema, Reijer and Lahaye, Domenico JP}, 7496 year = {2014}, 7497 publisher = {Springer}, 7498 petsc_uses = {KSP} 7499} 7500 7501@PhDThesis{ abhyankar2011thesis, 7502 author = {Shrirang Abhyankar}, 7503 title = {Development of an implicitly coupled electromechanical and electromagnetic 7504 transients simulator for power systems}, 7505 school = {Illinois Institute of Technology}, 7506 year = {2011}, 7507 petsc_uses = {KSP} 7508} 7509 7510@InProceedings{ abhyankarhipcna11-1, 7511 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 7512 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 7513 year = {2011}, 7514 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7515 Networking and Analytics for the Power Grid}, 7516 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 7517 publisher = {ACM}, 7518 petsc_uses = {KSP} 7519} 7520 7521@InProceedings{ abhyankarhipcna11-2, 7522 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 7523 title = {Development of a parallel three-phase transient stability simulator for power 7524 systems}, 7525 year = {2011}, 7526 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7527 Networking and Analytics for the Power Grid}, 7528 publisher = {ACM}, 7529 petsc_uses = {KSP} 7530} 7531 7532@InProceedings{ abhyankarpesgeneral2012, 7533 author = {Shrirang Abhyankar and A. Flueck}, 7534 title = {An implicitly-coupled solution approach for combined electromechanical and 7535 electromagnetic transients simulation}, 7536 year = {2012}, 7537 booktitle = {Proceedings of the IEEE PES General Meeting}, 7538 publisher = {IEEE}, 7539 petsc_uses = {KSP} 7540} 7541 7542@Article{ idemalahayevuiksluis2012, 7543 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 7544 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 7545 journal = {IEEE Transactions on Power Systems}, 7546 year = {2012}, 7547 volume = {27}, 7548 pages = {390-396}, 7549 petsc_uses = {KSP} 7550} 7551 7552@Article{ korrestzavellasgalinas2013, 7553 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 7554 title = {A distributed implementation of multi-area power system state estimation on a 7555 cluster of computers }, 7556 journal = {Electric Power Systems Research }, 7557 volume = {102}, 7558 number = {0}, 7559 pages = {20 - 32}, 7560 year = {2013}, 7561 issn = {0378-7796}, 7562 doi = {10.1016/j.epsr.2013.04.002}, 7563 petsc_uses = {KSP} 7564} 7565 7566% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7567% LiteralHTML:<font color="#FF0000"> 7568% LiteralHTML: Material failure, for example, cracking of steel beams resulting 7569% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 7570% LiteralHTML: are important for prediction and prevention. PETSc has been used 7571% LiteralHTML: in a variety of studies of material failure.</p> 7572% LiteralHTML:</font> 7573% LiteralHTML: 7574@InProceedings{ gray2, 7575 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 7576 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 7577 year = {2004}, 7578 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 7579 petsc_uses = {KSP} 7580} 7581 7582@InProceedings{ gray1, 7583 author = {J. Gray and C. Homescu and L. Petzold and Richard Alkire}, 7584 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 7585 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 7586 year = {2003}, 7587 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 7588 petsc_uses = {KSP} 7589} 7590 7591@InProceedings{ crack2, 7592 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 7593 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 7594 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 7595 Conference}, 7596 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 7597 year = {2003}, 7598 petsc_uses = {KSP} 7599} 7600 7601@TechReport{ hdams1, 7602 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 7603 Lynd Stringer}, 7604 title = {Fracture Mechanics on the Intel Itanium Architecture}, 7605 year = {2001}, 7606 institution = {Intel Corporation}, 7607 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 7608 petsc_uses = {KSP} 7609} 7610 7611@InProceedings{ ihwi, 7612 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 7613 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 7614 booktitle = {International Conference ON Computational Engineering and Sciences}, 7615 year = {2002}, 7616 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 7617 petsc_uses = {KSP} 7618} 7619 7620@InProceedings{ crack, 7621 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 7622 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 7623 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 7624 and Paul A. Wawrzynek}, 7625 title = {Parallel FEM Simulation of Crack Propagation}, 7626 booktitle = {Proceedings of Irregular 2000}, 7627 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 7628 year = {2000}, 7629 petsc_uses = {KSP} 7630} 7631 7632@InProceedings{ beaudoin98, 7633 author = {A. J. Beaudoin}, 7634 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 7635 booktitle = {Simulation of materials processing: Theory, methods, and applications - 7636 Proceedings of the Sixth International Conference, NUMIFORM'98}, 7637 editor = {J. Hu\'etink and F. P. T. Baaijens}, 7638 optvolume = {}, 7639 optnumber = {}, 7640 optseries = {}, 7641 year = {1998}, 7642 optorganization={}, 7643 publisher = {A. A. Balkema Publishers}, 7644 address = {Rotterdam, Netherlands}, 7645 month = jun, 7646 optpages = {}, 7647 petsc_uses = {KSP} 7648} 7649 7650% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7651@TechReport{ defordheld1, 7652 author = {JF DeFord and BL Held}, 7653 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 7654 year = {2002}, 7655 institution = {Simulation Technology and Applied Research}, 7656 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 7657 note = {Discusses their parallel commercial solver that uses PETSc}, 7658 petsc_uses = {KSP} 7659} 7660 7661@PhDThesis{ sande2003, 7662 author = {Hans Vande Sande}, 7663 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 7664 Quasi-Static Electromagnetic Systems}, 7665 school = {Katholieke Universiteit Leuven, Belgium}, 7666 year = {2003}, 7667 petsc_uses = {KSP} 7668} 7669 7670@Article{ sdchh2004, 7671 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 7672 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 7673 Tolerance}, 7674 journal = {IEEE Transactions on Magnetics}, 7675 year = {2004}, 7676 volume = {40}, 7677 pages = {1306--1309}, 7678 petsc_uses = {KSP} 7679} 7680 7681@Article{ holst-lindblom-etal:2004, 7682 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 7683 Scheel and Lawrence E. Kidder}, 7684 title = {Optimal constraint projection for hyperbolic evolution systems, }, 7685 journal = {Phys. Rev. D}, 7686 year = {2004}, 7687 volume = {70}, 7688 pages = {084017}, 7689 petsc_uses = {KSP} 7690} 7691 7692@Article{ marm2005, 7693 author = {Matthew Anderson and Richard A. Matzner}, 7694 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 7695 journal = {Foundations of Physics}, 7696 volume = {35}, 7697 pages = {1572--9516}, 7698 year = {2005}, 7699 petsc_uses = {KSP} 7700} 7701 7702@Article{ cook-pfeiffer:2004, 7703 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 7704 title = {Excision boundary conditions for black hole initial data}, 7705 journal = {Phys. Rev. D}, 7706 volume = {70}, 7707 pages = {104016--24}, 7708 year = {2004}, 7709 petsc_uses = {KSP} 7710} 7711 7712@Article{ pfeiffer-kidder-etal:2005, 7713 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 7714 Shoemaker}, 7715 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 7716 journal = {Phys. Rev. D}, 7717 year = {2005}, 7718 volume = {71}, 7719 pages = {024020}, 7720 petsc_uses = {KSP} 7721} 7722 7723@Article{ pfeiffer-kidder-etal:2003, 7724 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 7725 Saul A.}, 7726 title = {A multidomain spectral method for solving elliptic equations}, 7727 journal = {CPC}, 7728 year = {2003}, 7729 volume = {152}, 7730 pages = {253--273}, 7731 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 7732 For a related online version, see arXiv:gr-qc/0202096}, 7733 petsc_uses = {KSP} 7734} 7735 7736@Article{ pfeiffer-cook-teukolsky:2002, 7737 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 7738 title = {Comparing initial-data sets for binary black hole}, 7739 journal = {PRD}, 7740 year = {2002}, 7741 volume = {66}, 7742 pages = {024047}, 7743 note = {for a related online version, seearXiv:gr-qc/0203085}, 7744 petsc_uses = {KSP} 7745} 7746 7747@PhDThesis{ pfeiffer:2003, 7748 author = {Pfeiffer, Harald P.}, 7749 title = {Initial Data for Black Hole Evolutions}, 7750 school = {Cornell University}, 7751 year = {2003}, 7752 petsc_uses = {KSP} 7753} 7754 7755@TechReport{ h1, 7756 author = {Erik Schnetter}, 7757 title = {A fast apparent horizon algorithm}, 7758 year = {2002}, 7759 number = {Arxiv preprint gr-qc/0206003}, 7760 url = {http://arxiv.org/pdf/gr-qc/0206003}, 7761 petsc_uses = {KSP} 7762} 7763 7764@Article{ h2, 7765 author = {Erik Schnetter}, 7766 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 7767 year = {2003}, 7768 journal = {Class. Quantum Grav.}, 7769 pages = {4719-4737}, 7770 volume = {20}, 7771 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 7772 petsc_uses = {KSP} 7773} 7774 7775@Article{ adams-03a, 7776 author = {Adams, M.~F.}, 7777 journal = {Numerical Linear Algebra with Applications}, 7778 number = {2-3}, 7779 pages = {141-153}, 7780 title = {Algebraic multigrid methods for constrained linear systems with applications to 7781 contact problems in solid mechanics}, 7782 volume = {11}, 7783 year = {2004}, 7784 petsc_uses = {KSP} 7785} 7786 7787@Article{ vandesande1, 7788 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 7789 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 7790 year = {2003}, 7791 volume = {39}, 7792 pages = {1709--1712}, 7793 title = {Solving Nonlinear Magnetic Problems Using {N}ewton Trust Region Methods}, 7794 petsc_uses = {KSP} 7795} 7796 7797@InProceedings{ vbde1, 7798 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 7799 year = {2002}, 7800 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 7801 Uintah PSE}, 7802 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 7803 2002}, 7804 pages = {49-55}, 7805 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7806 note = {Extended abstract}, 7807 petsc_uses = {KSP} 7808} 7809 7810@Unpublished{ ep1, 7811 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 7812 author = {Bradley R. Eccleston and Todd S. Palmer}, 7813 institution = {Department of Nuclear Engineering, Oregon State University}, 7814 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 7815 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 7816 Parallel Simulations}, 7817 year = {1999}, 7818 petsc_uses = {KSP} 7819} 7820 7821@InProceedings{ teo2007scalable, 7822 title = {A scalable modular convex solver for regularized risk minimization}, 7823 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 7824 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 7825 discovery and data mining}, 7826 pages = {727--736}, 7827 year = {2007}, 7828 organization = {ACM}, 7829 petsc_uses = {KSP} 7830} 7831 7832@InProceedings{ rm02, 7833 author = {Robert Malouf}, 7834 year = {2002}, 7835 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 7836 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 7837 (CoNLL-2002)}, 7838 pages = {49-55}, 7839 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 7840 petsc_uses = {KSP} 7841} 7842 7843@Unpublished{ hrv02, 7844 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 7845 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7846 note = {Submitted to CMMSE}, 7847 petsc_uses = {KSP} 7848} 7849 7850@Article{ tmh2001, 7851 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 7852 journal = {Journal of Economic Dynamics and Control}, 7853 year = {2002}, 7854 volume = {26}, 7855 pages = {1499-1515}, 7856 title = {Solving finite difference schemes arising in trivariate option pricing}, 7857 petsc_uses = {KSP} 7858} 7859 7860@InProceedings{ a2, 7861 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 7862 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 7863 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 7864 Methods}, 7865 editor = {C.-H. Lai et al.}, 7866 publisher = {Domain Decomposition Press, Bergen}, 7867 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 7868 year = {1999}, 7869 petsc_uses = {KSP} 7870} 7871 7872@Unpublished{ mmmdcmaa-web-page, 7873 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 7874 {A}coustics {W}eb Page}, 7875 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 7876 author = {David E. Keyes}, 7877 institution = {Old Dominion University}, 7878 petsc_uses = {KSP} 7879} 7880 7881@Conference{ liu2010parallelization, 7882 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 7883 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 7884 booktitle = {International Symposium on Parallel and Distributed Processing with 7885 Applications}, 7886 pages = {528--535}, 7887 year = {2010}, 7888 organization = {IEEE}, 7889 petsc_uses = {KSP} 7890} 7891 7892@Unpublished{ oil-reservoir-sim-web-page, 7893 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 7894 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 7895 institution = {University of Texas at Austin and Argonne National Laboratory}, 7896 key = {University of Texas at Austin and Argonne National Laboratory}, 7897 petsc_uses = {KSP} 7898} 7899 7900@Article{ tmh2001b, 7901 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 7902 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 7903 year = {2001}, 7904 volume = {37}, 7905 pages = {143--146}, 7906 title = {Adapting EMAP3D to parallel processing}, 7907 petsc_uses = {KSP} 7908} 7909 7910@Article{ harbury98, 7911 author = {HK Harbury and W Porod}, 7912 journal = {VLSI Design}, 7913 year = {1998}, 7914 volume = {6}, 7915 pages = {47--51}, 7916 title = {Parallel computation for electronic waves in quantum corrals}, 7917 petsc_uses = {KSP} 7918} 7919 7920@Article{ bludszuwei98, 7921 author = {Mark Bludszuweit}, 7922 journal = {Journal of Lightwave Technology}, 7923 year = {1998}, 7924 volume = {16}, 7925 number = {7}, 7926 pages = {1336--42}, 7927 title = {Mixed Finite Element Beam Propagation Method}, 7928 petsc_uses = {KSP} 7929} 7930 7931@Article{ s1, 7932 author = {J. L. Friedman and N. Stergioulas}, 7933 journal = {Astrophysics Journal}, 7934 year = {1998}, 7935 volume = {492}, 7936 number = {301}, 7937 pages = {}, 7938 title = {}, 7939 petsc_uses = {KSP} 7940} 7941 7942@Article{ s1a, 7943 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 7944 journal = {Astrophysics Journal}, 7945 year = {1999}, 7946 volume = {510}, 7947 number = {854}, 7948 pages = {}, 7949 title = {}, 7950 petsc_uses = {KSP} 7951} 7952 7953@PhDThesis{ s2, 7954 author = {N. Stergioulas}, 7955 title = {Ph. D. thesis}, 7956 year = {1996}, 7957 institution = {University of Wisconsin-Milwaukee}, 7958 petsc_uses = {KSP} 7959} 7960 7961@InProceedings{ coral1, 7962 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7963 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 7964 Parallel Computing Environment}, 7965 booktitle = {Proceedings of the Miami TEAM Workshop}, 7966 location = {Florida International University, Department of Electrical Engineering and 7967 Computing Science}, 7968 month = nov, 7969 year = {1993}, 7970 petsc_uses = {KSP} 7971} 7972 7973@InProceedings{ coral2, 7974 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7975 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 7976 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 7977 month = dec, 7978 year = {1994}, 7979 petsc_uses = {KSP} 7980} 7981 7982@InProceedings{ coral3, 7983 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7984 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 7985 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 7986 location = {Florida International University, Department of Electrical Engineering and 7987 Computing Science}, 7988 year = {1995}, 7989 petsc_uses = {KSP} 7990} 7991 7992@InProceedings{ mijalkovic, 7993 author = {Slobodan Mijalkovi\'{c}}, 7994 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 7995 Process Simulation}, 7996 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 7997 Gent, Belgium, September 27--30, 1999.}, 7998 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 7999 optvolume = {14}, 8000 optseries = {Lecture Notes in Computational Science and Engineering}, 8001 year = {2000}, 8002 publisher = {Springer}, 8003 address = {Berlin}, 8004 optpages = {179--184}, 8005 petsc_uses = {KSP} 8006} 8007 8008@Article{ bludszuwei98a, 8009 author = {Mark Bludszuweit}, 8010 journal = {Journal of Lightwave Technology}, 8011 year = {1998}, 8012 volume = {16}, 8013 number = {7}, 8014 pages = {1336--42}, 8015 title = {Mixed Finite Element Beam Propagation Method}, 8016 petsc_uses = {KSP} 8017} 8018 8019@Article{ gilli-pauletto-1998, 8020 author = {Manfred Gilli and Giorgio Pauletto}, 8021 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 8022 journal = {Computational Economics}, 8023 year = {2000}, 8024 volume = {16}, 8025 pages = {173--186}, 8026 petsc_uses = {KSP} 8027} 8028 8029% LiteralHTML: 8030% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 8031% LiteralHTML: 8032@Article{ collierdalcincalo2013, 8033 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 8034 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 8035 journal = {arxiv}, 8036 year = {2013}, 8037 number = {1305.4452}, 8038 note = {\url{http://arxiv.org/abs/1305.4452}}, 8039 petsc_uses = {KSP} 8040} 8041 8042@Article{ collierdalcinvignalcortescalo2016, 8043 title = {PetIGA: A framework for high-performance isogeometric analysis}, 8044 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 8045 Victor M. Calo}, 8046 journal = {Computer Methods in Applied Mechanics and Engineering}, 8047 year = {2016}, 8048 petsc_uses = {KSP} 8049} 8050 8051@Misc{ petiga-web-page, 8052 author = {N. Collier and L. Dalcin and V.M. Calo}, 8053 title = {{PetIGA} {W}eb page}, 8054 url = {https://bitbucket.org/dalcinl/petiga/}, 8055 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 8056 year = {2014}, 8057 petsc_uses = {KSP} 8058} 8059 8060@Article{ logg07, 8061 author = {Logg, Anders}, 8062 title = {Automating the Finite Element Method}, 8063 journal = {Archives of Computational Methods in Engineering}, 8064 volume = {14}, 8065 number = {2}, 8066 pages = {93-138}, 8067 year = {2007}, 8068 doi = {10.1007/s11831-007-9003-9}, 8069 publisher = {Kluwer Academic Publishers}, 8070 issn = {1134-3060}, 8071 language = {English}, 8072 petsc_uses = {KSP} 8073} 8074 8075@Article{ jezequelcouturierdenis12, 8076 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 8077 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 8078 versus the PETSc library}, 8079 journal = {The Journal of Supercomputing}, 8080 volume = {59}, 8081 number = {3}, 8082 pages = {1517-1532}, 8083 year = {2012}, 8084 issn = {0920-8542}, 8085 doi = {10.1007/s11227-011-0563-y}, 8086 publisher = {Springer US}, 8087 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 8088 Sparse linear solver}, 8089 language = {English}, 8090 petsc_uses = {KSP} 8091} 8092 8093@Unpublished{ feap-web-page, 8094 title = {FEAP: A Finite Element Analysis Program}, 8095 url = {http://www.ce.berkeley.edu/projects/feap/}, 8096 author = {FEAP Team}, 8097 note = {Uses PETSc linear solvers - iterative and direct}, 8098 petsc_uses = {KSP} 8099} 8100 8101@Unpublished{ parpre-web-page, 8102 title = {{ParPre} {W}eb {P}age}, 8103 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 8104 institution = {University of Tennessee}, 8105 author = {Victor Eijkhout}, 8106 note = {This is no longer supported. A set of preconditioners built on PETSc}, 8107 petsc_uses = {KSP} 8108} 8109 8110@Unpublished{ pism, 8111 title = {{PISM}: a Parallel Ice Sheet Model}, 8112 author = {{PISM Team}}, 8113 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 8114 Sheet Model). The thickness, temperature, velocity and age of the ice are all 8115 simulated, as is the deformation of the earth underneath the ice. New techniques 8116 for fast ice dynamics, earth deformation, and verification have are included.}, 8117 note = {\url{http://www.pism-docs.org/}}, 8118 petsc_uses = {KSP} 8119} 8120 8121@Unpublished{ oofem, 8122 title = {OOFEM - an object oriented finite element package}, 8123 author = {Borek Patzak}, 8124 url = {http://www.oofem.org}, 8125 petsc_uses = {KSP} 8126} 8127 8128@Unpublished{ dks2openfvm, 8129 title = {OpenFVM - a finite volume based general purpose CFD solver}, 8130 author = {Open source development}, 8131 url = {http://openfvm.sourceforge.net/}, 8132 petsc_uses = {KSP} 8133} 8134 8135@Unpublished{ sundar-2008w, 8136 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 8137 octree meshes}, 8138 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 8139 institution = {University of Pennsylvania}, 8140 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 8141 petsc_uses = {KSP} 8142} 8143 8144@Unpublished{ khatiwala07-software, 8145 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 8146 author = {Khatiwala, S.}, 8147 institution = {Columbia University}, 8148 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 8149 petsc_uses = {KSP} 8150} 8151 8152@InBook{ jiaolima99, 8153 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 8154 chapter = {{SIFFEA}:Scalable Integrated Framework for Finite Element Analysis}, 8155 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 8156 title = {Lecture Notes in Computer Science}, 8157 publisher = {Springer-Verlag}, 8158 volume = {1732}, 8159 year = {1999}, 8160 petsc_uses = {KSP} 8161} 8162 8163@Article{ crow1, 8164 author = {C. S. Crow IV}, 8165 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 8166 journal = {Hopkins Undergraduate Research Journal}, 8167 year = {2003}, 8168 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 8169 petsc_uses = {KSP} 8170} 8171 8172@Unpublished{ petsc-python, 8173 title = {PETSc for Python}, 8174 author = {L. Dalcin}, 8175 url = {https://petsc.org/main/petsc4py}, 8176 note = {Provides Python bindings for PETSc}, 8177} 8178 8179@Unpublished{ cfdship, 8180 title = {{CFDShip-Iowa}}, 8181 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 8182 institution = {University of Iowa}, 8183 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 8184 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 8185 structured grids, designed for ship applications}, 8186 petsc_uses = {KSP} 8187} 8188 8189@Unpublished{ bvw, 8190 title = {Multiflow}, 8191 author = {Berend van Wachem}, 8192 institution = {Mechanical Engineering - Chalmers University of Technology}, 8193 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 8194 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 8195 flows.}, 8196 petsc_uses = {KSP} 8197} 8198 8199@Unpublished{ dks2, 8200 title = {FENA - A Finite Element Model for the North Atlantic}, 8201 author = {Jens Schroeter}, 8202 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 8203 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 8204 petsc_uses = {KSP} 8205} 8206 8207@TechReport{ piwonski2010idea, 8208 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 8209 and Simulation in {3-D}}, 8210 author = {Piwonski, J. and Slawig, T.}, 8211 year = {2010}, 8212 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8213 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 8214 petsc_uses = {KSP} 8215} 8216 8217@Unpublished{ metos3d-web, 8218 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 8219 author = {Piwonski, J. and Slawig, T.}, 8220 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8221 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 8222 petsc_uses = {KSP} 8223} 8224 8225@Unpublished{ magpar, 8226 author = {W. Scholz}, 8227 title = {Magpar: Parallel Micromagnetics Code}, 8228 institution = {Vienna University of Technology}, 8229 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 8230 petsc_uses = {KSP} 8231} 8232 8233@Misc{ libmesh:sourceforge, 8234 author = {}, 8235 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 8236 equations on serial and parallel platforms}, 8237 note = {[Online]}, 8238 url = {http://libmesh.github.io}, 8239 petsc_uses = {KSP} 8240} 8241 8242@Misc{ moose-web-page, 8243 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 8244 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 8245 Gaston and John Peterson and Jason Miller}, 8246 institution = {Idaho National Laboratory}, 8247 howpublished = {\url{http://mooseframework.org}}, 8248 petsc_uses = {KSP} 8249} 8250 8251@Article{ gaston2009moose, 8252 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 8253 equations}, 8254 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 8255 journal = {Nuclear Engineering and Design}, 8256 volume = {239}, 8257 number = {10}, 8258 pages = {1768--1778}, 8259 year = {2009}, 8260 publisher = {Elsevier}, 8261 petsc_uses = {KSP} 8262} 8263 8264@Article{ tonks2012object, 8265 title = {An object-oriented finite element framework for multiphysics phase field 8266 simulations}, 8267 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 8268 journal = {Computational Materials Science}, 8269 volume = {51}, 8270 number = {1}, 8271 pages = {20--29}, 8272 year = {2012}, 8273 publisher = {Elsevier}, 8274 petsc_uses = {KSP} 8275} 8276 8277@Misc{ pylithmanual, 8278 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 8279 Strand and Charles Williams}, 8280 title = {{PyLith} User Manual Version 2.0.0}, 8281 year = {2014}, 8282 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 8283 petsc_uses = {KSP} 8284} 8285 8286@Misc{ pylith-web-page, 8287 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 8288 title = {{PyLith}}, 8289 year = {2012}, 8290 url = {http://geodynamics.org/resources/pylith/}, 8291 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 8292 petsc_uses = {KSP} 8293} 8294 8295@Misc{ galemanual, 8296 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 8297 title = {Gale User Manual Version 2.0.0}, 8298 year = {2011}, 8299 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 8300 petsc_uses = {KSP} 8301} 8302 8303@Unpublished{ underworld, 8304 author = {Louis Moresi}, 8305 title = {{UnderWorld}: A Geodynamics Modelling Code}, 8306 institution = {Monash University}, 8307 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 8308 petsc_uses = {KSP} 8309} 8310 8311@Article{ moresi2007computational, 8312 title = {Computational approaches to studying non-linear dynamics of the crust and 8313 mantle}, 8314 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 8315 M{\"u}hlhaus, H.B.}, 8316 journal = {Physics of the Earth and Planetary Interiors}, 8317 volume = {163}, 8318 number = {1-4}, 8319 pages = {69--82}, 8320 year = {2007}, 8321 publisher = {Elsevier}, 8322 petsc_uses = {KSP} 8323} 8324 8325@Article{ pitt2009chaste, 8326 title = {Chaste: a test-driven approach to software development for biological modelling}, 8327 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 8328 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 8329 and Walter, A. and others}, 8330 journal = {Computer Physics Communications}, 8331 volume = {180}, 8332 number = {12}, 8333 pages = {2452--2471}, 8334 year = {2009}, 8335 publisher = {Elsevier}, 8336 petsc_uses = {KSP} 8337} 8338 8339@Misc{ fenicsproject, 8340 title = {{The FEniCS project}}, 8341 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 8342 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 8343 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 8344 url = {http://fenicsproject.org}, 8345 year = {2011}, 8346 petsc_uses = {KSP} 8347} 8348 8349@Unpublished{ snark, 8350 title = {Snark: A suite of software for geoscientific applications and a philosophy of 8351 scientific software development}, 8352 institution = {Victorian Partnership for Advanced Computing}, 8353 url = {http://vpac.org/Snark}, 8354 petsc_uses = {KSP} 8355} 8356 8357@Misc{ imoose:sourceforge, 8358 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 8359 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 8360 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 8361 note = {[Online]}, 8362 url = {http://imoose.sourceforge.net}, 8363 petsc_uses = {KSP} 8364} 8365 8366@Unpublished{ fossi, 8367 author = {Stephan Frickenhaus}, 8368 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 8369 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 8370 codes}, 8371 institution = {AWI-Bremerhaven, Germanny}, 8372 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 8373 petsc_uses = {KSP} 8374} 8375 8376@Unpublished{ fun3dweb, 8377 author = {Dinesh Kaushik}, 8378 title = {PETSC-FUN3D Benchmark Page}, 8379 institution = {ODU/ANL}, 8380 url = {http://www.mcs.anl.gov/petsc-fun3d}, 8381 note = {CFD Benchmark of some solvers in PETSc}, 8382 petsc_uses = {KSP} 8383} 8384 8385@Unpublished{ scirun, 8386 author = {SCIRun Development Team}, 8387 title = {SCIRun}, 8388 institution = {University of Utah}, 8389 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 8390 note = {SCIRun now uses PETSc linear solvers}, 8391 petsc_uses = {KSP} 8392} 8393 8394@Misc{ prometheus, 8395 author = {Mark F. Adams}, 8396 title = {Prometheus - A scalable unstructured finite element solver}, 8397 institution = {Berkeley}, 8398 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 8399 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 8400 petsc_uses = {KSP} 8401} 8402 8403@Unpublished{ illuminator, 8404 author = {Adam C. Powell, IV}, 8405 title = {Illuminator Distributed Visualization Library}, 8406 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 8407 petsc_uses = {KSP} 8408} 8409 8410@Unpublished{ rheoplast, 8411 title = {RheoPlast Phase Field Multi-Physics Code}, 8412 author = {Adam Powell and David Dussault and Bo Zhou}, 8413 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 8414 petsc_uses = {KSP} 8415} 8416 8417@Misc{ tao-web-page, 8418 title = {{Toolkit for Advanced Optimization ({TAO})} {W}eb Page}, 8419 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8420 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 8421 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8422 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 8423 petsc_uses = {KSP} 8424} 8425 8426@TechReport{ tao-user-ref, 8427 title = {{Toolkit for Advanced Optimization ({TAO}) users manual}}, 8428 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8429 and Steve Benson and Lois Curfman McInnes}, 8430 institution = {Argonne National Laboratory}, 8431 year = {2019}, 8432 number = {ANL/MCS-TM-322 - Rev 3.12}, 8433 petsc_uses = {KSP} 8434} 8435 8436% url = "http://www.mcs.anl.gov/tao", 8437@Unpublished{ mefpp-web-page, 8438 title = {{MEF++} {W}eb {P}age}, 8439 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 8440 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 8441 author = {Eric Chamberland}, 8442 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 8443 multiphysics}, 8444 petsc_uses = {KSP} 8445} 8446 8447@Unpublished{ tipetsc-titanium, 8448 title = {Ti-PETSc - an interface to PETSc from Titanium}, 8449 institution = {Berkeley}, 8450 author = {He, Yun and Liblit, Bun and Lin, Chang}, 8451 url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, 8452 year = {1999}, 8453 petsc_uses = {KSP}, 8454} 8455 8456@Unpublished{ ptatin-web-page, 8457 title = {ptatin3d}, 8458 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 8459 url = {https://bitbucket.org/jedbrown/ptatin3d}, 8460 year = {2018}, 8461 petsc_uses = {KSP} 8462} 8463 8464@Misc{ multiphase-web-page, 8465 author = {Q. Zou}, 8466 title = {Multiphase flow with {PETSc}}, 8467 institution = {LANL}, 8468 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 8469 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 8470 lab = {LANL}, 8471 petsc_uses = {KSP} 8472} 8473 8474@Misc{ electromag-web-page, 8475 title = {{EMSolve Web} page}, 8476 institution = {LLNL}, 8477 howpublished = {http://www.llnl.gov/casc/emsolve}, 8478 url = {http://www.Llnl.gov/casc/emsolve}, 8479 author = {Daniel {White et al.}}, 8480 lab = {LLNL}, 8481 petsc_uses = {KSP} 8482} 8483 8484@Unpublished{ fe-software-web-page, 8485 institution = {Kuleuven}, 8486 title = {Finite element software}, 8487 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 8488 petsc_uses = {KSP} 8489} 8490 8491@Misc{ petsc-web-page, 8492 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8493 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 8494 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8495 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8496 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8497 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8498 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8499 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8500 Zhang}, 8501 title = {{PETS}c {W}eb page}, 8502 url = {https://petsc.org/}, 8503 howpublished = {\url{https://petsc.org/}}, 8504 year = {2024} 8505} 8506 8507@Unpublished{ petsc-debian-package, 8508 author = {Adam C. Powell, IV}, 8509 title = {Debian package for PETSc}, 8510 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 8511 petsc_uses = {KSP} 8512} 8513 8514@Unpublished{ cactus, 8515 title = {Cactus Website}, 8516 url = {http://www.cactuscode.org/}, 8517 note = {Provides two interface to the PETSc solvers}, 8518 petsc_uses = {KSP} 8519} 8520 8521@Unpublished{ petsc-fem, 8522 author = {Mario Storti and Norberto Nigro}, 8523 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 8524 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 8525 url = {http://www.cimec.org.ar/petscfem}, 8526 petsc_uses = {KSP} 8527} 8528 8529@Misc{ fidap, 8530 title = {FIDAP 8.5}, 8531 howpublished = {\url{http://www.fluent.com}}, 8532 url = {http://www.fluent.com}, 8533 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 8534 solves.}, 8535 key = {FIDAP 8.5}, 8536 petsc_uses = {KSP} 8537} 8538 8539@Unpublished{ slepc, 8540 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8541 Vicente Hern\'andez and Vicent Vidal}, 8542 title = {{SLEPc} Website}, 8543 url = {http://slepc.upv.es/}, 8544 note = {Scalable Library for Eigenvalue Problem Computations}, 8545 petsc_uses = {KSP} 8546} 8547 8548@TechReport{ slepc-users-manual, 8549 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8550 Vicente Hern\'andez and Vicent Vidal}, 8551 title = {{SLEPc} Users Manual}, 8552 number = {DISC-II/24/02}, 8553 url = {http://slepc.upv.es/}, 8554 note = {Scalable Library for Eigenvalue Problem Computations}, 8555 petsc_uses = {KSP} 8556} 8557 8558@Misc{ deal.ii, 8559 title = {deal.II}, 8560 howpublished = {\url{http://www.dealii.org}}, 8561 url = {http://www.dealii.org}, 8562 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 8563 It allows PETSc linear algebra and solvers to be used underneath.}, 8564 key = {deal.II 5.0}, 8565 petsc_uses = {KSP} 8566} 8567 8568@Article{ bangerth2007deal, 8569 title = {{deal.II---A general-purpose object-oriented finite element library}}, 8570 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 8571 journal = {ACM Transactions on Mathematical Software (TOMS)}, 8572 volume = {33}, 8573 number = {4}, 8574 pages = {24--es}, 8575 issn = {0098-3500}, 8576 year = {2007}, 8577 publisher = {ACM}, 8578 petsc_uses = {KSP} 8579} 8580 8581@Misc{ globalarrays, 8582 author = {Jarek {Nieplocha et al.}}, 8583 title = {Global Arrays}, 8584 institution = {Pacific Northwest National Laboratories}, 8585 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 8586 url = {http://www.emsl.pnl.gov/docs/global}, 8587 note = {Global arrays can use PETSc linear solvers}, 8588 lab = {PNNL}, 8589 petsc_uses = {KSP} 8590} 8591 8592% LiteralHTML: 8593% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 8594% LiteralHTML: 8595@Article{ petsccommunity2022, 8596 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 8597 Community}, 8598 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 8599 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 8600 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 8601 and Hong Zhang and Junchao Zhang}, 8602 journal = {Computing in Science and Engineering}, 8603 volume = {24}, 8604 number = {03}, 8605 pages = {6--15}, 8606 issn = {1558-366X}, 8607 doi = {10.1109/MCSE.2022.3169974}, 8608 publisher = {IEEE Computer Society}, 8609 address = {Los Alamitos, CA, USA}, 8610 month = may, 8611 year = {2022}, 8612 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 8613 petsc_uses = {KSP} 8614} 8615 8616@Article{ brownknepleysmith14, 8617 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 8618 title = {Run-time extensibility and librarization of simulation software}, 8619 journal = {IEEE Computing in Science and Engineering}, 8620 month = jan, 8621 volume = {17}, 8622 number = {1}, 8623 pages = {38--45}, 8624 doi = {10.1109/MCSE.2014.95}, 8625 year = {2015}, 8626 petsc_uses = {KSP} 8627} 8628 8629@TechReport{ ass2012, 8630 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 8631 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 8632 institution = {Argonne National Laboratory}, 8633 type = {Preprint}, 8634 year = {2012}, 8635 number = {ANL/MCS-P2011-0112}, 8636 petsc_uses = {KSP} 8637} 8638 8639@TechReport{ clearyknepley99, 8640 author = {Andrew Cleary and Matthew G. Knepley}, 8641 title = {Solvers as Operators}, 8642 institution = {Lawrence Livermore National Laboratory}, 8643 type = {Technical Report}, 8644 number = {UCRL-ID-135342}, 8645 year = {1999}, 8646 petsc_uses = {KSP} 8647} 8648 8649@TechReport{ smcabbkz2012, 8650 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 8651 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 8652 title = {{PETSc's} software strategy for the design space of composable extreme-scale 8653 solvers}, 8654 institution = {Argonne National Laboratory}, 8655 type = {Preprint}, 8656 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 8657 year = {2012}, 8658 number = {ANL/MCS-P2059-0312}, 8659 petsc_uses = {KSP} 8660} 8661 8662@InProceedings{ mhwpmhs2009, 8663 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 8664 and G. E. Hammond and B. Smith}, 8665 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 8666 Toolkit {MPI} at Scale}, 8667 booktitle = {Cray Users Group Conference}, 8668 year = {2009}, 8669 petsc_uses = {KSP} 8670} 8671 8672@InProceedings{ msmhls2010, 8673 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 8674 Lichtner and B. F. Smith}, 8675 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 8676 {BlueGene} Architectures}, 8677 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 8678 year = {2010}, 8679 petsc_uses = {KSP} 8680} 8681 8682@InCollection{ msk2013, 8683 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 8684 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 8685 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8686 series = {Lecture Notes in Earth System Sciences}, 8687 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8688 Yaolin Shi}, 8689 doi = {10.1007/978-3-642-16405-7_7}, 8690 publisher = {Springer Berlin Heidelberg}, 8691 pages = {131--140}, 8692 year = {2013}, 8693 isbn = {978-3-642-16404-0}, 8694 petsc_uses = {KSP} 8695} 8696 8697@InCollection{ knepleyyuen13, 8698 author = {Matthew G. Knepley and David A. Yuen}, 8699 title = {Why Scientists and Engineers need {GPU}s today}, 8700 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8701 series = {Lecture Notes in Earth System Sciences}, 8702 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8703 Yaolin Shi}, 8704 doi = {10.1007/978-3-642-16405-7_1}, 8705 publisher = {Springer Berlin Heidelberg}, 8706 pages = {131--140}, 8707 year = {2013}, 8708 isbn = {978-3-642-16404-0}, 8709 petsc_uses = {KSP} 8710} 8711 8712@InCollection{ karpeevknepleybrune13, 8713 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 8714 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 8715 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8716 series = {Lecture Notes in Earth System Sciences}, 8717 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8718 Yaolin Shi}, 8719 doi = {10.1007/978-3-642-16405-7_30}, 8720 publisher = {Springer Berlin Heidelberg}, 8721 pages = {487--501}, 8722 year = {2013}, 8723 isbn = {978-3-642-16404-0}, 8724 petsc_uses = {KSP} 8725} 8726 8727@InCollection{ zhengetal13, 8728 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 8729 Variable Viscosity}, 8730 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8731 Zhang and Yaolin Shi}, 8732 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8733 series = {Lecture Notes in Earth System Sciences}, 8734 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8735 Yaolin Shi}, 8736 doi = {10.1007/978-3-642-16405-7_21}, 8737 publisher = {Springer Berlin Heidelberg}, 8738 pages = {321--333}, 8739 year = {2013}, 8740 isbn = {978-3-642-16404-0}, 8741 petsc_uses = {KSP} 8742} 8743 8744@Article{ zhengetal13b, 8745 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 8746 strongly variable viscosity based on {M}atlab and {CUDA}}, 8747 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8748 Zhang and Yaolin Shi}, 8749 journal = {IJHPCA}, 8750 volume = {28}, 8751 number = {1}, 8752 pages = {50--60}, 8753 doi = {10.1177/1094342013478640}, 8754 year = {2013}, 8755 petsc_uses = {KSP} 8756} 8757 8758@InBook{ s2011, 8759 author = {B. Smith}, 8760 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 8761 title = {Encyclopedia of Parallel Computing}, 8762 bookeditor = {D. Padua}, 8763 publisher = {Springer}, 8764 year = {2011}, 8765 petsc_uses = {KSP} 8766} 8767 8768@Article{ acostamejia06, 8769 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 8770 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 8771 journal = {Lecturas Matem\'aticas}, 8772 volume = {27}, 8773 year = {2006}, 8774 pages = {213--224}, 8775 petsc_uses = {KSP} 8776} 8777 8778@InProceedings{ quenettemoresisunterappelbe07, 8779 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 8780 title = {Explaining StGermain: An aspect oriented environment for building extensible 8781 computational mechanics modeling software}, 8782 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 8783 publisher = {IEEE}, 8784 pages = {1--8}, 8785 yerar = {2007}, 8786 petsc_uses = {KSP} 8787} 8788 8789@Article{ dfm1, 8790 title = {Vectorized sparse matrix multiply for compressed row storage format}, 8791 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 8792 journal = {Lecture Notes in Computer Science}, 8793 year = {2005}, 8794 pages = {99--106}, 8795 volume = {3514}, 8796 lab = {ORNL}, 8797 petsc_uses = {KSP} 8798} 8799 8800@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 8801 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 8802 Vandewalle and Stefaan Poedts}, 8803 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 8804 Scientific Computing Software}, 8805 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 8806 year = {2005}, 8807 note = {Lecture Notes in Computer Science}, 8808 volume = {3514}, 8809 publisher = {Springer-Verlag GmbH}, 8810 petsc_uses = {KSP} 8811} 8812 8813@InProceedings{ dalcin-paz-storti, 8814 author = {L. Dalcin and R. Paz and M. Storti}, 8815 title = {Desarrollo de Aplicaciones Paralelas en Python}, 8816 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 8817 Bariloche, Argentina}, 8818 year = {2004}, 8819 petsc_uses = {KSP} 8820} 8821 8822@Article{ mpi-python, 8823 author = {L. Dalcin and R. Paz and M. Storti}, 8824 title = {MPI for Python}, 8825 journal = {Journal of Parallel and Distributed Computing}, 8826 year = {2005}, 8827 petsc_uses = {KSP} 8828} 8829 8830@Unpublished{ hrv02a, 8831 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 8832 author = {V. Hernandex and J. E. Roman and V. Vidal}, 8833 note = {Submited to VecPar 2002}, 8834 year = {2002}, 8835 petsc_uses = {KSP} 8836} 8837 8838@Article{ knyazev2007block, 8839 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 8840 {PETSc}}, 8841 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 8842 journal = {SIAM Journal on Scientific Computing}, 8843 volume = {29}, 8844 pages = {2224-2239}, 8845 doi = {10.1137/060661624}, 8846 year = {2007}, 8847 petsc_uses = {KSP} 8848} 8849 8850@MastersThesis{ aarrestad-master, 8851 author = {Asbjorn Hoiland Aarrestad}, 8852 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 8853 school = {University of Bergen}, 8854 month = aug, 8855 year = {2003}, 8856 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 8857 note = {Implemented Runge-Kutta methods using PETSc}, 8858 petsc_uses = {KSP} 8859} 8860 8861@PhDThesis{ kaushik-phd, 8862 author = {D. K. Kaushik}, 8863 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 8864 Differential Equations on Unstructured Grids}, 8865 school = {Old Dominion University}, 8866 month = dec, 8867 year = {2002}, 8868 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 8869 petsc_uses = {KSP} 8870} 8871 8872@TechReport{ rb1, 8873 author = {Rickard Bergstrom}, 8874 title = {Object Oriented Implementation of a General Finite Element Code}, 8875 number = {2002-13}, 8876 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 8877 year = {2002}, 8878 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 8879 note = {Discribes a finite element software package that uses PETSc for its solvers}, 8880 petsc_uses = {KSP} 8881} 8882 8883@InProceedings{ dbl1, 8884 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 8885 title = {A Parallel General Purpose Finite Element System}, 8886 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 8887 publisher = {SIAM}, 8888 year = {1999}, 8889 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 8890 note = {Describes software that uses PETSc for its parallel linear solves}, 8891 petsc_uses = {KSP} 8892} 8893 8894@Article{ p1, 8895 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 8896 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 8897 and B. Smith}, 8898 journal = {Parallel Computing}, 8899 year = {2002}, 8900 pages = {1811--1831}, 8901 volume = {28 (12)}, 8902 petsc_uses = {KSP} 8903} 8904 8905@Article{ automatic-ad, 8906 author = {Paul Hovland and Boyana Norris and Barry Smith}, 8907 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 8908 year = {2005}, 8909 journal = {Future Generation Computer Systems}, 8910 volume = {21}, 8911 number = {8}, 8912 pages = {1426--1438}, 8913 petsc_uses = {KSP} 8914} 8915 8916@TechReport{ remote-math, 8917 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 8918 Smith}, 8919 title = {Remote Access to Mathematical Software}, 8920 number = {ANL/MCS-P889-0601}, 8921 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8922 month = jun, 8923 year = {2001}, 8924 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 8925 petsc_uses = {KSP} 8926} 8927 8928@InProceedings{ gropp98, 8929 author = {William D. Gropp}, 8930 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 8931 publisher = {SIAM}, 8932 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8933 Scientific and Engineering Computing}, 8934 year = {1999}, 8935 pages = {21-29}, 8936 petsc_uses = {KSP} 8937} 8938 8939@InProceedings{ knepleysarin99, 8940 author = {Matthew Knepley and Vivek Sarin}, 8941 title = {Algorithm Development for Large Scale Computing}, 8942 publisher = {SIAM}, 8943 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8944 Scientific and Engineering Computing}, 8945 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 8946 year = {1999}, 8947 petsc_uses = {KSP} 8948} 8949 8950@InBook{ bgms00, 8951 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8952 chapter = {Software for the Scalable Solution of {PDEs}}, 8953 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 8954 title = {CRPC Handbook of Parallel Computing}, 8955 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 8956 and A. White}, 8957 publisher = {Morgan Kaufmann Publishers}, 8958 year = {2002}, 8959 petsc_uses = {KSP} 8960} 8961 8962@InProceedings{ hovland_norris_smith98, 8963 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 8964 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 8965 Computations}, 8966 publisher = {SIAM}, 8967 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8968 Scientific and Engineering Computing}, 8969 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 8970 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 8971 year = {1999}, 8972 pages = {129-137}, 8973 petsc_uses = {KSP} 8974} 8975 8976@InProceedings{ efficient, 8977 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8978 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 8979 Libraries}, 8980 booktitle = {Modern Software Tools in Scientific Computing}, 8981 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 8982 publisher = {Birkhauser Press}, 8983 pages = {163--202}, 8984 year = {1997}, 8985 petsc_uses = {KSP} 8986} 8987 8988% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 8989@TechReport{ petsc-user-ref, 8990 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8991 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 8992 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8993 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8994 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8995 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8996 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8997 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8998 Zhang}, 8999 title = {{PETSc/TAO} Users Manual}, 9000 institution = {Argonne National Laboratory}, 9001 number = {ANL-21/39 - Revision 3.21}, 9002 doi = {10.2172/2205494}, 9003 year = {2024} 9004} 9005 9006% url = {https://petsc.org/release} 9007@TechReport{ petsc-developers, 9008 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 9009 title = {{PETS}c Developers Guide}, 9010 institution = {Argonne National Laboratory}, 9011 number = {ANL-18/18}, 9012 year = {2018}, 9013 url = {https://petsc.org/release/developers}, 9014 petsc_uses = {KSP} 9015} 9016 9017@Unpublished{ alice-memory-snooper, 9018 author = {Ibrahima Ba and Barry~F. Smith}, 9019 title = {The {ALICE} Memory Snooper}, 9020 year = {1999}, 9021 petsc_uses = {KSP} 9022} 9023 9024@TechReport{ petsc-user-ref-polish, 9025 author = {Marcin Bojko and Piotr Krzyzanowski}, 9026 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 9027 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 9028 year = {1998}, 9029 note = {An introduction to PETSc in Polish}, 9030 petsc_uses = {KSP} 9031} 9032 9033@InProceedings{ abghmn00, 9034 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 9035 High-Performance Scientific Computing}, 9036 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 9037 Norris}, 9038 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 9039 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 9040 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 9041 Hasco\"{e}t and Uwe Naumann}, 9042 publisher = {Springer}, 9043 year = {2002}, 9044 petsc_uses = {KSP} 9045} 9046 9047@Unpublished{ petsc-mpi-paper, 9048 author = {Lois Curfman McInnes and Barry F. Smith}, 9049 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 9050 Libraries}, 9051 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 9052 month = jun, 9053 year = {1995}, 9054 petsc_uses = {KSP} 9055} 9056 9057@InProceedings{ miss-paper, 9058 author = {William D. Gropp and Barry F. Smith}, 9059 title = {Scalable, Extensible, and Portable Numerical Libraries}, 9060 publisher = {IEEE}, 9061 year = {1994}, 9062 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9063 address = {Mississippi State University}, 9064 pages = {87--93}, 9065 keyword = {numerical libraries, scientific computing, parallel computing}, 9066 petsc_uses = {KSP} 9067} 9068 9069@InProceedings{ snes-paper, 9070 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9071 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 9072 Minimization Problems}, 9073 publisher = {IEEE}, 9074 year = {1995}, 9075 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9076 address = {Mississippi State University}, 9077 pages = {60-67}, 9078 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 9079 petsc_uses = {KSP} 9080} 9081 9082@Article{ dsneutral, 9083 author = {Barry F. Smith and William D. Gropp}, 9084 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 9085 Sparse Linear Systems}, 9086 journal = {Scientific Programming}, 9087 volume = {5}, 9088 pages = {329--336}, 9089 key = {GroppSmith96 ! KSP design}, 9090 year = {1996}, 9091 petsc_uses = {KSP} 9092} 9093 9094@InProceedings{ bgms98, 9095 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9096 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 9097 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 9098 Scientific and Engineering Computing}, 9099 publisher = {SIAM}, 9100 pages = {58-67}, 9101 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 9102 year = {1998}, 9103 petsc_uses = {KSP} 9104} 9105 9106@Article{ hkm98, 9107 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 9108 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 9109 {PDE} Computation}, 9110 journal = {Advances in Engineering Software}, 9111 volume = {29}, 9112 pages = {415-424}, 9113 year = {1998}, 9114 petsc_uses = {KSP} 9115} 9116 9117@TechReport{ pdpta99, 9118 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 9119 Smith}, 9120 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 9121 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 9122 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 9123 Vegas, Nevada}, 9124 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9125 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 9126 number = {ANL/MCS-P751-0599}, 9127 year = {1999}, 9128 petsc_uses = {KSP} 9129} 9130 9131@InProceedings{ bbh:com, 9132 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 9133 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 9134 Computing}}, 9135 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 9136 Euro-Par Conference, Munich, Germany, August/September 2000}, 9137 year = {2000}, 9138 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 9139 volume = {1900}, 9140 series = {Lecture Notes in Computer Science}, 9141 pages = {86--94}, 9142 address = {Berlin}, 9143 publisher = {Springer}, 9144 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 9145 petsc_uses = {KSP} 9146} 9147 9148@InProceedings{ overture00, 9149 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 9150 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 9151 Components}, 9152 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 9153 booktitle = {Proceedings of the International Federation for Information Processing Working 9154 Conference on Software Architectures for Scientific Computing, Kluwer}, 9155 year = {2000}, 9156 pages = {57--68}, 9157 petsc_uses = {KSP} 9158} 9159 9160@TechReport{ smith97, 9161 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 9162 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 9163 number = {ANL/MCS-P701}, 9164 author = {Barry F. Smith}, 9165 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9166 petsc_uses = {KSP} 9167} 9168 9169@Article{ smith98, 9170 author = {Barry Smith}, 9171 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 9172 journal = {SIGNUM Newsletter}, 9173 year = {1998}, 9174 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 9175 petsc_uses = {KSP} 9176} 9177 9178@TechReport{ ad-petsc-tm, 9179 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 9180 {PETSc}}, 9181 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 9182 year = {1997}, 9183 type = {Technical Memorandum}, 9184 institution = {ANL}, 9185 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 9186 number = {ANL/MCS-TM-233}, 9187 petsc_uses = {KSP} 9188} 9189 9190% LiteralHTML: 9191% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 9192% LiteralHTML: 9193@PhDThesis{ klotzthesis2019, 9194 author = {Thomas S. Klotz}, 9195 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 9196 Biology}, 9197 school = {Rice University}, 9198 year = {2019}, 9199 petsc_uses = {KSP} 9200} 9201 9202@Article{ klotzbardhanknepley2018, 9203 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 9204 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 9205 journal = {arXiv e-prints}, 9206 eprint = {1708.06028}, 9207 archiveprefix = {arXiv}, 9208 primaryclass = {math.na}, 9209 year = {2018}, 9210 note = {\url{http://arxiv.org/abs/1708.06028}}, 9211 petsc_uses = {KSP} 9212} 9213 9214@Misc{ brown2016, 9215 title = {Threading Tradeoffs in Domain Decomposition}, 9216 author = {Jed Brown}, 9217 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 9218 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 9219 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 9220 year = {2016}, 9221 petsc_uses = {KSP} 9222} 9223 9224@Article{ changnakshatralaknepleyjohnsson2017, 9225 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 9226 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 9227 Johnsson}, 9228 journal = {Concurency: Practice and Experience}, 9229 volume = {30}, 9230 number = {11}, 9231 eprint = {1705.03625}, 9232 doi = {10.1002/cpe.4401}, 9233 year = {2017}, 9234 petsc_uses = {KSP} 9235} 9236 9237@Article{ changfabienknepleymills2018, 9238 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 9239 spectrum analysis}, 9240 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 9241 journal = {SIAM Journal on Scientific Computing}, 9242 volume = {40}, 9243 number = {6}, 9244 pages = {C779--C802}, 9245 eprint = {1802.07832}, 9246 doi = {10.1137/18M1172260}, 9247 year = {2018}, 9248 petsc_uses = {KSP} 9249} 9250 9251@Article{ joshaghanichangnakshatralaknepley2019, 9252 title = {Composable solvers for the four-field double porosity/permeability model}, 9253 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 9254 Knepley}, 9255 journal = {Journal of Computational Physics}, 9256 volume = {386}, 9257 pages = {428--466}, 9258 doi = {10.1016/j.jcp.2019.02.020}, 9259 year = {2019}, 9260 petsc_uses = {KSP} 9261} 9262 9263@InProceedings{ barralknepleylangepiggottgorman2016, 9264 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 9265 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 9266 and Gerard J. Gorman}, 9267 booktitle = {25th International Meshing Roundtable}, 9268 editor = {Steve Owen and Hang Si}, 9269 month = sep, 9270 address = {Washington, DC}, 9271 pages = {1--5}, 9272 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 9273 year = {2016}, 9274 petsc_uses = {KSP} 9275} 9276 9277@Article{ adamsbrownknepleysamtaney2016, 9278 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 9279 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 9280 journal = {SIAM Journal on Scientific Computing}, 9281 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 9282 epub = {http://arxiv.org/abs/1406.7808}, 9283 volume = {8}, 9284 number = {4}, 9285 pages = {C426--C440}, 9286 doi = {10.1137/140975127}, 9287 year = {2016}, 9288 petsc_uses = {KSP} 9289} 9290 9291@InProceedings{ maysananruppknepleysmith2016, 9292 title = {Extreme-Scale Multigrid Components within {PETSc}}, 9293 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 9294 Smith}, 9295 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 9296 series = {PASC '16}, 9297 isbn = {978-1-4503-4126-4}, 9298 location = {Lausanne, Switzerland}, 9299 pages = {5:1--5:12}, 9300 articleno = {5}, 9301 numpages = {12}, 9302 doi = {10.1145/2929908.2929913}, 9303 acmid = {2929913}, 9304 publisher = {ACM}, 9305 address = {New York, NY, USA}, 9306 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 9307 preconditioning}, 9308 year = {2016}, 9309 petsc_uses = {KSP} 9310} 9311 9312@Article{ liu2015field, 9313 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 9314 author = {Lulu Liu and David E Keyes}, 9315 journal = {SIAM Journal on Scientific Computing}, 9316 volume = {37}, 9317 number = {3}, 9318 pages = {A1388--A1409}, 9319 year = {2015}, 9320 publisher = {SIAM}, 9321 petsc_uses = {KSP} 9322} 9323 9324@Article{ lujiaomissirlis2014, 9325 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 9326 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 9327 journal = {Numerical Linear Algebra with Applications}, 9328 volume = {21}, 9329 number = {2}, 9330 pages = {221--238}, 9331 year = {2014}, 9332 publisher = {Wiley Online Library}, 9333 petsc_uses = {KSP} 9334} 9335 9336@Article{ badiamartinprincipe2013, 9337 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 9338 solid mechanics}, 9339 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 9340 journal = {International Journal for Numerical Methods in Engineering}, 9341 volume = {96}, 9342 number = {4}, 9343 pages = {203--230}, 9344 year = {2013}, 9345 petsc_uses = {KSP} 9346} 9347 9348@Article{ morganknepleysananscott2016, 9349 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 9350 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 9351 journal = {Concurrency and Computation: Practice and Experience}, 9352 volume = {28}, 9353 pages = {4532--4542}, 9354 year = {2016}, 9355 url = {http://arxiv.org/abs/1602.04873}, 9356 doi = {10.1002/cpe.3820}, 9357 petsc_uses = {KSP} 9358} 9359 9360@Article{ morgansananknepleymills2020, 9361 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 9362 solvers}, 9363 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 9364 journal = {The International Journal of High Performance Computing Applications}, 9365 volume = {35}, 9366 issue = {1}, 9367 doi = {10.1177/1094342020966835}, 9368 url = {https://doi.org/10.1177/1094342020966835}, 9369 eprint = {https://doi.org/10.1177/1094342020966835}, 9370 year = {2020}, 9371 petsc_uses = {KSP} 9372} 9373 9374@Article{ msz2013, 9375 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 9376 author = {M. McCourt and B. F. Smith and H. Zhang}, 9377 journal = {SIAM Journal on Matrix Analysis and Applications}, 9378 year = {2015}, 9379 note = {To appear}, 9380 petsc_uses = {KSP} 9381} 9382 9383@Article{ bassi2014agglomeration, 9384 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 9385 free}, 9386 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 9387 journal = {Mathematical Models and Methods in Applied Sciences}, 9388 volume = {24}, 9389 number = {08}, 9390 pages = {1495--1539}, 9391 year = {2014}, 9392 publisher = {World Scientific}, 9393 petsc_uses = {KSP} 9394} 9395 9396@Article{ jhuranidemkowicz12, 9397 author = {{Jhurani}, C. and {Demkowicz}, L.}, 9398 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 9399 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 9400 journal = {Computer Methods in Applied Mechanics and Engineering}, 9401 volume = {213}, 9402 pages = {418-426}, 9403 year = {2012}, 9404 month = mar, 9405 doi = {10.1016/j.cma.2011.06.003}, 9406 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 9407 petsc_uses = {KSP} 9408} 9409 9410@Article{ yangcai11, 9411 author = {Yang, Haijian and Cai, Xiao-Chuan}, 9412 title = {Parallel Two-Grid Semismooth {N}ewton--{K}rylov--{S}chwarz Method for Nonlinear 9413 Complementarity Problems}, 9414 journal = {J. Sci. Comput.}, 9415 issue_date = {May 2011}, 9416 volume = {47}, 9417 number = {2}, 9418 month = may, 9419 pages = {258--280}, 9420 year = {2011}, 9421 issn = {0885-7474}, 9422 numpages = {23}, 9423 doi = {10.1007/s10915-010-9436-4}, 9424 acmid = {1971246}, 9425 publisher = {Plenum Press}, 9426 address = {New York, NY, USA}, 9427 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 9428 preconditioners, Semismooth Newton, Two-level methods}, 9429 petsc_uses = {KSP} 9430} 9431 9432@Article{ rheinbach09, 9433 author = {Rheinbach, Oliver}, 9434 title = {Parallel Iterative Substructuring in Structural Mechanics}, 9435 journal = {Archives of Computational Methods in Engineering}, 9436 volume = {16}, 9437 number = {4}, 9438 pages = {425-463}, 9439 year = {2009}, 9440 issn = {1134-3060}, 9441 doi = {10.1007/s11831-009-9035-4}, 9442 publisher = {Springer Netherlands}, 9443 language = {English}, 9444 petsc_uses = {KSP} 9445} 9446 9447@Article{ knepleyterrel2013, 9448 author = {Matthew G. Knepley and Andy R. Terrel}, 9449 title = {Finite Element Integration on {GPUs}}, 9450 journal = {{ACM} Transactions on Mathematical Software}, 9451 volume = {39}, 9452 number = {2}, 9453 accepted = {17 April 2012}, 9454 year = {2013}, 9455 abstract = {We present a novel finite element integration method for low order elements on 9456 GPUs. We achieve more than 100GF for element integration on first order 9457 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 9458 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 9459 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 9460 url = {http://arxiv.org/abs/1103.0066}, 9461 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 9462 petsc_uses = {KSP} 9463} 9464 9465@Article{ knepleyruppterrel2016, 9466 title = {Finite Element Integration with Quadrature on the GPU}, 9467 journal = {ArXiv e-prints}, 9468 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 9469 version = {1}, 9470 date = {2016-07-14}, 9471 eprinttype = {arxiv}, 9472 eprintclass = {cs.MS}, 9473 eprint = {1607.04245v1}, 9474 petsc_uses = {KSP} 9475} 9476 9477@Article{ klawonnlanserrheinbach2014, 9478 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 9479 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 9480 journal = {SIAM Journal on Scientific Computing}, 9481 volume = {36}, 9482 number = {2}, 9483 pages = {A737--A765}, 9484 year = {2014}, 9485 petsc_uses = {KSP} 9486} 9487 9488@Article{ bruneknepleysmithtu15, 9489 title = {Composing Scalable Nonlinear Algebraic Solvers}, 9490 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 9491 journal = {SIAM Review}, 9492 volume = {57}, 9493 number = {4}, 9494 pages = {535--565}, 9495 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 9496 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 9497 doi = {10.1137/130936725}, 9498 year = {2015}, 9499 petsc_uses = {KSP} 9500} 9501 9502@Article{ mszm2014, 9503 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 9504 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9505 volume = {40}, 9506 pages = {17--31}, 9507 year = {2014}, 9508 journal = {Parallel Computing}, 9509 doi = {10.1016/j.parco.2013.10.001}, 9510 petsc_uses = {KSP} 9511} 9512 9513@TechReport{ mszm2012, 9514 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 9515 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9516 year = {2012}, 9517 number = {ANL/MCS-P2097-0512}, 9518 institution = {Argonne National Laboratory}, 9519 petsc_uses = {KSP} 9520} 9521 9522@InProceedings{ bkmms2012, 9523 author = {Jed Brown and Matthew G. Knepley and David A. May and Lois C. McInnes and Barry 9524 F. Smith}, 9525 title = {Composable linear solvers for multiphysics}, 9526 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 9527 Computing} ({ISPDC} 2012)}, 9528 year = {2012}, 9529 doi = {10.1109/ISPDC.2012.16}, 9530 publisher = {IEEE Computer Society}, 9531 pages = {55--62}, 9532 petsc_uses = {KSP} 9533} 9534 9535@Article{ bourdinbucuroudet2009, 9536 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 9537 title = {Optimal Partitions for Eigenvalues}, 9538 journal = {SIAM J. Sci. Comput.}, 9539 volume = {31}, 9540 number = {6}, 9541 pages = {4100--4114}, 9542 year = {2009}, 9543 petsc_uses = {KSP} 9544} 9545 9546@InBook{ kimnbourdin2007, 9547 author = {J.-H. Kimn and Blaise Bourdin}, 9548 title = {Numerical implementation of overlapping balancing domain decomposition methods on 9549 unstructured meshes}, 9550 editor = {O. B. Widlund and D. E. Keyes}, 9551 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 9552 series = {Lecture Notes in Computational Science and Engineering}, 9553 number = {55}, 9554 publisher = {Springer-Verlag}, 9555 pages = {309--315}, 9556 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 9557 year = {2007}, 9558 petsc_uses = {KSP} 9559} 9560 9561@Article{ bjm2005, 9562 author = {AH Baker and ER Jessup and T Manteuffel}, 9563 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 9564 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 9565 year = {2005}, 9566 petsc_uses = {KSP} 9567} 9568 9569@Unpublished{ sundar-2008a, 9570 author = {R.S. Sampath and G. Biros}, 9571 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 9572 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9573 petsc_uses = {KSP} 9574} 9575 9576@Article{ sundar-2008, 9577 author = {H. Sundar and R.S. Sampath and G. Biros}, 9578 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 9579 journal = {SIAM Journal on Scientific Computing}, 9580 year = {2008}, 9581 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9582 petsc_uses = {KSP} 9583} 9584 9585@InProceedings{ sundar-2007, 9586 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 9587 title = {Low-constant parallel algorithms for finite element simulations using linear 9588 octrees}, 9589 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 9590 year = {2007}, 9591 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9592 petsc_uses = {KSP} 9593} 9594 9595@InProceedings{ adams-98a, 9596 author = {Adams, Mark ~F.}, 9597 title = {A Parallel Maximal Independent Set Algorithm}, 9598 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 9599 year = {1998}, 9600 petsc_uses = {KSP} 9601} 9602 9603@Article{ akcelik2005ddd, 9604 title = {{Dynamic data-driven inversion for terascale simulations: real-time 9605 identification of airborne contaminants}}, 9606 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 9607 van Bloemen Waanders, B.}, 9608 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 9609 year = {2005}, 9610 publisher = {IEEE Computer Society Washington, DC, USA}, 9611 petsc_uses = {KSP} 9612} 9613 9614@InBook{ akcelik-2006, 9615 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 9616 Bloemen Waanders}, 9617 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 9618 title = {Frontiers of Parallel Computing}, 9619 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 9620 publisher = {SIAM}, 9621 year = {2006}, 9622 petsc_uses = {KSP} 9623} 9624 9625@Article{ dt, 9626 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 9627 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 9628 Convection Diffusion Equations}, 9629 journal = {The Journal of Supercomputing}, 9630 year = {2004}, 9631 pages = {235--253}, 9632 volume = {28}, 9633 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 9634 petsc_uses = {KSP} 9635} 9636 9637@PhDThesis{ hwang2004, 9638 author = {Feng-Nan Hwang}, 9639 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 9640 Computational Fluid Dynamics}, 9641 school = {University of Colorado at Boulder}, 9642 year = {2004}, 9643 petsc_uses = {KSP} 9644} 9645 9646@PhDThesis{ baker, 9647 author = {{A. H.} Baker}, 9648 title = {On improving the performance of the linear solver restarted {GMRES}}, 9649 school = {University of Colorado at Boulder}, 9650 year = {2003}, 9651 petsc_uses = {KSP} 9652} 9653 9654@TechReport{ klawonnrheinbach601, 9655 author = {Axel Klawonn and Oliver Rheinbach}, 9656 title = {A Parallel Implementation of Dual-Primal {FETI-DP} Methods for Three Dimensional 9657 Linear Elasticity Using a Transformation of Basis}, 9658 institution = {Universit\"at Duisburg-Essen}, 9659 year = {2005}, 9660 type = {Technical Report}, 9661 number = {SM-E-601}, 9662 petsc_uses = {KSP} 9663} 9664 9665@TechReport{ klawonnrheinbach609, 9666 author = {Axel Klawonn and Oliver Rheinbach}, 9667 title = {Inexact FETI-DP Methods}, 9668 institution = {Universit\"at Duisburg-Essen}, 9669 year = {2005}, 9670 type = {Technical Report}, 9671 number = {SM-E-609}, 9672 petsc_uses = {KSP} 9673} 9674 9675@TechReport{ klawonnrheinbach607, 9676 author = {Axel Klawonn and Oliver Rheinbach}, 9677 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 9678 institution = {Universit\"at Duisburg-Essen}, 9679 year = {2005}, 9680 type = {Technical Report}, 9681 number = {SM-E-607}, 9682 petsc_uses = {KSP} 9683} 9684 9685@Article{ kul-natraj-pbp, 9686 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 9687 title = {Performance of a parallel mixed finite element implementation for fourth order 9688 clamped anisotropic plate bending problems in distributed memory environments}, 9689 journal = {Applied Mathematics and Computation}, 9690 volume = {155}, 9691 year = {2004}, 9692 number = {3}, 9693 pages = {753--777}, 9694 petsc_uses = {KSP} 9695} 9696 9697@Article{ bramkamp2006uej, 9698 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 9699 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 9700 journal = {Computers \& Fluids}, 9701 volume = {35}, 9702 number = {10}, 9703 pages = {1063--1073}, 9704 doi = {10.1016/j.compfluid.2005.10.003}, 9705 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 9706 derivation of the analytic flux Jacobian can become quite complicated depending on 9707 the complexity of the numerical flux calculation. Practically, the derivation of 9708 the exact Jacobian by hand is an unrealistic option because of the enormous 9709 man-hour investment needed. In this work, automatic differentiation is used to 9710 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 9711 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 9712 approximated by first-order forward differences. For a two-dimensional airfoil 9713 under three different flight conditions (quasi-incompressible flow, compressible 9714 subsonic flow, and transonic flow), we show that the robustness and performance of 9715 the present finite volume scheme is significantly improved by using exact 9716 Jacobians.}, 9717 year = {2006}, 9718 petsc_uses = {KSP} 9719} 9720 9721@Article{ shahbazi1, 9722 author = {Khosro Shahbazi}, 9723 title = {An explicit expression for the penalty parameter of the interior penalty method}, 9724 journal = {Journal of Computational Physics}, 9725 volume = {205}, 9726 year = {2005}, 9727 pages = {401--407}, 9728 petsc_uses = {KSP} 9729} 9730 9731@TechReport{ kk, 9732 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 9733 author = {Hans-Peter Kersken and Uwe Kuster}, 9734 year = {1999}, 9735 institution = {University of Stuttgart}, 9736 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 9737 number = {310}, 9738 petsc_uses = {KSP} 9739} 9740 9741@Article{ miha-mija, 9742 author = {M. D. Mihajlovi and S. Mijalkovi}, 9743 title = {A component decomposition preconditioning for 3D stress analysis problems}, 9744 journal = {Numerical Linear Algebra with Applications}, 9745 volume = {9}, 9746 year = {2002}, 9747 pages = {567--583}, 9748 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 9749 petsc_uses = {KSP} 9750} 9751 9752@Article{ bjm, 9753 author = {M Benzi and W Joubert and G Mateescu}, 9754 journal = {Electronic Transactions on Numerical Analysis}, 9755 year = {1999}, 9756 volume = {8}, 9757 pages = {88--114}, 9758 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 9759 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 9760 petsc_uses = {KSP} 9761} 9762 9763@PhDThesis{ hyde, 9764 author = {EMK Hyde}, 9765 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 9766 school = {Caltech}, 9767 year = {2003}, 9768 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 9769 petsc_uses = {KSP} 9770} 9771 9772@Article{ km2003, 9773 author = {A. Keese and H. G. Matthies}, 9774 journal = {Proceedings in Applied Mathematics and Mechanics}, 9775 year = {2003}, 9776 volume = {2}, 9777 pages = {485--486}, 9778 title = {Parallel Solution of Stochastic PDEs}, 9779 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 9780 petsc_uses = {KSP} 9781} 9782 9783@Article{ whszss, 9784 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 9785 and Otmar Scherzer and H. Siegfried Stiehl}, 9786 journal = {Real Time Imaging}, 9787 year = {2001}, 9788 volume = {7}, 9789 pages = {31--45}, 9790 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 9791 approaches}, 9792 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 9793 petsc_uses = {KSP} 9794} 9795 9796@TechReport{ baker1, 9797 title = {An Efficient Block Variant of GMRES}, 9798 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 9799 year = {2003}, 9800 type = {Technical Report}, 9801 institution = {University of Colorado, Boulder}, 9802 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 9803 number = {CU-CS-957-03}, 9804 petsc_uses = {KSP} 9805} 9806 9807@InProceedings{ mc2003, 9808 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 9809 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 9810 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9811 Methods}, 9812 pages = {639--646}, 9813 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9814 note = {}, 9815 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9816 year = {2003}, 9817 petsc_uses = {KSP} 9818} 9819 9820@InProceedings{ kt2003, 9821 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 9822 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 9823 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9824 Methods}, 9825 pages = {615--622}, 9826 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9827 note = {}, 9828 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9829 year = {2003}, 9830 petsc_uses = {KSP} 9831} 9832 9833@InProceedings{ krw2003, 9834 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 9835 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 9836 3D}, 9837 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9838 Methods}, 9839 pages = {361--368}, 9840 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9841 note = {}, 9842 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9843 year = {2003}, 9844 petsc_uses = {KSP} 9845} 9846 9847@InProceedings{ hc2003, 9848 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 9849 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 9850 Nonlinear Preconditioning}, 9851 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9852 Methods}, 9853 pages = {201--208}, 9854 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9855 note = {}, 9856 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9857 year = {2003}, 9858 petsc_uses = {KSP} 9859} 9860 9861@InProceedings{ g2003, 9862 author = {P. Goldfeld}, 9863 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 9864 (Generalized) {Stokes} and Parallel Implementation}, 9865 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9866 Methods}, 9867 pages = {209--216}, 9868 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9869 publisher = {National Autonomous University of Mexico (UNAM)}, 9870 note = {}, 9871 url = {http://www.ddm.org/DD14}, 9872 year = {2003}, 9873 petsc_uses = {KSP} 9874} 9875 9876@InProceedings{ dhv2003, 9877 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 9878 title = {Toward scalable {FETI} algorithm for variational inequalities with applications to 9879 composites}, 9880 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9881 Methods}, 9882 pages = {395--401}, 9883 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9884 publisher = {National Autonomous University of Mexico (UNAM)}, 9885 note = {}, 9886 url = {http://www.ddm.org/DD14}, 9887 year = {2003}, 9888 petsc_uses = {KSP} 9889} 9890 9891@InProceedings{ dhsv2002, 9892 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9893 title = {Scalabilities of {FETI} for variational inequalities and contact shape 9894 optimization}, 9895 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9896 Methods}, 9897 pages = {359--367}, 9898 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9899 publisher = {CIMNE, Barcelona, Spain}, 9900 note = {}, 9901 url = {http://www.ddm.org/DD13}, 9902 year = {2002}, 9903 petsc_uses = {KSP} 9904} 9905 9906@InProceedings{ cky2002, 9907 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 9908 title = {A Nonlinear Additive {S}chwarz Preconditioned Inexact {N}ewton Method for Shocked 9909 Duct Flows}, 9910 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9911 Methods}, 9912 pages = {343--350}, 9913 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9914 publisher = {CIMNE, Barcelona, Spain}, 9915 note = {}, 9916 url = {http://www.ddm.org/DD13}, 9917 year = {2002}, 9918 petsc_uses = {KSP} 9919} 9920 9921@Conference{ li-etal:03, 9922 author = {Li, Z. and Lanteri S. and Saad, Y.}, 9923 title = {Multiplicative-additive preconditioning combination for general sparse linear 9924 systems}, 9925 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 9926 Matrix Problems in Scientific and Industrial Applications}, 9927 address = {Napa, California, USA}, 9928 date = {october 27-29}, 9929 year = {2003}, 9930 petsc_uses = {KSP} 9931} 9932 9933@Article{ bashir2008hessian, 9934 title = {Hessian-based model reduction for large-scale systems with initial-condition 9935 inputs}, 9936 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 9937 J.}, 9938 journal = {International journal for numerical methods in engineering}, 9939 volume = {73}, 9940 number = {6}, 9941 pages = {844--868}, 9942 year = {2008}, 9943 publisher = {Wiley Online Library}, 9944 petsc_uses = {KSP} 9945} 9946 9947@Article{ bashir2007hessian, 9948 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 9949 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 9950 K.}, 9951 journal = {Computational Science--ICCS 2007}, 9952 pages = {1010--1017}, 9953 year = {2007}, 9954 publisher = {Springer}, 9955 petsc_uses = {KSP} 9956} 9957 9958@Article{ akcelik2011fast, 9959 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 9960 inverse problems based on low-rank partial {H}essian approximations}, 9961 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 9962 Waanders, B. and Wilcox, L.}, 9963 journal = {SIAM Journal on Scientific Computing}, 9964 volume = {33}, 9965 number = {1}, 9966 year = {2011}, 9967 petsc_uses = {KSP} 9968} 9969 9970@InProceedings{ ff2003, 9971 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 9972 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 9973 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 9974 year = {2003}, 9975 petsc_uses = {KSP} 9976} 9977 9978@InProceedings{ d2b2004, 9979 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 9980 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 9981 Ordering Strategies}, 9982 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 9983 year = {2004}, 9984 petsc_uses = {KSP} 9985} 9986 9987@InProceedings{ d2v2005, 9988 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 9989 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 9990 Flow Equations}, 9991 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 9992 year = {2005}, 9993 petsc_uses = {KSP} 9994} 9995 9996@InProceedings{ dvs2006, 9997 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 9998 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 9999 Mixed Convection Equations}, 10000 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 10001 year = {2006}, 10002 petsc_uses = {KSP} 10003} 10004 10005@Article{ dsv2006, 10006 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 10007 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 10008 Flow Equations}, 10009 journal = {Computational Fluid Dynamics}, 10010 year = {2006}, 10011 volume = {15}, 10012 number = {1}, 10013 petsc_uses = {KSP} 10014} 10015 10016@Article{ lahaye03, 10017 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 10018 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10019 journal = {J. Comput. Appl. Math.}, 10020 year = {2004}, 10021 pages = {267--275}, 10022 volume = {168}, 10023 petsc_uses = {KSP} 10024} 10025 10026@TechReport{ brmn, 10027 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 10028 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 10029 year = {2002}, 10030 type = {Technical Report}, 10031 institution = {ANL}, 10032 number = {ANL/MCS-P993-0902}, 10033 note = {To appear in Future Generation Computer Systems}, 10034 petsc_uses = {KSP} 10035} 10036 10037@InProceedings{ mnbr, 10038 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 10039 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 10040 Algorithms}, 10041 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 10042 Mechanics}, 10043 year = {2003}, 10044 petsc_uses = {KSP} 10045} 10046 10047@InProceedings{ bmnr, 10048 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 10049 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 10050 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 10051 Applications, Lecture notes in Computer Science 2677}, 10052 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 10053 pages = {828--839}, 10054 year = {2003}, 10055 petsc_uses = {KSP} 10056} 10057 10058@Article{ ph03, 10059 author = {M. Pernice and R. D. Hornung}, 10060 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 10061 journal = {Computing and Visualization in Science}, 10062 year = {2003}, 10063 lab = {LANL}, 10064 petsc_uses = {KSP} 10065} 10066 10067@Article{ adams-02, 10068 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 10069 journal = {J. Comp. Phys.}, 10070 number = {2}, 10071 pages = {593-610}, 10072 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 10073 volume = {188}, 10074 year = {2003}, 10075 petsc_uses = {KSP} 10076} 10077 10078@InProceedings{ adams2001distributed, 10079 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 10080 smoothers}, 10081 author = {Adams, M.F.}, 10082 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 10083 pages = {14--14}, 10084 year = {2001}, 10085 organization = {IEEE}, 10086 petsc_uses = {KSP} 10087} 10088 10089@PhDThesis{ els01, 10090 author = {Ulrich Elsner}, 10091 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 10092 algorithms}, 10093 school = {Technical University Chemnitz}, 10094 year = {2002}, 10095 publisher = {Logos Verlag, Berlin}, 10096 isbn = {3-89722-923-4}, 10097 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 10098 different graph partitioning algorithms}, 10099 petsc_uses = {KSP} 10100} 10101 10102@TechReport{ ckk02, 10103 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 10104 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 10105 year = {2002}, 10106 type = {Technical Report}, 10107 institution = {ODU}, 10108 url = {http://www.math.odu.edu/\~{ }keyes}, 10109 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 10110 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 10111 Methods}, 10112 petsc_uses = {KSP} 10113} 10114 10115@Article{ gpw2002, 10116 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 10117 Heterogeneous Problems in Linear Elasticity}, 10118 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 10119 year = {2003}, 10120 pages = {283--324}, 10121 volume = {95}, 10122 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 10123 journal = {Numerische Mathematik}, 10124 petsc_uses = {KSP} 10125} 10126 10127@Article{ dh1, 10128 title = {Scalability and FETI based algorithm for large discretized variational 10129 inequalities}, 10130 author = {Z Dostal and D Horak}, 10131 year = {2003}, 10132 pages = {347--357}, 10133 volume = {61}, 10134 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 10135 journal = {Mathematics and Computers in Simulation}, 10136 petsc_uses = {KSP} 10137} 10138 10139@InProceedings{ dhsv1, 10140 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 10141 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 10142 title = {36 Scalabilities of {FETI} for Variational Inequalities and Contact Shape 10143 Optimization}, 10144 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10145 Methods}, 10146 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10147 Kuznetsov}, 10148 petsc_uses = {KSP} 10149} 10150 10151@Article{ lahaye02, 10152 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 10153 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10154 journal = {IEEEMAGN}, 10155 year = {2002}, 10156 volume = {38}, 10157 number = {2}, 10158 pages = {413-416}, 10159 petsc_uses = {KSP} 10160} 10161 10162@Article{ ckm01, 10163 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 10164 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 10165 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 10166 fluid dynamics}, 10167 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 10168 year = {2002}, 10169 volume = {40}, 10170 pages = {1463--1470}, 10171 petsc_uses = {KSP} 10172} 10173 10174@InProceedings{ cky01, 10175 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 10176 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 10177 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 10178 duct flow}, 10179 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10180 Methods}, 10181 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10182 Kuznetsov}, 10183 year = {2002}, 10184 petsc_uses = {KSP} 10185} 10186 10187@Article{ ck02, 10188 author = {X.-C. Cai and D. E. Keyes}, 10189 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 10190 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 10191 journal = {SIAM J. Sci. Comput.}, 10192 year = {2002}, 10193 pages = {183--200}, 10194 volume = {24}, 10195 petsc_uses = {KSP} 10196} 10197 10198@Article{ c04, 10199 author = {Feng-Nan Hwang and X.-C. Cai}, 10200 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 10201 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 10202 for incompressible {Navier-Stokes} equations}, 10203 journal = {Journal of Computational Physics}, 10204 year = {2005}, 10205 volume = {204}, 10206 pages = {666--691}, 10207 petsc_uses = {KSP} 10208} 10209 10210@Article{ hc06, 10211 author = {Feng-Nan Hwang and X.-C. Cai}, 10212 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 10213 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 10214 Algorithms}, 10215 journal = {Computer Methods in Applied Mechanics and Engineering}, 10216 year = {2006}, 10217 volume = {196}, 10218 pages = {1603--1611}, 10219 petsc_uses = {KSP} 10220} 10221 10222@InProceedings{ adams-01, 10223 author = {Mark F. Adams}, 10224 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 10225 Smoothers}, 10226 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 10227 address = {Denver, Colorado}, 10228 month = nov, 10229 year = {2001}, 10230 petsc_uses = {KSP} 10231} 10232 10233@Book{ 1dl, 10234 author = {Domenico Lahaye}, 10235 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 10236 Computations}, 10237 year = {2001}, 10238 publisher = {Katholieke Universiteit Leuven}, 10239 notes = {Thesis}, 10240 petsc_uses = {KSP} 10241} 10242 10243@Article{ adams-00, 10244 author = {Adams, M.~F.}, 10245 journal = {International Journal for Numerical Methods in Engineering}, 10246 number = {8}, 10247 pages = {1241-1262}, 10248 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 10249 Deformation Elasticity and Plasticity}, 10250 volume = {48}, 10251 year = {2000}, 10252 petsc_uses = {KSP} 10253} 10254 10255@Article{ adams2002evaluation, 10256 author = {Adams, M.~F.}, 10257 journal = {International Journal for Numerical Methods in Engineering}, 10258 number = {1}, 10259 pages = {519-534}, 10260 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 10261 Problems in Solid Mechanics}, 10262 volume = {55}, 10263 year = {2002}, 10264 petsc_uses = {KSP} 10265} 10266 10267@Article{ lahaye00, 10268 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 10269 title = {Algebraic Multigrid for Complex Symmetric Systems}, 10270 journal = {IEEEMAGN}, 10271 year = {2000}, 10272 volume = {36}, 10273 number = {4}, 10274 pages = {1535--1538}, 10275 petsc_uses = {KSP} 10276} 10277 10278@InProceedings{ adams-99c, 10279 author = {Mark F. Adams and J. Demmel}, 10280 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 10281 Finite Element Problems}, 10282 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 10283 address = {Portland, Oregon}, 10284 month = nov, 10285 year = {1999}, 10286 petsc_uses = {KSP} 10287} 10288 10289@Article{ chan95, 10290 author = {T. Chan and B. Smith and J. Zou}, 10291 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 10292 Grids}, 10293 journal = {Numer. Math.}, 10294 year = {1995}, 10295 volume = {73}, 10296 pages = {149--167}, 10297 petsc_uses = {KSP} 10298} 10299 10300@TechReport{ adams-csd-98-993, 10301 pages = {11}, 10302 year = {1998}, 10303 type = {Technical Report}, 10304 number = {CSD-98-993}, 10305 institution = {University of California, Berkeley}, 10306 title = {A Parallel Maximal Independent Set Algorithm}, 10307 bibdate = {March 11, 1998}, 10308 author = {Mark F. Adams and James Demmel}, 10309 abstract = {The parallel construction of maximal independent sets is a useful building block 10310 for many algorithms in the computational sciences, including graph coloring and 10311 multigrid coarse grid creation on unstructured meshes. We present an efficient 10312 asynchronous maximal independent set algorithm for use on parallel computers, for 10313 ``well partitioned'' graphs, that arise from finite element (FE) models. For 10314 appropriately partitioned bounded degree graphs, it is shown that the running time 10315 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 10316 improvement over the previous best P-RAM complexity for this class of graphs. We 10317 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 10318 model is indicative of the performance one can expect with practical partitions on 10319 graphs from FE problems.}, 10320 month = mar, 10321 petsc_uses = {KSP} 10322} 10323 10324@Article{ benzigolubliesen2005, 10325 title = {Numerical solution of saddle point problems}, 10326 author = {Michele Benzi and Gene H. Golub and J\"org Liesen}, 10327 volume = {14}, 10328 journal = {Acta Numerica}, 10329 pages = {1-–137}, 10330 doi = {10.1017/S0962492904000212}, 10331 year = {2005} 10332} 10333 10334@Article{ mardal2011preconditioning, 10335 title = {Preconditioning discretizations of systems of partial differential equations}, 10336 author = {Kent-Andre Mardal and Ragnar Winther}, 10337 journal = {Numerical Linear Algebra with Applications}, 10338 volume = {18}, 10339 number = {1}, 10340 pages = {1--40}, 10341 year = {2011} 10342} 10343 10344@TechReport{ k676, 10345 year = {1994}, 10346 type = {Technical Report}, 10347 number = {TR1994-676}, 10348 institution = {New York University}, 10349 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 10350 Term}, 10351 author = {Axel Klawonn}, 10352 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 10353 petsc_uses = {KSP} 10354} 10355 10356@Book{ ak1, 10357 author = {Axel Klawonn}, 10358 title = {Preconditioners for Indefinite Problems}, 10359 year = {1995}, 10360 publisher = {Westfalishen Wilhelms-Universitat Munster}, 10361 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 10362 notes = {Thesis}, 10363 petsc_uses = {KSP} 10364} 10365 10366@TechReport{ knepleykarpeev05, 10367 pages = {41}, 10368 year = {2005}, 10369 type = {Technical Report}, 10370 number = {ANL/MCS-P1295-1005}, 10371 institution = {Argonne National Laboratory}, 10372 title = {Flexible Representation of Computational Meshes}, 10373 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10374 abstract = {}, 10375 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 10376 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 10377 month = oct, 10378 petsc_uses = {DMPlex} 10379} 10380 10381@TechReport{ knepleykarpeev07a, 10382 pages = {14}, 10383 year = {2007}, 10384 type = {Technical Report}, 10385 number = {ANL/MCS-P1455-0907}, 10386 institution = {Argonne National Laboratory}, 10387 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10388 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10389 abstract = {}, 10390 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 10391 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 10392 month = feb, 10393 petsc_uses = {DMPlex} 10394} 10395 10396@Article{ knepleykarpeev09, 10397 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10398 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10399 journal = {Scientific Programming}, 10400 volume = {17}, 10401 number = {3}, 10402 pages = {215--230}, 10403 year = {2009}, 10404 doi = {10.3233/SPR-2009-0249}, 10405 url = {http://arxiv.org/abs/0908.4427}, 10406 note = {\url{http://arxiv.org/abs/0908.4427}}, 10407 petsc_uses = {DMPlex} 10408} 10409 10410@Article{ biezuner2012computing, 10411 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 10412 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 10413 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 10414 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 10415 Sublinear Supersolutions}, 10416 journal = {Journal of Scientific Computing}, 10417 publisher = {Springer Netherlands}, 10418 issn = {0885-7474}, 10419 keyword = {Mathematics and Statistics}, 10420 pages = {180--201}, 10421 volume = {52}, 10422 issue = {1}, 10423 year = {2012}, 10424 doi = {10.1007/s10915-011-9540-0}, 10425 petsc_uses = {KSP} 10426} 10427 10428% LiteralHTML: 10429% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 10430% LiteralHTML: 10431@Book{ knepley2017, 10432 title = {Computational Science I}, 10433 author = {Matthew G. Knepley}, 10434 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 10435 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 10436 publisher = {PETSc}, 10437 year = {2017}, 10438 petsc_uses = {KSP} 10439} 10440 10441@Article{ verleyeuser, 10442 title = {{User friendly permeability predicting software for technical textiles}}, 10443 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 10444 Roose, D.}, 10445 journal = {status: published}, 10446 issn = {1560-6074}, 10447 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 10448 petsc_uses = {KSP} 10449} 10450 10451@Book{ pacheco, 10452 author = {Peter Pacheco}, 10453 title = {Parallel Programming with MPI}, 10454 year = {1997}, 10455 publisher = {Morgan-Kaufmann}, 10456 note = {Devotes a couple of sections to PETSc}, 10457 petsc_uses = {KSP} 10458} 10459 10460@Book{ 1sbg, 10461 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 10462 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 10463 Differential Equations}, 10464 year = {1996}, 10465 publisher = {Cambridge University Press}, 10466 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 10467 petsc_uses = {KSP} 10468} 10469 10470@Misc{ petsc-fem:homepage, 10471 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 10472 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 10473 G. Rodriguez and G. Filippini}, 10474 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 10475 petsc_uses = {KSP} 10476} 10477 10478@Misc{ petsc4py-web-page, 10479 author = {Lisandro Dalcin}, 10480 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 10481 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 10482 note = {http://code.google.com/p/petsc4py/}, 10483 petsc_uses = {KSP} 10484} 10485 10486@Article{ libmeshpaper06, 10487 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 10488 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 10489 Simulations}}, 10490 journal = {Engineering with Computers}, 10491 volume = {22}, 10492 number = {3--4}, 10493 pages = {237--254}, 10494 year = {2006}, 10495 doi = {10.1007/s00366-006-0049-3}, 10496 petsc_uses = {KSP} 10497} 10498 10499@Misc{ sisiphus:homepage, 10500 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 10501 High-Resolution, Unstructured Simulations}, 10502 author = {T. {Tautges et al.}}, 10503 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 10504 petsc_uses = {KSP} 10505} 10506 10507@Misc{ pflotran:homepage, 10508 title = {{PFLOTRAN} project}, 10509 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 10510 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 10511 howpublished = {\url{http://pflotran.org/}}, 10512 petsc_uses = {KSP} 10513} 10514 10515@Misc{ pism:homepage, 10516 title = {{PISM}: A Parallel Ice Sheet Model}, 10517 author = {E. {Bueler et al.}}, 10518 howpublished = {\url{http://pism-docs.org}}, 10519 petsc_uses = {KSP} 10520} 10521 10522@Misc{ dohp:homepage, 10523 title = {Dohp: Dual order $hp$-finite elements}, 10524 author = {J. Brown}, 10525 howpublished = {\url{http://dohp.org}}, 10526 petsc_uses = {KSP} 10527} 10528 10529@Article{ mccourtrognlienetal12, 10530 title = {Improving parallel scalability for edge plasma transport simulations with neutral 10531 gas species}, 10532 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 10533 journal = {Computational Science and Discovery}, 10534 year = {2012}, 10535 volume = {5}, 10536 number = {014012}, 10537 doi = {10.1088/1749-4699/5/1/014012}, 10538 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 10539 2011)}, 10540 petsc_uses = {KSP} 10541} 10542 10543@Misc{ petclaw-github, 10544 title = {Pet{C}law Software}, 10545 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 10546 year = {2011}, 10547 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 10548 petsc_uses = {KSP} 10549} 10550 10551@Misc{ pyclaw-web-page, 10552 author = {Kyle T. Mandli and David I. Ketcheson and others}, 10553 title = {{PyClaw} software}, 10554 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 10555 url = {http://clawpack.github.io/doc/pyclaw/}, 10556 year = {2012}, 10557 petsc_uses = {KSP} 10558} 10559 10560@Article{ ketcheson2011highorder, 10561 title = {High-order wave propagation algorithms for general hyperbolic systems}, 10562 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 10563 year = {2011}, 10564 note = {submitted}, 10565 petsc_uses = {KSP} 10566} 10567 10568@Article{ biros2005pln1, 10569 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 10570 optimization. Part I: The {Krylov-Schur} solver}}, 10571 author = {Biros, G. and Ghattas, O.}, 10572 journal = {SIAM Journal on Scientific Computing}, 10573 volume = {27}, 10574 number = {2}, 10575 pages = {687--713}, 10576 year = {2005}, 10577 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10578 petsc_uses = {KSP} 10579} 10580 10581@Article{ biros2005pln2, 10582 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 10583 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 10584 optimal control of steady viscous flows}, 10585 author = {Biros, G. and Ghattas, O.}, 10586 journal = {SIAM Journal on Scientific Computing}, 10587 volume = {27}, 10588 number = {2}, 10589 pages = {714--739}, 10590 year = {2005}, 10591 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10592 petsc_uses = {KSP} 10593} 10594 10595@Misc{ issm:homepage, 10596 title = {{I}ce {S}heet {S}ystem {M}odel}, 10597 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 10598 year = {2010}, 10599 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 10600 petsc_uses = {KSP} 10601} 10602 10603@Article{ morlighem2010spatial, 10604 title = {Spatial patterns of basal drag inferred using control methods from a 10605 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 10606 {A}ntarctica}, 10607 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 10608 Aubry, D.}, 10609 journal = {Geophysical Research Letters}, 10610 volume = {37}, 10611 number = {14}, 10612 pages = {L14502}, 10613 year = {2010}, 10614 publisher = {American Geophysical Union}, 10615 petsc_uses = {KSP} 10616} 10617 10618@Article{ jardin2012plasmas, 10619 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 10620 of tokamak plasmas}, 10621 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 10622 journal = {Computational Science \& Discovery}, 10623 volume = {5}, 10624 number = {1}, 10625 url = {http://stacks.iop.org/1749-4699/5/014002}, 10626 year = {2012}, 10627 petsc_uses = {KSP} 10628} 10629 10630@Article{ cmz2016, 10631 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10632 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 10633 journal = {Journal of Scientific Computing}, 10634 publisher = {Springer}, 10635 pages = {803--825}, 10636 volume = {68}, 10637 issue = {2}, 10638 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 10639 doi = {10.1007/s10915-015-0159-4}, 10640 year = {2016}, 10641 note = {Also preprint ANL/MCS-P3039-0912}, 10642 petsc_uses = {KSP} 10643} 10644 10645@Article{ knepleybrownruppsmith13, 10646 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 10647 title = {Achieving High Performance with Unified Residual Evaluation}, 10648 journal = {ArXiv e-prints}, 10649 eprint = {1309.1204}, 10650 archiveprefix = {arXiv}, 10651 primaryclass = {cs.MS}, 10652 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 10653 Engineering, Finance, and Science}, 10654 year = {2013}, 10655 month = sep, 10656 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 10657 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10658 petsc_uses = {KSP} 10659} 10660 10661@Book{ fenicsbook, 10662 title = {Automated Solution of Differential Equations by the Finite Element Method: The 10663 FEniCS Book}, 10664 series = {Lecture Notes in Computational Science and Engineering}, 10665 volume = {84}, 10666 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 10667 publisher = {Springer}, 10668 isbn = {978-3-642-23098-1}, 10669 year = {2012}, 10670 petsc_uses = {KSP} 10671} 10672 10673@Article{ demidovahnertruppgottschling12, 10674 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 10675 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 10676 journal = {ArXiv e-prints}, 10677 archiveprefix = {arXiv}, 10678 eprint = {1212.6326}, 10679 primaryclass = {cs.MS}, 10680 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 10681 Parallel, and Cluster Computing, Physics - Computational Physics}, 10682 year = {2012}, 10683 month = dec, 10684 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 10685 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10686 petsc_uses = {KSP} 10687} 10688 10689@InProceedings{ viennacl, 10690 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 10691 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 10692 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 10693 year = {2010}, 10694 pages = {51-56}, 10695 petsc_uses = {KSP} 10696} 10697 10698@Article{ knepleybrownmcinnessmithruppadams2015, 10699 title = {Exascale Computing without Threads}, 10700 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10701 Karl Rupp and Mark Adams}, 10702 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 10703 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10704 Scientific Software Architecture for Portability and Performance}, 10705 doi = {10.6084/m9.figshare.5824950.v1}, 10706 year = {2015}, 10707 petsc_uses = {KSP} 10708} 10709 10710@Article{ knepleybrownmcinnessmithruppadams2015b, 10711 title = {Overview of the {PETSc} Library}, 10712 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10713 Karl Rupp and Mark Adams}, 10714 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 10715 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10716 Scientific Software Architecture for Portability and Performance}, 10717 year = {2015}, 10718 petsc_uses = {KSP} 10719} 10720 10721@InCollection{ balaybrownknepleymcinnessmith2015, 10722 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 10723 Smith}, 10724 title = {Providing Mixed Language and Legacy Support within a Library}, 10725 editor = {J. Carver}, 10726 booktitle = {Software Engineering for Science}, 10727 publisher = {Taylor \& Francis}, 10728 year = {2015}, 10729 petsc_uses = {KSP} 10730} 10731 10732@Article{ ruppbalaybrownknepleymcinnessmith2015, 10733 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 10734 Software}, 10735 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 10736 McInnes and Barry F. Smith}, 10737 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 10738 Productivity Challenges}, 10739 journal = {ArXiv e-prints}, 10740 archiveprefix = {arXiv}, 10741 eprint = {1510.01122}, 10742 year = {2015}, 10743 petsc_uses = {KSP} 10744} 10745 10746@InProceedings{ knepley2013accurately, 10747 title = {Accurately Citing Software and Algorithms Used in Publications}, 10748 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 10749 F.}, 10750 year = {2013}, 10751 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10752 (WSSSPE), held at SC13}, 10753 doi = {10.6084/m9.figshare.785731}, 10754 petsc_uses = {KSP} 10755} 10756 10757@InProceedings{ milleretal2013, 10758 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 10759 Strategies Developed for {FASTMath}}, 10760 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 10761 Barry Smith}, 10762 year = {2013}, 10763 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10764 (WSSSPE), held at SC13}, 10765 doi = {10.6084/m9.figshare.789055}, 10766 petsc_uses = {KSP} 10767} 10768 10769@TechReport{ dudsonetal2012, 10770 title = {Improved Nonlinear Solvers in {BOUT++}}, 10771 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 10772 institution = {Argonne National Laboratory}, 10773 number = {ANL/MCS-P3025-0812}, 10774 year = {2012}, 10775 petsc_uses = {KSP} 10776} 10777 10778@Misc{ brown13, 10779 author = {J. Brown}, 10780 title = {Scalable Repository Workflows}, 10781 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10782 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10783 year = {2013}, 10784 petsc_uses = {KSP} 10785} 10786 10787@Misc{ starforest11, 10788 title = {Star forests as a parallel communication model}, 10789 author = {Jed Brown}, 10790 url = {https://jedbrown.org/files/StarForest.pdf}, 10791 year = {2011}, 10792 petsc_uses = {KSP} 10793} 10794 10795@Misc{ brownknepleysmith13, 10796 author = {J. Brown and M. Knepley and B. Smith}, 10797 title = {Run-time Extensibility: Anything Less is Unsustainable}, 10798 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10799 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10800 year = {2013}, 10801 petsc_uses = {KSP} 10802} 10803 10804@Article{ jzhaoyliwkliu15, 10805 author = {J. Zhao and Y. Li and W.K. Liu}, 10806 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 10807 via {XFEM}}, 10808 journal = {Computational Mechanics}, 10809 year = {2015}, 10810 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 10811 petsc_uses = {KSP} 10812} 10813 10814@Article{ alisic14, 10815 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 10816 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 10817 journal = {J. Geophys. Res.}, 10818 year = {2014}, 10819 volume = {119}, 10820 number = {7}, 10821 pages = {5903-5920}, 10822 doi = {10.1002/2013JB010906}, 10823 petsc_uses = {KSP} 10824} 10825 10826@Article{ rhebergen14, 10827 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 10828 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 10829 journal = {SIAM J. Sci. Comp.}, 10830 year = {2014}, 10831 volume = {36}, 10832 number = {4}, 10833 pages = {1960-1977}, 10834 doi = {10.1137/130946678}, 10835 petsc_uses = {KSP} 10836} 10837 10838@Article{ allwright14, 10839 author = {J. Allwright and R.F. Katz}, 10840 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 10841 journal = {Geophys. J. Int.}, 10842 year = {2014}, 10843 volume = {199}, 10844 number = {3}, 10845 pages = {1608--1624}, 10846 doi = {10.1093/gji/ggu345}, 10847 petsc_uses = {KSP} 10848} 10849 10850@Misc{ gropp10, 10851 author = {William D. Gropp}, 10852 title = {Update on libraries for {B}lue {W}aters}, 10853 address = {Bordeaux, France}, 10854 year = {2010}, 10855 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 10856 petsc_uses = {KSP} 10857} 10858 10859@InProceedings{ mayknepley2017, 10860 title = {{DMSwarm}: Particles in {PETSc}}, 10861 author = {Dave A May and Matthew G Knepley}, 10862 booktitle = {EGU General Assembly Conference Abstracts}, 10863 volume = {19}, 10864 pages = {10133}, 10865 year = {2017}, 10866 petsc_uses = {KSP} 10867} 10868 10869@InProceedings{ adamsbrownknepley2013, 10870 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 10871 title = {Low-communication techniques for extreme-scale multilevel solvers}, 10872 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 10873 organization = {DOE Office of Advanced Scientific Computing Research}, 10874 year = {2013}, 10875 petsc_uses = {KSP} 10876} 10877 10878@Article{ bhallagriffithknepleyadamsguy2017, 10879 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 10880 boundary equations}, 10881 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 10882 Adams and Robert D. Guy}, 10883 journal = {arXiv e-prints}, 10884 eprint = {1612.02208}, 10885 year = {2017}, 10886 note = {\url{http://arxiv.org/abs/1612.02208}}, 10887 petsc_uses = {KSP} 10888} 10889 10890@Article{ zampini2016pcbddc, 10891 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 10892 author = {Zampini, Stefano}, 10893 journal = {SIAM Journal on Scientific Computing}, 10894 volume = {38}, 10895 number = {5}, 10896 pages = {S282--S306}, 10897 year = {2016}, 10898 publisher = {SIAM}, 10899 petsc_uses = {KSP} 10900} 10901 10902@Article{ jolivetromanzampini2020, 10903 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 10904 robust multilevel overlapping {Schwarz} preconditioners}, 10905 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 10906 journal = {Computers and Mathematics with Applications}, 10907 volume = {84}, 10908 pages = {277--295}, 10909 year = {2020} 10910} 10911 10912@Article{ zampinitu2017, 10913 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 10914 porous media}, 10915 author = {Stefano Zampini and Xuemin Tu}, 10916 journal = {SIAM Journal of Scientific Computing}, 10917 volume = {39}, 10918 number = {4}, 10919 pages = {A1389--A1415}, 10920 year = {2017} 10921} 10922 10923@Article{ ohwidlundzampinidohrmann2017, 10924 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 10925 constraints for {Raviart-Thomas} vector fields}, 10926 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 10927 journal = {Mathematics of Computation}, 10928 volume = {87}, 10929 number = {310}, 10930 pages = {659--692}, 10931 year = {2017} 10932} 10933 10934@Article{ veigapavarinoscacchiwidlundzampini2016, 10935 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 10936 preconditioners}, 10937 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 10938 Stefano Zampini}, 10939 journal = {SIAM Journal of Scientific Computing}, 10940 volume = {39}, 10941 number = {1}, 10942 pages = {A281--A302}, 10943 year = {2016} 10944} 10945 10946@Article{ pavarinoscacchiwidlundzampini2018, 10947 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 10948 analysis}, 10949 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 10950 journal = {Mathematical Models and Methods in Applied Sciences}, 10951 volume = {28}, 10952 number = {7}, 10953 pages = {1337--1370}, 10954 year = {2018} 10955} 10956 10957@Article{ bergervergiatwaisman2017, 10958 title = {An overlapping Domain Decomposition preconditioning method for monolithic 10959 solution of shear bands}, 10960 author = {Luc Berger-Vergiat and Haim Waisman}, 10961 journal = {Computer Methods in Applied Mechanics and Engineering}, 10962 volume = {318}, 10963 pages = {33--60}, 10964 year = {2017}, 10965 petsc_uses = {KSP} 10966} 10967 10968@Article{ abhyankarmaldonadosmithzhang2020, 10969 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 10970 Simulations}, 10971 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 10972 H. Zhang}, 10973 journal = {ACM Transactions on Mathematical Software}, 10974 volume = {46}, 10975 number = {1}, 10976 year = {2020}, 10977 doi = {10.1145/3344587}, 10978 petsc_uses = {KSP} 10979} 10980 10981@InProceedings{ zhangellpack2018, 10982 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 10983 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 10984 {AVX-512}}, 10985 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 10986 year = {2018}, 10987 petsc_uses = {KSP} 10988} 10989 10990@Misc{ petsc-user-meetings:website, 10991 title = {{PETSc User Meetings}}, 10992 key = {PETSc User Meetings}, 10993 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 10994 petsc_uses = {KSP} 10995} 10996 10997@Article{ flexible-bicgstab-chen16, 10998 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10999 author = {J. Chen and L.C. McInnes and H. Zhang}, 11000 journal = {Journal of Scientific Computing}, 11001 volume = {68}, 11002 number = {2}, 11003 month = jul, 11004 year = {2016}, 11005 pages = {803--825}, 11006 doi = {10.1007/s10915-015-0159-4}, 11007 petsc_uses = {KSP} 11008} 11009 11010@Misc{ petsc-extensibility2016, 11011 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 11012 title = {{Extensibility in PETSc}}, 11013 note = {SIAM News, available via 11014 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 11015 year = {2016}, 11016 petsc_uses = {KSP} 11017} 11018 11019@Misc{ error-estimation-whitepaper2017, 11020 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 11021 title = {End-to-end error estimation and control}, 11022 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 11023 doi = {10.6084/m9.figshare.5339866}, 11024 year = {2017}, 11025 petsc_uses = {KSP} 11026} 11027 11028@Misc{ petsc-user-support15, 11029 title = {On the Evolution of User Support Topics in Computational Science and Engineering 11030 Software}, 11031 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 11032 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 11033 15-16, 2015}, 11034 year = {2015}, 11035 petsc_uses = {KSP} 11036} 11037 11038@InBook{ petsc-mixed-language-support2016, 11039 title = {Numerical Library Support for High-Performance Mixed Language Applications and 11040 Legacy Code}, 11041 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 11042 booktitle = {Software Engineering for Science}, 11043 editors = {J. Carver et al.}, 11044 publisher = {CRC Press}, 11045 pages = {201--214}, 11046 year = {2016}, 11047 petsc_uses = {KSP} 11048} 11049 11050@InProceedings{ konolige2018parallel, 11051 title = {A Parallel Solver for Graph {L}aplacians}, 11052 author = {Tristan Konolige and Jed Brown}, 11053 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 11054 doi = {10.1145/3218176.3218227}, 11055 note = {Best Paper Award}, 11056 archiveprefix = {arXiv}, 11057 eprint = {1705.06266}, 11058 year = {2018}, 11059 petsc_uses = {KSP} 11060} 11061 11062@InProceedings{ werner-kimn2019, 11063 title = {Parallel implementation of {AC} optimal power flow and time-constrained optimal 11064 power flow using high-performance computing}, 11065 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 11066 Jung-Han Kimn}, 11067 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 11068 note = {Best Paper in Track}, 11069 year = {2019}, 11070 petsc_uses = {KSP} 11071} 11072 11073@MastersThesis{ rinaldo-ceresoli18, 11074 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 11075 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 11076 Applications}, 11077 school = {Politecnico di Milano}, 11078 year = {2018}, 11079 month = apr, 11080 petsc_uses = {KSP} 11081} 11082 11083@Article{ sananschneppmay2016, 11084 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 11085 author = {P. Sanan and S. M. Schnepp and D. A. May}, 11086 journal = {SIAM Journal on Scientific Computing}, 11087 volume = {38}, 11088 number = {5}, 11089 pages = {C441-C470}, 11090 year = {2016}, 11091 doi = {10.1137/15M1049130}, 11092 petsc_uses = {KSP} 11093} 11094 11095@Article{ petscsf2022, 11096 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 11097 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 11098 Smith, Barry F. and Zampini, Stefano}, 11099 journal = {IEEE Transactions on Parallel and Distributed Systems}, 11100 title = {The {PetscSF} Scalable Communication Layer}, 11101 year = {2022}, 11102 volume = {33}, 11103 number = {4}, 11104 pages = {842-853}, 11105 doi = {10.1109/TPDS.2021.3084070} 11106} 11107 11108@Article{ brandt2000, 11109 title = {General highly accurate algebraic coarsening}, 11110 author = {Achi Brandt}, 11111 journal = {Electronic Transactions on Numerical Analysis}, 11112 volume = {10}, 11113 number = {9680}, 11114 pages = {1--20}, 11115 issn = {10689613}, 11116 year = {2000} 11117} 11118 11119@Article{ dalcinpazklercosimo2011, 11120 title = {Parallel distributed computing using Python}, 11121 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 11122 journal = {Advances in Water Resources}, 11123 volume = {34}, 11124 number = {9}, 11125 pages = {1124 - 1139}, 11126 note = {New Computational Methods and Software Tools}, 11127 issn = {0309-1708}, 11128 doi = {10.1016/j.advwatres.2011.04.013}, 11129 year = {2011} 11130} 11131 11132@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 11133 title = {Cython: The Best of Both Worlds}, 11134 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 11135 Seljebotn,Dag Sverre and Smith,Kurt }, 11136 journal = {Computing in Science \& Engineering}, 11137 volume = {13}, 11138 number = {2}, 11139 pages = {31-39}, 11140 doi = {10.1109/MCSE.2010.118}, 11141 year = {2011} 11142} 11143 11144@Article{ dalcinpazstorti2005, 11145 title = {MPI for Python}, 11146 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 11147 journal = {Journal of Parallel and Distributed Computing}, 11148 volume = {65}, 11149 number = {9}, 11150 pages = {1108 - 1115}, 11151 issn = {0743-7315}, 11152 doi = {10.1016/j.jpdc.2005.03.010}, 11153 year = {2005} 11154} 11155 11156@Article{ dalcincolliervignalcortescalo2016, 11157 title = {PetIGA: A framework for high-performance isogeometric analysis}, 11158 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 11159 Calo}, 11160 journal = {Computer Methods in Applied Mechanics and Engineering}, 11161 volume = {308}, 11162 pages = {151 - 181}, 11163 issn = {0045-7825}, 11164 doi = {10.1016/j.cma.2016.05.011}, 11165 year = {2016} 11166} 11167 11168@Article{ collierpardodalcinpaszynskicalo2012, 11169 title = {The cost of continuity: A study of the performance of isogeometric finite 11170 elements using direct solvers}, 11171 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 11172 Calo}, 11173 journal = {Computer Methods in Applied Mechanics and Engineering}, 11174 volume = {213-216}, 11175 pages = {353 - 361}, 11176 issn = {0045-7825}, 11177 doi = {10.1016/j.cma.2011.11.002}, 11178 year = {2012} 11179} 11180 11181@Article{ collierdalcinpardocalo2013, 11182 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 11183 Elements}, 11184 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 11185 journal = {SIAM Journal on Scientific Computing}, 11186 volume = {35}, 11187 number = {2}, 11188 pages = {A767-A784}, 11189 doi = {10.1137/120881038}, 11190 year = {2013} 11191} 11192 11193@Article{ dunning2017jump, 11194 title = {{JuMP}: a modeling language for mathematical optimization}, 11195 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 11196 journal = {SIAM Review}, 11197 volume = {59}, 11198 number = {2}, 11199 pages = {295--320}, 11200 year = {2017}, 11201 publisher = {SIAM} 11202} 11203 11204@InProceedings{ prudencioschulz2011, 11205 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 11206 Estimation, Simulation and Optimization}, 11207 author = {Ernesto E Prudencio and Karl W Schulz}, 11208 booktitle = {European Conference on Parallel Processing}, 11209 pages = {398--407}, 11210 year = {2011} 11211} 11212 11213@Misc{ rol-website, 11214 key = {ROL}, 11215 title = {{Rapid Optimization Library} Website}, 11216 howpublished = {\url{https://trilinos.org/packages/rol}}, 11217 year = {2018} 11218} 11219 11220@Article{ more1994line, 11221 title = {Line search algorithms with guaranteed sufficient decrease}, 11222 author = {Mor{\'e}, Jorge J and Thuente, David J}, 11223 journal = {ACM Transactions on Mathematical Software}, 11224 volume = {20}, 11225 number = {3}, 11226 pages = {286--307}, 11227 year = {1994}, 11228 publisher = {ACM} 11229} 11230 11231@Article{ griewank2000algorithm, 11232 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 11233 adjoint mode of computational differentiation}, 11234 author = {Griewank, Andreas and Walther, Andrea}, 11235 journal = {ACM Transactions on Mathematical Software}, 11236 volume = {26}, 11237 number = {1}, 11238 pages = {19--45}, 11239 year = {2000}, 11240 publisher = {ACM} 11241} 11242 11243@Article{ metcalf2011seven, 11244 title = {The seven ages of fortran}, 11245 author = {Metcalf, Michael}, 11246 journal = {Journal of Computer Science \& Technology}, 11247 volume = {11}, 11248 year = {2011} 11249} 11250 11251@Article{ giraldo_2013, 11252 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 11253 model of the atmosphere {(NUMA)}}, 11254 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 11255 journal = {SIAM Journal on Scientific Computing}, 11256 year = {2013}, 11257 number = {5}, 11258 pages = {B1162-B1194}, 11259 volume = {35}, 11260 doi = {10.1137/120876034} 11261} 11262 11263@Article{ constantinescu_tr2016b, 11264 author = {Constantinescu, E.M.}, 11265 title = {Estimating Global Errors in Time Stepping}, 11266 journal = {ArXiv e-prints}, 11267 archiveprefix = {arXiv}, 11268 eprint = {1503.05166}, 11269 primaryclass = {math.NA}, 11270 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 11271 year = {2016}, 11272 month = mar, 11273 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 11274 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 11275} 11276 11277@Article{ pareschi_2005, 11278 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 11279 with Relaxation}, 11280 author = {L. Pareschi and G. Russo}, 11281 journal = {Journal of Scientific Computing}, 11282 year = {2005}, 11283 number = {1}, 11284 pages = {129--155}, 11285 volume = {25} 11286} 11287 11288@Article{ kennedy_2003, 11289 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 11290 author = {C.A. Kennedy and M.H. Carpenter}, 11291 journal = {Appl. Numer. Math.}, 11292 year = {2003}, 11293 number = {1-2}, 11294 pages = {139--181}, 11295 volume = {44}, 11296 doi = {10.1016/S0168-9274(02)00138-1}, 11297 publisher = {Elsevier Science Publishers B. V.} 11298} 11299 11300@Unpublished{ boscarino_tr2011, 11301 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 11302 equations in the diffusion limit}, 11303 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 11304 note = {Arxiv preprint arXiv:1110.4375}, 11305 year = {2011} 11306} 11307 11308@Article{ ascher_1997, 11309 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 11310 equations}, 11311 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 11312 journal = {Applied Numerical Mathematics}, 11313 year = {1997}, 11314 pages = {151--167}, 11315 volume = {25} 11316} 11317 11318@Book{ ascherpetzold1998, 11319 title = {Computer methods for ordinary differential equations and differential-algebraic 11320 equations}, 11321 author = {Uri M Ascher and Linda R Petzold}, 11322 volume = {61}, 11323 publisher = {SIAM}, 11324 year = {1998} 11325} 11326 11327@Article{ colomesbadia2016, 11328 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 11329 equations}, 11330 author = {Oriol Colom{\'e}s and Santiago Badia}, 11331 journal = {International Journal for Numerical Methods in Engineering}, 11332 volume = {105}, 11333 number = {5}, 11334 pages = {372--400}, 11335 year = {2016} 11336} 11337 11338@Article{ sandu_1997, 11339 title = {Benchmarking stiff {ODE} solvers for atmospheric chemistry problems {II}: 11340 {R}osenbrock solvers}, 11341 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 11342 Potra}, 11343 journal = {Atmospheric Environment}, 11344 year = {1997}, 11345 number = {20}, 11346 pages = {3459--3472}, 11347 volume = {31}, 11348 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 11349 task is the integration of the stiff systems of ordinary differential equations 11350 describing the chemical transformations. It is therefore of interest to 11351 systematically search for stiff solvers which can be identified as close to 11352 optimal for atmospheric applications. In this paper we continue our investigation 11353 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 11354 and compare eight solvers on a set of seven box-models used in present day models. 11355 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 11356 application when they are provided with highly efficient sparse matrix techniques 11357 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 11358 the literature, viz. and 4, and two are new and specially developed for air 11359 quality applications, viz. 3 and 3. } 11360} 11361 11362@Article{ rang_2005, 11363 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 11364 equations of index 1}, 11365 author = {Rang, J. and Angermann, L.}, 11366 journal = {BIT Numerical Mathematics}, 11367 year = {2005}, 11368 number = {4}, 11369 pages = {761--787}, 11370 volume = {45}, 11371 publisher = {Springer}, 11372 doi = {10.1007/s10543-005-0035-y} 11373} 11374 11375@article{rang2015improved, 11376 title = {Improved traditional {R}osenbrock--{W}anner methods for stiff {ODE}s and {DAE}s}, 11377 author = {Rang, Joachim}, 11378 journal = {Journal of Computational and Applied Mathematics}, 11379 volume = {286}, 11380 pages = {128--144}, 11381 year = {2015}, 11382 publisher = {Elsevier}, 11383 doi = {10.1016/j.cam.2015.03.010} 11384} 11385 11386@Article{ gottliebketchesonshu2009, 11387 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 11388 title = {{High order strong stability preserving time discretizations}}, 11389 journal = {Journal of Scientific Computing}, 11390 volume = {38}, 11391 number = {3}, 11392 pages = {251--289}, 11393 doi = {10.1007/s10915-008-9239-z}, 11394 year = {2009} 11395} 11396 11397@Article{ ketcheson_2008, 11398 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 11399 Low-Storage Implementations}, 11400 author = {D.I. Ketcheson}, 11401 journal = {SIAM Journal on Scientific Computing}, 11402 year = {2008}, 11403 number = {4}, 11404 pages = {2113--2136}, 11405 volume = {30}, 11406 doi = {10.1137/07070485X}, 11407 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 11408 RungeKutta methods}, 11409 publisher = {SIAM} 11410} 11411 11412@Article{ jansen_2000, 11413 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 11414 equations with a stabilized finite element method}, 11415 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 11416 journal = {Computer Methods in Applied Mechanics and Engineering}, 11417 year = {2000}, 11418 number = {3}, 11419 pages = {305--319}, 11420 volume = {190}, 11421 publisher = {Elsevier} 11422} 11423 11424@Article{ butcher_2007, 11425 title = {Error propagation of general linear methods for ordinary differential equations}, 11426 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 11427 journal = {Journal of Complexity}, 11428 year = {2007}, 11429 number = {4-6}, 11430 pages = {560--580}, 11431 volume = {23}, 11432 abstract = {We discuss error propagation for general linear methods for ordinary differential 11433 equations up to terms of order p+2, where p is the order of the method. These 11434 results are then applied to the estimation of local discretization errors for 11435 methods of order p and for the adjacent order p+1. The results of numerical 11436 experiments confirm the reliability of these estimates. This research has 11437 applications in the design of robust stepsize and order changing strategies for 11438 algorithms based on general linear methods.}, 11439 doi = {10.1016/j.jco.2007.01.009}, 11440 issn = {0885-064X} 11441} 11442 11443@Article{ constantinescu_a2010a, 11444 title = {Extrapolated implicit-explicit time stepping}, 11445 author = {E.M. Constantinescu and A. Sandu}, 11446 journal = {SIAM Journal on Scientific Computing}, 11447 year = {2010}, 11448 number = {6}, 11449 pages = {4452-4477}, 11450 volume = {31}, 11451 comment = {Preprint \# ANL/MCS-P1612-0409}, 11452 doi = {10.1137/080732833} 11453} 11454 11455@InProceedings{ devito2011liszt, 11456 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 11457 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 11458 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 11459 Aiken, Alex and Duraisamy, Karthik and others}, 11460 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 11461 Networking, Storage and Analysis}, 11462 pages = {9}, 11463 year = {2011}, 11464 organization = {ACM} 11465} 11466 11467@Article{ devito2011designing, 11468 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 11469 author = {DeVito, Zachary and Hanrahan, Pat}, 11470 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 11471 year = {2011} 11472} 11473 11474@Misc{ pgasintro, 11475 author = {Tim Stitt}, 11476 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 11477 Model}, 11478 note = {\url{http://cnx.org/content/m20649/latest/}} 11479} 11480 11481@InProceedings{ el2006upc, 11482 title = {UPC: unified parallel C}, 11483 author = {El-Ghazawi, Tarek and Smith, Lauren}, 11484 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 11485 pages = {27}, 11486 year = {2006}, 11487 organization = {ACM} 11488} 11489 11490@InProceedings{ numrich1998co, 11491 title = {Co-Array Fortran for parallel programming}, 11492 author = {Numrich, Robert W and Reid, John}, 11493 booktitle = {ACM Sigplan Fortran Forum}, 11494 volume = {17}, 11495 number = {2}, 11496 pages = {1--31}, 11497 year = {1998}, 11498 organization = {ACM} 11499} 11500 11501@Article{ aiken1997titanium, 11502 title = {Titanium: A high-performance Java dialect}, 11503 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 11504 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 11505 Geoff and Semenzato, Luigi and others}, 11506 year = {1997} 11507} 11508 11509@Article{ charles2005x10, 11510 title = {X10: an object-oriented approach to non-uniform cluster computing}, 11511 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 11512 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 11513 Sarkar, Vivek}, 11514 journal = {Acm Sigplan Notices}, 11515 volume = {40}, 11516 number = {10}, 11517 pages = {519--538}, 11518 year = {2005}, 11519 publisher = {ACM} 11520} 11521 11522@Article{ chamberlain2007parallel, 11523 title = {Parallel programmability and the chapel language}, 11524 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 11525 journal = {International Journal of High Performance Computing Applications}, 11526 volume = {21}, 11527 number = {3}, 11528 pages = {291--312}, 11529 year = {2007}, 11530 publisher = {SAGE Publications} 11531} 11532 11533@InProceedings{ charmppoopsla93, 11534 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 11535 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 11536 editor = {Paepcke, A.}, 11537 fulleditor = {Paepcke, Andreas}, 11538 pages = {91--108}, 11539 month = sep, 11540 year = {1993}, 11541 booktitle = {{Proceedings of OOPSLA'93}}, 11542 publisher = {{ACM Press}} 11543} 11544 11545@InProceedings{ hewitt1973universal, 11546 title = {A universal modular actor formalism for artificial intelligence}, 11547 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 11548 booktitle = {Proceedings of the 3rd international joint conference on Artificial 11549 intelligence}, 11550 pages = {235--245}, 11551 year = {1973}, 11552 organization = {Morgan Kaufmann Publishers Inc.} 11553} 11554 11555@Book{ yonezawa1990abcl, 11556 title = {ABCL: an object-oriented concurrent system}, 11557 author = {Yonezawa, Akinori}, 11558 year = {1990}, 11559 publisher = {MIT press} 11560} 11561 11562@InProceedings{ dally1988object, 11563 title = {Object-oriented concurrent programming in CST}, 11564 author = {Dally, William J and Chien, Andrew A}, 11565 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 11566 applications: Architecture, software, computer systems, and general issues-Volume 11567 1}, 11568 pages = {434--439}, 11569 year = {1988}, 11570 organization = {ACM} 11571} 11572 11573@Article{ grimshaw1993easy, 11574 title = {Easy-to-use object-oriented parallel processing with Mentat}, 11575 author = {Grimshaw, Andrew S.}, 11576 journal = {Computer}, 11577 volume = {26}, 11578 number = {5}, 11579 pages = {39--51}, 11580 year = {1993}, 11581 publisher = {IEEE} 11582} 11583 11584@InProceedings{ gannon1991object, 11585 title = {Object oriented parallelism: pC++ ideas and experiments}, 11586 author = {Gannon, Dennis and Lee, JK}, 11587 booktitle = {Proceedings of}, 11588 pages = {13--23}, 11589 year = {1991} 11590} 11591 11592@InProceedings{ lau1992object, 11593 title = {An object-oriented class library for scalable parallel heuristic search}, 11594 author = {Lau, Wing-cheong and Singh, Vineet}, 11595 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 11596 pages = {252--267}, 11597 year = {1992}, 11598 organization = {Springer} 11599} 11600 11601@Book{ chase1989amber, 11602 title = {The Amber system: Parallel programming on a network of multiprocessors}, 11603 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 11604 Littlefield, Richard}, 11605 volume = {23}, 11606 number = {5}, 11607 year = {1989}, 11608 publisher = {ACM} 11609} 11610 11611@InProceedings{ kaiser2009parallex, 11612 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 11613 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 11614 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 11615 pages = {394--401}, 11616 year = {2009}, 11617 organization = {IEEE} 11618} 11619 11620@TechReport{ ipm, 11621 author = {Barry F. Smith}, 11622 title = {A New Parallel Programming Model for Computer Simulation}, 11623 institution = {Argonne National Laboratory}, 11624 year = {2014}, 11625 number = {ANL/MCS-P5135-0414} 11626} 11627 11628@Article{ groppsnir, 11629 author = {William Gropp and Marc Snir}, 11630 title = {Programming for Exascale Computers}, 11631 journal = {Computing in Science and Engineering}, 11632 volume = {15}, 11633 number = {6}, 11634 issn = {1521-9615}, 11635 year = {2013}, 11636 pages = {27-35}, 11637 doi = {10.1109/MCSE.2013.96}, 11638 publisher = {IEEE Computer Society}, 11639 address = {Los Alamitos, CA} 11640} 11641 11642@Book{ mpi3, 11643 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 11644 author = {Message Passing Interface Forum}, 11645 year = {2012}, 11646 publisher = {High Performance Computing Center Stuttgart (HLRS)} 11647} 11648 11649@Book{ openmp4, 11650 title = {OpenMP Application Program Interface, Version 4.0}, 11651 year = {2013}, 11652 publisher = {OpenMP Architecture Review Board} 11653} 11654 11655@InProceedings{ hartono2009annotation, 11656 title = {Annotation-based empirical performance tuning using {Orio}}, 11657 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 11658 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 11659 Symposium on}, 11660 pages = {1--11}, 11661 year = {2009}, 11662 organization = {IEEE} 11663} 11664 11665@Book{ toselli2005domain, 11666 title = {Domain Decomposition Methods: Algorithms and Theory}, 11667 author = {Toselli, Andrea and Widlund, Olof B}, 11668 volume = {34}, 11669 year = {2005}, 11670 publisher = {Springer} 11671} 11672 11673@InBook{ st2016, 11674 author = {Barry F. Smith and Xumin Tu}, 11675 chapter = {Domain Decomposition}, 11676 title = {Encyclopedia of Applied and Computational Mathematics}, 11677 bookeditor = {B. Engquist}, 11678 publisher = {Springer}, 11679 pages = {375--381}, 11680 year = {2016} 11681} 11682 11683@TechReport{ saws, 11684 author = {Matt Otten and Jed Brown and Barry F. Smith}, 11685 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 11686 institution = {Argonne National Laboratory}, 11687 year = {2013} 11688} 11689 11690@Article{ smith1997domain, 11691 title = {Domain Decomposition Methods for Partial Differential Equations}, 11692 author = {Smith, B.F.}, 11693 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 11694 volume = {4}, 11695 pages = {225--244}, 11696 year = {1997}, 11697 publisher = {Citeseer} 11698} 11699 11700@Article{ spillane2011abstract, 11701 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 11702 in the overlaps}, 11703 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 11704 Scheichl, R}, 11705 journal = {NuMa-Report}, 11706 volume = {7}, 11707 pages = {2007}, 11708 year = {2011} 11709} 11710 11711@InProceedings{ jolivet2013scalabledd, 11712 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 11713 problems}, 11714 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 11715 Prud'homme, Christophe}, 11716 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 11717 Networking, Storage and Analysis}, 11718 pages = {80}, 11719 year = {2013}, 11720 organization = {ACM} 11721} 11722 11723@Book{ ks2000, 11724 author = {D. Kinderlehrer and G. Stampacchia}, 11725 publisher = {Society for Industrial Mathematics}, 11726 title = {An Introduction to Variational Inequalities and Their Applications}, 11727 year = {2000} 11728} 11729 11730@Article{ wan2000energy, 11731 title = {An energy-minimizing interpolation for robust multigrid methods}, 11732 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 11733 journal = {SIAM Journal on Scientific Computing}, 11734 volume = {21}, 11735 number = {4}, 11736 pages = {1632--1649}, 11737 year = {2000}, 11738 publisher = {Philadelphia, PA: SIAM, c1993-} 11739} 11740 11741@Article{ chansmith1994, 11742 title = {Domain decomposition and multigrid algorithms for elliptic problems on 11743 unstructured meshes}, 11744 author = {Chan, T.F. and Smith, B.F.}, 11745 journal = {Electronic Transactions on Numerical Analysis}, 11746 volume = {2}, 11747 pages = {171--182}, 11748 year = {1994} 11749} 11750 11751@TechReport{ proto-fsp, 11752 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 11753 and Michael Zarnstorff and Michael Zika}, 11754 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 11755 institution = {Princeton Plasma Physics Laboratory}, 11756 year = {2010}, 11757 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 11758} 11759 11760@Article{ hirvijoki2021, 11761 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 11762 particle-in-cell codes}, 11763 journal = {Plasma Phys. Control. Fusion}, 11764 author = {Eero Hirvijoki}, 11765 note = {in press}, 11766 doi = {10.1088/1361-6587/abe884}, 11767 year = {2021} 11768} 11769 11770@Article{ ipsen2001, 11771 author = {Ilse C. F. Ipsen}, 11772 journal = {SIAM J. Sci. Comput.}, 11773 pages = {1050--1051}, 11774 volume = {23}, 11775 publisher = {SIAM}, 11776 title = {A Note on Preconditioning Nonsymmetric Matrices}, 11777 year = {2001} 11778} 11779 11780% Random papers on solvers for GPUs 11781@InProceedings{ gpus-suck, 11782 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 11783 title = { On the Limits of {GPU} Acceleration}, 11784 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 11785 year = {2010}, 11786 publisher = {USENIX} 11787} 11788 11789@InProceedings{ 882364, 11790 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 11791 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11792 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 11793 year = {2003}, 11794 isbn = {1-58113-709-5}, 11795 pages = {917--924}, 11796 location = {San Diego, California}, 11797 doi = {10.1145/1201775.882364}, 11798 publisher = {ACM}, 11799 address = {New York, NY} 11800} 11801 11802@Conference{ feng2008multigrid, 11803 author = {Feng, Z. and Li, P.}, 11804 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 11805 date-added = {2010-08-19 15:57:06 -0500}, 11806 date-modified = {2010-08-19 15:57:06 -0500}, 11807 pages = {647--654}, 11808 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 11809 year = {2008} 11810} 11811 11812@Conference{ goodnight2003multigrid, 11813 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 11814 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 11815 date-added = {2010-08-19 15:45:20 -0500}, 11816 date-modified = {2010-08-19 15:45:20 -0500}, 11817 organization = {Eurographics Association}, 11818 pages = {102--111}, 11819 title = {A multigrid solver for boundary value problems using programmable graphics 11820 hardware}, 11821 year = {2003} 11822} 11823 11824@Article{ buatois2007concurrent, 11825 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 11826 date-added = {2010-08-19 15:45:02 -0500}, 11827 date-modified = {2010-08-19 15:45:02 -0500}, 11828 journal = {High Performance Computing and Communications}, 11829 pages = {358--371}, 11830 publisher = {Citeseer}, 11831 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 11832 year = {2007} 11833} 11834 11835@Article{ joldes2010real, 11836 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 11837 date-added = {2010-08-19 15:44:41 -0500}, 11838 date-modified = {2010-08-19 15:44:41 -0500}, 11839 journal = {Computer Methods in Applied Mechanics and Engineering}, 11840 publisher = {Elsevier}, 11841 title = {Real-time nonlinear finite element computations on {GPU}-application to 11842 neurosurgical simulation}, 11843 year = {2010} 11844} 11845 11846@Misc{ aharon2005gpu, 11847 author = {Aharon, S.}, 11848 date-added = {2010-08-19 15:44:32 -0500}, 11849 date-modified = {2010-08-19 15:44:32 -0500}, 11850 month = apr, 11851 note = {US Patent App. 11/115,642}, 11852 publisher = {Google Patents}, 11853 title = {{GPU}-based Finite Element}, 11854 year = {2005} 11855} 11856 11857@Article{ cevahir2009fast, 11858 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 11859 date-added = {2010-08-19 15:44:01 -0500}, 11860 date-modified = {2010-08-19 15:44:01 -0500}, 11861 journal = {Computational Science--ICCS 2009}, 11862 pages = {893--903}, 11863 publisher = {Springer}, 11864 title = {Fast conjugate gradients with multiple {GPU}s}, 11865 year = {2009} 11866} 11867 11868@Article{ maier1995symmetric, 11869 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 11870 date-added = {2010-08-19 15:43:57 -0500}, 11871 date-modified = {2010-08-19 15:43:57 -0500}, 11872 journal = {Computational Mechanics}, 11873 number = {1}, 11874 pages = {115--129}, 11875 publisher = {Springer}, 11876 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 11877 plasticity}, 11878 volume = {17}, 11879 year = {1995} 11880} 11881 11882@Article{ corrigan-running, 11883 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 11884 date-added = {2010-08-19 15:43:47 -0500}, 11885 date-modified = {2010-08-19 15:43:47 -0500}, 11886 journal = {International Journal for Numerical Methods in Fluids}, 11887 publisher = {John Wiley \& Sons}, 11888 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 11889} 11890 11891@InProceedings{ volkov08, 11892 author = {Vasily Volkov and James W. Demmel}, 11893 title = {Benchmarking GPUs to tune dense linear algebra}, 11894 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 11895 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 11896 year = {2008} 11897} 11898 11899@TechReport{ cray-mvmult, 11900 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 11901 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 11902 institution = {School of Computer Science, Carnegie Mellon University}, 11903 number = {CMU-CS-93-173}, 11904 month = aug, 11905 year = {1993} 11906} 11907 11908@Conference{ bell2009implementing, 11909 author = {Bell, N. and Garland, M.}, 11910 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 11911 and Analysis}, 11912 date-added = {2010-08-19 15:43:42 -0500}, 11913 date-modified = {2010-08-19 15:43:42 -0500}, 11914 organization = {ACM}, 11915 pages = {1--11}, 11916 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 11917 processors}, 11918 year = {2009} 11919} 11920 11921@Article{ bell2008efficient, 11922 author = {Bell, N. and Garland, M.}, 11923 date-added = {2010-08-19 15:43:36 -0500}, 11924 date-modified = {2010-08-19 15:43:36 -0500}, 11925 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 11926 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 11927 year = {2008} 11928} 11929 11930@Article{ cohen-fast, 11931 author = {Cohen, J. and Molemaker, M.J.}, 11932 date-added = {2010-08-19 15:43:34 -0500}, 11933 date-modified = {2010-08-19 15:43:34 -0500}, 11934 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 11935 pages = {414}, 11936 publisher = {DEStech Publications}, 11937 title = {A fast double precision CFD code using CUDA} 11938} 11939 11940@Article{ kazhdan2008streaming, 11941 author = {Kazhdan, M. and Hoppe, H.}, 11942 date-added = {2010-08-19 15:43:32 -0500}, 11943 date-modified = {2010-08-19 15:43:32 -0500}, 11944 journal = {ACM Transactions on Graphics (TOG)}, 11945 number = {3}, 11946 pages = {21}, 11947 publisher = {ACM}, 11948 title = {Streaming multigrid for gradient-domain operations on large images}, 11949 volume = {27}, 11950 year = {2008} 11951} 11952 11953@Article{ bonnet1998symmetric, 11954 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 11955 date-added = {2010-08-19 15:43:18 -0500}, 11956 date-modified = {2010-08-19 15:43:18 -0500}, 11957 journal = {Appl. Mech. Rev}, 11958 pages = {669--704}, 11959 title = {Symmetric {G}alerkin boundary element method.}, 11960 volume = {51}, 11961 year = {1998} 11962} 11963 11964@Conference{ zamith2007gpu, 11965 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 11966 Valente, L.}, 11967 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 11968 Entertainment}, 11969 date-added = {2010-08-19 15:43:14 -0500}, 11970 date-modified = {2010-08-19 15:43:14 -0500}, 11971 pages = {37--43}, 11972 title = {The {GPU} used as a math co-processor in real time applications}, 11973 year = {2007} 11974} 11975 11976@Article{ baskaran2009optimizing, 11977 author = {Baskaran, M.M. and Bordawekar, R.}, 11978 date-added = {2010-08-19 15:42:56 -0500}, 11979 date-modified = {2010-08-19 15:42:56 -0500}, 11980 journal = {IBM Research Report RC24704, IBM}, 11981 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 11982 year = {2009} 11983} 11984 11985@Misc{ szeliski2006locally, 11986 author = {Szeliski, R.}, 11987 date-added = {2010-08-19 15:42:45 -0500}, 11988 date-modified = {2010-08-19 15:42:45 -0500}, 11989 month = jul, 11990 note = {US Patent App. 11/459,724}, 11991 publisher = {Google Patents}, 11992 title = {Locally adapted hierarchical basis preconditioning}, 11993 year = {2006} 11994} 11995 11996@Article{ jung2006cholesky, 11997 author = {Jung, J.H. and O'Leary, D.P.}, 11998 date-added = {2010-08-19 15:42:34 -0500}, 11999 date-modified = {2010-08-19 15:42:34 -0500}, 12000 journal = {Scholarly Paper, University of Maryland}, 12001 publisher = {Citeseer}, 12002 title = {Cholesky decomposition and linear programming on a {GPU}}, 12003 year = {2006} 12004} 12005 12006@Conference{ filipovic2009gpu, 12007 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 12008 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 12009 date-added = {2010-08-19 15:42:33 -0500}, 12010 date-modified = {2010-08-19 15:42:33 -0500}, 12011 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 12012 Results}, 12013 year = {2009} 12014} 12015 12016@Article{ taylor2009modelling, 12017 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 12018 Atkinson, D. and Ourselin, S.}, 12019 date-added = {2010-08-19 15:42:23 -0500}, 12020 date-modified = {2010-08-19 15:42:23 -0500}, 12021 journal = {Medical Image Analysis}, 12022 number = {2}, 12023 pages = {234--244}, 12024 publisher = {Elsevier}, 12025 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 12026 solution and {GPU} execution}, 12027 volume = {13}, 12028 year = {2009} 12029} 12030 12031@Conference{ owens2007survey, 12032 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 12033 and Lefohn, A.E. and Purcell, T.J.}, 12034 booktitle = {Computer Graphics Forum}, 12035 date-added = {2010-08-19 15:42:21 -0500}, 12036 date-modified = {2010-08-19 15:42:21 -0500}, 12037 number = {1}, 12038 organization = {John Wiley \& Sons}, 12039 pages = {80--113}, 12040 title = {A survey of general-purpose computation on graphics hardware}, 12041 volume = {26}, 12042 year = {2007} 12043} 12044 12045@Article{ strzodka2005scientific, 12046 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 12047 date-added = {2010-08-19 15:42:18 -0500}, 12048 date-modified = {2010-08-19 15:42:18 -0500}, 12049 journal = {Simulation Modelling Practice and Theory}, 12050 number = {8}, 12051 pages = {667--680}, 12052 publisher = {Elsevier}, 12053 title = {Scientific computation for simulations on programmable graphics hardware}, 12054 volume = {13}, 12055 year = {2005} 12056} 12057 12058@Conference{ rumpf2001using, 12059 author = {Rumpf, M. and Strzodka, R.}, 12060 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 12061 (VIIP-01)}, 12062 date-added = {2010-08-19 15:42:15 -0500}, 12063 date-modified = {2010-08-19 15:42:15 -0500}, 12064 organization = {Citeseer}, 12065 pages = {193--202}, 12066 title = {Using graphics cards for quantized FEM computations}, 12067 year = {2001} 12068} 12069 12070@Article{ sirtori1992galerkin, 12071 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 12072 date-added = {2010-08-19 15:42:14 -0500}, 12073 date-modified = {2010-08-19 15:42:14 -0500}, 12074 journal = {International Journal for Numerical Methods in Engineering}, 12075 number = {2}, 12076 pages = {255--282}, 12077 publisher = {John Wiley \& Sons}, 12078 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 12079 implementation}, 12080 volume = {35}, 12081 year = {1992} 12082} 12083 12084@Article{ tejada2005large, 12085 author = {Tejada, E. and Ertl, T.}, 12086 date-added = {2010-08-19 15:42:09 -0500}, 12087 date-modified = {2010-08-19 15:42:09 -0500}, 12088 journal = {Simulation Modelling Practice and Theory}, 12089 number = {8}, 12090 pages = {703--715}, 12091 publisher = {Elsevier}, 12092 title = {Large steps in {GPU}-based deformable bodies simulation}, 12093 volume = {13}, 12094 year = {2005} 12095} 12096 12097@Article{ goddeke2008using, 12098 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 12099 and Becker, C. and Turek, S.}, 12100 date-added = {2010-08-19 15:42:06 -0500}, 12101 date-modified = {2010-08-19 15:42:06 -0500}, 12102 journal = {International Journal of Computational Science and Engineering}, 12103 number = {1}, 12104 pages = {36--55}, 12105 publisher = {Inderscience}, 12106 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 12107 volume = {4}, 12108 year = {2008} 12109} 12110 12111@Article{ garland2008parallel, 12112 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 12113 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 12114 date-added = {2010-08-19 15:41:51 -0500}, 12115 date-modified = {2010-08-19 15:41:51 -0500}, 12116 journal = {IEEE Micro}, 12117 number = {4}, 12118 pages = {13--27}, 12119 title = {Parallel computing experiences with CUDA}, 12120 volume = {28}, 12121 year = {2008} 12122} 12123 12124@Article{ wong1985method, 12125 author = {Wong, SH and Ciric, IR}, 12126 date-added = {2010-08-19 15:41:48 -0500}, 12127 date-modified = {2010-08-19 15:41:48 -0500}, 12128 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 12129 and Electronic Engineering}, 12130 publisher = {MCB UP Ltd}, 12131 title = {Method of conformal transformation for the finite-element solution of 12132 axisymmetric exterior-field problems}, 12133 volume = {4}, 12134 year = {1985} 12135} 12136 12137@Article{ turek-feast, 12138 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 12139 H.}, 12140 date-added = {2010-08-19 15:41:47 -0500}, 12141 date-modified = {2010-08-19 15:41:47 -0500}, 12142 journal = {Concurrency and Computation: Practice and Experience}, 12143 publisher = {John Wiley \& Sons}, 12144 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 12145 elements} 12146} 12147 12148@Article{ abedi2006space, 12149 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 12150 date-added = {2010-08-19 15:41:46 -0500}, 12151 date-modified = {2010-08-19 15:41:46 -0500}, 12152 journal = {Computer Methods in Applied Mechanics and Engineering}, 12153 number = {25-28}, 12154 pages = {3247--3273}, 12155 publisher = {Elsevier}, 12156 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 12157 element-wise momentum balance}, 12158 volume = {195}, 12159 year = {2006} 12160} 12161 12162@Conference{ georgii2005interactiveb, 12163 author = {Georgii, J. and Westermann, R.}, 12164 booktitle = {Proceedings of VMV}, 12165 date-added = {2010-08-19 15:41:36 -0500}, 12166 date-modified = {2010-08-19 15:41:36 -0500}, 12167 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 12168 year = {2005} 12169} 12170 12171@Article{ mosegaard2005gpu, 12172 author = {Mosegaard, J. and others}, 12173 date-added = {2010-08-19 15:41:35 -0500}, 12174 date-modified = {2010-08-19 15:41:35 -0500}, 12175 publisher = {IEEE Computer Society}, 12176 title = {{GPU} accelerated surgical simulators for complex morphology}, 12177 year = {2005} 12178} 12179 12180@Article{ meyer2007particle, 12181 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 12182 date-added = {2010-08-19 15:41:33 -0500}, 12183 date-modified = {2010-08-19 15:41:33 -0500}, 12184 journal = {IEEE Transactions on Visualization and Computer Graphics}, 12185 pages = {1015--1026}, 12186 publisher = {Published by the IEEE Computer Society}, 12187 title = {Particle systems for efficient and accurate high-order finite element 12188 visualization}, 12189 year = {2007} 12190} 12191 12192@Conference{ rumpf2001nonlinear, 12193 author = {Rumpf, M. and Strzodka, R.}, 12194 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 12195 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 12196 date-added = {2010-08-19 15:41:29 -0500}, 12197 date-modified = {2010-08-19 15:41:29 -0500}, 12198 organization = {Springer Verlag Wien}, 12199 pages = {75}, 12200 title = {Nonlinear diffusion in graphics hardware}, 12201 year = {2001} 12202} 12203 12204@Article{ georgii2005interactive, 12205 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 12206 date-added = {2010-08-19 15:41:28 -0500}, 12207 date-modified = {2010-08-19 15:41:28 -0500}, 12208 journal = {Simulation and Visualisation}, 12209 pages = {247--258}, 12210 publisher = {Citeseer}, 12211 title = {Interactive simulation of deformable bodies on {GPU}s}, 12212 volume = {2005}, 12213 year = {2005} 12214} 12215 12216@Article{ harish2007accelerating, 12217 author = {Harish, P. and Narayanan, P.}, 12218 date-added = {2010-08-19 15:41:27 -0500}, 12219 date-modified = {2010-08-19 15:41:27 -0500}, 12220 journal = {High Performance Computing--HiPC 2007}, 12221 pages = {197--208}, 12222 publisher = {Springer}, 12223 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 12224 year = {2007} 12225} 12226 12227@Article{ keunings1995parallel, 12228 author = {Keunings, R.}, 12229 date-added = {2010-08-19 15:41:19 -0500}, 12230 date-modified = {2010-08-19 15:41:19 -0500}, 12231 journal = {Computers and Chemical Engineering}, 12232 number = {6}, 12233 pages = {647--670}, 12234 publisher = {Oxford; New York: Pergamon Press, 1977-}, 12235 title = {Parallel finite element algorithms applied to computational rheology}, 12236 volume = {19}, 12237 year = {1995} 12238} 12239 12240@Conference{ taylor2007real, 12241 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12242 booktitle = {Proceedings of the 10th international conference on Medical image computing and 12243 computer-assisted intervention-Volume Part I}, 12244 date-added = {2010-08-19 15:41:17 -0500}, 12245 date-modified = {2010-08-19 15:41:17 -0500}, 12246 organization = {Springer-Verlag}, 12247 pages = {701--708}, 12248 title = {Real-time nonlinear finite element analysis for surgical simulation using 12249 graphics processing units}, 12250 year = {2007} 12251} 12252 12253@Article{ liu2000finite, 12254 author = {Liu, R. and Li, DY}, 12255 date-added = {2010-08-19 15:41:16 -0500}, 12256 date-modified = {2010-08-19 15:41:16 -0500}, 12257 journal = {Materials Science and Engineering A}, 12258 number = {1-2}, 12259 pages = {169--175}, 12260 publisher = {Elsevier}, 12261 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 12262 volume = {277}, 12263 year = {2000} 12264} 12265 12266@Conference{ kakadiaris1994active, 12267 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 12268 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 12269 date-added = {2010-08-19 15:41:15 -0500}, 12270 date-modified = {2010-08-19 15:41:15 -0500}, 12271 organization = {Citeseer}, 12272 pages = {980--980}, 12273 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 12274 physics-based approach}, 12275 year = {1994} 12276} 12277 12278@Conference{ de2004gpu, 12279 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 12280 booktitle = {Proceedings of Eurohaptics}, 12281 date-added = {2010-08-19 15:41:14 -0500}, 12282 date-modified = {2010-08-19 15:41:14 -0500}, 12283 organization = {Citeseer}, 12284 pages = {44--51}, 12285 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 12286 volume = {2004}, 12287 year = {2004} 12288} 12289 12290@Book{ taflove1995computational, 12291 author = {Taflove, A. and Hagness, S.C.}, 12292 date-added = {2010-08-19 15:41:14 -0500}, 12293 date-modified = {2010-08-19 15:41:14 -0500}, 12294 publisher = {Artech House Norwood, MA}, 12295 title = {Computational electrodynamics}, 12296 year = {1995} 12297} 12298 12299@Conference{ galoppo2005lu, 12300 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 12301 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 12302 date-added = {2010-08-19 15:41:13 -0500}, 12303 date-modified = {2010-08-19 15:41:13 -0500}, 12304 organization = {IEEE Computer Society}, 12305 pages = {3}, 12306 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 12307 hardware}, 12308 year = {2005} 12309} 12310 12311@Conference{ ryoo2008optimization, 12312 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 12313 and Hwu, W.W.}, 12314 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 12315 parallel programming}, 12316 date-added = {2010-08-19 15:41:12 -0500}, 12317 date-modified = {2010-08-19 15:41:12 -0500}, 12318 organization = {ACM}, 12319 pages = {73--82}, 12320 title = {Optimization principles and application performance evaluation of a multithreaded 12321 {GPU} using CUDA}, 12322 year = {2008} 12323} 12324 12325@Conference{ micikevicius20093d, 12326 author = {Micikevicius, P.}, 12327 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 12328 Units}, 12329 date-added = {2010-08-19 15:41:11 -0500}, 12330 date-modified = {2010-08-19 15:41:11 -0500}, 12331 organization = {ACM}, 12332 pages = {79--84}, 12333 title = {3D finite difference computation on {GPU}s using {CUDA}}, 12334 year = {2009} 12335} 12336 12337@Conference{ zhou2004pixel, 12338 author = {Zhou, Y. and Garland, M. and Haber, R.}, 12339 booktitle = {IEEE Visualization, 2004}, 12340 date-added = {2010-08-19 15:41:03 -0500}, 12341 date-modified = {2010-08-19 15:41:03 -0500}, 12342 pages = {425--432}, 12343 title = {Pixel-exact rendering of spacetime finite element solutions}, 12344 year = {2004} 12345} 12346 12347@Article{ komatitsch2009porting, 12348 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 12349 date-added = {2010-08-19 15:41:01 -0500}, 12350 date-modified = {2010-08-19 15:41:01 -0500}, 12351 journal = {Journal of Parallel and Distributed Computing}, 12352 number = {5}, 12353 pages = {451--460}, 12354 publisher = {Elsevier}, 12355 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 12356 graphics cards using CUDA}, 12357 volume = {69}, 12358 year = {2009} 12359} 12360 12361@Article{ komatitsch1998spectral, 12362 author = {Komatitsch, D. and Vilotte, J.P.}, 12363 date-added = {2010-08-19 15:40:59 -0500}, 12364 date-modified = {2010-08-19 15:40:59 -0500}, 12365 journal = {Bulletin of the Seismological Society of America}, 12366 number = {2}, 12367 pages = {368--392}, 12368 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 12369 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 12370 of 2D and 3D geological structures}, 12371 volume = {88}, 12372 year = {1998} 12373} 12374 12375@Article{ wu2005improved, 12376 author = {Wu, W. and Heng, P.A.}, 12377 date-added = {2010-08-19 15:40:59 -0500}, 12378 date-modified = {2010-08-19 15:40:59 -0500}, 12379 journal = {The Visual Computer}, 12380 number = {8}, 12381 pages = {707--716}, 12382 publisher = {Springer}, 12383 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 12384 cutting and deformation}, 12385 volume = {21}, 12386 year = {2005} 12387} 12388 12389@Article{ taylor2008high, 12390 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12391 date-added = {2010-08-19 15:40:57 -0500}, 12392 date-modified = {2010-08-19 15:40:57 -0500}, 12393 journal = {IEEE transactions on medical imaging}, 12394 number = {5}, 12395 pages = {650}, 12396 title = {High-speed nonlinear finite element analysis for surgical simulation using 12397 graphics processing units.}, 12398 volume = {27}, 12399 year = {2008} 12400} 12401 12402@Conference{ bolz2003sparse, 12403 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 12404 booktitle = {ACM SIGGRAPH 2003 Papers}, 12405 date-added = {2010-08-19 15:40:55 -0500}, 12406 date-modified = {2010-08-19 15:40:55 -0500}, 12407 organization = {ACM}, 12408 pages = {924}, 12409 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 12410 year = {2003} 12411} 12412 12413@Article{ wu2004hybrid, 12414 author = {Wu, W. and Heng, P.A.}, 12415 date-added = {2010-08-19 15:40:54 -0500}, 12416 date-modified = {2010-08-19 15:40:54 -0500}, 12417 journal = {Computer Animation and Virtual Worlds}, 12418 number = {3-4}, 12419 pages = {219--227}, 12420 publisher = {John Wiley \& Sons}, 12421 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 12422 3D soft tissue cutting}, 12423 volume = {15}, 12424 year = {2004} 12425} 12426 12427% ---------------------------------------------------------------------------------------------------------------- 12428@TechReport{ davis97, 12429 author = {T. Davis}, 12430 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 12431 institution = {University of Florida}, 12432 year = {1997} 12433} 12434 12435@Article{ davis2011, 12436 author = {Davis, T. A. and Hu, Y.}, 12437 title = {The {U}niversity of {F}lorida sparse matrix collection}, 12438 journal = {ACM Transactions on Mathematical Software}, 12439 volume = {38}, 12440 issue = {1}, 12441 year = {2011}, 12442 pages = {1--25} 12443} 12444 12445@Article{ davis2004algorithm, 12446 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 12447 author = {Davis, Timothy A}, 12448 journal = {ACM Transactions on Mathematical Software}, 12449 volume = {30}, 12450 number = {2}, 12451 pages = {196--199}, 12452 year = {2004}, 12453 publisher = {ACM} 12454} 12455 12456@TechReport{ streams, 12457 author = {J. D. McCalpin}, 12458 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 12459 institution = {University of Virginia}, 12460 url = {http://www.cs.virginia.edu/stream}, 12461 year = {1995} 12462} 12463 12464@Article{ areusken_1988b, 12465 author = {A. Reusken}, 12466 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 12467 mildly nonlinear boundary value problems}, 12468 journal = {Numer. Math.}, 12469 volume = {52}, 12470 year = {1988}, 12471 pages = {251--277} 12472} 12473 12474@Article{ areusken_1988c, 12475 author = {A. Reusken}, 12476 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 12477 journal = {Numer. Math.}, 12478 volume = {53}, 12479 year = {1988}, 12480 pages = {663--686} 12481} 12482 12483@Unpublished{ mgnet, 12484 title = {Multigrid Net; http://www.mgnet.org/}, 12485 author = {Craig Douglas}, 12486 note = {Contains enormous bibliography on multigrid publications}, 12487 year = {2009} 12488} 12489 12490@Unpublished{ copper, 12491 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 12492 author = {}, 12493 note = {Held bi-annually}, 12494 year = {2009} 12495} 12496 12497@Book{ wessling1992, 12498 author = {Pieter Wesseling}, 12499 title = {An Introduction to Multigrid Methods}, 12500 year = {2004}, 12501 publisher = {R. T. Edwards} 12502} 12503 12504@Book{ bhm2000, 12505 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 12506 title = {A Multigrid Tutorial}, 12507 year = {2000}, 12508 publisher = {SIAM} 12509} 12510 12511@Book{ trottenberg2001multigrid, 12512 title = {{Multigrid}}, 12513 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 12514 isbn = {012701070X}, 12515 year = {2001}, 12516 publisher = {Academic Press} 12517} 12518 12519@TechReport{ brandt1984, 12520 author = {Achi Brandt}, 12521 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 12522 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 12523 number = {GMD-Studien Nr. 85}, 12524 year = {1984} 12525} 12526 12527@Article{ yavneh1998coarse, 12528 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 12529 author = {Yavneh, I.}, 12530 journal = {SIAM Journal on Scientific Computing}, 12531 volume = {19}, 12532 number = {5}, 12533 pages = {1682--1699}, 12534 year = {1998}, 12535 publisher = {Society for Industrial and Applied Mathematics} 12536} 12537 12538@Article{ wan2003phase, 12539 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 12540 author = {Wan, WL and Chan, T.F.}, 12541 journal = {SIAM Journal on Scientific Computing}, 12542 volume = {25}, 12543 pages = {857}, 12544 year = {2003} 12545} 12546 12547@Article{ imex, 12548 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 12549 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 12550 journal = {SIAM Journel on Numerical Analysis}, 12551 volume = {32}, 12552 number = {3}, 12553 pages = {797--823}, 12554 year = {1995} 12555} 12556 12557@Article{ ow1, 12558 author = {T. Washio and C. W. Oosterlee}, 12559 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 12560 Recirculating Flow}, 12561 journal = {SIAM Journal on Scientific Computing}, 12562 volume = {21}, 12563 number = {5}, 12564 pages = {1670--1690}, 12565 year = {2000} 12566} 12567 12568@Article{ vm1, 12569 author = {V. A. Mousseau}, 12570 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 12571 Heat Conduction}, 12572 journal = {Journal Of Computational Physics}, 12573 volume = {200}, 12574 pages = {104--132}, 12575 year = {2004} 12576} 12577 12578@Article{ vm2, 12579 author = {V. A. Mousseau}, 12580 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 12581 journal = {Journal Of Heat Transfer}, 12582 volume = {127}, 12583 pages = {531--539}, 12584 year = {2005} 12585} 12586 12587@Misc{ salome1, 12588 author = {Laurent Dada and Daniel Caruge}, 12589 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 12590 Simulation}, 12591 year = {2005}, 12592 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 12593 note = {Presentation at an ESA/ESTEC conference} 12594} 12595 12596@InProceedings{ downar1, 12597 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 12598 A. Mousseau and D. E. Ebert}, 12599 title = {Application of a generalized interface module to the coupling of {PARCS} with 12600 both {RELAP5} and {TRAC-M}}, 12601 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 12602 year = {1999} 12603} 12604 12605@Article{ lopez1, 12606 author = {A. P. Lopez and J. B. Sandova}, 12607 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 12608 thermal-hydraulics}, 12609 journal = {Annals of Nuclear Energy}, 12610 volume = {32(6)}, 12611 pages = {621--634}, 12612 year = {2005} 12613} 12614 12615@InProceedings{ og-1996, 12616 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 12617 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 12618 Transport Code}, 12619 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 12620 Transport Codes}, 12621 editor = {}, 12622 publisher = {}, 12623 pages = {}, 12624 note = {Paris, France}, 12625 month = dec, 12626 year = {1996} 12627} 12628 12629@Article{ wo-2000, 12630 author = {P. Warner and C. R. E. de Oliveira}, 12631 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 12632 {EVENT} for Shielding Applications}, 12633 journal = {J. Nucl. Sci. and Tech.}, 12634 volume = {Supplement 1}, 12635 pages = {466--470}, 12636 year = {2000} 12637} 12638 12639@Unpublished{ gnep-web, 12640 author = {{U.S. Department of Energy}}, 12641 title = {Global Nuclear Energy Partnership ({GNEP})}, 12642 note = {\url{ http://www.gnep.energy.gov}}, 12643 year = {2007} 12644} 12645 12646@Book{ lewis-miller-1984, 12647 author = {E. E. Lewis and W. F. Miller, Jr.}, 12648 title = {Computational Methods of Neutron Transport}, 12649 address = {}, 12650 publisher = {Wiley}, 12651 year = {1984} 12652} 12653 12654@Article{ couple1, 12655 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 12656 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 12657 THE {IBM-704}}, 12658 journal = {Nuclear Sci. and Eng.}, 12659 year = {1959}, 12660 pages = {113--115}, 12661 volume = {2(1)} 12662} 12663 12664@InProceedings{ weber1, 12665 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 12666 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 12667 and component design}, 12668 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 12669 year = {2000} 12670} 12671 12672@Misc{ gnep:report, 12673 author = {Phillip Finck and David Keyes and Rick Stevens}, 12674 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 12675 Nuclear Energy Systems}}, 12676 year = {2006} 12677} 12678 12679@Misc{ subsurface-workshop-ref, 12680 author = {D. {Zachman (Chair)}}, 12681 title = {{Computational Subsurface Sciences Workshop}}, 12682 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 12683} 12684 12685@Misc{ fusion:report, 12686 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 12687 Panel}}, 12688 author = {{Fusion Energy Sciences Advisory Committee}}, 12689 year = {2002}, 12690 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 12691} 12692 12693@Misc{ hecrtf:report, 12694 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 12695 key = {HECRTF}, 12696 year = {2004}, 12697 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 12698} 12699 12700@Misc{ doesc20years, 12701 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 12702 key = {Office of Science, U.S. Department of Energy}, 12703 year = {2003}, 12704 howpublished = {Office of Science, U.S. Department of Energy, see 12705 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 12706} 12707 12708@PhDThesis{ karpeev-thesis, 12709 author = {D. A. Karpeyev}, 12710 title = {Geometric Integrators for Hamiltonian PDEs}, 12711 school = {Old Dominion University}, 12712 year = {2002} 12713} 12714 12715@InCollection{ fjp:ima, 12716 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12717 title = {The Scalability of Mesh Improvement Algorithms}, 12718 booktitle = {Algorithms for Parallel Processing}, 12719 publisher = {Springer-Verlag}, 12720 volume = {105}, 12721 series = {The IMA Volumes in Mathematics and Its Applications}, 12722 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 12723 year = {1998}, 12724 pages = {185--212} 12725} 12726 12727@InProceedings{ poet, 12728 author = {Rob Armstrong and Alex Cheung}, 12729 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 12730 for Scientific Distributed Computing}, 12731 booktitle = {Proceedings of {HICSS97}}, 12732 year = {1997} 12733} 12734 12735@Misc{ pseware-web-page, 12736 author = {}, 12737 title = {{PSEware} {Web} page}, 12738 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 12739 key = {{PSEware} {Web} page} 12740} 12741 12742@Article{ epperly2011high, 12743 title = {High-performance language interoperability for scientific computing through 12744 {B}abel}, 12745 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 12746 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 12747 journal = {International Journal of High Performance Computing Applications}, 12748 pages = {1094342011414036}, 12749 year = {2011}, 12750 publisher = {SAGE Publications} 12751} 12752 12753@Misc{ babel-web-page, 12754 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 12755 title = {{Babel} {Web} page}, 12756 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 12757} 12758 12759@Misc{ infospheres-web-page, 12760 author = {K.~M. {Chandy et al.}}, 12761 title = {{Infospheres} {W}eb page}, 12762 note = {\url{http://www.infospheres.caltech.edu}}, 12763 key = {{Infospheres} {Web} page} 12764} 12765 12766@Misc{ hammond, 12767 author = {Glenn Hammond}, 12768 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 12769 communication} 12770} 12771 12772@Misc{ ornl, 12773 author = {Oak Ridge National Laboratory}, 12774 title = {Private communication via petsc-maint email support} 12775} 12776 12777@Unpublished{ cumulvs-web-page, 12778 author = {}, 12779 title = {{Cumulvs} {W}eb page}, 12780 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 12781 key = {{Cumulvs} {W}eb page} 12782} 12783 12784@Article{ nonlineargmres, 12785 author = {T. Washio and C. W. Oosterlee}, 12786 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 12787 journal = {ETNA}, 12788 year = {1997}, 12789 pages = {271--290}, 12790 volume = {6} 12791} 12792 12793@Article{ pcice, 12794 author = {Richard C. Martineau and Ray A. Berry}, 12795 title = {The pressure-corrected ICE finite element method for compressible flows on 12796 unstructured meshes}, 12797 journal = {Journal of Computational Physics}, 12798 year = {2004}, 12799 pages = {659--685}, 12800 volume = {198(2)} 12801} 12802 12803@Article{ cumulvs97, 12804 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 12805 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 12806 Applications}, 12807 journal = {International Journal of Supercomputing Applications}, 12808 year = {1997} 12809} 12810 12811@TechReport{ daly2012interagency, 12812 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 12813 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 12814 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 12815 Paul Woodward}, 12816 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 12817 year = {2012}, 12818 publisher = {US Department of Defense} 12819} 12820 12821@Article{ karpeev1, 12822 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 12823 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 12824 journal = {J. Comp. Phys.}, 12825 year = {2001}, 12826 pages = {116--148}, 12827 volume = {173} 12828} 12829 12830@InProceedings{ scirun97, 12831 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 12832 title = {The {SCIRun} Computational Steering System}, 12833 booktitle = {Modern Software Tools in Scientific Computing}, 12834 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 12835 publisher = {Birkhauser Press}, 12836 year = {1997} 12837} 12838 12839@TechReport{ szyld, 12840 author = {Valeria Simoncini and Daniel B. Szyld}, 12841 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 12842 Computing}, 12843 year = {2002}, 12844 institution = {Department of Mathematics, Temple University}, 12845 number = {02-4-12} 12846} 12847 12848@TechReport{ pdelab, 12849 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 12850 and C. C. Chui and S. Markus}, 12851 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 12852 for {PDE} Based Applications}, 12853 year = {1994}, 12854 institution = {Department of Computer Sciences, Purdue University}, 12855 number = {CSD-TR-94-021} 12856} 12857 12858@Unpublished{ ilu-web-page, 12859 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 12860 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 12861 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 12862} 12863 12864@Unpublished{ doe2k-web-page, 12865 title = {{DOE2000 Initiative} {W}eb page}, 12866 note = {http://www.mcs.anl.gov/DOE2000}, 12867 key = {DOE2000 Initiative} 12868} 12869 12870@Misc{ pvode-web-page, 12871 title = {{PVODE} {W}eb Page}, 12872 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 12873 author = {A. {Hindmarsh et al.}} 12874} 12875 12876@Book{ szyperski97, 12877 author = {Clemens Szyperski}, 12878 title = {Component Software: Beyond Object-Oriented Programming}, 12879 publisher = {ACM Press}, 12880 address = {New York}, 12881 year = {1997} 12882} 12883 12884@Unpublished{ petsc:coloringuse, 12885 title = {Code for computing sparse {J}acobians}, 12886 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12887 institution = {Argonne National Laboratory} 12888} 12889 12890@Unpublished{ petsc:external, 12891 author = {B. F. {Smith et al.}}, 12892 title = {{External Software Used by PETSc}}, 12893 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12894 institution = {Argonne National Laboratory} 12895} 12896 12897@Unpublished{ petsc:use-by-external-packages, 12898 author = {B. F. {Smith et al.}}, 12899 title = {{Software Packages that Use or Interface to PETSc}}, 12900 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 12901 institution = {Argonne National Laboratory} 12902} 12903 12904@Unpublished{ petsc:prizes, 12905 author = {B. F. {Smith et al.}}, 12906 title = {{Prizes Won Using PETSc}}, 12907 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12908 institution = {Argonne National Laboratory} 12909} 12910 12911@Unpublished{ petsc:csgf, 12912 author = {B. F. {Smith et al.}}, 12913 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 12914 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12915 institution = {Argonne National Laboratory} 12916} 12917 12918@Unpublished{ flash-web-page, 12919 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 12920 {W}eb Page}, 12921 note = {http://www.asci.uchicago.edu}, 12922 author = {R. {Rosner et al.}}, 12923 institution = {University of Chicago} 12924} 12925 12926@Unpublished{ esi-web-page, 12927 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 12928 note = {http://z.ca.sandia.gov/esi}, 12929 author = {R. {Clay et al.}} 12930} 12931 12932@Unpublished{ infobus-web-page, 12933 title = {{I}nfo{B}us {W}eb Page}, 12934 note = {http://www.java.sun.com/beans/infobus}, 12935 key = {infobus} 12936} 12937 12938@Unpublished{ xray-web-page, 12939 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 12940 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 12941 note = {http://www.mcs.anl.gov/xray/}, 12942 institution = {Argonne National Laboratory} 12943} 12944 12945@InProceedings{ kohn98, 12946 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 12947 title = {Language Interoperability Mechanisms for High-Performance Scientific 12948 Applications}, 12949 publisher = {SIAM}, 12950 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12951 Scientific and Engineering Computing}, 12952 year = {1999}, 12953 pages = {30-39} 12954} 12955 12956@InProceedings{ kohn01, 12957 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 12958 title = {Divorcing Language Dependencies from a Scientific Software Library}, 12959 publisher = {SIAM}, 12960 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 12961 year = {2001} 12962} 12963 12964@InProceedings{ freitag_jones_plassmann98, 12965 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12966 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 12967 publisher = {SIAM}, 12968 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12969 Scientific and Engineering Computing}, 12970 year = {1999}, 12971 pages = {215-224} 12972} 12973 12974@Book{ templates, 12975 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 12976 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 12977 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 12978 Methods}, 12979 publisher = {SIAM}, 12980 year = {1994}, 12981 address = {Philadelphia, PA} 12982} 12983 12984@InProceedings{ parasha2, 12985 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 12986 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 12987 {PDE} Solutions}, 12988 booktitle = {SC97 Proceedings}, 12989 publisher = {IEEE Computer Society Press}, 12990 year = {1997} 12991} 12992 12993@TechReport{ parasha, 12994 author = {M. Parashar and J. C. Browne}, 12995 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 12996 Techniques}, 12997 institution = {Department of Computer Science, University of Texas at Austin}, 12998 year = {1995} 12999} 13000 13001@Article{ parti, 13002 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 13003 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 13004 Memory Architectures}, 13005 journal = {Journal of Parallel and Distributed Computing}, 13006 year = {1994}, 13007 volume = {22}, 13008 pages = {462--478} 13009} 13010 13011@Article{ mparti, 13012 author = {G. Agrawal and A. Sussman and J. Saltz}, 13013 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 13014 Block Structured Applications}, 13015 journal = {IEEE Trans. on Parallel and Distributed Systems}, 13016 volume = {6}, 13017 number = {7}, 13018 year = {1995} 13019} 13020 13021@Article{ gropp-lusk-doss-skjellum, 13022 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 13023 title = {A high-performance, portable implementation of the {MPI} Message Passing 13024 Interface standard}, 13025 journal = {Parallel Computing}, 13026 year = {1996}, 13027 volume = {22}, 13028 pages = {789--828} 13029} 13030 13031@InProceedings{ lam, 13032 author = {Greg Burns and Raja Daoud and James Vaigl}, 13033 title = {{LAM}: An Open Cluster Environment for {MPI}}, 13034 booktitle = {Proceedings of Supercomputing Symposium '94}, 13035 editor = {John W. Ross}, 13036 publisher = {University of Toronto}, 13037 pages = {379--386}, 13038 year = {1994} 13039} 13040 13041@Article{ cs99, 13042 author = {X.-C. Cai and M. Sarkis}, 13043 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 13044 systems}, 13045 journal = {SIAM J. Scientific Computing}, 13046 year = {1999}, 13047 volume = {21}, 13048 pages = {792-797} 13049} 13050 13051@Article{ cai2003restricted, 13052 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 13053 positive definite linear systems}, 13054 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 13055 journal = {SIAM Journal on Numerical Analysis}, 13056 volume = {41}, 13057 issue = {1}, 13058 pages = {1209--1231}, 13059 year = {2003}, 13060 doi = {10.1137/S0036142901389621} 13061} 13062 13063@TechReport{ caisaad, 13064 author = {Xiao-Chuan Cai and Youcef Saad}, 13065 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 13066 institution = {Army High Performance Computing Research Center, University of Minnesota }, 13067 year = {1993}, 13068 number = {Preprint 93-027 }, 13069 note = {SIAM J. Sci. Comp. (submitted)} 13070} 13071 13072@Book{ ruminations, 13073 author = {Andrew Koenig and Barbara Moo}, 13074 title = {Ruminations on C++}, 13075 year = {1996}, 13076 publisher = {Addison-Wesley} 13077} 13078 13079@Book{ mpi-complete, 13080 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 13081 Dongarra}, 13082 title = {{MPI}: The Complete Reference}, 13083 year = {1995}, 13084 publisher = {MIT Press} 13085} 13086 13087@Unpublished{ tcl-tk-web-page, 13088 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 13089 note = {http://www.sunlabs.com/research/tcl/}, 13090 year = {1996}, 13091 month = aug 13092} 13093 13094@Misc{ mpich-web-page, 13095 author = {William Gropp and {et. al.}}, 13096 title = {{MPICH} {W}eb page}, 13097 key = {MPICH}, 13098 url = {http://www.mpich.org}, 13099 howpublished = {\url{http://www.mpich.org}} 13100} 13101 13102@Article{ mpi-final, 13103 author = {MPI Forum}, 13104 title = {{MPI}: A Message-Passing Interface Standard}, 13105 journal = {International J. Supercomputing Applications}, 13106 volume = {8}, 13107 number = {3/4}, 13108 year = {1994}, 13109 key = {MPI Standard - final} 13110} 13111 13112@Unpublished{ npb-web-page, 13113 key = {NAS Parallel Benchmarks}, 13114 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 13115 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 13116 year = {1996}, 13117 month = dec 13118} 13119 13120@Book{ george81, 13121 title = {Computer Solution of Large Sparse Positive Definite Systems}, 13122 author = {Alan George and Joseph W. Liu}, 13123 publisher = {Prentice-Hall}, 13124 year = {1981}, 13125 key = {SparseDirect} 13126} 13127 13128@Book{ p4-book, 13129 title = {Portable Programs for Parallel Processors}, 13130 publisher = {Holt, Rinehart, {and} Winston}, 13131 year = {1987}, 13132 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 13133 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 13134 key = {P4Book} 13135} 13136 13137@Article{ stones, 13138 author = {H. L. Stone}, 13139 title = {Iterative solution of implicit approximations of multidimensional partial 13140 differential equations}, 13141 journal = {SIAM J. Numerical Analysis}, 13142 pages = {87--113}, 13143 volumne = {5}, 13144 year = {1968} 13145} 13146 13147@Article{ parallelstones, 13148 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 13149 title = {Parallel versions of {S}tones strongly implicit algorithm}, 13150 journal = {Concurrency and Computation: Practice and Experience}, 13151 pages = {1049--1062}, 13152 volumne = {13}, 13153 year = {2001} 13154} 13155 13156@Article{ p4-paper, 13157 author = {Ralph Butler and Ewing Lusk}, 13158 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 13159 journal = {Journal of Parallel Computing}, 13160 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 13161 Division preprint P362-0493)}, 13162 year = {1993} 13163} 13164 13165@TechReport{ picl, 13166 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 13167 title = {{PICL}: A portable instrumented communications library}, 13168 institution = {Oak Ridge National Laboratory}, 13169 number = {TM-11130}, 13170 year = {1990}, 13171 key = {PICL} 13172} 13173 13174@TechReport{ upshot, 13175 author = {Virginia Herrarte and Ewing Lusk}, 13176 title = {Studying Parallel Program Behavior with {U}pshot}, 13177 institution = {Argonne National Laboratory}, 13178 number = {ANL-91/15}, 13179 month = aug, 13180 year = {1991}, 13181 key = {Upshot} 13182} 13183 13184@TechReport{ p4-manual, 13185 author = {Ralph Butler and Ewing Lusk}, 13186 title = {User's Guide to the p4 Parallel Programming System}, 13187 institution = {Argonne National Laboratory}, 13188 number = {ANL-92/17}, 13189 month = oct, 13190 year = {1992}, 13191 key = {p4-Manual} 13192} 13193 13194@InProceedings{ oldparti, 13195 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 13196 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 13197 booktitle = {Proceedings of Supercomputing '93}, 13198 pages = {578--587}, 13199 year = {1993} 13200} 13201 13202@Article{ parti2, 13203 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 13204 and J. Saltz}, 13205 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 13206 journal = {ACM SIGPLAN Notices}, 13207 year = {1995}, 13208 pages = {68-79}, 13209 volume = {30}, 13210 number = {8} 13211} 13212 13213@Article{ parti3, 13214 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 13215 title = {Run-Time Parallelization and Scheduling of Loops}, 13216 journal = {IEEE Trans. Computers}, 13217 year = {1991}, 13218 pages = {604-612}, 13219 volume = {40}, 13220 number = {5} 13221} 13222 13223@InProceedings{ disz-lusk:wamtrace, 13224 author = {Terrence Disz and Ewing Lusk}, 13225 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 13226 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13227 year = {1987}, 13228 pages = {46--53} 13229} 13230 13231@InProceedings{ gorlick-kesselman:gauge, 13232 author = {Michael Gorlick and Carl Kesselman}, 13233 title = {Timing {Prolog} programs without Clocks}, 13234 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13235 year = {1996}, 13236 publisher = {Birkhauser} 13237} 13238 13239@TechReport{ aztec, 13240 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 13241 title = {Aztec User's Guide Version 1.1}, 13242 institution = {Sandia National Laboratories}, 13243 month = oct, 13244 year = {1995}, 13245 number = {SAND95/1559} 13246} 13247 13248@TechReport{ aztec2, 13249 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 13250 title = {Official {Aztec} User's Guide Version 2.1}, 13251 institution = {Sandia National Laboratories}, 13252 year = {1999} 13253} 13254 13255@Book{ taylor-chandy:pcn, 13256 author = {Chandy, M. and Taylor, S.}, 13257 title = {An Introduction to Parallel Programming}, 13258 year = {1991}, 13259 publisher = {Jones and Bartlett} 13260} 13261 13262@Book{ foster-taylor:strand, 13263 title = {Strand: New Concepts in Parallel Programming}, 13264 author = {Ian Foster and Stephen Taylor}, 13265 publisher = {Prentice-Hall}, 13266 adress = { Englewood Cliffs, New Jersey}, 13267 year = {1990} 13268} 13269 13270@Article{ aurora, 13271 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 13272 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 13273 Carlsson and A. Ciepielewski and B. Hausman}, 13274 title = {The Aurora OR-Parallel Prolog System}, 13275 journal = {New Generation Computing}, 13276 volume = {7}, 13277 number = {3}, 13278 year = {1990}, 13279 pages = {243--271} 13280} 13281 13282@TechReport{ roo, 13283 author = {E. Lusk and W. McCune and J. Slaney}, 13284 title = {Roo---a Parallel Theorem Prover}, 13285 institution = {Argonne National Laboratory}, 13286 number = {MCS--TM--149}, 13287 year = {1991} 13288} 13289 13290@TechReport{ heath-etheridge:vppp, 13291 author = {M. T. Heath and J. A. Etheridge}, 13292 title = {Visualizing the Performance of Parallel Programs}, 13293 institution = {Oak Ridge National Laboratory}, 13294 number = {ORNL TM-11813}, 13295 year = {1991} 13296} 13297 13298@TechReport{ chem:vis, 13299 author = {Ewing L. Lusk}, 13300 title = {Performance Visualization for Parallel Programs}, 13301 institution = {Argonne National Laboratory}, 13302 number = {ANL/MCS--P287--0192}, 13303 year = {1991}, 13304 note = {(to appear in {\em Theoretica Chimica Acta})} 13305} 13306 13307@TechReport{ picltrace, 13308 author = {P.~H.~Worley}, 13309 title = {A new {PICL} trace file format}, 13310 institution = {Oak Ridge National Laboratory}, 13311 number = {ORNL TM-12125}, 13312 month = jun, 13313 year = {1992} 13314} 13315 13316@InProceedings{ hideo, 13317 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 13318 title = {Inference of Phylogenetic trees using maximum likelihood}, 13319 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 13320 year = {1992}, 13321 pages = {247--262} 13322} 13323 13324@InProceedings{ dw90, 13325 author = {M. Dryja and O. Widlund}, 13326 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 13327 Problems}, 13328 booktitle = {Third International Symposium on Domain Decomposition Methods}, 13329 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 13330 year = {1990}, 13331 pages = {3-21}, 13332 publisher = {SIAM}, 13333 address = {Philadelphia}, 13334 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 13335 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 13336 references, good introduction to the theory. No computations}, 13337 key = {DryjaWidlund90 !AS} 13338} 13339 13340@Unpublished{ rosing, 13341 author = {Matt Rosing and Joel Saltz}, 13342 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 13343 key = {LowLatency}, 13344 note = {manuscript, 1992} 13345} 13346 13347@TechReport{ jp:incomplete, 13348 author = {Mark T. Jones and Paul E. Plassmann}, 13349 title = {An Improved Incomplete {C}holesky Factorization}, 13350 institution = {Argonne National Laboratory}, 13351 address = {Argonne, IL}, 13352 type = {Preprint}, 13353 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 13354 number = {MCS-P206-0191}, 13355 year = {1991}, 13356 key = {jones} 13357} 13358 13359@InCollection{ jp:ima, 13360 author = {Mark Jones and Paul Plassmann}, 13361 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 13362 booktitle = {Graph Theory and Sparse Matrix Computation}, 13363 publisher = {Springer-Verlag}, 13364 series = {The IMA Volumes in Mathematics and Its Applications}, 13365 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 13366 volume = {56}, 13367 year = {1993}, 13368 pages = {229--245} 13369} 13370 13371@Article{ pw98, 13372 author = {M. Pernice and H. F. Walker}, 13373 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 13374 journal = {SIAM J. Sci. Stat. Comput.}, 13375 year = {1998}, 13376 volume = {19}, 13377 pages = {302--318} 13378} 13379 13380@TechReport{ ysmp83, 13381 key = {Eisenstat}, 13382 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13383 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13384 institution = {Department of Computer Science, Yale University}, 13385 number = {YALE/DCS/RR-265}, 13386 month = apr, 13387 year = {1983} 13388} 13389 13390@InBook{ ysmp84, 13391 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13392 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13393 title = {Elliptic Problem Solvers II}, 13394 publisher = {Academic Press}, 13395 pages = {45--52}, 13396 editors = {G. Birkhoff and A. Schoenstadt}, 13397 year = {1984} 13398} 13399 13400@TechReport{ sparsekit, 13401 key = {Saad}, 13402 author = {Youcef Saad}, 13403 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 13404 institution = {Center for Supercomputing Research and Development, University of Illinois at 13405 Urbana-Champaign}, 13406 number = {1029}, 13407 year = {1990} 13408} 13409 13410@TechReport{ pde-user-ref, 13411 author = {Barry F. Smith}, 13412 title = {Extensible {PDE} Solvers Package Users Manual}, 13413 institution = {Argonne National Laboratory}, 13414 month = sep, 13415 year = {1994}, 13416 number = {ANL-93/40}, 13417 key = {Smith94 ! PDE} 13418} 13419 13420@TechReport{ bs-user-ref, 13421 author = {Mark T. Jones and Paul E. Plassmann}, 13422 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 13423 of Sparse Linear Systems}, 13424 institution = {Argonne National Laboratory}, 13425 month = dec, 13426 year = {1995}, 13427 number = {ANL-95/48} 13428} 13429 13430@TechReport{ snes-user-ref, 13431 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 13432 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 13433 institution = {Argonne National Laboratory}, 13434 month = feb, 13435 year = {1995}, 13436 number = {ANL/MCS-TM-193}, 13437 key = {GroppMcInnesSmith95 ! SNES} 13438} 13439 13440@TechReport{ sles-user-ref, 13441 author = {William D. Gropp and Barry F. Smith}, 13442 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 13443 institution = {Argonne National Laboratory}, 13444 month = mar, 13445 year = {1993}, 13446 number = {ANL-93/8}, 13447 key = {GroppSmith93 ! SLES} 13448} 13449 13450@TechReport{ chameleon-user-ref, 13451 author = {William D. Gropp and Barry F. Smith}, 13452 title = {Chameleon Parallel programming tools Users Manual}, 13453 institution = {Argonne National Laboratory}, 13454 month = mar, 13455 year = {1993}, 13456 number = {ANL-93/23}, 13457 key = {GroppSmith93 ! Chameleon} 13458} 13459 13460@Article{ euclid2, 13461 author = {D. Hysom and A. Pothen}, 13462 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 13463 journal = {SIAM J. Sci. Comput.}, 13464 volume = {22}, 13465 number = {6}, 13466 pages = {2194--2215} 13467} 13468 13469@TechReport{ euclid1, 13470 author = {D. Hysom and A. Pothen}, 13471 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 13472 Solution of Sparse Linear Systems)}, 13473 institution = {Old Dominion University}, 13474 year = {2001} 13475} 13476 13477@TechReport{ ksp-user-ref, 13478 author = {William D. Gropp and Barry F. Smith}, 13479 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 13480 Methods}, 13481 institution = {Argonne National Laboratory}, 13482 month = aug, 13483 year = {1993}, 13484 number = {ANL-93/30}, 13485 key = {GroppSmith93 ! KSP} 13486} 13487 13488@TechReport{ mpi-chameleon, 13489 author = {William D. Gropp and Ewing Lusk}, 13490 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 13491 institution = {Argonne National Laboratory}, 13492 month = dec, 13493 year = {1992}, 13494 number = {ANL-92/47}, 13495 key = {GroppLusk92 ! MPI} 13496} 13497 13498@TechReport{ blockcomm-fortran, 13499 author = {William D. Gropp}, 13500 title = {Block{C}omm for {F}ortran}, 13501 institution = {Argonne National Laboratory}, 13502 month = may, 13503 year = {1993}, 13504 number = {ANL-93/00 (to appear)}, 13505 key = {Gropp93 ! BlockComm} 13506} 13507 13508@TechReport{ autodocument, 13509 author = {William D. Gropp}, 13510 title = {Automatic documentation of {C} programs}, 13511 institution = {Argonne National Laboratory}, 13512 month = may, 13513 year = {1993}, 13514 number = {ANL-93/00}, 13515 key = {Gropp93 ! Autodoc} 13516} 13517 13518@TechReport{ zipcode, 13519 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 13520 Manfred Morari}, 13521 title = {The {Z}ipcode message-passing system}, 13522 institution = {Lawrence Livermore National Laboratory}, 13523 month = sep, 13524 year = {1992}, 13525 number = {Unpublished}, 13526 key = {Skjellum92 ! Zipcode} 13527} 13528 13529@Article{ paragraph, 13530 author = {Michael T. Heath and Jennifer Etheridge Finger}, 13531 title = {Visualizing performance of parallel programs}, 13532 journal = {IEEE Software}, 13533 volume = {8}, 13534 number = {5}, 13535 month = sep, 13536 year = {1991}, 13537 pages = {29--39}, 13538 key = {Heath91 ! Paragraph} 13539} 13540 13541@Article{ gropp90, 13542 author = {William Gropp and Edward Smith}, 13543 title = {Computational Fluid Dynamics on Parallel Processors}, 13544 journal = {Computers and Fluids}, 13545 volume = {18}, 13546 year = {1990}, 13547 pages = {289--304}, 13548 key = {Gropp90 ! performance} 13549} 13550 13551@Article{ foster92, 13552 author = {Ian Foster and William Gropp and Rick Stevens}, 13553 title = {The parallel scalability of the spectral transform method}, 13554 journal = {Monthly Weather Review}, 13555 volume = {120}, 13556 year = {1992}, 13557 pages = {835--850}, 13558 key = {Foster92 ! performance} 13559} 13560 13561@InBook{ fgn, 13562 author = {R. Freund and G. H. Golub and N. Nachtigal}, 13563 title = {Iterative Solution of Linear Systems}, 13564 series = {Acta Numerica}, 13565 year = {1992}, 13566 publisher = {Cambridge University Press}, 13567 pages = {57--100} 13568} 13569 13570@TechReport{ nachtigal90, 13571 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 13572 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13573 institution = {Massachusetts Institute of Technology}, 13574 month = mar, 13575 year = {1990}, 13576 number = {90-2}, 13577 key = {Nachtigal | Krylov} 13578} 13579 13580@Article{ nachtigal1992fnm, 13581 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13582 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 13583 journal = {SIAM Journal on Matrix Analysis and Applications}, 13584 volume = {13}, 13585 pages = {778}, 13586 year = {1992}, 13587 publisher = {SIAM} 13588} 13589 13590@TechReport{ embree1999descriptive, 13591 title = {How descriptive are {GMRES} convergence bounds}, 13592 author = {Embree, M.}, 13593 year = {1999}, 13594 number = {08}, 13595 institution = {Oxford University Computing Laboratory} 13596} 13597 13598@Article{ vorst92, 13599 author = {H. van der Vorst}, 13600 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 13601 of nonsymmetric linear systems}, 13602 journal = {SIAM J. Sci. Stat. Comput.}, 13603 year = {1992}, 13604 volume = {13}, 13605 pages = {631--644} 13606} 13607 13608@Article{ eisenstat81, 13609 author = {S. Eisenstat}, 13610 title = {Efficient Implementation of a Class of {CG} Methods}, 13611 journal = {SIAM J. Sci. Stat. Comput.}, 13612 year = {1981}, 13613 volume = {2}, 13614 pages = {1--4} 13615} 13616 13617@Manual{ ibm-essl, 13618 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 13619 Reference}, 13620 organization = {IBM}, 13621 year = {1992}, 13622 key = {IBM-ESSL} 13623} 13624 13625@Manual{ ibm-eui, 13626 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 13627 Release 2.0}, 13628 organization = {IBM}, 13629 month = jun, 13630 year = {1994}, 13631 key = {IBM-EUI} 13632} 13633 13634@Manual{ ibm-euih, 13635 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 13636 organization = {IBM}, 13637 author = {Peter Hochschild}, 13638 year = {1993}, 13639 key = {IBM-EUIH} 13640} 13641 13642@TechReport{ mpi, 13643 title = {Document for a Standard Message-Passing Interface}, 13644 author = {Message Passing Interface Forum}, 13645 institution = {University of Tennessee}, 13646 number = {CS-93-214}, 13647 month = nov, 13648 year = {1993}, 13649 key = {MPI Standard} 13650} 13651 13652@Unpublished{ mpi-final-web, 13653 author = {Message Passing Interface Forum}, 13654 title = {{MPI}: A Message-Passing Interface Standard}, 13655 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 13656 year = {1994}, 13657 month = may 13658} 13659 13660@Book{ hockney-jesshope, 13661 author = {R. W. Hockney and C. R. Jesshope}, 13662 title = {Parallel Computers 2}, 13663 publisher = {Adam Hilger}, 13664 year = {1988} 13665} 13666 13667@Book{ cm-fortran, 13668 author = {{Thinking Machines Corporation}}, 13669 title = {Users Manual for CM-Fortran}, 13670 publisher = {Thinking Machines Corporation}, 13671 year = {1993} 13672} 13673 13674@TechReport{ chang93, 13675 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 13676 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 13677 institution = {Yale Department of Computer Science}, 13678 number = {YALEU/DCS/RR-994}, 13679 month = nov, 13680 year = {1993}, 13681 key = {BDD|diag} 13682} 13683 13684@InProceedings{ gropplevine93, 13685 author = {N. Galbreath and W. Gropp and D. Levine}, 13686 title = {Applications-Driven Parallel {I/O}}, 13687 booktitle = {Proceedings of Supercomputing '93}, 13688 year = {1993}, 13689 pages = {462--471} 13690} 13691 13692@Book{ siegle85, 13693 author = {H. J. Siegel}, 13694 title = {Interconnection Networks for Large Scale Parallel Processing}, 13695 publisher = {Lexington Books}, 13696 year = {1985}, 13697 key = {Network Comparison} 13698} 13699 13700@Article{ lawrie75, 13701 author = {D. H. Lawrie}, 13702 title = {Access and alignment of data in an array processor}, 13703 journal = {IEEE Transactions on Computers}, 13704 volume = {C-24}, 13705 number = {12}, 13706 month = dec, 13707 year = {1975}, 13708 pages = {1145--1155}, 13709 key = {Omega Network} 13710} 13711 13712@Book{ knuth1986, 13713 title = {The {\TeX}{Book}}, 13714 author = {Donald Ervin Knuth and Duane Bibby}, 13715 volume = {1993}, 13716 year = {1986}, 13717 publisher = {Addison-Wesley Reading, Massachusetts} 13718} 13719 13720@Book{ lamport86, 13721 author = {Leslie Lamport}, 13722 title = {{LaTeX}: A document preparation system}, 13723 publisher = {Addison-Wesley}, 13724 year = {1986}, 13725 key = {Latex Manual} 13726} 13727 13728@InProceedings{ gropp-lusk:unix-tools, 13729 author = {William Gropp and Ewing Lusk}, 13730 title = {Scalable {U}nix Tools on Parallel Processors}, 13731 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 13732 publisher = {IEEE}, 13733 pages = {56--62} 13734} 13735 13736@InProceedings{ jp:bell_prize, 13737 author = {Mark Jones and Paul Plassmann}, 13738 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 13739 Applications}, 13740 booktitle = {Proceedings of Supercomputing '92}, 13741 publisher = {IEEE Computer Society Press}, 13742 year = {1992}, 13743 pages = {551--560} 13744} 13745 13746@COMMENT{WEB, CWEB references (for doctext)} 13747@TechReport{ web, 13748 author = {Donald E. Knuth}, 13749 title = {The {\tt WEB} system of structured documentation}, 13750 institution = {Computer Science Department, Stanford University}, 13751 year = {1983}, 13752 number = {980}, 13753 month = sep 13754} 13755 13756@Article{ literatepgm, 13757 author = {Donald E. Knuth}, 13758 title = {Literate Programming}, 13759 journal = {Computer Journal}, 13760 year = {1984}, 13761 volume = {27}, 13762 number = {2}, 13763 pages = {91--111} 13764} 13765 13766@Unpublished{ cweb-code, 13767 author = {Silvio Levy and Donald E. Knuth}, 13768 title = {CWEB}, 13769 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 13770} 13771 13772@Article{ jp:scalable, 13773 author = {Mark Jones and Paul Plassmann}, 13774 title = {Scalable Iterative Solution of Sparse Linear Systems}, 13775 journal = {Parallel Computing}, 13776 volume = {20}, 13777 number = {5}, 13778 month = may, 13779 year = {1994}, 13780 pages = {753--773} 13781} 13782 13783@Article{ jp:pcolor, 13784 author = {Mark T. Jones and Paul E. Plassmann}, 13785 title = {A Parallel Graph Coloring Heuristic}, 13786 journal = {SIAM J. Sci. Comput.}, 13787 volume = {14}, 13788 number = {3}, 13789 pages = {654-669}, 13790 year = {1993} 13791} 13792 13793@TechReport{ block_solve, 13794 author = {Mark T. Jones and Paul E. Plassmann}, 13795 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 13796 Sparse Linear Systems}, 13797 institution = {Argonne National Laboratory}, 13798 year = {1992}, 13799 number = {ANL-92/46}, 13800 key = {JonesPlassmann92 ! block_solve} 13801} 13802 13803@InProceedings{ supercond, 13804 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 13805 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 13806 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 13807 Conference}, 13808 month = feb, 13809 year = {1994}, 13810 key = {McInnesPalumbo94 ! superconductivity } 13811} 13812 13813@Unpublished{ preosti:93, 13814 author = {Gianfranco Preosti}, 13815 title = { }, 13816 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 13817 year = {1993}, 13818 key = {preosti93 ! GL-tilt3d} 13819} 13820 13821@Unpublished{ more:93, 13822 author = {Jorge J. Mor\'{e}}, 13823 title = { }, 13824 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 13825 {A}rgonne {N}ational {L}aboratory}, 13826 year = {1993}, 13827 key = {more93 ! MINPACK-2} 13828} 13829 13830@Article{ brownsaad:90, 13831 author = {Peter N. Brown and Youcef Saad}, 13832 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 13833 journal = {SIAM J. Sci. Stat. Comput.}, 13834 year = {1990}, 13835 volume = {11}, 13836 pages = {450-481} 13837} 13838 13839@Book{ using-mpi, 13840 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 13841 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 13842 publisher = {MIT Press}, 13843 year = {1994} 13844} 13845 13846@Book{ using-mpi2, 13847 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 13848 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 13849 publisher = {MIT Press}, 13850 year = {1999} 13851} 13852 13853@Article{ hs:52, 13854 author = {Magnus R. Hestenes and Eduard Steifel}, 13855 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 13856 journal = {J. Research of the National Bureau of Standards}, 13857 year = {1952}, 13858 volume = {49}, 13859 pages = {409-436} 13860} 13861 13862@Article{ so:89, 13863 author = {Peter Sonneveld}, 13864 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 13865 journal = {SIAM J. Sci. Stat. Comput.}, 13866 year = {1989}, 13867 volume = {10}, 13868 pages = {36-52} 13869} 13870 13871@Article{ v:92, 13872 author = {{H. A.} {van der Vorst}}, 13873 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 13874 of nonsymmetric linear systems}, 13875 journal = {SIAM J. Sci. Stat. Comput.}, 13876 volume = {13}, 13877 year = {1992}, 13878 pages = {631-644} 13879} 13880 13881@Article{ f:93, 13882 author = {Roland W. Freund}, 13883 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 13884 Systems}, 13885 journal = {SIAM J. Sci. Stat. Comput.}, 13886 volume = {14}, 13887 year = {1993}, 13888 pages = {470-482} 13889} 13890 13891@Article{ ish:89, 13892 author = {S. Ishizuka}, 13893 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 13894 journal = {Combustion and Flame}, 13895 volume = {75}, 13896 year = {1989}, 13897 pages = {367-379} 13898} 13899 13900@Book{ williams89, 13901 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 13902 author = {F.A. Williams}, 13903 publisher = {Addison-Wesley}, 13904 year = {1989}, 13905 pages = {367-379} 13906} 13907 13908@Book{ ra75, 13909 author = {R. Aris}, 13910 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 13911 publisher = {Oxford}, 13912 year = {1975} 13913} 13914 13915@Book{ bebernes89, 13916 author = {J. Bebernes and D. Eberly}, 13917 title = {Mathematical Problems from Combustion Theory}, 13918 publisher = {Springer-Verlag}, 13919 series = {Applied Mathematical Sciences 83}, 13920 year = {1989} 13921} 13922 13923@InProceedings{ kikuchi89, 13924 author = {F. Kikuchi}, 13925 booktitle = { Computing Methods in Applied Sciences and Engineering}, 13926 editor = {R. Glowinski and J. L. Lions}, 13927 publisher = {Springer-Verlag}, 13928 series = {Lecture Notes in Mathematics}, 13929 title = {Finite element approximations to bifurcation problems of turning point type}, 13930 year = {1977} 13931} 13932 13933@Article{ rg85, 13934 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 13935 title = {Continuation-conjugate Gradient Methods for the Least Squares Solution of 13936 Nonlinear Boundary Problems}, 13937 journal = {SIAM J. Sci. Stat. Comput.}, 13938 volume = {6}, 13939 year = {1985}, 13940 pages = {793-832} 13941} 13942 13943@InProceedings{ whitfield91, 13944 author = {D. Whitfield and L. Taylor}, 13945 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13946 Schemes}, 13947 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 13948 misc = {AIAA-91-1539}, 13949 pages = {134-145}, 13950 year = {1991} 13951} 13952 13953@InProceedings{ quinlan1, 13954 author = {M. Lemke and D. Quinlan}, 13955 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 13956 Architecture-Independent Development of Structured Grid Applications}, 13957 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 13958 publisher = {Springer Verlag}, 13959 year = {1992} 13960} 13961 13962@InProceedings{ quinlan2, 13963 author = {R. Parsons and D. Quinlan}, 13964 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 13965 Computations}, 13966 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 13967 year = {1994} 13968} 13969 13970% ***** Overview of functionality in Diffpack 13971@InBook{ dpoverview, 13972 author = {Bruaset, A. M. and Langtangen, H. P.}, 13973 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13974 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 13975 {Diffpack}}, 13976 publisher = {Birkh{\"{a}}user}, 13977 pages = {61--90}, 13978 year = {1997} 13979} 13980 13981% ***** Short overview of Diffpack 13982@InCollection{ dpoverview2, 13983 author = {Bruaset, A. M. and Langtangen, H. P.}, 13984 editor = {A. Sydow}, 13985 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 13986 and Applied Mathematics}, 13987 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 13988 pages = {553--558}, 13989 volume = {4}, 13990 year = {1997} 13991} 13992 13993% ***** Comprehensive documentation of Diffpack and 13994% associated numerical methods: 13995@Book{ dpbook, 13996 author = {H. P. Langtangen}, 13997 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 13998 Software. Part I}, 13999 series = {Lecture Notes in Computational Science and Engineering}, 14000 publisher = {Springer-Verlag}, 14001 year = {1998} 14002} 14003 14004% ***** Design issues of the linear solvers in Diffpack, serves also as a 14005% collection of examples on O-O in numerical computing 14006@Article{ ambhpl97a, 14007 author = {A. M. Bruaset and H. P. Langtangen }, 14008 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 14009 journal = {Transactions on Mathematical Software}, 14010 volume = {23 }, 14011 pages = {50--80}, 14012 year = {1997} 14013} 14014 14015@Misc{ dpurl, 14016 author = {{Diffpack Web page}}, 14017 howpublished = {\url{http://www.diffpack.com}} 14018} 14019 14020% ***** General intro to object-oriented numerics for "FORTRAN programmers" 14021@InCollection{ oonintro, 14022 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 14023 editor = {D{\ae}hlen, M. and Tveito, A.}, 14024 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14025 title = {Object-Oriented Numerics}, 14026 publisher = {Birkh{\"{a}}user}, 14027 year = {1997} 14028} 14029 14030% ***** Efficiency comparison: BLAS 1, Diffpack, C, 14031% and finite element applications (F77 vs Diffpack) 14032@InCollection{ dpefficiency, 14033 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 14034 H. P. and Miller, C. T.}, 14035 editor = {D{\ae}hlen, M. and Tveito, A.}, 14036 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14037 title = {On the Efficiency of {C++} in Scientific Computing}, 14038 publisher = {Birkh{\"{a}}user}, 14039 pages = {91--118}, 14040 year = {1997} 14041} 14042 14043% ***** Parallel concept in Diffpack: 14044@InCollection{ dpparallel, 14045 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 14046 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 14047 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 14048 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 14049 Simulators}, 14050 publisher = {Springer--Verlag}, 14051 series = {Lecture Notes in Computer Science}, 14052 pages = {161--168}, 14053 year = {1997} 14054} 14055 14056% ***** DD and ML methods in Diffpack: 14057@InCollection{ dpddml, 14058 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 14059 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 14060 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 14061 title = {Domain decomposition and multilevel methods in Diffpack}, 14062 year = {1997} 14063} 14064 14065@InProceedings{ bsca98, 14066 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 14067 Alexander}, 14068 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 14069 Optimization}, 14070 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14071 Scientific and Engineering Computing}, 14072 editor = {Mike Henderson et al.}, 14073 pages = {165-173}, 14074 year = {1998} 14075} 14076 14077@Book{ scalapack-user-guide, 14078 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 14079 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 14080 Stanley and D. Walker and R. C. Whaley}, 14081 title = {Sca{LAPACK} Users' Guide}, 14082 publisher = {SIAM}, 14083 address = {Philadelphia, PA}, 14084 year = {1997} 14085} 14086 14087@InProceedings{ keyes99, 14088 author = {D. E. Keyes}, 14089 title = {How Scalable is Domain Decomposition in Practice?}, 14090 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 14091 Methods}, 14092 editor = {C.-H. Lai et al.}, 14093 publisher = {Domain Decomposition Press, Bergen}, 14094 note = {To appear}, 14095 year = {1999} 14096} 14097 14098@Article{ fun3d, 14099 author = {W. K. Anderson and D. L. Bonhaus}, 14100 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 14101 grids}, 14102 journal = {Computers and Fluids}, 14103 year = {1994}, 14104 volume = {23}, 14105 pages = {1--21} 14106} 14107 14108% ------------------------------------------------------------------------- 14109% ------------------------------------------------------------------------- 14110@Article{ torczon, 14111 author = {Dennis, Jr., J. E. and V.~Torczon}, 14112 title = {Direct Search Methods on Parallel Machines}, 14113 journal = {SIAM J. Optimization}, 14114 volume = {1}, 14115 pages = {448--474}, 14116 year = {1991}, 14117 key = {Torczon !PDS} 14118} 14119 14120@InProceedings{ wt91, 14121 author = {D. L. Whitfield and L. K. Taylor}, 14122 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 14123 Schemes}, 14124 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 14125 misc = {AIAA-91-1539}, 14126 pages = {134-145}, 14127 year = {1991} 14128} 14129 14130@Article{ ew96, 14131 author = {S. C. Eisenstat and H. F. Walker}, 14132 title = {Choosing the forcing terms in an inexact {N}ewton method}, 14133 journal = {SIAM J. Scientific Computing}, 14134 volume = {17}, 14135 year = {1996}, 14136 pages = {16--32} 14137} 14138 14139@Book{ thi93, 14140 author = {{Thinking Machines Corporation}}, 14141 title = {Users Manual for CM-Fortran}, 14142 publisher = {Thinking Machines Corporation}, 14143 year = {1993} 14144} 14145 14146@Book{ mortonmayers94, 14147 author = {K. W. Morton and D. F. Mayers}, 14148 title = {Numerical Solution of Partial Differential Equations}, 14149 publisher = {Press Syndicate of the University of Cambridge}, 14150 year = {1994} 14151} 14152 14153@Book{ heath97, 14154 author = {Michael T. Heath}, 14155 title = {Scientific Computing: An Introductory Survey}, 14156 publisher = {McGraw Hill}, 14157 year = {1997} 14158} 14159 14160@Article{ captools96, 14161 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 14162 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 14163 Performance on the Parallelization of Structured Mesh Codes}, 14164 journal = {Parallel Computing}, 14165 volume = {22}, 14166 pages = {197-226}, 14167 year = {1996} 14168} 14169 14170@Misc{ nastran-web-page, 14171 author = {{MSC Software Corporation}}, 14172 title = {{NASTRAN} {W}eb page}, 14173 howpublished = {\url{http://www.mechsolutions.com/products/nastran/}}, 14174 year = {2024} 14175} 14176 14177@Book{ hpf, 14178 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 14179 Zosel}, 14180 title = {The High Performance Fotran Handbook}, 14181 publisher = {MIT Press}, 14182 year = {1994} 14183} 14184 14185@InProceedings{ keyes98, 14186 author = {D. E. Keyes}, 14187 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 14188 Architectures}, 14189 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 14190 editors = {M. D. Salas and W. K. Anderson}, 14191 ppublisher = {Elsevier}, 14192 year = {1998} 14193} 14194 14195@InProceedings{ pooma-atlas, 14196 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 14197 J. V. W. Reynders and M. Tholburn}, 14198 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 14199 Applications}, 14200 year = {1995}, 14201 month = dec, 14202 booktitle = {Supercomputing '95 Proceedings} 14203} 14204 14205% --------------------------------------------------------------------------------- 14206% New bib entries for CRPC paper 14207@Misc{ mgnet-web-page, 14208 author = {Craig C. Douglas}, 14209 title = {{MGNet Web page}}, 14210 note = {See {\tt http://\-www.mgnet.org}} 14211} 14212 14213@Misc{ dagh-web-page, 14214 author = {M. Parashar and J. C. Browne}, 14215 title = {{DAGH Web page}}, 14216 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 14217} 14218 14219@Misc{ parasol-web-page, 14220 key = {PARASOL}, 14221 title = {{PARASOL Web page}}, 14222 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 14223} 14224 14225@Misc{ pooma-web-page, 14226 author = {{POOMA Web page}}, 14227 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 14228} 14229 14230@Misc{ mudpack-web-page, 14231 author = {John C. Adams}, 14232 title = {{MUDPACK Web page}}, 14233 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 14234} 14235 14236@Misc{ pellpack-web-page, 14237 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 14238 title = {{Parallel ELLPACK Web page}}, 14239 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 14240} 14241 14242@InProceedings{ pellpack95, 14243 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 14244 Catlin and S. Weerawarana and T.S. Papatheodorou}, 14245 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 14246 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 14247 address = {Albuquerque, NM}, 14248 year = {1995} 14249} 14250 14251@Misc{ nhse-web-page, 14252 author = {{National High-Performance Software Exchange Web page}}, 14253 note = {See {\tt http://\-www.nhse.org}} 14254} 14255 14256@Misc{ doug-web-page, 14257 author = {Mark J. Hagger and Linda Stals}, 14258 title = {{DOUG Web Page}}, 14259 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 14260} 14261 14262@TechReport{ doug97, 14263 author = {Mark J. Hagger}, 14264 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 14265 institution = {Mathematical Sciences, University of Bath}, 14266 year = {1997}, 14267 number = {9706}, 14268 note = {Advances in Computational Mathematics (to appear)} 14269} 14270 14271@Misc{ ug-web-page, 14272 author = {{UG Web Page}}, 14273 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 14274} 14275 14276@Article{ ug97, 14277 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 14278 Rentz-Reichert and C. Wieners}, 14279 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 14280 journal = {Computing and Visualization in Science}, 14281 year = {1997}, 14282 volume = {}, 14283 pages = {} 14284} 14285 14286@Misc{ vecfem-web-page, 14287 author = {Lutz Grosz}, 14288 title = {{VECFEM Web Page}}, 14289 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 14290} 14291 14292@Misc{ atlas-web-page, 14293 author = {R. Clint {Whaley et al.}}, 14294 title = {{ATLAS Web Page}}, 14295 howpublished = {\url{http://math-atlas.sourceforge.net}} 14296} 14297 14298@Misc{ fenics-web-page, 14299 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 14300 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 14301 title = {{FEniCS Web Page}}, 14302 note = {\url{http://www.fenicsproject.org}}, 14303 year = {2005} 14304} 14305 14306@Misc{ matlab-web-page, 14307 author = {{The} {MathWorks}}, 14308 title = {{Matlab} {Web} page}, 14309 url = {http://www.mathworks.com} 14310} 14311 14312@Misc{ phipac-web-page, 14313 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 14314 and D. Lam}, 14315 title = {{PHiPAC Web Page}}, 14316 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 14317} 14318 14319@InProceedings{ kelp, 14320 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 14321 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 14322 booktitle = {Irregular '96}, 14323 year = {1996} 14324} 14325 14326@Unpublished{ kelp-web-page, 14327 author = {Scott Baden}, 14328 title = {{KeLP} {W}eb page}, 14329 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 14330} 14331 14332@InProceedings{ hk99, 14333 author = {R. Hornung and S. Kohn}, 14334 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 14335 Framework}, 14336 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 14337 Scientific and Engineering Computing}, 14338 pages = {235-244}, 14339 year = {1999}, 14340 note = {See \url{http://www.llnl.gov/CASC/samrai}} 14341} 14342 14343@Unpublished{ samrai-web-page, 14344 title = {{SAMRAI} {W}eb Page}, 14345 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 14346 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 14347} 14348 14349@Misc{ overture-web-page, 14350 author = {William Henshaw and Kyle Chand}, 14351 title = {{Overture} {W}eb page}, 14352 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 14353} 14354 14355@InProceedings{ overture99, 14356 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 14357 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 14358 on Overlapping Grids}, 14359 publisher = {SIAM}, 14360 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14361 Scientific and Engineering Computing}, 14362 year = {1999}, 14363 pages = {215-224}, 14364 note = {See \url{http://www.llnl.gov/CASC/Overture}} 14365} 14366 14367@InProceedings{ diffpack, 14368 author = {A.M. Bruaset and H.P. Langtangen}, 14369 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 14370 {D}iffpack}, 14371 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 14372 year = {1997}, 14373 pages = {61--90}, 14374 publisher = {Birkhauser Press} 14375} 14376 14377@Article{ dongarra:1984:ila, 14378 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 14379 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 14380 Machine}, 14381 journal = {SIAM Review}, 14382 volume = {26}, 14383 number = {1}, 14384 pages = {91--112}, 14385 month = jan, 14386 year = {1984}, 14387 coden = {SIREAD}, 14388 issn = {0036-1445 (print), 1095-7200 (electronic)}, 14389 mrclass = {65F10 (65F30)}, 14390 mrnumber = {85c:65032}, 14391 bibdate = {Mon Jan 20 1997}, 14392 abstract = {The authors examine common implementations of linear algebra algorithms, such as 14393 matrix-vector multiplication, matrix-matrix multiplication and the solution of 14394 linear equations. The different versions are examined for efficiency on a computer 14395 architecture which uses vector processing and has pipelined instruction execution. 14396 By using the advanced architectural features of such machines, one can usually 14397 achieve maximum performance, and tremendous improvements in terms of execution 14398 speed can be seen over conventional computers.}, 14399 classification= {723; 921}, 14400 journalabr = {SIAM Rev}, 14401 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 14402 mathematical programming; vector pipeline machine} 14403} 14404 14405@Book{ qv99, 14406 author = {Alfio Quarteroni and Alberto Valli}, 14407 title = {Domain Decomposition Methods for Partial Differential Equations}, 14408 publisher = {Oxford Science Publications}, 14409 address = {Oxford}, 14410 year = {1999} 14411} 14412 14413@Book{ ksv97, 14414 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 14415 title = {Parallel Numerical Algorithms}, 14416 publisher = {Kluwer Academic Publishers}, 14417 address = {the Netherlands}, 14418 year = {1997} 14419} 14420 14421@Book{ hackbusch94, 14422 author = {Wolfgang Hackbusch}, 14423 title = {Iterative Solution of Large Sparse Systems of Equations}, 14424 publisher = {Springer-Verlag}, 14425 address = {New York}, 14426 year = {1994} 14427} 14428 14429@Article{ hackbusch1980fast, 14430 title = {Fast solution of elliptic control problems}, 14431 author = {Hackbusch, W.}, 14432 journal = {Journal of Optimization Theory and Applications}, 14433 volume = {31}, 14434 number = {4}, 14435 pages = {565--581}, 14436 year = {1980}, 14437 publisher = {Springer} 14438} 14439 14440@Book{ hackbusch1985multi, 14441 title = {{Multi-grid methods and applications}}, 14442 author = {Hackbusch, W.}, 14443 isbn = {3540127615}, 14444 issn = {0179-3632}, 14445 year = {1985}, 14446 publisher = {Springer Verlag} 14447} 14448 14449@Book{ axelsson94, 14450 author = {Owe Axelsson}, 14451 title = {Iterative Solution Methods}, 14452 publisher = {Cambridge University Press}, 14453 address = {Cambridge}, 14454 year = {1994} 14455} 14456 14457@Book{ saad96, 14458 author = {Yousef Saad}, 14459 title = {Iterative Methods for Sparse Linear Systems}, 14460 publisher = {PWS Publishing Company}, 14461 address = {Boston}, 14462 year = {1996} 14463} 14464 14465@Book{ saad2003, 14466 title = {Iterative Methods for Sparse Linear Systems}, 14467 author = {Saad, Yousef}, 14468 doi = {10.1016/S1570-579X(01)80025-2}, 14469 edition = {2nd}, 14470 publisher = {SIAM}, 14471 year = {2003} 14472} 14473 14474@Book{ vandervorst03, 14475 author = {Henk A. {van der Vorst}}, 14476 title = {Iterative Krylov Methods for Large Linear Systems}, 14477 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 14478 year = {2003} 14479} 14480 14481@Book{ koniges00, 14482 editor = {Alice E. Koniges}, 14483 title = {Industrial Strength Parallel Computing}, 14484 publisher = {Morgan Kaufmann Publishers}, 14485 address = {San Francisco}, 14486 year = {2000} 14487} 14488 14489@Misc{ fftw-web-page, 14490 key = {Fftw}, 14491 title = {{FFTW} {Web} page}, 14492 note = {\texttt{http://www.fftw.org/}}, 14493 annote = {fast FFT. Parallel versions with MPI and Cilk} 14494} 14495 14496@InProceedings{ frigojohnson93, 14497 author = {Matteo Frigo and Steven G. Johnson}, 14498 title = {The Design and Implementation of {FFTW3}}, 14499 booktitle = {Proceedings of the IEEE}, 14500 volume = {93}, 14501 number = {2}, 14502 pages = {216--231}, 14503 year = {2005} 14504} 14505 14506@Book{ kelley95, 14507 author = {C. T. Kelley}, 14508 title = {Iterative Methods for Linear and Nonlinear Equations}, 14509 year = {1995}, 14510 publisher = {SIAM}, 14511 address = {Philadelphia} 14512} 14513 14514@Unpublished{ spai-web-page, 14515 title = {{SPAI} {W}eb {P}age}, 14516 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 14517 author = {Steven Bernard and Marcus Grote}, 14518 institution = {NASA Ames Research Center and ETH Zurich} 14519} 14520 14521@Article{ gh97, 14522 author = {M. J. Grote and T. Huckle}, 14523 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 14524 year = {1997}, 14525 journal = {SIAM J. of Scient. Comput.}, 14526 volume = {18}, 14527 pages = {838-853} 14528} 14529 14530@Article{ zhang96, 14531 author = {Wen Zhang}, 14532 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 14533 simulation of a sintering process}, 14534 year = {1996}, 14535 journal = {Appl. Numer. Math.}, 14536 volume = {20}, 14537 pages = {235-244} 14538} 14539 14540@Article{ zhang98, 14541 author = {Wen Zhang and Ian Gladwell}, 14542 title = {The sintering of two particles by surface and grain boundary diffusion - a 14543 three-dimensional numerical study}, 14544 journal = {Comp. Mater. Sci.}, 14545 year = {1998}, 14546 volume = {12} 14547} 14548 14549@InProceedings{ mollerschwartzbach01, 14550 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 14551 title = {The Pointer Assertion Logic Engine}, 14552 booktitle = {ACM Proceedings of PLDI'01}, 14553 year = {2001} 14554} 14555 14556@InProceedings{ klarlandschwartzbach97, 14557 author = {Nils Klarland and Michael I. Schwartzbach}, 14558 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 14559 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 14560 publisher = {USENIX}, 14561 month = oct, 14562 year = {1997}, 14563 address = {Santa Barbara, CA} 14564} 14565 14566@InProceedings{ conselmarlet98, 14567 author = {C. Consel and R. Marlet}, 14568 title = {Architecturing software using a methodology for language development}, 14569 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 14570 Implementations, Logics and Programs}, 14571 year = {1998}, 14572 pages = {170-174}, 14573 month = sep, 14574 address = {Pisa, Italy} 14575} 14576 14577@Misc{ sundials:homepage, 14578 author = {C. {Woodward et al.}}, 14579 title = {{SUNDIALS {W}eb page}}, 14580 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 14581} 14582 14583@article{gardner2022sundials, 14584 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 14585 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 14586 journal = {ACM Transactions on Mathematical Software (TOMS)}, 14587 publisher = {ACM}, 14588 year = {2022}, 14589 doi = {10.1145/3539801} 14590} 14591 14592@Misc{ sundials-user-ref, 14593 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14594 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 14595 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 14596 and Dan Shumaker and Carol Woodward}, 14597 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14598 number = {UCRL-JP-200037}, 14599 year = {2003} 14600} 14601 14602@Article{ sundials05, 14603 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 14604 and C. Woodward}, 14605 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14606 journal = {ACM Transactions on Mathematical Software}, 14607 volume = {31}, 14608 number = {3}, 14609 pages = {363--396}, 14610 year = {2005} 14611} 14612 14613@InProceedings{ serban2005cvodes, 14614 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 14615 author = {Serban, Radu and Hindmarsh, Alan C}, 14616 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 14617 Dynamics and Control, Long Beach, CA}, 14618 year = {2005} 14619} 14620 14621@Article{ pvode99, 14622 author = {G. Byrne and A. Hindmarsh}, 14623 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 14624 journal = {Int. J. High Perf. Comput. Apps.}, 14625 volume = {13}, 14626 number = {4}, 14627 year = {1999}, 14628 pages = {354 -- 365} 14629} 14630 14631@Article{ cvode95, 14632 author = {S. Cohen and A. Hindmarsh}, 14633 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 14634 journal = {Computers in Physics}, 14635 volume = {10}, 14636 number = {2}, 14637 year = {1996}, 14638 pages = {138 -- 143} 14639} 14640 14641@TechReport{ ifpack, 14642 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 14643 author = {Marzio Sala and Michael Heroux}, 14644 institution = {Sandia National Laboratories}, 14645 number = {SAND2005-0662}, 14646 year = {2005} 14647} 14648 14649@TechReport{ kinsol-user-ref, 14650 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 14651 Computers}, 14652 author = {Allan Taylor and Alan Hindmarsh}, 14653 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14654 number = {UCRL-ID-131185}, 14655 year = {1998} 14656} 14657 14658@Article{ fiardmanteuffelmccormick98, 14659 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 14660 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 14661 numerical results}, 14662 journal = {SIAM J. Sci. Comp.}, 14663 year = {1998}, 14664 volume = {19}, 14665 pages = {1958--1979} 14666} 14667 14668@InProceedings{ vuduc02, 14669 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 14670 Rajesh Nishtala and Benjamin Lee}, 14671 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 14672 booktitle = {Proceedings of Supercomputing}, 14673 year = {2002}, 14674 month = nov, 14675 address = {Baltimore} 14676} 14677 14678@Article{ beckerbraackrannacher1999, 14679 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 14680 elements}, 14681 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 14682 journal = {Combustion Theory and Modelling}, 14683 volume = {3}, 14684 pages = {503--534}, 14685 year = {1999} 14686} 14687 14688@Article{ beckerrannacher01, 14689 author = {R. Becker and R. Rannacher}, 14690 title = {An optimal control approach to a posteriori error estimation in finite element 14691 methods}, 14692 journal = {Acta Numerica}, 14693 year = {2001}, 14694 volume = {10}, 14695 pages = {1--102} 14696} 14697 14698@Article{ babuskamiller84a, 14699 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14700 title = {The post-processing approach in the finite element method, {I}: Calculations of 14701 displacements, stresses, and other higher derivatives of the displacements}, 14702 journal = {Int. J. Numer. Meth. Eng.}, 14703 year = {1984}, 14704 volume = {20}, 14705 pages = {1085--1109} 14706} 14707 14708@Article{ babuskamiller84b, 14709 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14710 title = {The post-processing approach in the finite element method, {II}: The calculation 14711 of stress intensity factors}, 14712 journal = {Int. J. Numer. Meth. Eng.}, 14713 year = {1984}, 14714 volume = {20}, 14715 pages = {1111--1129} 14716} 14717 14718@Article{ babuskamiller84c, 14719 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14720 title = {The post-processing approach in the finite element method, {III}: A posteriori 14721 error estimation and adaptive mesh refinement}, 14722 journal = {Int. J. Numer. Meth. Eng.}, 14723 year = {1984}, 14724 volume = {20}, 14725 pages = {2311--2324} 14726} 14727 14728@Unpublished{ jtb-web-page, 14729 title = {{The Java Tree Builder}}, 14730 note = {See \url{http://www.cs.purdue.edu/jtb}}, 14731 author = {Jens Palsberg}, 14732 institution = {Purdue University} 14733} 14734 14735@Unpublished{ palsberg98, 14736 title = {Why Visitors?}, 14737 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 14738 author = {Jens Palsberg}, 14739 institution = {Purdue University}, 14740 year = {1998} 14741} 14742 14743@Unpublished{ ply-web-page, 14744 title = {{PLY (Python Lex-Yacc)}}, 14745 note = {\url{http://systems.cs.chicago.edu/ply}}, 14746 author = {David Beazley}, 14747 institution = {University of Chicago} 14748} 14749 14750@Misc{ adic-web-page, 14751 title = {{ADIC Web page}}, 14752 note = {\url{http://www.mcs.anl.gov/autodiff}}, 14753 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 14754 institution = {Argonne National Laboratory} 14755} 14756 14757@Article{ naumann02, 14758 author = {Uwe Naumann}, 14759 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 14760 computational graph}, 14761 journal = {Mathematical Programming (to appear)}, 14762 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 14763 year = {2003} 14764} 14765 14766@Article{ kaper1, 14767 author = {H. G. Kaper and T. J. Kaper}, 14768 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 14769 journal = {Physica D}, 14770 year = {2002}, 14771 pages = {66--93}, 14772 volume = {165} 14773} 14774 14775@Misc{ veltisto-web-page, 14776 author = {George Biros}, 14777 title = {{Veltisto Web page}}, 14778 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 14779} 14780 14781@Article{ karypiskumar98, 14782 author = {George Karypis and Vipin Kumar}, 14783 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 14784 Ordering}, 14785 journal = {Journal of Parallel and Distributed Computing}, 14786 volume = {48}, 14787 pages = {71--85}, 14788 year = {1998} 14789} 14790 14791@TechReport{ karypiskumar97, 14792 author = {Karypis, George and Kumar, V.}, 14793 institution = {Department of Computer Science, University of Minnesota}, 14794 keywords = {graph partitioning; ParMetis}, 14795 note = {http://www.cs.umn.edu/~metis}, 14796 number = {97-060}, 14797 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 14798 year = {1997} 14799} 14800 14801@Misc{ parmetis-web-page, 14802 author = {George {Karypis et al.}}, 14803 title = {{ParMETIS Web page}}, 14804 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 14805 year = {2005} 14806} 14807 14808@Misc{ sparskit-web-page, 14809 author = {Yousef {Saad et al.}}, 14810 title = {{SPARSKIT Web page}}, 14811 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 14812} 14813 14814@Misc{ dscpack-web-page, 14815 author = {Padma Raghavan}, 14816 title = {{DSCPACK Web page}}, 14817 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 14818} 14819 14820@Misc{ gaussian-web-page, 14821 author = {}, 14822 title = {{Gaussian Web page}}, 14823 note = {\url{http://gaussian.com}}, 14824 key = {{Gaussian} {Web} page} 14825} 14826 14827@Book{ lapack-user-guide, 14828 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 14829 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 14830 Sorensen}, 14831 title = {LAPACK Users' Guide, Third Edition}, 14832 publisher = {SIAM}, 14833 year = {1999} 14834} 14835 14836@Manual{ nwchem4.1, 14837 author = {High Performance Computational Chemistry Group}, 14838 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 14839 year = {2002}, 14840 organization = {Pacific Northwest National Laboratory}, 14841 address = {Richland, Washington 99325-0999 USA}, 14842 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 14843} 14844 14845@TechReport{ tchem, 14846 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 14847 author = {Cosmin Safta and Habib Najm and Omar Knio}, 14848 institution = {Sandia National Laboratories}, 14849 number = {SAND2011-3282}, 14850 year = {2011} 14851} 14852 14853@Misc{ scidac-web-page, 14854 author = {}, 14855 title = {{{SciDAC Initiative Web page}}}, 14856 note = {\url{http://www.osti.gov/scidac}}, 14857 key = {{SciDAC Initiative Web page}} 14858} 14859 14860@Misc{ cmrs:homepage, 14861 author = {Amitava {Bhattacharjee (PI)}}, 14862 title = {{Center for Magnetic Reconnection Studies}}, 14863 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 14864} 14865 14866@Misc{ tops:homepage, 14867 author = {David {Keyes (PI)}}, 14868 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 14869 howpublished = {\url{http://scalablesolvers.org}} 14870} 14871 14872@Misc{ tstt:homepage, 14873 author = {David Brown and Jim Glimm and Lori Freitag}, 14874 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 14875 howpublished = {\url{http://www.tstt-scidac.org}}, 14876 year = {2005} 14877} 14878 14879@Misc{ petsc:applications, 14880 author = {B. F. {Smith et al.}}, 14881 title = {{Scientific Applications Using {PETSc}}}, 14882 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 14883} 14884 14885@Misc{ petsc:users, 14886 author = {B. F. {Smith et al.}}, 14887 title = {{PETSc User Statistics}}, 14888 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 14889} 14890 14891@Misc{ cemm:homepage, 14892 author = {Steve {Jardin (PI)}}, 14893 title = {{Center for Extended MHD Modeling}}, 14894 howpublished = {\url{http://w3.pppl.gov/CEMM}} 14895} 14896 14897@Misc{ m3d:homepage, 14898 author = {Steve {Jardin et al.}}, 14899 title = {{M3D Web page}}, 14900 howpublished = {\url{http://w3.pppl.gov/m3d}} 14901} 14902 14903@Misc{ nimrod:homepage, 14904 author = {Carl R. {Sovinec et al.}}, 14905 title = {{NIMROD Web page}}, 14906 howpublished = {http://nimrodteam.org} 14907} 14908 14909@Misc{ grace-web-page, 14910 author = {Manish {Parashar et al.}}, 14911 title = {{GrACE Web Page}}, 14912 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 14913} 14914 14915@Misc{ accel1, 14916 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 14917 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 14918 author = {K. Ko and R. Ryne (PIs)} 14919} 14920 14921@Unpublished{ katzspiegelman03, 14922 author = {Richard F. Katz and Marc Spiegelman}, 14923 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 14924 advection-diffusion problems}, 14925 note = {Columbia University, in preparation} 14926} 14927 14928@Misc{ acts:homepage, 14929 author = {}, 14930 title = {{Advanced CompuTational Software (ACTS) Web page}}, 14931 howpublished = {\url{http://acts.nersc.gov}}, 14932 key = {{Advanced CompuTational Software (ACTS) Web page}} 14933} 14934 14935@Article{ superlu99, 14936 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 14937 Joseph W. H. Liu}, 14938 title = {A supernodal approach to sparse partial pivoting}, 14939 journal = {SIAM J. Matrix Analysis and Applications}, 14940 year = {1999}, 14941 volume = {20}, 14942 number = {3}, 14943 pages = {720-755} 14944} 14945 14946@Misc{ superlu:homepage, 14947 author = {J. Demmel and J. Gilbert and X. Li}, 14948 title = {{SuperLU Web page}}, 14949 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 14950} 14951 14952@InProceedings{ ccf98, 14953 author = {E. Chow and A. Cleary and R. Falgout}, 14954 title = {Design of the hypre Preconditioner Library}, 14955 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14956 Scientific and Engineering Computing}, 14957 publisher = {SIAM}, 14958 year = {1999} 14959} 14960 14961@TechReport{ hypre-users-manual, 14962 author = {R. Falgout}, 14963 title = {{hypre} Users Manual}, 14964 number = {Revision 2.28}, 14965 institution = {Lawrence Livermore National Laboratory}, 14966 year = {2023}, 14967 url = {https://hypre.readthedocs.io/} 14968} 14969 14970@Misc{ hypre:homepage, 14971 author = {R. Falgout}, 14972 title = {{hypre Web page}}, 14973 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 14974} 14975 14976@InProceedings{ trilinos:gpu, 14977 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 14978 title = {A Light-weight API for Portable Multicore Programming}, 14979 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 14980 Network-Based Processing (PDP)}, 14981 pages = {601--606}, 14982 publisher = {IEEE}, 14983 year = {2010} 14984} 14985 14986@InProceedings{ heroux2004design, 14987 title = {The design of {T}rilinos}, 14988 author = {Heroux, Michael A and Sala, Marzio}, 14989 booktitle = {International Workshop on Applied Parallel Computing}, 14990 pages = {620--628}, 14991 year = {2004}, 14992 organization = {Springer} 14993} 14994 14995@Misc{ trilinos:homepage, 14996 author = {M. {Heroux et al.}}, 14997 title = {{Trilinos Web page}}, 14998 howpublished = {{\tt http://trilinos.sandia.gov/}} 14999} 15000 15001@Article{ trilinos:overview, 15002 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 15003 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 15004 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 15005 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 15006 Kendall S. Stanley}, 15007 title = {An overview of the {T}rilinos project}, 15008 journal = {ACM Transactions on Mathematical Software}, 15009 volume = {31}, 15010 number = {3}, 15011 year = {2005}, 15012 issn = {0098-3500}, 15013 pages = {397--423}, 15014 publisher = {ACM Press}, 15015 doi = {10.1145/1089014.1089021} 15016} 15017 15018@Misc{ rythmos:homepage, 15019 author = {T. Coffey and R. Bartlett}, 15020 title = {Rythmos: Transient Integration of Differential Equations}, 15021 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 15022} 15023 15024@Misc{ triangle:homepage, 15025 author = {J. {Shewchuk}}, 15026 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 15027 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 15028 year = {2005} 15029} 15030 15031@Misc{ tetgen:homepage, 15032 author = {Hang {Si}}, 15033 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 15034 Triangulator}}, 15035 howpublished = {\url{http://tetgen.berlios.de}}, 15036 year = {2005} 15037} 15038 15039@Misc{ opencascade:homepage, 15040 author = {{OpenCASCADE SAS}}, 15041 title = {{Open CASCADE Technology (OCCT)}}, 15042 howpublished = {\url{https://dev.opencascade.org/}}, 15043 year = {2024} 15044} 15045 15046@Misc{ eigen:homepage, 15047 author = {Benoit Jacob and Ga\"el Guennebaud}, 15048 title = {{Eigen} {W}eb page}, 15049 key = {Jacob}, 15050 url = {http://eigen.tuxfamily.org/}, 15051 howpublished = {\url{http://eigen.tuxfamily.org/}}, 15052 year = {2015} 15053} 15054 15055@Misc{ dune:homepage, 15056 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 15057 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 15058 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 15059 Oliver Sander}, 15060 title = {{DUNE} {W}eb page}, 15061 key = {Bastian}, 15062 url = {http://www.dune-project.org/}, 15063 howpublished = {\url{http://www.dune-project.org/}}, 15064 year = {2015} 15065} 15066 15067@Misc{ thrust, 15068 author = {N. Bell and J. Hoberock}, 15069 title = {The {T}hrust Library}, 15070 howpublished = {{\tt http://code.google.com/p/thrust/}}, 15071 year = {2010} 15072} 15073 15074@Misc{ cusp, 15075 author = {N. Bell and M. Garland}, 15076 title = {The {C}usp Library}, 15077 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 15078 year = {2010} 15079} 15080 15081@Misc{ cig:homepage, 15082 author = {M. {Gurnis et al.}}, 15083 title = {{Computational Infrastructure for Geodynamics}}, 15084 howpublished = {\url{http://www.geodynamics.org}} 15085} 15086 15087@Article{ maltsevselkov00, 15088 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 15089 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 15090 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 15091 metabolic reconstruction}, 15092 journal = {Nucleic Acids Res.}, 15093 year = {2000}, 15094 month = jan, 15095 pages = {123-125}, 15096 volume = {28}, 15097 number = {1} 15098} 15099 15100@Article{ more:coloring, 15101 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 15102 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 15103 journal = {SIAM Journal on Numerical Analysis}, 15104 year = {1983}, 15105 month = feb, 15106 pages = {187--209}, 15107 volume = {20}, 15108 number = {1} 15109} 15110 15111@Article{ selkovmaltsev97, 15112 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 15113 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 15114 data}, 15115 journal = {Gene}, 15116 year = {1997}, 15117 pages = {GC11-GC26}, 15118 volume = {197}, 15119 number = {1-2} 15120} 15121 15122@Unpublished{ rocketcenter, 15123 title = {Center for Simulation of Advanced Rockets}, 15124 note = {http://www.csar.uiuc.edu}, 15125 institution = {University of Illinois at Urbana-Champaign} 15126} 15127 15128@Article{ kirby03, 15129 title = {A posteriori error estimates for the mixed hybrid finite element method}, 15130 author = {Robert C Kirby}, 15131 journal = {Computational Geosciences}, 15132 volume = {7}, 15133 pages = {197--214}, 15134 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 15135 year = {2003} 15136} 15137 15138@Article{ kirby2003b, 15139 title = {On the convergence of high resolution methods with multiple time scales for 15140 hyperbolic conservation laws}, 15141 author = {Robert C Kirby}, 15142 journal = {Mathematics of computation}, 15143 volume = {72}, 15144 number = {243}, 15145 pages = {1239--1250}, 15146 year = {2003} 15147} 15148 15149@Article{ dawsonkirby2001, 15150 title = {High resolution schemes for conservation laws with locally varying time steps}, 15151 author = {Clint Dawson and Robert C Kirby}, 15152 journal = {SIAM Journal on Scientific Computing}, 15153 volume = {22}, 15154 number = {6}, 15155 pages = {2256--2281}, 15156 year = {2001}, 15157 publisher = {SIAM} 15158} 15159 15160@Article{ dawsonkirby1999, 15161 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 15162 a dynamically changing mesh}, 15163 author = {Clint Dawson and Robert C Kirby}, 15164 journal = {SIAM Journal on Numerical Analysis}, 15165 volume = {37}, 15166 number = {2}, 15167 pages = {423--442}, 15168 year = {1999}, 15169 publisher = {SIAM} 15170} 15171 15172@Article{ barthlarson00, 15173 author = {T. J. Barth and M. G. Larson}, 15174 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 15175 Hyperbolic Systems}, 15176 journal = {LNCS}, 15177 year = {2000}, 15178 volume = {11}, 15179 publisher = {Spinger-Verlag} 15180} 15181 15182@Article{ xu1, 15183 author = {J. Xu}, 15184 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 15185 journal = {SIAM Review}, 15186 volume = {34}, 15187 pages = {581--613}, 15188 year = {1992} 15189} 15190 15191@Article{ brandt77, 15192 author = {Achi Brandt}, 15193 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 15194 journal = {Mathematics of Computation}, 15195 month = apr, 15196 year = {1977}, 15197 pages = {333--390}, 15198 volume = {31}, 15199 number = {138}, 15200 doi = {10.2307/2006422} 15201} 15202 15203@Article{ brandt1979multigrid, 15204 title = {{Multigrid solutions to elliptic flow problems}}, 15205 author = {Brandt, A. and Dinar, N.}, 15206 journal = {Numerical Methods for Partial Differential Equations}, 15207 pages = {53--147}, 15208 year = {1979} 15209} 15210 15211@InCollection{ brandt1979singular, 15212 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 15213 author = {Achi Brandt}, 15214 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 15215 editor = {Hemker, Pieter W. and Miller, John J.H.}, 15216 pages = {53--142}, 15217 year = {1979}, 15218 publisher = {Academic Press} 15219} 15220 15221@Article{ amge1, 15222 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 15223 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 15224 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 15225 journal = {SIAM J. Scientific Computing}, 15226 volume = {22}, 15227 pages = {1570--1592}, 15228 year = {2000} 15229} 15230 15231@Book{ bramble1, 15232 author = {J. H. Bramble}, 15233 title = {Multigrid Methods}, 15234 publisher = {Longman Scientific and Technical}, 15235 address = {Essex, England}, 15236 year = {1993} 15237} 15238 15239@Book{ arpack98, 15240 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 15241 title = {ARPACK, Users' Guide}, 15242 publisher = {SIAM}, 15243 year = {1998} 15244} 15245 15246@Article{ bbder96, 15247 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 15248 title = {Algorithmic bombardment for the iterative solution of linear systems: A 15249 polyIterative approach}, 15250 journal = {J. of Computational and Applied Mathematics}, 15251 year = {1996}, 15252 volume = {74}, 15253 pages = {91--110} 15254} 15255 15256@Article{ egks94, 15257 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 15258 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 15259 journal = {SIAM J. Scientific Computing}, 15260 year = {1994}, 15261 volume = {15}, 15262 number = {3}, 15263 pages = {681--703} 15264} 15265 15266@Article{ dftb02, 15267 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 15268 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 15269 diamond grain boundaries,}, 15270 journal = {Phys. Rev}, 15271 year = {2002}, 15272 volume = {B65}, 15273 pages = {045403} 15274} 15275 15276@InBook{ lsa, 15277 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 15278 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 15279 title = {The linear system analyzer}, 15280 series = {enabling technologies for computational science}, 15281 year = {2002}, 15282 publisher = {Kluwer}, 15283 location = {Dordrecht} 15284} 15285 15286@Article{ kk97, 15287 author = {Carl T. Kelley and David E. Keyes}, 15288 title = {Convergence analysis of pseudo-transient continuation}, 15289 journal = {SIAM J. Numerical Analysis}, 15290 year = {1998}, 15291 volume = {35}, 15292 pages = {508--523} 15293} 15294 15295@Article{ swtm01, 15296 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 15297 journal = {Journal of Computational Physics}, 15298 year = {2001}, 15299 volume = {172}, 15300 number = {2}, 15301 pages = {472--514}, 15302 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 15303 Method} 15304} 15305 15306@TechReport{ zhou03, 15307 author = {Y. Zhou}, 15308 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 15309 IIGD, RQI and Newton} Updates}, 15310 institution = {Argonne National Laboratory}, 15311 number = {ANL/MCS-P1074-0803}, 15312 note = {Submitted to Numerical Linear Algebra with Applications}, 15313 year = {2003} 15314} 15315 15316@Unpublished{ mtwm03, 15317 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 15318 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 15319 Detailed analysis of one-dimensional applications}, 15320 note = {to appear in the Journal of Chemical Physics}, 15321 year = {2003} 15322} 15323 15324@Article{ singhjosephheslaglowinskipan00, 15325 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 15326 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 15327 particulate flows}, 15328 journal = {J. Non-Newtonian Fluid Mech.}, 15329 volume = {91}, 15330 pages = {165--188}, 15331 year = {2000} 15332} 15333 15334@Book{ joseph02, 15335 author = {Daniel D. Joseph}, 15336 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 15337 publisher = {Springer-Verlag}, 15338 month = mar, 15339 year = {2002}, 15340 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 15341} 15342 15343@Misc{ triangle-web-page, 15344 author = {Jonathan R. Shewchuk}, 15345 title = {{Triangle Web} page}, 15346 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 15347} 15348 15349@InCollection{ shewchuk96, 15350 author = {Jonathan R. Shewchuk}, 15351 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 15352 Triangulator}, 15353 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 15354 editor = {Ming C. Lin and Dinesh Manocha}, 15355 series = {Lecture Notes in Computer Science}, 15356 volume = {1148}, 15357 publisher = {Springer-Verlag}, 15358 pages = {203--222}, 15359 month = may, 15360 year = {1996}, 15361 note = {From the First ACM Workshop on Applied Computational Geometry} 15362} 15363 15364@Article{ leaf1, 15365 author = {Transient Dynamics of Pinning of Domain Walls}, 15366 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 15367 journal = {J. Magnetism and Magnetic Materials}, 15368 volume = {241}, 15369 pages = {118--123}, 15370 year = {2002} 15371} 15372 15373@Article{ leaf2, 15374 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 15375 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 15376 Superconductivity}, 15377 journal = {SIAM J. Sci. Comp.}, 15378 volume = {23}, 15379 pages = {1944--1959}, 15380 year = {2002} 15381} 15382 15383@Article{ leaf3, 15384 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 15385 title = {Hysteresis in Layered Spring Magnets}, 15386 journal = { Discreet and Continuous Dynamical Systems, Series B}, 15387 volume = {1}, 15388 pages = {219--232}, 15389 year = {2001} 15390} 15391 15392@Article{ leaf4, 15393 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 15394 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 15395 journal = {J. Phys. D Appl. Phys.}, 15396 volume = {35}, 15397 pages = {2339--2343}, 15398 year = {2002} 15399} 15400 15401@Article{ leaf5, 15402 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 15403 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 15404 journal = {Submitted to Phys. Rev. B.}, 15405 note = {Submitted}, 15406 year = {2003} 15407} 15408 15409@Article{ graysumpternoidbarnes01, 15410 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 15411 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 15412 Nanospheres}, 15413 journal = {Chem. Phys. Lett.}, 15414 volume = {333}, 15415 pages = {308--313}, 15416 year = {2001} 15417} 15418 15419@InProceedings{ petsc-efficient, 15420 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 15421 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 15422 Libraries}, 15423 booktitle = {Modern Software Tools in Scientific Computing}, 15424 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 15425 publisher = {Birkh{\"{a}}user Press}, 15426 pages = {163--202}, 15427 year = {1997} 15428} 15429 15430@Article{ mumps01, 15431 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 15432 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 15433 journal = {SIAM Journal on Matrix Analysis and Applications}, 15434 volume = {23}, 15435 number = {1}, 15436 pages = {15--41}, 15437 year = {2001} 15438} 15439 15440@Article{ mumps19, 15441 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 15442 Multicore Architectures}}, 15443 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 15444 journal = {ACM Transactions on Mathematical Software}, 15445 volume = {45}, 15446 issue = {1}, 15447 pages = {2:1--2:26}, 15448 year = {2019} 15449} 15450 15451@Article{ zoltan06, 15452 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 15453 \c{C}ataly\"urek and Robert H. Bisseling}, 15454 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 15455 journal = {SIAM Parallel Processing for Scientific Computing}, 15456 month = feb, 15457 year = {2006} 15458} 15459 15460@Article{ lidemmel03, 15461 author = {Xiaoye S. Li and James W. Demmel}, 15462 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 15463 unsymmetric linear systems}, 15464 journal = {ACM Transactions on Mathematical Software}, 15465 year = {2003}, 15466 month = jun, 15467 volume = {29}, 15468 number = {2}, 15469 pages = {110--140} 15470} 15471 15472@TechReport{ superlu, 15473 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 15474 title = {{SuperLU} Users' Guide}, 15475 number = {LBNL-44289}, 15476 institution = {Lawrence Berkeley National Laboratory}, 15477 year = {2003}, 15478 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 15479} 15480 15481@TechReport{ trilinos-overview03, 15482 title = {{An Overview of {T}rilinos}}, 15483 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 15484 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 15485 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 15486 Willenbring and Alan Williams}, 15487 institution = {Sandia National Laboratories}, 15488 number = {SAND2003-2927}, 15489 year = {2003} 15490} 15491 15492@TechReport{ trilinos-users-guide, 15493 title = {{Trilinos} Users Guide}, 15494 author = {Michael A. Heroux and James M. Willenbring}, 15495 institution = {Sandia National Laboratories}, 15496 number = {SAND2003-2952}, 15497 url = {http://trilinos.sandia.gov/}, 15498 year = {2003} 15499} 15500 15501@Article{ pilut01, 15502 author = {David Hysom and Alex Pothen}, 15503 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 15504 journal = {SIAM Journal on Scientific Computing}, 15505 volume = {22}, 15506 pages = {2194--2215}, 15507 year = {2001} 15508} 15509 15510@TechReport{ boomeramg00, 15511 author = {V.~E. Henson and U.~M. Yang}, 15512 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 15513 institution = {Lawrence Livermore National Laboratory}, 15514 number = {UCRL-JC-133948}, 15515 year = {2000} 15516} 15517 15518@InCollection{ baker2012scaling, 15519 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 15520 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 15521 and Schulz, Martin and Yang, Ulrike Meier}, 15522 booktitle = {Competence in High Performance Computing 2010}, 15523 pages = {215--226}, 15524 year = {2012}, 15525 publisher = {Springer} 15526} 15527 15528@Article{ knollkeyes:04, 15529 author = {D. A. Knoll and D. E. Keyes}, 15530 year = {2004}, 15531 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 15532 journal = {J. Comp. Phys.}, 15533 volume = {193}, 15534 pages = {357-397} 15535} 15536 15537@Article{ chacon02, 15538 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 15539 title = {An implicit nonlinear reduced resistive {MHD} solver}, 15540 journal = {J. Comput. Phys}, 15541 volume = {188}, 15542 year = {2002}, 15543 pages = {15--36} 15544} 15545 15546@Article{ mousseau03, 15547 author = {V. A. Mousseau and D. A. Knoll}, 15548 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 15549 Radiation Diffusion}, 15550 journal = {J. Comput. Physics}, 15551 year = {2003} 15552} 15553 15554@Article{ mousseau00, 15555 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 15556 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 15557 Radiation Diffusion}, 15558 journal = {J. Comput. Physics}, 15559 year = {2000}, 15560 pages = {743--765}, 15561 volume = {160} 15562} 15563 15564@Unpublished{ facets:homepage, 15565 author = {John {Cary (PI)}}, 15566 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 15567 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 15568} 15569 15570@Unpublished{ cpes:homepage, 15571 author = {{C.S.} {Chang (PI)}}, 15572 title = {{Center for Plasma Edge Simulation (CPES)}}, 15573 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 15574} 15575 15576@Misc{ epsi:homepage, 15577 author = {{C.S.} {Chang (PI)}}, 15578 title = {{Center for Edge Physics Simulation (EPSI)}}, 15579 note = {\url{http://epsi.pppl.gov}} 15580} 15581 15582@Unpublished{ groundwater-scidac2:web, 15583 author = {Peter {Lichtner (PI)}}, 15584 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15585 Advanced Computing}, 15586 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 15587} 15588 15589@Misc{ pflotran:web, 15590 author = {Peter {Lichtner (PI)}}, 15591 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15592 Advanced Computing}}, 15593 note = {\url{http://ees.lanl.gov/pflotran/}} 15594} 15595 15596@Misc{ accel-scidac2-solicitation, 15597 author = {{DOE Office of Science}}, 15598 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 15599 year = {2006}, 15600 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 15601} 15602 15603@Article{ nieter04, 15604 author = {C. Nieter and J. R. Cary}, 15605 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 15606 journal = {J. Comp. Phys.}, 15607 year = {2004}, 15608 volume = {196}, 15609 pages = {448} 15610} 15611 15612@Article{ synergia06, 15613 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 15614 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 15615 journal = {J. Comp. Phys.}, 15616 year = {2006}, 15617 volume = {211}, 15618 pages = {229-248} 15619} 15620 15621@Unpublished{ stoltz07, 15622 author = {P. H. Stoltz}, 15623 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 15624 year = {2007}, 15625 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 15626 Albuquerque, NM, 2007} 15627} 15628 15629@Misc{ iter:homepage, 15630 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15631 year = {2007}, 15632 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15633 howpublished = {\url{http://www.iter.org}} 15634} 15635 15636@Misc{ epp2010, 15637 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 15638 Council}}, 15639 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 15640 Particle Physics}, 15641 year = {2006}, 15642 howpublished = {The National Academies Press, ISBN: 0309101948} 15643} 15644 15645@Misc{ post-fsp-report, 15646 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 15647 and P.~Colella and S.~C.~Jardin}, 15648 title = {{Report of Fusion Simulation Project Steering Committee}}, 15649 month = aug, 15650 year = {2004}, 15651 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 15652} 15653 15654@Misc{ fsp:workshop2011, 15655 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15656 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15657 month = feb, 15658 year = {2011}, 15659 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 15660} 15661 15662@Book{ hazeltine-meiss-book, 15663 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 15664 title = {Plasma Confinement}, 15665 year = {1991}, 15666 publisher = {Addison-Wesley, Redwood City, CA} 15667} 15668 15669@Article{ falgout05a, 15670 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15671 title = {Conceptual Interfaces in hypre}, 15672 journal = {Future Generation Computer Systems}, 15673 note = {Special issue on PDE software}, 15674 volume = {22}, 15675 year = {2005}, 15676 pages = {239--251} 15677} 15678 15679@Article{ falgout05b, 15680 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15681 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 15682 journal = {ACM Trans. Math. Softw.}, 15683 volume = {31}, 15684 year = {2005}, 15685 pages = {326--350} 15686} 15687 15688@Unpublished{ compass:homepage, 15689 author = {Panagiotis {Spentzouris (PI)}}, 15690 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 15691 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 15692} 15693 15694@Unpublished{ cmsnf:homepage, 15695 author = {{Todd Allen, Director}}, 15696 title = {{Center for Materials Science of Nuclear Fuel}}, 15697 note = {Energy Frontier Research Center, see 15698 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 15699} 15700 15701@Unpublished{ dvi-materials:project, 15702 author = {{L.~C.} {McInnes (PI)}}, 15703 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 15704 note = {{SciDAC}-e project}, 15705 year = {2011} 15706} 15707 15708@Misc{ scidac:homepage, 15709 author = {{DOE Office of Science}}, 15710 title = {{Scientific Discovery through Advanced Computing}}, 15711 year = {2007}, 15712 howpublished = {\url{http://www.scidac.gov}} 15713} 15714 15715@Misc{ corba, 15716 author = {{Object Management Group}}, 15717 year = {2007}, 15718 title = {{Common Object Request Broker Architecture (CORBA)}}, 15719 howpublished = {\url{http://www.corba.org}} 15720} 15721 15722@Article{ uedge, 15723 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 15724 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 15725 Divertor Tokamak}, 15726 journal = {J. Plasma Physics}, 15727 year = {1999}, 15728 volume = {6}, 15729 pages = {1851}, 15730 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 15731} 15732 15733@Article{ bout, 15734 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 15735 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 15736 journal = {J. Plasma Physics}, 15737 year = {2000}, 15738 volume = {7}, 15739 pages = {1951}, 15740 note = {} 15741} 15742 15743@Article{ bout++, 15744 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 15745 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 15746 journal = {Computer Physics Communications}, 15747 year = {2009}, 15748 volume = {180}, 15749 issue = {9}, 15750 pages = {1467 -- 1480}, 15751 note = {} 15752} 15753 15754@Article{ tempest, 15755 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 15756 and G. Kerbel and W.M. Nevins and T. Rognlien}, 15757 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 15758 journal = {Bull. Am. Phys. Soc. }, 15759 year = {2005}, 15760 volume = {50}, 15761 number = {86}, 15762 pages = {CP1}, 15763 note = {} 15764} 15765 15766@Article{ ccahpc, 15767 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 15768 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 15769 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 15770 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 15771 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 15772 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 15773 and Theresa L. Windus and Shujia Zhou}, 15774 title = {A Component Architecture for High-Performance Scientific Computing}, 15775 journal = {Intl. J. High-Perf. Computing Appl.}, 15776 volume = {20}, 15777 pages = {163--202}, 15778 year = {2006}, 15779 note = {ACTS Collection special issue} 15780} 15781 15782@Misc{ cca-forum:homepage, 15783 author = {{Common Component Architecture Forum}}, 15784 note = {\url{http://www.cca-forum.org}}, 15785 year = {2010} 15786} 15787 15788@Misc{ petsc:driven-cavity-example, 15789 title = {{PETSc Driven Cavity Example Code}}, 15790 author = {B. F. {Smith et al.}}, 15791 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 15792} 15793 15794@Misc{ petsc-dm:webpage, 15795 author = {B. F. {Smith et al.}}, 15796 title = {{PETSc DM Webpage}}, 15797 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 15798 year = {2018} 15799} 15800 15801@Misc{ unic-ref, 15802 author = {Giuseppe Palmiotti}, 15803 title = {{UNIC} Neutronics Software}, 15804 note = {Nuclear Engineering Division, Argonne National Laboratory} 15805} 15806 15807% ----------------------------------------------------------------------- 15808% Model coupling refs 15809@Book{ greve-blatter, 15810 author = {Ralf Greve and Heinz Blatter}, 15811 title = {Dynamics of Ice Sheets and Glaciers}, 15812 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 15813 publisher = {Springer}, 15814 year = {2009} 15815} 15816 15817@Misc{ doe-isicles, 15818 key = {ISICLES}, 15819 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 15820 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 15821} 15822 15823@Article{ safta2011tchem, 15824 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 15825 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 15826 journal = {Sandia Report, SAND2011-3282}, 15827 year = {2011} 15828} 15829 15830@Misc{ chemkin-website, 15831 key = {chemkin}, 15832 title = {ANSYS Chemkin-Pro Website}, 15833 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 15834 year = {2017} 15835} 15836 15837@Misc{ mct-website, 15838 key = {MCT}, 15839 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 15840 howpublished = {\url{http://www.mcs.anl.gov/mct}} 15841} 15842 15843@Article{ larson:05, 15844 author = {Jay Larson and Robert Jacob and Everest Ong}, 15845 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 15846 Multi-Physics Parallel Coupled Models}, 15847 journal = {Int. J. High Perf. Comp. App.}, 15848 year = {2005}, 15849 pages = {277--292} 15850} 15851 15852@Article{ dennis2012computational, 15853 title = {Computational performance of ultra-high-resolution capability in the Community 15854 Earth System Model}, 15855 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 15856 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 15857 journal = {International Journal of High Performance Computing Applications}, 15858 volume = {26}, 15859 number = {1}, 15860 pages = {5--16}, 15861 year = {2012}, 15862 publisher = {SAGE Publications} 15863} 15864 15865@InProceedings{ bettge01, 15866 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 15867 year = {2001}, 15868 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 15869 Backroads}, 15870 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15871 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15872 pages = {148 -- 156}, 15873 series = {Lecture Notes in Computer Science}, 15874 volume = {2073}, 15875 publisher = {Springer-Verlag} 15876} 15877 15878@InProceedings{ jacob01, 15879 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 15880 year = {2001}, 15881 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 15882 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15883 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15884 series = {Lecture Notes in Computer Science}, 15885 volume = {2073}, 15886 publisher = {Springer-Verlag} 15887} 15888 15889@Article{ chen2008new, 15890 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 15891 design}, 15892 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 15893 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 15894 journal = {Chinese Science Bulletin}, 15895 volume = {53}, 15896 number = {22}, 15897 pages = {3433--3445}, 15898 year = {2008}, 15899 publisher = {Springer} 15900} 15901 15902@InProceedings{ baum01, 15903 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 15904 and C. Charman}, 15905 year = {2001}, 15906 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 15907 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15908 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15909 series = {Lecture Notes in Computer Science}, 15910 volume = {2073}, 15911 publisher = {Springer-Verlag} 15912} 15913 15914@InProceedings{ lefantzi03, 15915 author = {S. Lefantzi and J. Ray}, 15916 year = {2003}, 15917 title = {A Component-based Scientific Toolkit for Reacting Flows}, 15918 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 15919 volume = {2}, 15920 publisher = {Elsevier} 15921} 15922 15923@Article{ boville98, 15924 author = {B. A. Boville and P. R. Gent}, 15925 title = {The {NCAR} Climate System Model, Version One}, 15926 journal = {Journal of Climate}, 15927 volume = {11}, 15928 year = {1998}, 15929 pages = {1115--1130} 15930} 15931 15932@Misc{ paraschivoiu99, 15933 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 15934 title = {Multi-domain multi-model formulation for compressible flows: Conservative 15935 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 15936 note = {AIAA Paper 99-0784}, 15937 year = {1999} 15938} 15939 15940@Article{ peszynska, 15941 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 15942 title = {Mortar upscaling for multiphysics flow in porous media}, 15943 journal = {Computational Geosciences} 15944} 15945 15946@TechReport{ wheeler00, 15947 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 15948 title = {A distributed computing portal for coupling multi-physics and multiple domains in 15949 porous media}, 15950 institution = {University of Texas at Austin}, 15951 number = {TICAM 00-03}, 15952 year = {2000} 15953} 15954 15955@TechReport{ peszynska00, 15956 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 15957 title = {Multiphysics Coupling of Codes}, 15958 institution = {University of Texas at Austin}, 15959 number = {TICAM 00-02}, 15960 year = {2000} 15961} 15962 15963@Article{ joshaghanijoodatnakshatrala2019, 15964 title = {A stabilized mixed discontinuous Galerkin formulation for double 15965 porosity/permeability model}, 15966 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 15967 journal = {Computer Methods in Applied Mechanics and Engineering}, 15968 volume = {352}, 15969 pages = {508--560}, 15970 year = {2019} 15971} 15972 15973@InProceedings{ cai99, 15974 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 15975 title = {An explicit multi-model compressible flow formulation based on the full potential 15976 equation and the {Euler} equations on {3D} unstructured meshes}, 15977 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 15978 Methods}, 15979 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 15980 year = {1999} 15981} 15982 15983@Article{ he05, 15984 author = {Yun He and Chris H. Q. Ding}, 15985 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 15986 Architectures}, 15987 year = {2005}, 15988 volume = {19}, 15989 pages = {329--240}, 15990 number = {3}, 15991 journal = {Int. Journal of High Performance Computing Applications} 15992} 15993 15994@InProceedings{ uiuc-rocket-center02, 15995 author = {W. A. Dick and M. T. Heath}, 15996 title = {Whole System Simulation of Solid Propellant Rockets}, 15997 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 15998 month = jul, 15999 year = {2002} 16000} 16001 16002@InProceedings{ toth04, 16003 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 16004 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 16005 Oehmke}, 16006 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 16007 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 16008 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 16009 Sun-Earth Connection}, 16010 year = {2004}, 16011 publisher = {Elsevier}, 16012 pages = {383--397} 16013} 16014 16015@Misc{ csdrm:web, 16016 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 16017 Shepherd}, 16018 title = {{Center for Simulation of Dynamic Response of Materials}}, 16019 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 16020} 16021 16022@Misc{ csar:web, 16023 author = {M. {Heath (Director)}}, 16024 title = {{Center for Simulation of Advanced Rockets}}, 16025 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 16026} 16027 16028@Misc{ csafe:web, 16029 author = {D. {Pershing (Director)}}, 16030 title = {{Center for Simulation of Accidental Fires and Explosions}}, 16031 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 16032} 16033 16034@Misc{ cits:web, 16035 author = {P. {Moin (Director)}}, 16036 title = {{Center for Integrated Turbulence Simulations}}, 16037 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 16038} 16039 16040@Misc{ flash:web, 16041 author = {D. {Lamb (Director)}}, 16042 title = {{Center for Integrated Turbulence Simulations}}, 16043 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 16044} 16045 16046@TechReport{ utah-csafe03, 16047 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 16048 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 16049 Problems, Part 1: Algorithm Development}, 16050 institution = {University of Utah, Center for the Simulation of Accidental Fires and 16051 Explosions}, 16052 year = {2003} 16053} 16054 16055@InBook{ shepherd07, 16056 author = {M. Shepherd and E. Seol and B. FrantzDale}, 16057 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 16058 year = {2007}, 16059 booktitle = {CRC Handbook of Dynamic System Modeling}, 16060 publisher = {Wiley}, 16061 pages = {1--41}, 16062 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 16063} 16064 16065@InProceedings{ cactus02, 16066 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 16067 Radke and Edward Seidel and John Shalf}, 16068 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 16069 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 16070 year = {2002}, 16071 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 16072} 16073 16074@Misc{ cactus:homepage, 16075 author = {G. {Allen et al.}}, 16076 title = {{Cactus Web page}}, 16077 howpublished = {\url{http://cactuscode.org}} 16078} 16079 16080@Misc{ open-grid-forum:web, 16081 key = {{Open Grid Forum}}, 16082 title = {{Open Grid Forum}}, 16083 note = {See \url{http://www.ogf.org}} 16084} 16085 16086@Misc{ nox:web, 16087 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 16088 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 16089 note = {See \url{http://software.sandia.gov/nox}} 16090} 16091 16092@Misc{ chombo:web, 16093 author = {P. {Colella (PI)}}, 16094 title = {{Chombo}}, 16095 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 16096} 16097 16098@Article{ lanzkron96, 16099 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 16100 title = {An Analysis of Approximate Nonlinear Elimination}, 16101 journal = {SIAM J. Sci. Comput.}, 16102 volume = {17}, 16103 year = {1996}, 16104 pages = {538--559} 16105} 16106 16107@Article{ jiang95, 16108 author = {J. Jiang and P. Forsyth}, 16109 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 16110 Equations}, 16111 journal = {Computers and Fluids}, 16112 volume = {24}, 16113 pages = {753--770}, 16114 year = {1995} 16115} 16116 16117@Article{ young90, 16118 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 16119 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 16120 journal = {Int. J. Numer. Methods Fluids}, 16121 volume = {11}, 16122 pages = {1075--1095}, 16123 year = {1990} 16124} 16125 16126@Article{ fishwick04, 16127 author = {Paul A. Fishwick}, 16128 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 16129 to Interrelating Model Structures}, 16130 journal = {SCS Trans. on Simulation}, 16131 note = {Special Issue in Grand Challenges in Computer Simulation}, 16132 year = {2004} 16133} 16134 16135@Article{ fishwick03, 16136 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 16137 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 16138 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 16139 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 16140 year = {2003} 16141} 16142 16143@InProceedings{ kirner00, 16144 author = {T. G. Kirner and V. F. Martins}, 16145 title = {Development of an Information Visualization Tool Using Virtual Reality}, 16146 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 16147 year = {2000}, 16148 pages = {604--606} 16149} 16150 16151@InProceedings{ orso03, 16152 author = {A. Orso and J. Jones and M. J. Harrold}, 16153 title = {Visualization of Program-Execution Data for Deployed Software}, 16154 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 16155 year = {2003}, 16156 pages = {67--76} 16157} 16158 16159@Book{ tiller01, 16160 author = {M. Tiller}, 16161 title = {Introduction to Physical System Modeling with Modelica}, 16162 series = {Kluwer International Series inEngineering and Computer Science}, 16163 volume = {615}, 16164 publisher = {Kluwer}, 16165 year = {2001} 16166} 16167 16168@Article{ buck94, 16169 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 16170 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 16171 journal = {Int. Journal of Computer Simulation}, 16172 volume = {4}, 16173 pages = {155--182}, 16174 year = {1994} 16175} 16176 16177@Article{ mu95, 16178 author = {M. Mu and J.R. Rice}, 16179 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 16180 journal = {Comp. Syst. Engr.}, 16181 volume = {6}, 16182 year = {1995}, 16183 pages = {87--95} 16184} 16185 16186@TechReport{ drashansky96, 16187 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 16188 author = {R. Drashansky and A. Joshi and J. R. Rice}, 16189 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 16190 year = {1996} 16191} 16192 16193@Article{ michopoulos05, 16194 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 16195 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 16196 journal = {Journal of Computing and Information Science in Engineering}, 16197 volume = {5}, 16198 issue = {3}, 16199 pages = {198--213}, 16200 year = {2005} 16201} 16202 16203@Article{ dubey09, 16204 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 16205 Multiphysics Simulation Code}, 16206 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 16207 Siegel and K. Weide}, 16208 journal = {Parallel Computing}, 16209 volume = {35}, 16210 issue = {10 -- 11}, 16211 pages = {512 -- 522}, 16212 year = {2009} 16213} 16214 16215@Book{ bottloring95, 16216 author = {Raoul Bott and Loring W. Tu}, 16217 title = {Differential Forms in Algebraic Topology}, 16218 publisher = {Springer}, 16219 year = {1995} 16220} 16221 16222@Book{ kobayashinomizu96, 16223 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 16224 title = {Foundations of Differential Geometry}, 16225 publisher = {Wiley-Interscience}, 16226 year = {1996} 16227} 16228 16229@Article{ hornungkohn02, 16230 author = {Richard D. Hornung and Scott R. Kohn}, 16231 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 16232 journal = {Concurrency and Computation: Practice and Experience}, 16233 volume = {14}, 16234 pages = {347--368}, 16235 year = {2002} 16236} 16237 16238@InProceedings{ concepts06, 16239 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 16240 Gabriel Dos Reis and Andrew Lumsdaine}, 16241 title = {Concepts: Linguistic Support for Generic Programming in C++}, 16242 booktitle = {Proceedings of OOPSLA 2006}, 16243 year = {2006}, 16244 pages = {???--???} 16245} 16246 16247@Book{ hatcher02, 16248 author = {Hatcher, Allen}, 16249 title = {Algebraic Topology}, 16250 publisher = {Cambridge University Press}, 16251 year = {2002} 16252} 16253 16254@Book{ gammahelmjohnsonvlissides95, 16255 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 16256 development, offering timeless and elegant solutions to common problems in 16257 software design. It describes patterns for managing object creation, composing 16258 objects into larger structures, and coordinating control flow between objects. The 16259 book provides numerous examples where using composition rather than inheritance 16260 can improve the reusability and flexibility of code. Note, though, that it's not a 16261 tutorial but a catalog that you can use to find an object-oriented design pattern 16262 that's appropriate for the needs of your particular application--a selection for 16263 virtuoso programmers who appreciate (or require) consistent, well-engineered 16264 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 16265 more valuable than ever! 16266 16267 Use the contents of the CD to create your own design documents and reusable 16268 components. The CD contains: 23 patterns you can cut and paste into your own 16269 design documents; sample code demonstrating pattern implementation; complete 16270 Design Patterns content in standard HTML format, with numerous hyperlinked 16271 cross-references; accessed through a standard web browser; Java-based dynamic 16272 search mechanism, enhancing online search capabilities; graphical user environment, 16273 allowing ease of navigation. 16274 16275 First published in 1995, this landmark work on object-oriented software design 16276 presents a catalog of simple and succinct solutions to common design problems. 16277 Created by four experienced designers, the 23 patterns contained herein have 16278 become an essential resource for anyone developing reusable object-oriented 16279 software. In response to reader demand, the complete text and pattern catalog are 16280 now available on CD-ROM. This electronic version of Design Patterns enables 16281 programmers to install the book directly onto a computer or network for use as an 16282 online reference for creating reusable object-oriented software. 16283 16284 The authors first describe what patterns are and how they can help you in the 16285 design process. They then systematically name, explain, evaluate, and catalog 16286 recurring designs in object-oriented systems. All patterns are compiled from 16287 real-world examples and include code that demonstrates how they may be implemented 16288 in object-oriented programming languages such as C++ and Smalltalk. Readers who 16289 already own the book will want the CD to take advantage of its dynamic search 16290 mechanism and ready-to-install patterns.}}, 16291 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 16292 citeulike-article-id={115158}, 16293 howpublished = {Hardcover}, 16294 isbn = {0201633612}, 16295 keywords = {1995 algorithms architecture book books computer computing design design-pattern 16296 design-patterns design_patterns designpatterns development diplom entwurfsmuster 16297 four gang gof java mathgamespatterns no-tag object object-orientation 16298 object-oriented of oo-patterns oop oriented pattern patterns programming se 16299 software software-development software-engineering software_design 16300 softwareengineering standard}, 16301 month = jan, 16302 publisher = {{Addison-Wesley Professional}}, 16303 title = {Design Patterns}, 16304 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 16305 year = {1995} 16306} 16307 16308@InProceedings{ chaco95, 16309 author = {Bruce Hendrickson and Robert Leland}, 16310 title = {A multilevel algorithm for partitioning graphs}, 16311 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 16312 (CDROM)}, 16313 year = {1995}, 16314 isbn = {0-89791-816-9}, 16315 pages = {28}, 16316 location = {San Diego, California, United States}, 16317 doi = {10.1145/224170.224228}, 16318 publisher = {ACM Press}, 16319 address = {New York} 16320} 16321 16322@Book{ aleksandrov98, 16323 author = {Aleksandrov, Pavel S.}, 16324 title = {Combinatorial Topology}, 16325 publisher = {Dover}, 16326 volume = {3}, 16327 year = {1998} 16328} 16329 16330@Book{ steenrod99, 16331 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 16332 importance in modern physics--such as in gauge theory. This book, a succinct 16333 introduction to the subject by renown mathematician Norman Steenrod, was the first 16334 to present the subject systematically. 16335 16336 It begins with a general introduction to bundles, including such topics as 16337 differentiable manifolds and covering spaces. The author then provides brief 16338 surveys of advanced topics, such as homotopy theory and cohomology theory, before 16339 using them to study further properties of fibre bundles. The result is a classic 16340 and timeless work of great utility that will appeal to serious mathematicians and 16341 theoretical physicists alike. }}, 16342 author = {Steenrod, Norman}, 16343 citeulike-article-id={712999}, 16344 howpublished = {Paperback}, 16345 isbn = {0691005486}, 16346 keywords = {fibre_bundles topology}, 16347 month = apr, 16348 publisher = {{Princeton University Press}}, 16349 title = {The Topology of Fibre Bundles. (PMS-14)}, 16350 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 16351 year = {1999} 16352} 16353 16354@Book{ bredon97, 16355 author = {Bredon, Glen E.}, 16356 title = {Sheaf Theory}, 16357 publisher = {Springer}, 16358 pages = {524}, 16359 series = {Graduate Texts in Mathematics}, 16360 year = {1997} 16361} 16362 16363@TechReport{ tautgesmeyers04, 16364 title = {{MOAB}: A Mesh-Oriented Database}, 16365 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 16366 Ernst}, 16367 institution = {Sandia National Laboratories}, 16368 number = {SAND2004-1592}, 16369 month = apr, 16370 year = {2004} 16371} 16372 16373@Article{ tautges04, 16374 author = {Timothy J. Tautges}, 16375 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 16376 journal = {Engineering With Computers}, 16377 volume = {20}, 16378 pages = {286--293}, 16379 year = {2004} 16380} 16381 16382@InProceedings{ meyers02, 16383 author = {Ray Meyers et. al}, 16384 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 16385 booktitle = {8th International conference on numerical grid generation in computational field 16386 simulations}, 16387 month = jun, 16388 year = {2002} 16389} 16390 16391@InProceedings{ seolshepard05, 16392 author = {E. S. Seol and Mark S. Shephard}, 16393 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 16394 Analysis}, 16395 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 16396 year = {2005} 16397} 16398 16399@Article{ lishephardbeall2005, 16400 title = {3D anisotropic mesh adaptation by mesh modification}, 16401 author = {Xiangrong Li and Mark S Shephard and Mark W Beall}, 16402 journal = {Computer methods in applied mechanics and engineering}, 16403 volume = {194}, 16404 number = {48-49}, 16405 pages = {4915--4950}, 16406 year = {2005}, 16407} 16408 16409@Article{ lushephardtendulkarbeall2014, 16410 title = {Parallel mesh adaptation for high-order finite element methods with curved element geometry}, 16411 author = {Qiukai Lu and Mark S Shephard and Saurabh Tendulkar and Mark W Beall}, 16412 journal = {Engineering with Computers}, 16413 volume = {30}, 16414 pages = {271--286}, 16415 year = {2014}, 16416} 16417 16418@Article{ beallwalshshephard04, 16419 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 16420 title = {A comparison of techniques for geometry access related to mesh generation}, 16421 journal = {Engineering With Computers}, 16422 volume = {20}, 16423 number = {3}, 16424 pages = {210--221}, 16425 year = {2004} 16426} 16427 16428@Article{ careyandersoncarneskirk04, 16429 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 16430 Kirk}, 16431 title = {Some aspects of adaptive grid technology related to boundary and interior 16432 layers}, 16433 journal = {Journal of Computational Applied Mathematics}, 16434 volume = {166}, 16435 number = {1}, 16436 pages = {55--86}, 16437 year = {2004} 16438} 16439 16440@PhDThesis{ gralthesis, 16441 author = {Guntram Berti}, 16442 title = {Generic Software Components for Scientific Computing}, 16443 school = {TU Cottbus}, 16444 year = {2000}, 16445 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 16446} 16447 16448@Article{ whitehead1949, 16449 title = {Combinatorial homotopy. I}, 16450 author = {John HC Whitehead}, 16451 journal = {Bulletin of the American Mathematical Society}, 16452 volume = {55}, 16453 number = {3. P1}, 16454 pages = {213--245}, 16455 year = {1949}, 16456 publisher = {American Mathematical Society} 16457} 16458 16459@Article{ beylkincoifmanrokhlin91, 16460 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 16461 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 16462 journal = {Communications on Pure and Applied Mathematics}, 16463 volume = {44}, 16464 pages = {141--183}, 16465 year = {1991} 16466} 16467 16468@Book{ wesseling92, 16469 author = {Pieter Wesseling}, 16470 title = {An Introduction to Multigrid Methods}, 16471 publisher = {John Wiley and Sons}, 16472 year = {1992} 16473} 16474 16475@Book{ grakakos04, 16476 author = {Loukas Grakakos}, 16477 title = {Classical and Modern Fourier Analysis}, 16478 publisher = {Pearson Education}, 16479 address = {New Jersey}, 16480 year = {2004} 16481} 16482 16483@Misc{ hlib-web-page, 16484 key = {HLib}, 16485 title = {{HLib} {Web} page}, 16486 note = {{\texttt{http://www.hlib.org/}}}, 16487 annote = {Hierarchical matrices for fast integral transform} 16488} 16489 16490@Article{ hackbusch99, 16491 author = {Wolfgang Hackbusch}, 16492 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 16493 Introduction to {$\mathcal H$}-matrices}, 16494 journal = {Computing}, 16495 volume = {62}, 16496 pages = {89--108}, 16497 year = {1999} 16498} 16499 16500@TechReport{ kay1999green, 16501 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 16502 equations}, 16503 author = {Kay, D. and Loghin, D.}, 16504 year = {1999}, 16505 institution = {Oxford University Computing Laboratory}, 16506 number = {99/06} 16507} 16508 16509@Article{ bebendorf2003existence, 16510 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 16511 elliptic operators with {$L^\infty$}-coefficients}, 16512 author = {Bebendorf, M. and Hackbusch, W.}, 16513 journal = {Numerische Mathematik}, 16514 volume = {95}, 16515 number = {1}, 16516 pages = {1--28}, 16517 year = {2003}, 16518 publisher = {Springer} 16519} 16520 16521@Article{ hackbusch2005direct, 16522 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 16523 H$}-matrix approximation}, 16524 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 16525 journal = {Computing and Visualization in Science}, 16526 volume = {8}, 16527 number = {3}, 16528 pages = {179--188}, 16529 year = {2005}, 16530 publisher = {Springer} 16531} 16532 16533@TechReport{ duphof2003, 16534 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 16535 Logg and L. R. Scott}, 16536 title = {The {FE}ni{CS} project}, 16537 institution = {Chalmers Finite Element Center Preprint Series}, 16538 number = {2003--21}, 16539 year = {2003} 16540} 16541 16542@Article{ flame01, 16543 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 16544 Geijn}, 16545 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 16546 journal = {Transactions on Mathematical Software}, 16547 volume = {27}, 16548 number = {4}, 16549 year = {2001}, 16550 pages = {422--455} 16551} 16552 16553@Article{ puschel05, 16554 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 16555 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 16556 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 16557 Nick Rizzolo}, 16558 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 16559 journal = {Proceedings of the IEEE}, 16560 volume = {93}, 16561 number = {2}, 16562 year = {2005}, 16563 note = {special issue on "Program Generation, Optimization, and Adaptation"} 16564} 16565 16566@Article{ kirbylogg06, 16567 author = {Robert C. Kirby and Anders Logg}, 16568 title = {A compiler for variational forms}, 16569 journal = {ACM Transactions on Mathematical Software}, 16570 volume = {32}, 16571 number = {3}, 16572 year = {2006}, 16573 issn = {0098-3500}, 16574 pages = {417--444}, 16575 doi = {10.1145/1163641.1163644}, 16576 publisher = {ACM Press}, 16577 address = {New York, NY} 16578} 16579 16580@Article{ kirbylogg07, 16581 author = {Robert C. Kirby and Anders Logg}, 16582 title = {Efficient compilation of a class of variational forms}, 16583 journal = {ACM Transactions on Mathematical Software}, 16584 volume = {33}, 16585 number = {3}, 16586 year = {2007}, 16587 issn = {0098-3500}, 16588 pages = {17}, 16589 doi = {10.1145/1268769.1268771}, 16590 publisher = {ACM Press}, 16591 address = {New York, NY} 16592} 16593 16594@Article{ bankdupont81, 16595 author = {Randolph Bank and Todd Dupont}, 16596 title = {An optimal order process for solving finite element equations}, 16597 journal = {Mathematics of Computation}, 16598 volume = {36}, 16599 pages = {35--51}, 16600 year = {1981} 16601} 16602 16603@TechReport{ adams00, 16604 author = {Mark F. Adams}, 16605 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 16606 in solid mechanics}, 16607 institution = {UC Berkeley}, 16608 number = {CSD-00-1103}, 16609 year = {2000}, 16610 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 16611} 16612 16613@Article{ bergengradlhuelsemannruede06, 16614 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 16615 title = {A Massively Parallel Multigrid Method for Finite Elements}, 16616 journal = {Computing in Science \& Engineering}, 16617 volume = {8}, 16618 number = {6}, 16619 pages = {56--62}, 16620 year = {2006} 16621} 16622 16623@MastersThesis{ brunethesis08, 16624 author = {Peter R. Brune}, 16625 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 16626 school = {University of Chicago}, 16627 address = {Chicago, IL}, 16628 year = {2008}, 16629 month = feb 16630} 16631 16632@Article{ arnoldwinther02, 16633 author = {Douglas N. Arnold and Ragnar Winther}, 16634 title = {Mixed finite elements for elasticity}, 16635 journal = {Numerische Mathematik}, 16636 volume = {92}, 16637 number = {3}, 16638 month = sep, 16639 year = {2002}, 16640 pages = {401--419}, 16641 doi = {10.1007/s002110100348} 16642} 16643 16644@Article{ arnoldfalkwinther06, 16645 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 16646 title = {Finite element exterior calculus, homological techniques, and applications}, 16647 journal = {Acta Numerica}, 16648 year = {2006}, 16649 volume = {15}, 16650 pages = {1--155}, 16651 publisher = {Cambridge University Press}, 16652 doi = {10.1017/S0962492906210018} 16653} 16654 16655@Article{ kirby04, 16656 author = {Robert C. Kirby}, 16657 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 16658 functions}, 16659 journal = {ACM Transactions on Mathematical Software}, 16660 volume = {30}, 16661 number = {4}, 16662 year = {2004}, 16663 issn = {0098-3500}, 16664 pages = {502--516}, 16665 doi = {10.1145/1039813.1039820}, 16666 publisher = {ACM Press}, 16667 address = {New York, NY} 16668} 16669 16670@Article{ kirby06, 16671 author = {Robert C. Kirby}, 16672 title = {Optimizing {FIAT} with level 3 {BLAS}}, 16673 journal = {ACM Transactions on Mathematical Software}, 16674 volume = {32}, 16675 number = {2}, 16676 year = {2006}, 16677 issn = {0098-3500}, 16678 pages = {223--235}, 16679 doi = {10.1145/1141885.1141889}, 16680 publisher = {ACM Press}, 16681 address = {New York, NY} 16682} 16683 16684@Misc{ bluecrystal08, 16685 author = {{B}lue {C}rystal Cluster}, 16686 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 16687 year = {2008}, 16688 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 16689} 16690 16691@Article{ beylkin95, 16692 author = {Gregory Beylkin}, 16693 title = {On the Fast Fourier Transform of Functions With Singularities}, 16694 journal = {Applied and Computational Harmonic Analysis}, 16695 volume = {2}, 16696 pages = {363--381}, 16697 year = {1995} 16698} 16699 16700@InProceedings{ riehl08, 16701 author = {Jonathan Riehl}, 16702 title = {Implementing the MyFEM Embedded Domain-specific Language}, 16703 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 16704 Development (DSPD'08)}, 16705 address = {Nashville, TN}, 16706 year = {2008} 16707} 16708 16709@Article{ appel85, 16710 author = {Andrew W. Appel}, 16711 date-added = {2008-02-27 12:23:39 +0000}, 16712 date-modified = {2008-02-27 12:24:02 +0000}, 16713 doi = {10.1137/0906008}, 16714 journal = {SIAM Journal on Scientific and Statistical Computing}, 16715 keywords = {treecodes}, 16716 number = {1}, 16717 pages = {85-103}, 16718 publisher = {SIAM}, 16719 title = {An Efficient Program for Many-Body Simulation}, 16720 volume = {6}, 16721 year = {1985} 16722} 16723 16724@Article{ ewald21, 16725 author = {{Ewald}, P.~P.}, 16726 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 16727 journal = {Annalen der Physik}, 16728 year = {1921}, 16729 volume = {369}, 16730 pages = {253-287}, 16731 doi = {10.1002/andp.19213690304}, 16732 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 16733 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16734} 16735 16736@Article{ greengardrokhlin87, 16737 author = {L. Greengard and V. Rokhlin}, 16738 date-added = {2008-02-15 18:43:55 +0000}, 16739 date-modified = {2008-02-26 20:09:11 +0000}, 16740 doi = {10.1016/0021-9991(87)90140-9}, 16741 journal = {J. Comput.\ Phys.}, 16742 keywords = {FMM}, 16743 number = {2}, 16744 pages = {325--348}, 16745 title = {A Fast Algorithm for Particle Simulations}, 16746 url = {citeseer.ist.psu.edu/greengard87fast.html}, 16747 volume = {73}, 16748 year = {1987}, 16749 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 16750} 16751 16752@Article{ greengardrokhlin97, 16753 author = {L. Greengard and V. Rokhlin}, 16754 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 16755 Dimensions}, 16756 journal = {Acta Numerica}, 16757 volume = {6}, 16758 year = {1997}, 16759 pages = {229--269} 16760} 16761 16762@Article{ luchenghuangmccammon06, 16763 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 16764 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 16765 systems}, 16766 journal = {PNAS}, 16767 doi = {10.1073/pnas.0605166103}, 16768 volume = {102}, 16769 number = {51}, 16770 year = {2006}, 16771 pages = {19314--19319} 16772} 16773 16774@Article{ schussnadlereisenberg01, 16775 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 16776 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 16777 from a molecular model}, 16778 journal = {Physical Review E}, 16779 volume = {64}, 16780 number = {3}, 16781 year = {2001} 16782} 16783 16784@Book{ hairerlubichwanner02, 16785 author = {E. Hairer and Ch. Lubich and G. Wanner}, 16786 title = {Geometric Numerical Integration}, 16787 publisher = {Springer-Verlag}, 16788 address = {Berlin Heidelberg}, 16789 year = {2002} 16790} 16791 16792@Article{ holstbakerwang00, 16793 author = {M. Holst and N. Baker and F. Wang}, 16794 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 16795 equation on massively parallel computers}, 16796 journal = {Journal of Computational Chemistry}, 16797 volume = {21}, 16798 year = {2000} 16799} 16800 16801@Book{ hockneyeastwood81, 16802 author = {R. Hockney and J. Eastwood}, 16803 title = {Computer simulation using particles}, 16804 publisher = {McGraw-Hill}, 16805 address = {New York}, 16806 year = {1981} 16807} 16808 16809@Article{ lutydavistironigunsteren94, 16810 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 16811 Gunsteren}, 16812 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 16813 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 16814 journal = {Molecular Simulation}, 16815 volume = {14}, 16816 number = {1}, 16817 year = {1994}, 16818 pages = {11--20} 16819} 16820 16821@Book{ briggshensonmccormick00, 16822 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 16823 title = {A Multigrid Tutorial (2nd ed.)}, 16824 year = {2000}, 16825 isbn = {0-89871-462-1}, 16826 publisher = {Society for Industrial and Applied Mathematics}, 16827 address = {Philadelphia, PA} 16828} 16829 16830@Article{ chartier2003spectral, 16831 title = {Spectral AMGe ($\rho$ AMGe)}, 16832 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 16833 McCormick, S and Ruge, J and Vassilevski, PS}, 16834 journal = {SIAM Journal on Scientific Computing}, 16835 volume = {25}, 16836 number = {1}, 16837 pages = {1--26}, 16838 year = {2003}, 16839 publisher = {SIAM} 16840} 16841 16842@Article{ galvis2010domain, 16843 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 16844 media}, 16845 author = {Galvis, Juan and Efendiev, Yalchin}, 16846 journal = {Multiscale Modeling \& Simulation}, 16847 volume = {8}, 16848 number = {4}, 16849 pages = {1461--1483}, 16850 year = {2010}, 16851 publisher = {SIAM} 16852} 16853 16854@Book{ brennerscott02, 16855 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 16856 title = {The mathematical theory of finite element methods}, 16857 year = {2002}, 16858 isbn = {0-38795-451-1}, 16859 publisher = {Springer}, 16860 pages = {361} 16861} 16862 16863@Book{ trefethenbau97, 16864 author = {Lloyd N. Trefethen and David {Bau, III}}, 16865 title = {Numerical Linear Algebra}, 16866 publisher = {Society for Industrial and Applied Mathematics}, 16867 address = {Philadelphia, PA}, 16868 pages = {xii + 361}, 16869 year = {1997}, 16870 isbn = {0-89871-361-7}, 16871 isbn-13 = {978-0-89871-361-9}, 16872 lccn = {QA184 .T74 1997}, 16873 mrclass = {65-01 (65-02 65Fxx)}, 16874 mrnumber = {MR1444820 (98k:65002)}, 16875 mrreviewer = {Moody T. Chu}, 16876 bibdate = {Wed Jan 07 15:23:19 1998}, 16877 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 16878} 16879 16880@Article{ liptonreagan2014, 16881 title = {Quantum Algorithms via Linear Algebra: A Primer}, 16882 author = {Richard J Lipton and Kenneth W Regan}, 16883 pages = {206}, 16884 isbn = {978-0-26202-839-4}, 16885 year = {2014} 16886} 16887 16888@InProceedings{ rhea08, 16889 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 16890 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 16891 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16892 booktitle = {Proceedings of IEEE/ACM SC '08}, 16893 year = {2008} 16894} 16895 16896@Misc{ bursteddewilcox09, 16897 author = {Carsten Burstedde and Lucas~C. Wilcox}, 16898 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 16899 note = {in preparation} 16900} 16901 16902@Article{ skeeltezcanhardy02, 16903 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 16904 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 16905 journal = {J. Comp. Chem.}, 16906 volume = {23}, 16907 pages = {673--684}, 16908 year = {2002} 16909} 16910 16911@Article{ verschelde99, 16912 author = {Jan Verschelde}, 16913 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 16914 homotopy continuation}, 16915 journal = {ACM Trans. Math. Softw.}, 16916 volume = {25}, 16917 number = {2}, 16918 issn = {0098-3500}, 16919 pages = {251--276}, 16920 doi = {10.1145/317275.317286}, 16921 publisher = {ACM}, 16922 address = {New York, NY}, 16923 year = {1999} 16924} 16925 16926@InProceedings{ sommeseverscheldewampler08, 16927 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 16928 title = {Solving Polynomial Systems Equation by Equation}, 16929 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 16930 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 16931 pages = {133--152}, 16932 publisher = {Springer-Verlag}, 16933 year = {2008} 16934} 16935 16936@Article{ phanthientanner77, 16937 author = {N. Phan-Thien and R.~I. Tanner}, 16938 title = {A new constitutive equation derived from network theory}, 16939 journal = {J. Non-Newt. Fluid Mech.}, 16940 volume = {2}, 16941 pages = {353}, 16942 year = {1977} 16943} 16944 16945@Manual{ sage, 16946 key = {SAGE}, 16947 author = {W.\thinspace{}A. Stein and others}, 16948 organization = {The Sage~Development Team}, 16949 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 16950 note = {{\tt http://www.sagemath.org}}, 16951 year = {2009} 16952} 16953 16954@Misc{ bateshauensteinsommesewampler06, 16955 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 16956 Wampler}, 16957 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 16958 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 16959} 16960 16961@Article{ archer09, 16962 author = {A. J. Archer}, 16963 collaboration = {}, 16964 title = {Dynamical density functional theory for molecular and colloidal fluids: A 16965 microscopic approach to fluid mechanics}, 16966 publisher = {AIP}, 16967 year = {2009}, 16968 journal = {The Journal of Chemical Physics}, 16969 volume = {130}, 16970 number = {1}, 16971 eid = {014509}, 16972 numpages = {8}, 16973 pages = {014509}, 16974 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 16975 transition; statistical distributions; stochastic processes}, 16976 doi = {10.1063/1.3054633} 16977} 16978 16979@Article{ giesekus1966, 16980 author = {Hanswalter Giesekus}, 16981 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 16982 journal = {Rheologica Acta}, 16983 publisher = {Springer Berlin / Heidelberg}, 16984 volume = {5}, 16985 number = {1}, 16986 month = mar, 16987 year = {1966}, 16988 doi = {10.1007/BF01973575}, 16989 pages = {29-35} 16990} 16991 16992@Article{ baaijens98, 16993 author = {F.P. Baaijens}, 16994 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 16995 journal = {Journal of Non-Newtonian Fluid Mechanics}, 16996 volume = {79}, 16997 year = {1998}, 16998 pages = {361--385} 16999} 17000 17001@Book{ joseph90, 17002 author = {D.~D. Joseph}, 17003 title = {Fluid Dynamics of Viscoelastic Liquids}, 17004 publisher = {Springer}, 17005 address = {New York, NY}, 17006 year = {1990} 17007} 17008 17009@Article{ oldroyd50, 17010 author = {J.~G. Oldroyd}, 17011 title = {On the Formulation of Rheological Equations of State}, 17012 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 17013 Sciences}, 17014 volume = {200}, 17015 year = {1950}, 17016 pages = {523--541} 17017} 17018 17019@InProceedings{ bynasungroppthakur04, 17020 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 17021 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 17022 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 17023 year = {2004} 17024} 17025 17026@Book{ pozrikidis07, 17027 author = {C. Pozrikidis}, 17028 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 17029 publisher = {Kluwer (Springer)}, 17030 pages = {675}, 17031 year = {2001}, 17032 isbn = {0792373510} 17033} 17034 17035@Misc{ kritzkeyesfsp07, 17036 author = {A. Kritz and D. Keyes}, 17037 title = {{Fusion Simulation Project Workshop Report}}, 17038 month = jul, 17039 year = {2007}, 17040 note = {Available via 17041 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 17042} 17043 17044@Misc{ dahlburg02, 17045 author = {J. {Dahlburg (Chair)}}, 17046 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 17047 year = {2002}, 17048 note = {Available via 17049 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 17050} 17051 17052@Misc{ brown08, 17053 author = {D. {Brown (Chair)}}, 17054 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 17055 to the Future}}, 17056 year = {2008}, 17057 howpublished = {Office of Science, U.S. Department of Energy}, 17058 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 17059} 17060 17061@Misc{ crosscutting10, 17062 author = {D. Brown and P. {Messina (Chairs)}}, 17063 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 17064 Exascale}}, 17065 year = {2010}, 17066 howpublished = {Office of Science, U.S. Department of Energy}, 17067 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 17068} 17069 17070@Misc{ extreme-scale-solvers-workshop12, 17071 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 17072 L.C. McInnes and E. Ng and S. Wild}, 17073 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 17074 Architectures}, 17075 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 17076 note = {{Washington, DC}, March 8-9, 2012}, 17077 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 17078 year = {2012} 17079} 17080 17081@Misc{ monizrosner09, 17082 author = {{E. Moniz and R. Rosner}}, 17083 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 17084 and Simulation at the Extreme Scale}}, 17085 month = may, 17086 year = {2009}, 17087 note = {See 17088 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 17089} 17090 17091@Misc{ blanford08, 17092 author = {{R. Blandord (Chair)}}, 17093 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 17094 Computing at the Extreme Scale}}, 17095 month = dec, 17096 year = {2008}, 17097 note = {See 17098 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 17099} 17100 17101@Misc{ exascale07, 17102 author = {H. Simon and T. Zacharia and R. Stevens}, 17103 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 17104 year = {2007}, 17105 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 17106} 17107 17108@Misc{ ascrbreakthroughs08, 17109 author = {{Panel on Recent Significant Advancements in Computational Science}}, 17110 title = {Breakthroughs}, 17111 year = {2008}, 17112 note = {See 17113 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 17114} 17115 17116@Misc{ petsc-rd100-2009, 17117 author = {{R\&D Magazine}}, 17118 title = {{PETSc} {R}\&{D} 100 Award}, 17119 year = {2009}, 17120 note = {See 17121 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 17122} 17123 17124@Article{ compass-scidac08, 17125 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 17126 R. Ryne}, 17127 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 17128 Computational Science for Future Accelerators and Accelerator Technologies}, 17129 journal = {J. Phys.: Conf. Ser.}, 17130 volume = {125}, 17131 year = {2008}, 17132 pages = {012001}, 17133 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 17134} 17135 17136@Article{ compass-amundson-scidac08, 17137 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 17138 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 17139 Stoltz}, 17140 journal = {J. Phys.: Conf. Ser.}, 17141 volume = {125}, 17142 year = {2008} 17143} 17144 17145@InProceedings{ muszala09, 17146 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 17147 Simulations}, 17148 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 17149 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 17150 {(CBHPC 2009)}}, 17151 year = {2009} 17152} 17153 17154@Article{ gaston09, 17155 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 17156 Equations}, 17157 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 17158 journal = {Nuclear Engineering and Design}, 17159 volume = {239}, 17160 number = {10}, 17161 year = {2009}, 17162 pages = {1768 -- 1778} 17163} 17164 17165@Article{ gaston09b, 17166 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 17167 Engineering}, 17168 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 17169 and C. Permann and W. Taitano}, 17170 journal = {J. Phys.: Conf. Ser.}, 17171 volume = {180}, 17172 year = {2009}, 17173 pages = {012012} 17174} 17175 17176@Article{ newman09, 17177 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 17178 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 17179 author = {Chris Newman and Glen Hansen and Derek Gaston}, 17180 journal = {Journal of Nuclear Materials}, 17181 volume = {392}, 17182 issue = {1}, 17183 year = {2009}, 17184 pages = {6 -- 15} 17185} 17186 17187@Misc{ www:fenics, 17188 author = {{FE}ni{CS}}, 17189 title = {{FE}ni{CS} Project}, 17190 howpublished = {\url{http://www.fenics.org/}}, 17191 year = {2018} 17192} 17193 17194@InProceedings{ zwart08, 17195 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 17196 Systems}, 17197 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 17198 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 17199 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 17200 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 17201 booktitle = {Proceedings of ICCS 2008}, 17202 year = {2008} 17203} 17204 17205@Article{ klocknerwarburtonbridgehesthaven09, 17206 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 17207 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 17208 journal = {J. Comput. Phys.}, 17209 volume = {228}, 17210 number = {21}, 17211 year = {2009}, 17212 issn = {0021-9991}, 17213 pages = {7863--7882}, 17214 doi = {10.1016/j.jcp.2009.06.041}, 17215 publisher = {Academic Press Professional}, 17216 address = {San Diego, CA} 17217} 17218 17219@PhDThesis{ rankin99, 17220 author = {Rankin, W. T.}, 17221 keywords = {FMM, parallel FMM}, 17222 school = {Department of Electrical and Computer Engineering, Duke University}, 17223 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 17224 year = {1999} 17225} 17226 17227@InProceedings{ warrensalmon93, 17228 abstract = {We report on an efficient adaptive N-body method which we have recently designed 17229 and implemented. The algorithm computes the forces on an arbitrary distribution of 17230 bodies in a time which scales as N log N with the particle number. The accuracy of 17231 the force calculations is analytically bounded, and can be adjusted via a user 17232 defined parameter between a few percent relative accuracy, down to machine 17233 arithmetic accuracy. Instead of using pointers to indicate the topology of the 17234 tree, we identify...}, 17235 address = {New York}, 17236 author = {Warren, Michael S. and Salmon, John K.}, 17237 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 17238 citeulike-article-id={580952}, 17239 keywords = {oct-tree}, 17240 pages = {12--21}, 17241 publisher = {ACM}, 17242 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 17243 year = {1993}, 17244 doi = {10.1145/169627.169640}, 17245 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 17246} 17247 17248@Unpublished{ cruzwccm10, 17249 author = {Felipe A. Cruz}, 17250 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 17251 note = {Presentation at WCCM 2010, Sydney Australia}, 17252 year = {2010} 17253} 17254 17255@Article{ mcguffee06, 17256 author = {S.~R. {McGuffee} and A.~H. Elcock}, 17257 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 17258 of salt, {pH}, point mutations, and protein concentration in simulations of 17259 1000-molecule systems}, 17260 journal = {Journal of the American Chemical Society}, 17261 volume = {128}, 17262 pages = {12098--12110}, 17263 year = {2006} 17264} 17265 17266@Article{ nilsencaihoylandlangtangen10, 17267 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 17268 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 17269 in Python}}, 17270 journal = {ArXiv e-prints}, 17271 archiveprefix = {arXiv}, 17272 eprint = {1002.0705}, 17273 primaryclass = {cs.DC}, 17274 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 17275 - Programming Languages}, 17276 year = {2010}, 17277 month = feb, 17278 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 17279 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 17280} 17281 17282@Misc{ mcinnes:siam09:minisymposium, 17283 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 17284 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 17285 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 17286 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 17287 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 17288 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 17289 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 17290 Austin).} 17291} 17292 17293@Misc{ mcinnes:fsp-summary:feb2011, 17294 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 17295 title = {Solvers and Time Integration Breakout Summary}, 17296 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 17297 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 17298} 17299 17300@Misc{ dvi-materials:siamcse11, 17301 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 17302 Materials}, 17303 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 17304 Smith and L. Wang}, 17305 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 17306 and Engineering, March 3, 2011} 17307} 17308 17309@Misc{ jamroz:cemm10, 17310 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 17311 author = {B. Jamroz and S. Kruger and T. Austin}, 17312 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 17313} 17314 17315@Misc{ kruger:feb4-2011, 17316 title = {personal communication}, 17317 author = {S. Kruger}, 17318 note = {February, 2011} 17319} 17320 17321@Article{ elman1996, 17322 author = {H.C. Elman}, 17323 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 17324 viscosity}, 17325 journal = {SIAM J. Sci. Comput.}, 17326 volume = {20}, 17327 year = {1996}, 17328 pages = {1299--1316} 17329} 17330 17331@Article{ kayloghinwathen2002, 17332 author = {D. Kay and D. Loghin and A. Wathen}, 17333 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 17334 journal = {SIAM J. Sci. Comput.}, 17335 volume = {24}, 17336 year = {2002}, 17337 pages = {237--256} 17338} 17339 17340@Article{ elmanhowleshadidshuttleworthtuminaro2006, 17341 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 17342 title = {Block preconditioners based on approximate commutators}, 17343 journal = {SIAM J. Sci. Comput.}, 17344 volume = {27}, 17345 number = {5}, 17346 year = {2006}, 17347 pages = {1651--1668} 17348} 17349 17350@Article{ braesssarazin1997, 17351 author = {Dietrich Braess and Regina Sarazin}, 17352 title = {An efficient smoother for the {Stokes} problem}, 17353 journal = {Applied Numerical Mathematics}, 17354 volume = {23}, 17355 number = {1}, 17356 year = {1997}, 17357 pages = {3--19}, 17358 doi = {10.1016/S0168-9274(96)00059-1} 17359} 17360 17361@Article{ wright2001large, 17362 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 17363 author = {Wright, T.G. and Trefethen, L.N.}, 17364 journal = {SIAM Journal on Scientific Computing}, 17365 volume = {23}, 17366 pages = {591}, 17367 year = {2001} 17368} 17369 17370@Misc{ wright2002eigtool, 17371 title = {Eig{T}ool}, 17372 author = {Wright, T.G. and Trefethen, LN}, 17373 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 17374 year = {2002} 17375} 17376 17377@Misc{ visit-web-site, 17378 key = {{VisIt}}, 17379 title = {{VisIt web site}}, 17380 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 17381 url = {http://wci.llnl.gov/codes/visit/}, 17382 year = {2011} 17383} 17384 17385@Book{ trefethen1996, 17386 title = {Finite difference and spectral methods for ordinary and partial differential 17387 equations}, 17388 author = {Lloyd Nicholas Trefethen}, 17389 year = {1996}, 17390 publisher = {Cornell University-Department of Computer Science and Center for Applied 17391 Mathematics} 17392} 17393 17394@Book{ trefethen2005spectra, 17395 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 17396 author = {Trefethen, L.N. and Embree, M.}, 17397 year = {2005}, 17398 publisher = {Princeton University Press} 17399} 17400 17401@Article{ gomez2010isogeometric, 17402 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 17403 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 17404 journal = {Computer Methods in Applied Mechanics and Engineering}, 17405 volume = {199}, 17406 number = {25-28}, 17407 pages = {1828--1840}, 17408 issn = {0045-7825}, 17409 year = {2010}, 17410 publisher = {Elsevier} 17411} 17412 17413@Article{ gomez2008isogeometric, 17414 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 17415 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 17416 journal = {Computer Methods in Applied Mechanics and Engineering}, 17417 volume = {197}, 17418 number = {49-50}, 17419 pages = {4333--4352}, 17420 year = {2008}, 17421 publisher = {Elsevier} 17422} 17423 17424@Misc{ fastmath:project, 17425 author = {Lori {Diachin (PI)}}, 17426 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 17427 (FASTMath) Institute}}, 17428 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 17429} 17430 17431@Misc{ exascale-software:proposal, 17432 author = {Peter {Beckman (PI)}}, 17433 title = {{Exascale Software Center}}, 17434 note = {proposal to DOE} 17435} 17436 17437@Misc{ imex:project, 17438 author = {Barry {Smith (PI)}}, 17439 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 17440 Multimodel PDEs}}, 17441 note = {DOE ASCR applied math project} 17442} 17443 17444@Misc{ intel-mic:website, 17445 author = {Intel}, 17446 title = {{Many Integrated Core Architecture}}, 17447 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 17448} 17449 17450@Article{ dudson:2009, 17451 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 17452 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 17453 journal = {Computer Physics Communications}, 17454 volume = {180}, 17455 pages = {1467}, 17456 year = {2009} 17457} 17458 17459@Article{ umansky:2009, 17460 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 17461 title = {{Status and verification of edge plasma turbulence code BOUT}}, 17462 journal = {Computer Physics Communications}, 17463 year = {2009}, 17464 volume = {180}, 17465 pages = {887-903} 17466} 17467 17468@Article{ xu:1998, 17469 author = {X.Q. Xu and R.H. Cohen}, 17470 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 17471 journal = {Computer Physics Communications}, 17472 year = {1998}, 17473 volume = {36}, 17474 number = {1-2}, 17475 pages = {158} 17476} 17477 17478@Article{ tron:1999, 17479 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 17480 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 17481 journal = {SIAM Journal on Optimization}, 17482 volume = {9}, 17483 number = {4}, 17484 pages = {1100-1127}, 17485 year = {1999} 17486} 17487 17488@Article{ stubenamg, 17489 author = {K. St\"{u}ben}, 17490 title = {A review of algebraic multigrid}, 17491 journal = {J. Comput. Appl. Math.}, 17492 volume = {128}, 17493 number = {1-2}, 17494 year = {2001}, 17495 issn = {0377-0427}, 17496 pages = {281--309}, 17497 doi = {10.1016/S0377-0427(00)00516-1}, 17498 publisher = {Elsevier Science Publishers B. V.}, 17499 address = {Amsterdam, The Netherlands, The Netherlands} 17500} 17501 17502@Article{ feuchtermg, 17503 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 17504 title = {Bridging the gap between geometric and algebraic multigrid methods}, 17505 journal = {Computing and visualization in science}, 17506 publisher = {Springer}, 17507 volume = {6}, 17508 number = {1}, 17509 year = {2003}, 17510 pages = {1--13} 17511} 17512 17513@Article{ chowmgsmoothness, 17514 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 17515 only attempts to interpolate in the directions of geometrical smoothness. These 17516 directions are determined by analyzing samples of algebraically smooth error, e. 17517 Neighboring grid points i and j are called smoothly coupled if e i and e j are 17518 consistently nearby in value. In addition, these dierences may be used to dene 17519 interpolation weights. These new ideas may be incorporated into the algebraic 17520 multigrid method. Test results show that the new method can have much lower grid 17521 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 17522 author = {Chow, Edmond}, 17523 citeulike-article-id={7675372}, 17524 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17525 journal = {American Journal of Mathematics}, 17526 keywords = {fem, multigrid}, 17527 pages = {197--215}, 17528 posted-at = {2010-08-17 23:29:51}, 17529 priority = {2}, 17530 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 17531 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17532 volume = {65}, 17533 year = {2001} 17534} 17535 17536@Article{ jonesamge, 17537 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 17538 elements) method based on element agglomeration. In the method, coarse grid 17539 elements are formed by agglomerating fine grid elements. Compatible interpolation 17540 operators are constructed which yield coarse grid basis functions with a minimal 17541 energy property. Heuristics based on interpolation quality measures are used to 17542 guide the agglomeration procedure. The performance of the resulting method is 17543 demonstrated in two-level numerical experiments.}}, 17544 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 17545 citeulike-article-id={8598569}, 17546 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17547 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 17548 journal = {SIAM Journal on Scientific Computing}, 17549 keywords = {amg, fem, multigrid}, 17550 number = {1}, 17551 pages = {109--133}, 17552 posted-at = {2011-01-13 18:05:55}, 17553 priority = {2}, 17554 publisher = {SIAM}, 17555 title = {{AMGE Based on Element Agglomeration}}, 17556 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17557 volume = {23}, 17558 year = {2001} 17559} 17560 17561@Article{ saad1993, 17562 author = {Saad, Youcef}, 17563 doi = {10.1137/0914028}, 17564 issn = {10648275}, 17565 journal = {SIAM Journal on Scientific Computing}, 17566 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 17567 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 17568 precondition-,preconditioned conju-,subject classi cations,variable 17569 preconditioners}, 17570 number = {2}, 17571 pages = {461--469}, 17572 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 17573 volume = {14}, 17574 year = {1993} 17575} 17576 17577@Misc{ path:homepage, 17578 author = {S. Dirkse and M. Ferris and T. Munson}, 17579 title = {{{PATH} {W}eb page}}, 17580 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 17581} 17582 17583@Article{ ketcheson2008, 17584 author = {David I Ketcheson}, 17585 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 17586 Low-Storage Implementations}, 17587 volume = {30}, 17588 journal = {SIAM Journal on Scientific Computing}, 17589 year = {2008}, 17590 pages = {2113--2136} 17591} 17592 17593@Article{ elman2009boundary, 17594 title = {{Boundary conditions in approximate commutator preconditioners for the 17595 Navier-Stokes equations}}, 17596 author = {Elman, H.C. and Tuminaro, R.}, 17597 journal = {Electronic Transactions on Numerical Analysis}, 17598 volume = {35}, 17599 pages = {257--280}, 17600 year = {2009} 17601} 17602 17603@Article{ elman2008tcp, 17604 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 17605 incompressible Navier-Stokes equations}}, 17606 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 17607 R.}, 17608 journal = {Journal of Computational Physics}, 17609 volume = {227}, 17610 number = {1}, 17611 pages = {1790--1808}, 17612 year = {2008}, 17613 publisher = {Academic Press}, 17614 url = {http://chess.cs.umd.edu/~elman/papers/tax.pdf} 17615} 17616 17617@Article{ arioli2013, 17618 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 17619 author = {Arioli, Mario}, 17620 journal = {SIAM Journal on Matrix Analysis and Applications}, 17621 volume = {34}, 17622 number = {2}, 17623 pages = {571--592}, 17624 year = {2013}, 17625 publisher = {SIAM} 17626} 17627 17628@Book{ wesseling2009, 17629 title = {Principles of computational fluid dynamics}, 17630 author = {Wesseling, Pieter}, 17631 volume = {29}, 17632 year = {2009}, 17633 publisher = {Springer Science \& Business Media} 17634} 17635 17636@Article{ silvester2001efficient, 17637 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 17638 incompressible flow}}, 17639 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 17640 journal = {Journal of Computational and Applied Mathematics}, 17641 volume = {128}, 17642 number = {1-2}, 17643 pages = {261--279}, 17644 issn = {0377-0427}, 17645 year = {2001}, 17646 publisher = {Elsevier} 17647} 17648 17649@Article{ elman1999bfbt, 17650 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 17651 viscosity}}, 17652 author = {Elman, H.C.}, 17653 journal = {SIAM Journal on Scientific Computing}, 17654 volume = {20}, 17655 number = {4}, 17656 pages = {1299--1316}, 17657 issn = {1064-8275}, 17658 year = {1999}, 17659 publisher = {Citeseer} 17660} 17661 17662@Article{ elman2006bpb, 17663 title = {{Block preconditioners based on approximate commutators}}, 17664 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 17665 journal = {SIAM Journal on Scientific Computing}, 17666 volume = {27}, 17667 number = {5}, 17668 pages = {1651--1668}, 17669 year = {2006}, 17670 publisher = {Philadelphia, PA: SIAM, c1993-} 17671} 17672 17673@Article{ olshanskii2006analysis, 17674 title = {{Analysis of a Stokes interface problem}}, 17675 author = {Olshanskii, M.A. and Reusken, A.}, 17676 journal = {Numerische Mathematik}, 17677 volume = {103}, 17678 number = {1}, 17679 pages = {129--149}, 17680 issn = {0029-599X}, 17681 year = {2006}, 17682 publisher = {Springer} 17683} 17684 17685@Article{ patankar1972cph, 17686 title = {{A calculation procedure for heat, mass and momentum transfer in 17687 three-dimensional parabolic flows}}, 17688 author = {Patankar, S.V. and Spalding, D.B.}, 17689 journal = {Int. J. Heat Mass Transfer}, 17690 volume = {15}, 17691 pages = {1787--1806}, 17692 year = {1972} 17693} 17694 17695@Article{ rannacher1992simple, 17696 title = {{Simple nonconforming quadrilateral Stokes element}}, 17697 author = {Rannacher, R. and Turek, S.}, 17698 journal = {Numerical Methods for Partial Differential Equations}, 17699 volume = {8}, 17700 number = {2}, 17701 pages = {97--111}, 17702 issn = {1098-2426}, 17703 year = {1992}, 17704 publisher = {Wiley Online Library} 17705} 17706 17707@Article{ rannacher2000finite, 17708 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 17709 author = {Rannacher, R.}, 17710 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 17711 pages = {191}, 17712 isbn = {3764364149}, 17713 year = {2000}, 17714 publisher = {Birkhauser} 17715} 17716 17717@Article{ vanka1986block, 17718 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 17719 variables}}, 17720 author = {Vanka, S.P.}, 17721 journal = {Journal of Computational Physics}, 17722 volume = {65}, 17723 number = {1}, 17724 pages = {138--158}, 17725 issn = {0021-9991}, 17726 year = {1986}, 17727 publisher = {Elsevier} 17728} 17729 17730@Article{ eisenstat1983variational, 17731 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 17732 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 17733 journal = {SIAM Journal on Numerical Analysis}, 17734 volume = {20}, 17735 number = {2}, 17736 pages = {345--357}, 17737 year = {1983}, 17738 publisher = {JSTOR} 17739} 17740 17741@InProceedings{ burstedde2008scalable, 17742 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 17743 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 17744 T. and Wilcox, L.C. and Zhong, S.}, 17745 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 17746 pages = {62}, 17747 year = {2008}, 17748 organization = {IEEE Press} 17749} 17750 17751@Article{ burstedde2009parallel, 17752 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 17753 flow problems}, 17754 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 17755 journal = {Computer Methods in Applied Mechanics and Engineering}, 17756 volume = {198}, 17757 number = {21-26}, 17758 pages = {1691--1700}, 17759 year = {2009}, 17760 publisher = {Elsevier} 17761} 17762 17763@Article{ stadler2010dynamics, 17764 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 17765 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 17766 Ghattas, O.}, 17767 journal = {Science}, 17768 volume = {329}, 17769 number = {5995}, 17770 pages = {1033}, 17771 year = {2010}, 17772 publisher = {American Association for the Advancement of Science} 17773} 17774 17775@Article{ tackley2008modelling, 17776 title = {Modelling compressible mantle convection with large viscosity contrasts in a 17777 three-dimensional spherical shell using the yin-yang grid}, 17778 author = {Tackley, P.J.}, 17779 journal = {Physics of the Earth and Planetary Interiors}, 17780 volume = {171}, 17781 number = {1-4}, 17782 pages = {7--18}, 17783 year = {2008}, 17784 publisher = {Elsevier} 17785} 17786 17787@Article{ moresizhonggurnis96, 17788 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 17789 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 17790 viscosity}, 17791 journal = {Physics of the Earth and Planetary Interiors}, 17792 volume = {97}, 17793 pages = {83-–94}, 17794 year = {1996} 17795} 17796 17797@Article{ moresisolomatov95, 17798 author = {Louis N. Moresi and V. S. Solomatov}, 17799 title = {Numerical investigation of {2D} convection with extremely large viscosity 17800 variations}, 17801 journal = {Physics of Fluids}, 17802 volume = {7}, 17803 number = {9}, 17804 pages = {2154-–2162}, 17805 year = {1995} 17806} 17807 17808@Article{ chenmolnar83, 17809 author = {W.-P. Chen and P. Molnar}, 17810 title = {Focal depths of intra-continental and intraplate earthquakes and their 17811 implications for the thermal and mechanical properties of the lithosphere}, 17812 journal = {Journal of Geophysical Research}, 17813 volume = {88}, 17814 pages = {4183–-4214}, 17815 year = {1983} 17816} 17817 17818@Article{ jackson02, 17819 author = {J. Jackson}, 17820 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 17821 journal = {GSA Today}, 17822 volume = {12}, 17823 pages = {4–-10}, 17824 year = {2002} 17825} 17826 17827@Article{ burovwatts06, 17828 author = {E.B. Burov and A.B. Watts}, 17829 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 17830 brulee?}, 17831 journal = {GSA Today}, 17832 volume = {16}, 17833 pages = {4–-10}, 17834 year = {2006} 17835} 17836 17837@InProceedings{ yang:brent:2002, 17838 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 17839 Parallel Distributed Memory Architectures}, 17840 author = {Laurence T. Yang and Richard Brent}, 17841 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 17842 for Parallel Processing}, 17843 year = {2002}, 17844 publisher = {IEEE} 17845} 17846 17847@Article{ demmel2008communication, 17848 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 17849 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 17850 journal = {Arxiv preprint arXiv:0808.2664}, 17851 year = {2008} 17852} 17853 17854@Article{ demmel09, 17855 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 17856 title = {Communication-optimal Iterative Methods}, 17857 journal = {Journal of Physics: Conf. Series}, 17858 volume = {180}, 17859 year = {2009} 17860} 17861 17862@TechReport{ parms04, 17863 author = {Yousef Saad and Masha Sosonkina}, 17864 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 17865 linear systems user's guide}, 17866 number = {UMSI2004-8}, 17867 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 17868 year = {2004} 17869} 17870 17871@Article{ picard1890, 17872 author = {Emile Picard}, 17873 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 17874 m\'ethode des approximations successives}, 17875 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 17876 volume = {4}, 17877 number = {6}, 17878 pages = {145--210}, 17879 year = {1890}, 17880 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 17881} 17882 17883@Book{ rall1969, 17884 author = {Louis B. Rall}, 17885 title = {Computational solution of nonlinear operator equations}, 17886 publisher = {Krieger Pub Co.}, 17887 pages = {225}, 17888 year = {1969} 17889} 17890 17891@Article{ fletcherreeves1964, 17892 author = {R. Fletcher and C. M. Reeves}, 17893 title = {Function Minimization by Conjugate Gradients}, 17894 journal = {Computer Journal}, 17895 volume = {7}, 17896 pages = {149–-154}, 17897 year = {1964} 17898} 17899 17900@InBook{ mcinnesallanetal06, 17901 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 17902 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 17903 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 17904 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 17905 editor = {A.~M.~Bruaset and A.~Tveito}, 17906 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 17907 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 17908 publisher = {Springer}, 17909 year = {2006}, 17910 number = {51}, 17911 series = {Lecture Notes in Computational Science and Engineering}, 17912 pages = {327--381}, 17913 doi = {10.1016/S0167-8191(02)00191-6} 17914} 17915 17916@Article{ cyrshadidtuminaro12, 17917 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 17918 equations}, 17919 journal = {Journal of Computational Physics}, 17920 volume = {231}, 17921 number = {2}, 17922 pages = {345 - 363}, 17923 year = {2012}, 17924 issn = {0021-9991}, 17925 doi = {10.1016/j.jcp.2011.09.001}, 17926 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 17927} 17928 17929@Article{ keyesmcinneswoodwardetal13, 17930 title = {Multiphysics Simulations: Challenges and Opportunities}, 17931 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 17932 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 17933 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 17934 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 17935 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 17936 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 17937 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 17938 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 17939 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 17940 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 17941 journal = {International Journal of High Performance Computing Applications}, 17942 month = feb, 17943 year = {2013}, 17944 volume = {27}, 17945 number = {1}, 17946 pages = {4--83}, 17947 doi = {10.1177/1094342012468181}, 17948 note = {Special issue}, 17949 abstract = {We consider multiphysics applications from algorithmic and architectural 17950 perspectives, where ``algorithmic'' includes both mathematical analysis and 17951 computational complexity and ``architectural'' includes both software and hardware 17952 environments. Many diverse multiphysics applications can be reduced, en route to 17953 their computational simulation, to a common algebraic coupling paradigm. 17954 Mathematical analysis of multiphysics coupling in this form is not always 17955 practical for realistic applications, but model problems representative of 17956 applications discussed herein can provide insight. A variety of software 17957 frameworks for multiphysics applications have been constructed and refined within 17958 disciplinary communities and executed on leading-edge computer systems. We examine 17959 several of these, expose some commonalities among them, and attempt to extrapolate 17960 best practices to future systems. From our study, we summarize challenges and 17961 forecast opportunities.} 17962} 17963 17964@Misc{ rosner10, 17965 author = {Robert {Rosner (Chair)}}, 17966 title = {{The Opportunities and Challenges of Exascale Computing}}, 17967 year = {2010}, 17968 howpublished = {Office of Science, U.S. Department of Energy}, 17969 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 17970} 17971 17972@Misc{ kogge2008exascale, 17973 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 17974 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 17975 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 17976 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 17977 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 17978 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 17979 howpublished = {DARPA}, 17980 year = {2008}, 17981 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 17982} 17983 17984@Misc{ doegrandchallengeworkshops, 17985 key = {Office of Science, U.S. Department of Energy}, 17986 title = {{Scientific Grand Challenges Workshop Series}}, 17987 howpublished = {Office of Science, U.S. Department of Energy, see 17988 \url{http://extremecomputing.labworks.org/workshops.stm}} 17989} 17990 17991@Misc{ lawrence2011, 17992 key = {Lawrence}, 17993 title = {{Ernest Orlando Lawrence Award Winners}}, 17994 howpublished = {U.S. Department of Energy, {\footnotesize 17995 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 17996 year = {2011} 17997} 17998 17999@Article{ murphy2000npi, 18000 title = {{A note on preconditioning for indefinite linear systems}}, 18001 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 18002 journal = {SIAM Journal on Scientific Computing}, 18003 volume = {21}, 18004 number = {6}, 18005 pages = {1969--1972}, 18006 year = {2000}, 18007 publisher = {Philadelphia, PA: SIAM, c1993-} 18008} 18009 18010@Article{ elman2011bouyancy, 18011 title = {Fast iterative solvers for buoyancy driven flow problems}, 18012 journal = {Journal of Computational Physics}, 18013 volume = {230}, 18014 number = {10}, 18015 pages = {3900 - 3914}, 18016 year = {2011}, 18017 note = {}, 18018 issn = {0021-9991}, 18019 doi = {10.1016/j.jcp.2011.02.014}, 18020 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 18021 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 18022 Adaptivity, Preconditioning, Algebraic multigrid} 18023} 18024 18025@Article{ dongarrabeckman11, 18026 author = {J. Dongarra and P. Beckman and et al.}, 18027 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 18028 journal = {Int. J. High Perf. Comput. Applics.}, 18029 volume = {25}, 18030 year = {2011}, 18031 pages = {3--60} 18032} 18033 18034@Article{ mandel1999energy, 18035 title = {Energy optimization of algebraic multigrid bases}, 18036 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 18037 journal = {Computing}, 18038 volume = {62}, 18039 number = {3}, 18040 pages = {205--228}, 18041 year = {1999}, 18042 publisher = {Springer} 18043} 18044 18045@Article{ vanek1996algebraic, 18046 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 18047 problems}, 18048 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 18049 journal = {Computing}, 18050 volume = {56}, 18051 number = {3}, 18052 pages = {179--196}, 18053 year = {1996}, 18054 publisher = {Springer} 18055} 18056 18057@Article{ vanek2001convergence, 18058 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 18059 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 18060 journal = {Numerische Mathematik}, 18061 volume = {88}, 18062 number = {3}, 18063 pages = {559--579}, 18064 year = {2001}, 18065 publisher = {Springer} 18066} 18067 18068@Article{ brannick2007algebraic, 18069 title = {Algebraic multigrid methods based on compatible relaxation and energy 18070 minimization}, 18071 author = {Brannick, J. and Zikatanov, L.}, 18072 journal = {Domain decomposition methods in science and engineering XVI}, 18073 pages = {15--26}, 18074 year = {2007}, 18075 publisher = {Springer} 18076} 18077 18078@Article{ brannickfalgout2010, 18079 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 18080 author = {James J. Brannick and Robert D. Falgout}, 18081 journal = {SIAM Journal on Scientific Computing}, 18082 volume = {32}, 18083 number = {3}, 18084 pages = {1393--1416}, 18085 url = {http://epubs.siam.org/doi/10.1137/090772216}, 18086 doi = {10.1137/090772216}, 18087 issn = {1064-8275}, 18088 year = {2010} 18089} 18090 18091@Article{ xu2004energy, 18092 title = {On an energy minimizing basis for algebraic multigrid methods}, 18093 author = {Xu, J. and Zikatanov, L.}, 18094 journal = {Computing and Visualization in Science}, 18095 volume = {7}, 18096 number = {3}, 18097 pages = {121--127}, 18098 year = {2004}, 18099 publisher = {Springer} 18100} 18101 18102@Article{ dblp:journals/toms/bakerhlt09, 18103 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 18104 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 18105 journal = {ACM Trans. Math. Softw.}, 18106 volume = {36}, 18107 number = {3}, 18108 year = {2009}, 18109 doi = {10.1145/1527286.1527287}, 18110 bibsource = {DBLP, http://dblp.uni-trier.de} 18111} 18112 18113@Article{ dblp:journals/siamsc/yanggbllhn05, 18114 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 18115 Parry Husbands and Esmond G. Ng}, 18116 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 18117 journal = {SIAM J. Scientific Computing}, 18118 volume = {27}, 18119 number = {3}, 18120 year = {2005}, 18121 pages = {873-892}, 18122 doi = {10.1137/040613767}, 18123 bibsource = {DBLP, http://dblp.uni-trier.de} 18124} 18125 18126@TechReport{ ml-guide, 18127 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 18128 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 18129 institution = {Sandia National Laboratories}, 18130 year = {2006}, 18131 number = {SAND2006-2649} 18132} 18133 18134@Article{ brannick06, 18135 title = {An energy-based AMG coarsening strategy}, 18136 volume = {13}, 18137 doi = {10.1002/nla.480}, 18138 number = {2-3}, 18139 journal = {Numerical Linear Algebra with Applications}, 18140 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 18141 and Ruge, J}, 18142 year = {2006}, 18143 pages = {133--148} 18144} 18145 18146@Article{ olson10, 18147 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 18148 title = {A new perspective on strength measures in algebraic multigrid}, 18149 journal = {Numerical Linear Algebra with Applications}, 18150 volume = {17}, 18151 number = {4}, 18152 pages = {713--733}, 18153 year = {2010}, 18154 publisher = {John Wiley \& Sons, Ltd.}, 18155 issn = {1099-1506}, 18156 doi = {10.1002/nla.669} 18157} 18158 18159@Article{ olson11, 18160 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 18161 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 18162 Minimization}, 18163 journal = {SIAM J. Sci. Comput.}, 18164 issue_date = {April 2011}, 18165 volume = {33}, 18166 issue = {2}, 18167 month = apr, 18168 year = {2011}, 18169 issn = {1064-8275}, 18170 pages = {966--991}, 18171 numpages = {26}, 18172 doi = {10.1137/100803031}, 18173 acmid = {2078825}, 18174 publisher = {Society for Industrial and Applied Mathematics}, 18175 address = {Philadelphia, PA}, 18176 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 18177 aggregation} 18178} 18179 18180@Article{ dorit2011, 18181 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 18182 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 18183 journal = {Multiscale Modeling {\&} Simulation}, 18184 volume = {9}, 18185 number = {1}, 18186 year = {2011}, 18187 pages = {407-423}, 18188 doi = {10.1137/100791142} 18189} 18190 18191@Article{ chen2011algebraic, 18192 title = {Algebraic distance on graphs}, 18193 author = {Chen, Jie and Safro, Ilya}, 18194 journal = {SIAM Journal on Scientific Computing}, 18195 volume = {33}, 18196 number = {6}, 18197 pages = {3468--3490}, 18198 year = {2011}, 18199 publisher = {SIAM} 18200} 18201 18202@InProceedings{ adams04, 18203 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 18204 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 18205 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 18206 half a billion degrees of freedom}, 18207 note = {Gordon Bell Award}, 18208 year = {2004} 18209} 18210 18211@Article{ adams03a, 18212 author = {Adams, M.~F.}, 18213 journal = {Numerical Linear Algebra with Applications}, 18214 number = {2-3}, 18215 pages = {141-153}, 18216 title = {Algebraic multigrid methods for constrained linear systems with applications to 18217 contact problems in solid mechanics}, 18218 volume = {11}, 18219 year = {2004} 18220} 18221 18222@Article{ adams-10a, 18223 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 18224 doi = {10.1016/j.jcp.2010.04.024}, 18225 issn = {0021-9991}, 18226 journal = {Journal of Computational Physics}, 18227 keywords = {Implicit magnetohydrodynamics}, 18228 number = {18}, 18229 pages = {6208 - 6219}, 18230 title = {Toward textbook multigrid efficiency for fully implicit resistive 18231 magnetohydrodynamics}, 18232 volume = {229}, 18233 year = {2010} 18234} 18235 18236@InProceedings{ adams98, 18237 address = {Copper Mountain, CO}, 18238 author = {Adams, M.~F.}, 18239 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 18240 title = {A Parallel Maximal Independent Set Algorithm}, 18241 year = {1998} 18242} 18243 18244@InProceedings{ madaypatera89, 18245 author = {Y. Maday and A. T. Patera}, 18246 title = {Spectral element methods for the {Navier-Stokes} equations}, 18247 editor = {A. K. Noor and J. T. Oden}, 18248 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 18249 pages = {71-–143}, 18250 publisher = {ASME}, 18251 address = {New York, NY}, 18252 year = {1989} 18253} 18254 18255@Article{ mishra2012mlmcfvm, 18256 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 18257 conservation laws in multi-dimensions}, 18258 journal = {Journal of Computational Physics}, 18259 volume = {231}, 18260 number = {8}, 18261 pages = {3365--3388}, 18262 year = {2012}, 18263 issn = {0021-9991}, 18264 doi = {10.1016/j.jcp.2012.01.011}, 18265 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 18266 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 18267 Carlo, Parallelization} 18268} 18269 18270@Article{ barth2011mlmcfe, 18271 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 18272 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 18273 Switzerland}, 18274 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 18275 stochastic coefficients}, 18276 journal = {Numerische Mathematik}, 18277 publisher = {Springer Berlin / Heidelberg}, 18278 issn = {0029-599X}, 18279 keyword = {Mathematics and Statistics}, 18280 pages = {123-161}, 18281 volume = {119}, 18282 issue = {1}, 18283 doi = {10.1007/s00211-011-0377-0}, 18284 year = {2011} 18285} 18286 18287@Article{ nguyen2011hybridizable, 18288 title = {Hybridizable discontinuous {G}alerkin methods}, 18289 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 18290 journal = {Spectral and High Order Methods for Partial Differential Equations}, 18291 pages = {63--84}, 18292 year = {2011}, 18293 publisher = {Springer} 18294} 18295 18296@Misc{ snyder-scidac3:proposal, 18297 author = {Philip {Snyder (PI)}}, 18298 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 18299 note = {proposal to DOE SciDAC3}, 18300 month = oct, 18301 year = {2011} 18302} 18303 18304@Misc{ wirth-scidac3:proposal, 18305 author = {Brian {Wirth (PI)}}, 18306 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 18307 through Leadership Class Computing}}, 18308 note = {proposal to DOE SciDAC3}, 18309 month = oct, 18310 year = {2011} 18311} 18312 18313@Misc{ cary-scidac3:proposal, 18314 author = {John {Cary (PI)}}, 18315 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 18316 Stability (IMMPACTS)}}, 18317 note = {proposal to DOE SciDAC3}, 18318 month = oct, 18319 year = {2011} 18320} 18321 18322@Misc{ vashista-scidac3:proposal, 18323 author = {Priya {Vashista (PI)}}, 18324 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 18325 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 18326 Multi-Petaflops Simulations}}, 18327 note = {proposal to DOE SciDAC3}, 18328 month = mar, 18329 year = {2012} 18330} 18331 18332@Article{ elemental2012, 18333 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 18334 Robert {v}an~{d}e~{G}eijn}, 18335 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 18336 journal = {{ACM} Transactions on Mathematical Software}, 18337 volume = {39}, 18338 number = {2}, 18339 year = {2013} 18340} 18341 18342@Misc{ elemental-web-page, 18343 author = {Jack Poulson}, 18344 title = {Elemental: Distributed memory dense linear algebra}, 18345 howpublished = {\url{http://libelemental.org}}, 18346 url = {http://libelemental.org/}, 18347 year = {2015} 18348} 18349 18350@Book{ scalesreport, 18351 title = {A Science-based Case for Large-scale Simulation}, 18352 editor = {D. E. Keyes}, 18353 publisher = {U.S. Department of Energy}, 18354 year = {2004}, 18355 url = {http://www.pnl.gov/scales} 18356} 18357 18358@InProceedings{ cilk95, 18359 address = {Santa Barbara, California}, 18360 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 18361 Leiserson and Keith H. Randall and Yuli Zhou}, 18362 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 18363 Parallel Programming (PPoPP)}, 18364 day = {19--21}, 18365 month = jul, 18366 pages = {207--216}, 18367 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 18368 year = {1995} 18369} 18370 18371@Misc{ valgrind-web-page, 18372 author = {Julian Seward}, 18373 title = {Valgrind}, 18374 url = {http://valgrind.org/}, 18375 howpublished = {\url{http://valgrind.org/}}, 18376 year = {2012} 18377} 18378 18379@Article{ blas79, 18380 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 18381 title = {Basic linear algebra subprograms for Fortran usage}, 18382 journal = {ACM Transactions on Mathematical Software}, 18383 volume = {5}, 18384 pages = {308--323}, 18385 year = {1979} 18386} 18387 18388@TechReport{ lapack90, 18389 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 18390 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 18391 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 18392 institution = {Computer Science Dept., University of Tennessee}, 18393 number = {CS-90-105}, 18394 month = may, 18395 year = {1990} 18396} 18397 18398@TechReport{ nvidiafermi, 18399 author = {NVIDIA}, 18400 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 18401 institution = {NVIDIA}, 18402 year = {2009} 18403} 18404 18405@Misc{ intelmic, 18406 author = {Many Core Group, Cambridge University}, 18407 title = {Intel Many Integrated Core Architecture}, 18408 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 18409 month = dec, 18410 year = {2010} 18411} 18412 18413@Article{ abusufahkucklawrie81, 18414 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 18415 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 18416 Transformations}, 18417 journal = {IEEE Trans. Comput.}, 18418 volume = {30}, 18419 number = {5}, 18420 pages = {341--356}, 18421 year = {1981} 18422} 18423 18424@InProceedings{ guobikshandifraguelagarzaranpadua08, 18425 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 18426 and Padua, David}, 18427 title = {Programming with tiles}, 18428 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 18429 parallel programming}, 18430 series = {PPoPP '08}, 18431 year = {2008}, 18432 isbn = {978-1-59593-795-7}, 18433 location = {Salt Lake City, UT}, 18434 pages = {111--122}, 18435 numpages = {12}, 18436 doi = {10.1145/1345206.1345225}, 18437 acmid = {1345225}, 18438 publisher = {ACM}, 18439 address = {New York, NY} 18440} 18441 18442@Article{ strout04, 18443 journal = {International Journal of High Performance Computing Applications}, 18444 year = {2004}, 18445 title = {Sparse Tiling for Stationary Iterative Methods}, 18446 month = feb, 18447 publisher = {Sage Publications}, 18448 pages = {95-114}, 18449 volume = {18}, 18450 number = {1}, 18451 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 18452} 18453 18454@Misc{ openclstandard, 18455 author = {Khronos Group}, 18456 title = {{OpenCL} 1.2 Specification}, 18457 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 18458 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 18459 year = {2011} 18460} 18461 18462@Misc{ stlguide, 18463 author = {SGI}, 18464 title = {Standard Template Library Programmer's Guide}, 18465 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 18466 url = {http://www.sgi.com/tech/stl/}, 18467 year = {2011} 18468} 18469 18470@Book{ stepanov09, 18471 author = {Alexander Stepanov and Paul McJones}, 18472 title = {Elements of Programming}, 18473 publisher = {Addison-Wesley}, 18474 isbn = {978-0-321-63537-2}, 18475 year = {2009} 18476} 18477 18478@Article{ bangerthhartmannkanschat2007, 18479 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18480 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 18481 journal = {ACM Trans. Math. Softw.}, 18482 year = {2007}, 18483 volume = {33}, 18484 number = {4}, 18485 pages = {24/1--24/27} 18486} 18487 18488@Misc{ dealii-web-page, 18489 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18490 title = {{deal.II}}, 18491 howpublished = {\url{http://www.dealii.org/}}, 18492 url = {http://www.dealii.org/}, 18493 year = {2012} 18494} 18495 18496@InBook{ siek2012, 18497 title = {The C++0x ``Concepts'' Effort}, 18498 author = {Jeremy G. Siek}, 18499 editor = {Jeremy Gibbons}, 18500 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 18501 UK, March 22-26, 2010, Revised Lectures}, 18502 pages = {175--216}, 18503 isbn = {978-3-642-32202-0}, 18504 doi = {10.1007/978-3-642-32202-0_4}, 18505 url = {http://arxiv.org/abs/1201.0027}, 18506 note = {\url{http://arxiv.org/abs/1201.0027}}, 18507 publisher = {Springer Berlin Heidelberg}, 18508 year = {2012} 18509} 18510 18511@Misc{ sharpclaw, 18512 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 18513 author = {Ketcheson, D. I. and Parsani, M.}, 18514 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18515 PDEs,sharpclaw,software}, 18516 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18517 PDEs,sharpclaw,software}, 18518 title = {{SharpClaw software}}, 18519 year = {2011} 18520} 18521 18522@Book{ leveque2002, 18523 title = {Finite volume methods for hyperbolic problems}, 18524 author = {Randall J LeVeque}, 18525 volume = {31}, 18526 year = {2002} 18527} 18528 18529@Misc{ clawpack45, 18530 note = {\url{http://www.clawpack.org}}, 18531 author = {LeVeque, R. J. and Berger, M. J.}, 18532 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 18533 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 18534 title = {{Clawpack Software version 4.5}}, 18535 url = {www.clawpack.org}, 18536 year = {2011} 18537} 18538 18539@Article{ nilsen2010, 18540 archiveprefix = {arXiv}, 18541 arxivid = {arXiv:1002.0705v1}, 18542 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 18543 eprint = {arXiv:1002.0705v1}, 18544 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 18545 parallelization of scientific codes by a function-centric approach in 18546 Python.pdf:pdf}, 18547 journal = {Computational Science \& Discovery}, 18548 keywords = {parallel,programming,python,software}, 18549 mendeley-tags = {parallel,programming,python,software}, 18550 pages = {015003}, 18551 publisher = {IOP Publishing}, 18552 title = {{Simplifying the parallelization of scientific codes by a function-centric 18553 approach in Python}}, 18554 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 18555 volume = {3}, 18556 year = {2010} 18557} 18558 18559@Book{ langtangen09, 18560 author = {Hans Petter Langtangen}, 18561 title = {Python Scripting for Computational Science}, 18562 publisher = {Springer}, 18563 series = {Texts in Computational Science and Engineering}, 18564 pages = {784}, 18565 isbn = {3540739157}, 18566 year = {2009} 18567} 18568 18569@Book{ numpyguide, 18570 author = {Travis E. Oliphant}, 18571 title = {Guide to {N}umpy}, 18572 publisher = {Trelgol}, 18573 year = {2008} 18574} 18575 18576@Misc{ pycuda, 18577 author = {Andreas Kl\"ockner}, 18578 title = {{PyCUDA}}, 18579 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 18580 year = {2011} 18581} 18582 18583@Misc{ pyopencl, 18584 author = {Andreas Kl\"ockner}, 18585 title = {{PyOpenCL}}, 18586 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 18587 year = {2011} 18588} 18589 18590@Article{ klockner2012, 18591 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 18592 Paul Ivanov and Ahmed Fasih}, 18593 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 18594 generation}, 18595 journal = {Parallel Computing}, 18596 volume = {38}, 18597 number = {3}, 18598 pages = {157--174}, 18599 year = {2012}, 18600 issn = {0167-8191}, 18601 doi = {10.1016/j.parco.2011.09.001} 18602} 18603 18604%%%%%% Matt Stuff %%%%%% 18605@Article{ morrabozdagknepleyrassvesselinov, 18606 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 18607 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 18608 Velimir Vesselinov}, 18609 journal = {Eos}, 18610 volume = {102}, 18611 doi = {10.1029/2021EO159258}, 18612 month = {Jun}, 18613 year = {2021} 18614} 18615 18616@Misc{ knepley:icerm-workshop:2012, 18617 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 18618 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 18619 Models for Large-scale Simulations}, 18620 note = {Workshop sponsored by the Institute for Computational and Experimental Research 18621 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 18622 \url{http://icerm.brown.edu/tw12-1-exascale}}, 18623 year = {2012} 18624} 18625 18626@TechReport{ kirbyknepleyscott04, 18627 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18628 title = {Optimal Evaluation of Finite Element Matrices}, 18629 type = {Technical Report}, 18630 number = {TR-2004-04}, 18631 institution = {University of Chicago}, 18632 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 18633 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 18634 pages = {14}, 18635 month = may, 18636 year = {2004} 18637} 18638 18639@TechReport{ kirbyknepleyscott10, 18640 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18641 title = {Languages and Compilers for Variational Forms}, 18642 type = {Technical Report}, 18643 number = {TR-2010-09}, 18644 institution = {University of Chicago}, 18645 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 18646 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 18647 month = oct, 18648 year = {2010} 18649} 18650 18651@TechReport{ kirbyknepleyscott10b, 18652 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18653 title = {Evaluation of the Action of Finite Element Operators}, 18654 type = {Technical Report}, 18655 number = {TR-2010-08}, 18656 institution = {University of Chicago}, 18657 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 18658 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 18659 month = oct, 18660 year = {2010} 18661} 18662 18663@TechReport{ bruneknepleyscott11, 18664 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18665 title = {Exponential grids in high-dimensional space}, 18666 type = {Technical Report}, 18667 number = {TR-2011-07}, 18668 institution = {University of Chicago}, 18669 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 18670 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 18671 month = dec, 18672 year = {2011} 18673} 18674 18675@TechReport{ zheng11, 18676 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 18677 Zhang and Yaolin Shi}, 18678 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 18679 strongly variable viscosity based on {Matlab} and {CUDA}}, 18680 type = {Research Report}, 18681 number = {UMSI 2011/33}, 18682 institution = {University of Minnesota Supercomputing Institute}, 18683 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 18684 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 18685 month = mar, 18686 year = {2011} 18687} 18688 18689@InProceedings{ zheng2010, 18690 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 18691 Zhang and Yaolin Shi}, 18692 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 18693 booktitle = {Eos Transactions of the AGU}, 18694 organization = {American Geophysical Union}, 18695 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 18696 year = {2010} 18697} 18698 18699@InCollection{ terrelkirbyknepleyscott12, 18700 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 18701 and Garth N. Wells}, 18702 title = {Finite elements for incompressible fluids}, 18703 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18704 booktitle = {Automated solutions of differential equations by the finite element method}, 18705 series = {Lecture Notes in Computational Science and Engineering}, 18706 volume = {84}, 18707 pages = {163--169}, 18708 publisher = {Springer-Verlag}, 18709 year = {2012} 18710} 18711 18712@InCollection{ mardalhaga12, 18713 author = {Kent-Andre Mardal and Joachim Berdal Haga}, 18714 title = {Block preconditioning of systems of PDEs}, 18715 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18716 booktitle = {Automated solutions of differential equations by the finite element method}, 18717 series = {Lecture Notes in Computational Science and Engineering}, 18718 volume = {84}, 18719 pages = {643--655}, 18720 publisher = {Springer-Verlag}, 18721 year = {2012} 18722} 18723 18724@InCollection{ kirbyknepleyloggscottterrel12, 18725 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 18726 Andy R. Terrel}, 18727 title = {Discrete optimization of finite element matrix evaluation}, 18728 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18729 booktitle = {Automated solutions of differential equations by the finite element method}, 18730 series = {Lecture Notes in Computational Science and Engineering}, 18731 volume = {84}, 18732 pages = {385--397}, 18733 publisher = {Springer-Verlag}, 18734 year = {2012} 18735} 18736 18737@InCollection{ kirby12, 18738 author = {Robert C. Kirby}, 18739 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 18740 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18741 booktitle = {Automated solutions of differential equations by the finite element method}, 18742 series = {Lecture Notes in Computational Science and Engineering}, 18743 volume = {84}, 18744 publisher = {Springer-Verlag}, 18745 year = {2012} 18746} 18747 18748@Article{ brownconveryhotesknepleypetropolous1993, 18749 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 18750 Labros Petropolous}, 18751 title = {Closed strings with low harmonics and kinks}, 18752 journal = {Physical Review D}, 18753 volume = {48}, 18754 number = {6}, 18755 year = {1993} 18756} 18757 18758@Article{ minimax1996, 18759 title = {MiniMax: What has been learned thus far}, 18760 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 18761 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 18762 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 18763 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 18764 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 18765 journal = {Nuovo Cimento}, 18766 volume = {19}, 18767 number = {1}, 18768 pages = {1045--1049}, 18769 year = {1996} 18770} 18771 18772@Article{ minimax1997, 18773 author = {Minimax Collaboration}, 18774 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 18775 Production}, 18776 journal = {Physical Review D}, 18777 volume = {55}, 18778 number = {9}, 18779 year = {1997} 18780} 18781 18782@Article{ minimax2000, 18783 author = {Minimax Collaboration}, 18784 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 18785 journal = {Physical Review D}, 18786 volume = {61}, 18787 number = {3}, 18788 year = {2000} 18789} 18790 18791@Article{ kirbyknepleyloggscott05, 18792 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 18793 title = {Optimizing the evaluation of finite element matrices}, 18794 journal = {SIAM Journal on Scientific Computing}, 18795 volume = {27}, 18796 number = {3}, 18797 pages = {741--758}, 18798 year = {2005} 18799} 18800 18801@Article{ bardhanknepleyanitescu2008, 18802 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 18803 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 18804 of Molecular Solvation}, 18805 journal = {Journal of Chemical Physics}, 18806 volume = {130}, 18807 number = {10}, 18808 pages = {104108}, 18809 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 18810 Research}, 18811 doi = {10.1063/1.3081148}, 18812 year = {2008} 18813} 18814 18815%Poster at Biophysical Society Fall Meeting 18816@Article{ bardhanknepley2017, 18817 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18818 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 18819 Hydration-Shell {Poisson}-{Boltzmann} Model}, 18820 journal = {Biophysical Journal}, 18821 volume = {110}, 18822 number = {3}, 18823 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 18824 doi = {10.1016/j.bpj.2015.11.1766}, 18825 year = {2017} 18826} 18827 18828@Article{ tabrizirahimigoossensknepleybardhan2018, 18829 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 18830 Interface Condition (SLIC) Continuum Dielectric Model}, 18831 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 18832 Matthew G. Knepley and Jaydeep P. Bardhan}, 18833 journal = {International Journal of Quantum Chemistry}, 18834 note = {Accepted}, 18835 year = {2018} 18836} 18837 18838@Article{ knepley2010, 18839 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 18840 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 18841 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 18842 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 18843 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 18844 title = {{Reproducible Research: addressing the need for data and code sharing in 18845 computational science}}, 18846 journal = {Computing in Science and Engineering}, 18847 volume = {12}, 18848 number = {5}, 18849 pages = {8--13}, 18850 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 18851 year = {2010} 18852} 18853 18854@Article{ ketchesonahmadiaknepley2011, 18855 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 18856 Hyperbolic PDE Codes}, 18857 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 18858 journal = {SIAM News}, 18859 volume = {44}, 18860 number = {7}, 18861 month = sep, 18862 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 18863 year = {2011} 18864} 18865 18866@Article{ yokotabardhanknepleybarbahamada2011, 18867 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 18868 Tsuyoshi Hamada}, 18869 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 18870 a billion unknowns}, 18871 journal = {Computer Physics Communications}, 18872 volume = {182}, 18873 number = {6}, 18874 pages = {1272--1283}, 18875 year = {2011}, 18876 issn = {0010-4655}, 18877 doi = {10.1016/j.cpc.2011.02.013}, 18878 url = {http://arxiv.org/abs/1007.4591} 18879} 18880 18881@Article{ bardhanknepley2011, 18882 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18883 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 18884 Results for Spherical Inclusions}, 18885 journal = {Journal of Chemical Physics}, 18886 volume = {135}, 18887 number = {12}, 18888 pages = {124107--124117}, 18889 url = {http://arxiv.org/abs/1109.0651}, 18890 note = {\url{http://arxiv.org/abs/1109.0651}}, 18891 year = {2011} 18892} 18893 18894@Article{ bruneknepleyscott2013, 18895 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18896 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 18897 Graded Meshes}, 18898 journal = {SIAM Journal on Scientific Computing}, 18899 url = {http://arxiv.org/abs/1104.0261}, 18900 note = {\url{http://arxiv.org/abs/1104.0261}}, 18901 volume = {35}, 18902 number = {1}, 18903 pages = {A173--A191}, 18904 year = {2013} 18905} 18906 18907@Article{ bardhanknepley2012a, 18908 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18909 title = {Computational science and re-discovery: open-source implementations of 18910 ellipsoidal harmonics for problems in potential theory}, 18911 journal = {Computational Science \& Discovery}, 18912 volume = {5}, 18913 pages = {014006}, 18914 note = {\url{http://arxiv.org/abs/1204.0267}}, 18915 doi = {10.1088/1749-4699/5/1/014006}, 18916 year = {2012} 18917} 18918 18919@Article{ kreienkampetal2013, 18920 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 18921 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 18922 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 18923 contributions of molecular binding}, 18924 journal = {Molecular Based Mathematical Biology}, 18925 volume = {1}, 18926 pages = {124--150}, 18927 doi = {10.2478/mlbmb-2013-0007}, 18928 issn = {2299-3266}, 18929 month = jun, 18930 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 18931 year = {2013} 18932} 18933 18934@Article{ bardhanknepleybrune2015, 18935 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 18936 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 18937 Boundary-Integral Operators}, 18938 journal = {Molecular Based Mathematical Biology}, 18939 volume = {3}, 18940 number = {1}, 18941 pages = {1--22}, 18942 doi = {10.1515/mlbmb-2015-0001}, 18943 year = {2015} 18944} 18945 18946@Article{ bardhanknepley14, 18947 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18948 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 18949 Conditions}, 18950 journal = {Journal of Chemical Physics}, 18951 volume = {141}, 18952 number = {13}, 18953 pages = {131103}, 18954 doi = {10.1063/1.4897324}, 18955 year = {2014} 18956} 18957 18958@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 18959 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 18960 Electrostatics}, 18961 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 18962 Matthew G. Knepley}, 18963 booktitle = {Proceedings of PIERS}, 18964 pages = {1215--1221}, 18965 month = jul, 18966 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 18967 year = {2015} 18968} 18969 18970@Article{ tabriziknepleybardhan2016, 18971 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 18972 condition at the solute-solvent interface}, 18973 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 18974 journal = {Molecular Physics}, 18975 volume = {114}, 18976 number = {16-17}, 18977 pages = {2558--2567}, 18978 doi = {10.1080/00268976.2016.1198503}, 18979 year = {2016} 18980} 18981 18982% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 18983@Article{ tabrizigoossensrahimiknepleybardhan2017, 18984 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 18985 Mixtures Using a Solvation-Layer Interface Condition}, 18986 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 18987 Matthew G. Knepley and Jaydeep P. Bardhan}, 18988 journal = {Journal of Chemical Physics}, 18989 volume = {146}, 18990 number = {9}, 18991 pages = {094103}, 18992 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 18993 eprint = {https://arxiv.org/abs/1611.02150}, 18994 doi = {10.1063/1.4977037}, 18995 note = {PMCID: PMC5336475}, 18996 year = {2017} 18997} 18998 18999@Article{ tabrizigoossenscooperknepleybardhan2017, 19000 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 19001 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 19002 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 19003 Matthew G. Knepley and Jaydeep P. Bardhan}, 19004 number = {6}, 19005 pages = {2897--2914}, 19006 journal = {Journal of Chemical Theory and Computation}, 19007 year = {2017} 19008} 19009 19010@InProceedings{ mcclanahan2011, 19011 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 19012 K and Vuduc, Richard}, 19013 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 19014 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 19015 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 19016 year = {2011} 19017} 19018 19019@Article{ ghyselsashbymeerbergenvanroose2013, 19020 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 19021 title = {Hiding global communication latency in the {GMRES} algorithm on massively 19022 parallel machines}, 19023 journal = {SIAM Journal on Scientific Computing}, 19024 volume = {35}, 19025 number = {1}, 19026 pages = {C48--C71}, 19027 year = {2013} 19028} 19029 19030@Article{ ghyselsvanroose2014, 19031 author = {P. Ghysels and W. Vanroose}, 19032 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 19033 Algorithm}, 19034 journal = {Parallel Computing}, 19035 volume = {40}, 19036 number = {7}, 19037 pages = {224--238}, 19038 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 19039 doi = {10.1016/j.parco.2013.06.001}, 19040 year = {2014} 19041} 19042 19043@InProceedings{ strzodkagoddeke06, 19044 author = {R. Strzodka and D. G\"oddeke}, 19045 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 19046 from Low Precision Components}, 19047 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 19048 Computing Machines}, 19049 note = {FCCM ’06}, 19050 pages = {259--270}, 19051 year = {2006}, 19052 organization = {IEEE Computer Society} 19053} 19054 19055@InCollection{ jacquesnicolasvollaire12, 19056 author = {T. Jacques and L. Nicolas and C. Vollaire}, 19057 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 19058 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 19059 booktitle = {High-Performance Computing and Networking}, 19060 series = {Lecture Notes in Computer Science}, 19061 volume = {1593}, 19062 pages = {1025--1031}, 19063 publisher = {Springer}, 19064 year = {1999} 19065} 19066 19067@InProceedings{ hoeflerlumsdainerehm07, 19068 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 19069 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 19070 for MPI}}, 19071 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 19072 Networking, Storage and Analysis, SC07}, 19073 location = {Reno, NV}, 19074 publisher = {IEEE Computer Society/ACM}, 19075 source = {http://www.unixer.de/~htor/publications/}, 19076 month = nov, 19077 year = {2007} 19078} 19079 19080@InProceedings{ hoeflersiebretlumsdaine10, 19081 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 19082 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 19083 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 19084 Parallel Programming (PPoPP'10)}, 19085 month = jan, 19086 location = {Bangalore, India}, 19087 publisher = {ACM}, 19088 isbn = {978-1-60558-708-0}, 19089 source = {http://www.unixer.de/~htor/publications/}, 19090 pages = {159--168}, 19091 year = {2010} 19092} 19093 19094@Article{ ruppweinbubjungelgrasser15, 19095 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 19096 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 19097 journal = {ACM Transactions on Mathematical Software (TOMS)}, 19098 volume = {43}, 19099 number = {2}, 19100 pages = {11}, 19101 year = {2016}, 19102 publisher = {ACM} 19103} 19104 19105@Article{ bai_hu_reichel_1994, 19106 title = {A {Newton} basis {GMRES} implementation}, 19107 volume = {14}, 19108 url = {}, 19109 number = {}, 19110 journal = {IMA Journal of Numerical Analysis}, 19111 author = {Z. Bai and D. Hu and L. Reichel}, 19112 year = {1994}, 19113 pages = {563--581} 19114} 19115 19116@Article{ chronopoulos_gear_1989, 19117 title = {{S-step} iterative methods for symmetric linear systems}, 19118 volume = {25}, 19119 url = {}, 19120 number = {}, 19121 journal = {Journal of Computational and Applied Mathematics}, 19122 author = {A. T. Chronopoulos and C. W. Gear}, 19123 year = {1989}, 19124 pages = {153--168} 19125} 19126 19127@Article{ chronopoulos_1996, 19128 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 19129 author = {A. T. Chronopoulos and C. D. Swanson}, 19130 journal = {Parallel Computing}, 19131 volume = {22}, 19132 number = {5}, 19133 year = {1996}, 19134 pages = {623--641} 19135} 19136 19137@Article{ chronopoulos_2010, 19138 author = {A. T. Chronopoulos and A. Kucherov}, 19139 title = {Block {S-step} {Krylov} Iterative Methods}, 19140 journal = {Numerical Linear Algebra with Applications}, 19141 volume = {17}, 19142 number = {1}, 19143 pages = {3--15}, 19144 year = {2010} 19145} 19146 19147@Article{ sturler_vorst_1995, 19148 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 19149 distributed memory computers}, 19150 volume = {18}, 19151 url = {}, 19152 number = {}, 19153 journal = {Applied Numerical Mathematics}, 19154 author = {E. De Sturler and H. A. van der Vorst}, 19155 year = {1995}, 19156 pages = {441--459} 19157} 19158 19159@Article{ joubert_carey_1992, 19160 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 19161 I: Theory}, 19162 volume = {44}, 19163 url = {}, 19164 number = {}, 19165 journal = {International journal of computer mathematics}, 19166 author = {W. D. Joubert and G. F. Carey}, 19167 year = {1992}, 19168 pages = {243--267} 19169} 19170 19171@Article{ elman_saadsaylor_1986, 19172 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 19173 of linear equations}, 19174 volume = {7}, 19175 url = {}, 19176 number = {3}, 19177 journal = {SIAM Journal on Scientific and Statistical Computing}, 19178 author = {Howard Elman and Y. Saad and P. E. Saylor}, 19179 year = {1986}, 19180 pages = {840--855} 19181} 19182 19183@Article{ golub95innerand, 19184 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 19185 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 19186 journal = {SIAM J. Numer. Anal}, 19187 year = {1995}, 19188 volume = {35}, 19189 pages = {300--319} 19190} 19191 19192@Article{ golub_varga_1961, 19193 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 19194 and second-order {Richardson} iterative methods, parts {I} and {II}}, 19195 volume = {3}, 19196 url = {}, 19197 number = {}, 19198 journal = {Numer. Math.}, 19199 author = {Gene Golub and R.S. Varga}, 19200 year = {1961}, 19201 pages = {147--168} 19202} 19203 19204@Article{ el_maliki_guenette_fortin_2011, 19205 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 19206 element problems}, 19207 volume = {18}, 19208 doi = {10.1002/nla.757}, 19209 number = {5}, 19210 journal = {Numerical Linear Algebra with Applications}, 19211 author = {A. {El maliki} and R. Guenette and M. Fortin}, 19212 year = {2011}, 19213 pages = {789-803} 19214} 19215 19216@Article{ adavani2008multigrid, 19217 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 19218 Constraints}, 19219 author = {Adavani, S.S. and Biros, G.}, 19220 journal = {SIAM Journal on Scientific Computing}, 19221 volume = {31}, 19222 number = {1}, 19223 pages = {369--397}, 19224 year = {2008}, 19225 publisher = {Society for Industrial and Applied Mathematics} 19226} 19227 19228@Article{ horton1995space, 19229 title = {A space-time multigrid method for parabolic {PDE}s}, 19230 author = {Horton, G. and Vandewalle, S.}, 19231 journal = {SIAM Journal on Scientific Computing}, 19232 volume = {16}, 19233 number = {4}, 19234 pages = {848--864}, 19235 year = {1995} 19236} 19237 19238@Article{ lewis2005model, 19239 title = {Model problems for the multigrid optimization of systems governed by differential 19240 equations}, 19241 author = {Lewis, R.M. and Nash, S.G.}, 19242 journal = {SIAM Journal on Scientific Computing}, 19243 volume = {26}, 19244 number = {6}, 19245 pages = {1811--1837}, 19246 year = {2005}, 19247 publisher = {Philadelphia, PA: SIAM, c1993-} 19248} 19249 19250@Article{ nash2000mgopt, 19251 title = {A multigrid approach to discretized optimization problems}, 19252 author = {Nash, S.G.}, 19253 journal = {Optimization Methods and Software}, 19254 volume = {14}, 19255 number = {1-2}, 19256 pages = {99--116}, 19257 year = {2000}, 19258 publisher = {Taylor \& Francis} 19259} 19260 19261@Article{ borzi2009multigrid, 19262 title = {Multigrid Methods for {PDE} Optimization}, 19263 author = {Borz{\`i}, A. and Schulz, V.}, 19264 journal = {SIAM Review}, 19265 volume = {51}, 19266 pages = {361}, 19267 year = {2009} 19268} 19269 19270@Article{ borzi2005multigrid, 19271 title = {A multigrid scheme for elliptic constrained optimal control problems}, 19272 author = {Borz{\`i}, A. and Kunisch, K.}, 19273 journal = {Computational Optimization and Applications}, 19274 volume = {31}, 19275 number = {3}, 19276 pages = {309--333}, 19277 year = {2005}, 19278 publisher = {Springer} 19279} 19280 19281@Article{ borzi2003multigrid, 19282 title = {Multigrid methods for parabolic distributed optimal control problems}, 19283 author = {Borz{\`i}, A.}, 19284 journal = {Journal of Computational and Applied Mathematics}, 19285 volume = {157}, 19286 number = {2}, 19287 pages = {365--382}, 19288 year = {2003}, 19289 publisher = {Elsevier} 19290} 19291 19292@Article{ ito2002receding, 19293 title = {Receding horizon optimal control for infinite dimensional systems}, 19294 author = {Ito, K. and Kunisch, K.}, 19295 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 19296 volume = {8}, 19297 number = {1}, 19298 pages = {741--760}, 19299 year = {2002}, 19300 publisher = {Cambridge University Press} 19301} 19302 19303@Article{ schulz1998solving, 19304 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 19305 author = {Schulz, V.H.}, 19306 journal = {Computing and Visualization in Science}, 19307 volume = {1}, 19308 number = {2}, 19309 pages = {83--96}, 19310 year = {1998}, 19311 publisher = {Springer} 19312} 19313 19314@Article{ hazra2005aerodynamic, 19315 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 19316 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 19317 journal = {Journal of Computational Physics}, 19318 volume = {204}, 19319 number = {1}, 19320 pages = {46--64}, 19321 year = {2005}, 19322 publisher = {Elsevier} 19323} 19324 19325@Article{ mandel1985multilevel, 19326 title = {On multilevel iterative methods for integral equations of the second kind and 19327 related problems}, 19328 author = {Mandel, J.}, 19329 journal = {Numerische Mathematik}, 19330 volume = {46}, 19331 number = {1}, 19332 pages = {147--157}, 19333 year = {1985}, 19334 publisher = {Springer} 19335} 19336 19337@Article{ king1992multilevel, 19338 title = {Multilevel algorithms for ill-posed problems}, 19339 author = {King, J.T.}, 19340 journal = {Numerische Mathematik}, 19341 volume = {61}, 19342 number = {1}, 19343 pages = {311--334}, 19344 year = {1992}, 19345 publisher = {Springer} 19346} 19347 19348@Article{ kaltenbacher2001regularizing, 19349 title = {On the regularizing properties of a full multigrid method for ill-posed 19350 problems}, 19351 author = {Kaltenbacher, B.}, 19352 journal = {Inverse Problems}, 19353 volume = {17}, 19354 pages = {767}, 19355 year = {2001}, 19356 publisher = {IOP Publishing} 19357} 19358 19359@Article{ kaltenbacher2002multi, 19360 title = {A multi-grid method with a priori and a posteriori level choice for the 19361 regularization of nonlinear ill-posed problems}, 19362 author = {Kaltenbacher, B. and Schicho, J.}, 19363 journal = {Numerische Mathematik}, 19364 volume = {93}, 19365 number = {1}, 19366 pages = {77--107}, 19367 year = {2002}, 19368 publisher = {Springer} 19369} 19370 19371@Article{ burger2006regularizing, 19372 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 19373 author = {Burger, M. and Kaltenbacher, B.}, 19374 journal = {SIAM Journal on Numerical Analysis}, 19375 volume = {44}, 19376 pages = {153}, 19377 year = {2006} 19378} 19379 19380@Article{ draganescu2008optimal, 19381 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 19382 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 19383 journal = {Mathematics of Computation}, 19384 volume = {77}, 19385 number = {264}, 19386 pages = {2001--2038}, 19387 year = {2008} 19388} 19389 19390@Article{ bastian1998additive, 19391 title = {Additive and multiplicative multi-grid---a comparison}, 19392 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 19393 journal = {Computing}, 19394 volume = {60}, 19395 number = {4}, 19396 pages = {345--364}, 19397 year = {1998}, 19398 publisher = {Springer} 19399} 19400 19401@Article{ fournier2001multiplicative, 19402 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 19403 compressible flow computations on unstructured meshes}, 19404 author = {Fournier, L. and Lanteri, S.}, 19405 journal = {Applied Numerical Mathematics}, 19406 volume = {36}, 19407 number = {4}, 19408 pages = {401--426}, 19409 year = {2001}, 19410 publisher = {Elsevier} 19411} 19412 19413@Article{ chow2006survey, 19414 title = {A survey of parallelization techniques for multigrid solvers}, 19415 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 19416 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 19417 Simon, eds}, 19418 volume = {20}, 19419 pages = {179--201}, 19420 year = {2006} 19421} 19422 19423@InBook{ brandt2001multiscale, 19424 title = {Multiscale scientific computation: {R}eview 2001}, 19425 author = {Brandt, A.}, 19426 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 19427 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 19428 series = {Lecture Notes in Computational Science and Engineering}, 19429 year = {2001}, 19430 volume = {20}, 19431 pages = {3--96}, 19432 publisher = {Springer Verlag} 19433} 19434 19435@InCollection{ brandt2003multigrid, 19436 title = {Multigrid solvers and multilevel optimization strategies}, 19437 author = {Brandt, A. and Ron, D.}, 19438 booktitle = {Multilevel Optimization and VLSICAD}, 19439 editors = {J. Cong and J.R. Shinnerl}, 19440 pages = {1--69}, 19441 publisher = {Kluwer Academic Publishers}, 19442 year = {2003} 19443} 19444 19445@InBook{ brandt2009principles, 19446 title = {Principles of systematic upscaling}, 19447 author = {Brandt, A.}, 19448 booktitle = {Bridging the Scales in Science and Engineering}, 19449 editors = {J. Fish}, 19450 publisher = {Oxford University Press}, 19451 pages = {193--215}, 19452 year = {2009} 19453} 19454 19455@Article{ livne2004coarsening, 19456 title = {Coarsening by compatible relaxation}, 19457 author = {Livne, O.E.}, 19458 journal = {Numerical Linear Algebra with Applications}, 19459 volume = {11}, 19460 number = {2-3}, 19461 pages = {205--227}, 19462 year = {2004}, 19463 publisher = {Wiley Online Library} 19464} 19465 19466@InProceedings{ brandt1986stochastic, 19467 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 19468 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 19469 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 19470 Methods, held at Cologne, October 1-4, 1985}, 19471 volume = {1228}, 19472 pages = {65--98}, 19473 year = {1986}, 19474 organization = {Springer} 19475} 19476 19477@Article{ halko2011finding, 19478 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 19479 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 19480 Approximate Matrix Decompositions}, 19481 journal = {SIAM Review}, 19482 volume = {53}, 19483 number = {2}, 19484 year = {2011}, 19485 pages = {217-288}, 19486 doi = {10.1137/090771806} 19487} 19488 19489@InProceedings{ mhdy09, 19490 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 19491 booktitle = {Proceedings of SC09}, 19492 organization = {ACM}, 19493 title = {Minimizing communication in sparse matrix solvers}, 19494 doi = {10.1145/1654059.1654096}, 19495 year = {2009} 19496} 19497 19498@InProceedings{ vanrosendale83, 19499 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 19500 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 19501 author = {J. van Rosendale}, 19502 year = {1983}, 19503 publisher = {IEEE Computer Society} 19504} 19505 19506@PhDThesis{ vuduc95, 19507 title = {Quantitative performance modeling of scientific computations and creating 19508 locality in numerical algorithms}, 19509 author = {R. Vuduc}, 19510 journal = {Massachusetts Institute of Technology}, 19511 school = {Massachusetts Institute of Technology}, 19512 year = {1995} 19513} 19514 19515@Article{ simoncini2003flexible, 19516 title = {Flexible inner-outer {Krylov} subspace methods}, 19517 author = {Simoncini, V. and Szyld, D.B.}, 19518 journal = {SIAM Journal on Numerical Analysis}, 19519 pages = {2219--2239}, 19520 year = {2003}, 19521 publisher = {JSTOR} 19522} 19523 19524@Article{ parks2006recycling, 19525 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 19526 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 19527 journal = {SIAM Journal on Scientific Computing}, 19528 volume = {28}, 19529 number = {5}, 19530 pages = {1651--1674}, 19531 year = {2006}, 19532 publisher = {Society for Industrial and Applied Mathematics} 19533} 19534 19535@Article{ freund2003model, 19536 title = {Model reduction methods based on Krylov subspaces}, 19537 author = {Freund, R.W.}, 19538 journal = {Acta Numerica}, 19539 volume = {12}, 19540 number = {1}, 19541 pages = {267--319}, 19542 year = {2003}, 19543 publisher = {Cambridge Univ Press} 19544} 19545 19546@InBook{ gutknecht2006block, 19547 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 19548 an introduction}, 19549 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 19550 author = {Gutknecht, M.H.}, 19551 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 19552 publisher = {Anamaya Publishers}, 19553 location = {New Delhi}, 19554 pages = {420-447}, 19555 year = {2006} 19556} 19557 19558@Article{ moulton1998black, 19559 title = {The black box multigrid numerical homogenization algorithm}, 19560 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 19561 journal = {Journal of Computational Physics}, 19562 volume = {142}, 19563 number = {1}, 19564 pages = {80--108}, 19565 year = {1998}, 19566 publisher = {Elsevier} 19567} 19568 19569@Article{ neuss2001homogenization, 19570 title = {Homogenization and multigrid}, 19571 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 19572 journal = {Computing}, 19573 volume = {66}, 19574 number = {1}, 19575 pages = {1--26}, 19576 year = {2001}, 19577 publisher = {Springer} 19578} 19579 19580@Article{ bai2002krylov, 19581 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 19582 systems}, 19583 author = {Bai, Z.}, 19584 journal = {Applied Numerical Mathematics}, 19585 volume = {43}, 19586 number = {1}, 19587 pages = {9--44}, 19588 year = {2002}, 19589 publisher = {Elsevier} 19590} 19591 19592@InProceedings{ dong2003piecewise, 19593 title = {Piecewise polynomial nonlinear model reduction}, 19594 author = {Dong, N. and Roychowdhury, J.}, 19595 booktitle = {Design Automation Conference, 2003. Proceedings}, 19596 pages = {484--489}, 19597 year = {2003}, 19598 organization = {IEEE} 19599} 19600 19601@Article{ bond2009stable, 19602 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 19603 approximation and projection}, 19604 author = {Bond, B.N. and Daniel, L.}, 19605 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 19606 volume = {28}, 19607 number = {10}, 19608 pages = {1467--1480}, 19609 year = {2009}, 19610 publisher = {IEEE} 19611} 19612 19613@Article{ xin2000front, 19614 title = {Front Propagation in Heterogeneous Media}, 19615 author = {Xin, J.}, 19616 journal = {SIAM Review}, 19617 volume = {42}, 19618 number = {2}, 19619 pages = {161--230}, 19620 year = {2000}, 19621 publisher = {Society for Industrial and Applied Mathematics} 19622} 19623 19624@Article{ owhadi2011localized, 19625 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 19626 Nonseparated Scales and High Contrast}, 19627 author = {Owhadi, H. and Zhang, L.}, 19628 journal = {Multiscale Modeling and Simulation}, 19629 volume = {9}, 19630 pages = {1373}, 19631 year = {2011} 19632} 19633 19634@Article{ berlyand2010flux, 19635 title = {Flux norm approach to finite dimensional homogenization approximations with 19636 non-separated scales and high contrast}, 19637 author = {Berlyand, L. and Owhadi, H.}, 19638 journal = {Archive for rational mechanics and analysis}, 19639 volume = {198}, 19640 number = {2}, 19641 pages = {677--721}, 19642 year = {2010}, 19643 publisher = {Springer} 19644} 19645 19646@Article{ babuska2011optimal, 19647 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 19648 Application to Multiscale Problems}, 19649 author = {Babuska, I. and Lipton, R.}, 19650 journal = {Multiscale Modeling \& Simulation}, 19651 volume = {9}, 19652 pages = {373}, 19653 year = {2011} 19654} 19655 19656@Article{ boettinger2002phase, 19657 title = {Phase-Field Simulation of Solidification}, 19658 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 19659 journal = {Annual review of materials research}, 19660 volume = {32}, 19661 number = {1}, 19662 pages = {163--194}, 19663 year = {2002}, 19664 publisher = {Annual Reviews} 19665} 19666 19667@Article{ karma1998quantitative, 19668 title = {Quantitative phase-field modeling of dendritic growth in two and three 19669 dimensions}, 19670 author = {Karma, A. and Rappel, W.J.}, 19671 journal = {Physical Review E}, 19672 volume = {57}, 19673 number = {4}, 19674 pages = {4323}, 19675 year = {1998}, 19676 publisher = {APS} 19677} 19678 19679@Article{ chen2002phase, 19680 title = {Phase-field models for microstructure evolution}, 19681 author = {Chen, L.Q.}, 19682 journal = {Annual review of materials research}, 19683 volume = {32}, 19684 number = {1}, 19685 pages = {113--140}, 19686 year = {2002}, 19687 publisher = {Annual Reviews} 19688} 19689 19690@Article{ galbally2010reductionuq, 19691 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 19692 problems}, 19693 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 19694 journal = {International journal for numerical methods in engineering}, 19695 volume = {81}, 19696 number = {12}, 19697 pages = {1581--1608}, 19698 year = {2010}, 19699 publisher = {Wiley Online Library} 19700} 19701 19702@Article{ griebel1995abstract, 19703 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 19704 author = {Griebel, M. and Oswald, P.}, 19705 journal = {Numerische Mathematik}, 19706 volume = {70}, 19707 number = {2}, 19708 pages = {163--180}, 19709 year = {1995}, 19710 publisher = {Springer} 19711} 19712 19713@InProceedings{ voutchkov2006multiobjective, 19714 title = {Multiobjective optimization using surrogates}, 19715 author = {Voutchkov, I. and Keane, A.J.}, 19716 booktitle = {Adaptive Computing in Design and Manufacture}, 19717 pages = {167--175}, 19718 year = {2006}, 19719 publisher = {The MC Escher Company} 19720} 19721 19722@Article{ leary2001constraint, 19723 title = {A constraint mapping approach to the structural optimization of an expensive 19724 model using surrogates}, 19725 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 19726 journal = {Optimization and Engineering}, 19727 volume = {2}, 19728 number = {4}, 19729 pages = {385--398}, 19730 year = {2001}, 19731 publisher = {Springer} 19732} 19733 19734@InProceedings{ legresley2000airfoil, 19735 title = {Airfoil design optimization using reduced order models based on proper orthogonal 19736 decomposition}, 19737 author = {LeGresley, P.A. and Alonso, J.J.}, 19738 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 19739 year = {2000} 19740} 19741 19742@Book{ myers2009response, 19743 title = {Response surface methodology: process and product optimization using designed 19744 experiments}, 19745 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 19746 volume = {705}, 19747 year = {2009}, 19748 publisher = {John Wiley \& Sons} 19749} 19750 19751@Article{ carlberg2012gnat, 19752 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 19753 application to computational fluid dynamics and turbulent flows}, 19754 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 19755 journal = {arXiv}, 19756 volume = {1207.1349}, 19757 year = {2012} 19758} 19759 19760@Article{ biros2008multilevel, 19761 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 19762 author = {Biros, G. and Dogan, G.}, 19763 journal = {Inverse Problems}, 19764 volume = {24}, 19765 pages = {034010}, 19766 year = {2008}, 19767 publisher = {IOP Publishing} 19768} 19769 19770@Article{ rees2010optimal, 19771 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 19772 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 19773 journal = {SIAM Journal on Scientific Computing}, 19774 volume = {32}, 19775 pages = {271}, 19776 year = {2010} 19777} 19778 19779@Article{ rees2010block, 19780 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 19781 author = {Rees, T. and Stoll, M.}, 19782 journal = {Numerical Linear Algebra with Applications}, 19783 volume = {17}, 19784 number = {6}, 19785 pages = {977--996}, 19786 year = {2010}, 19787 publisher = {Wiley Online Library} 19788} 19789 19790@Article{ rees2011preconditioning, 19791 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 19792 Equations}, 19793 author = {Rees, T. and Wathen, A.J.}, 19794 journal = {SIAM Journal on Scientific Computing}, 19795 volume = {33}, 19796 number = {5}, 19797 pages = {2903--2926}, 19798 year = {2011}, 19799 publisher = {Society for Industrial and Applied Mathematics} 19800} 19801 19802@Article{ vogel2007fbicg, 19803 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19804 author = {Vogel,J.A.}, 19805 journal = {Applied Mathematics and Computation}, 19806 volume = {188}, 19807 number = {1}, 19808 pages = {226–-233}, 19809 year = {2007}, 19810 publisher = {Elsevier} 19811} 19812 19813@Unpublished{ leehammond2010, 19814 author = {B. Lee and G.E. Hammond}, 19815 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 19816 Equation}, 19817 key = {multigrid}, 19818 note = {manuscript, 2010} 19819} 19820 19821@Article{ vandeneshop2004inexact, 19822 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 19823 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 19824 journal = {SIAM Journal on Matrix Analysis and Applications}, 19825 volume = {26}, 19826 number = {1}, 19827 pages = {125--153}, 19828 year = {2004} 19829} 19830 19831@Article{ fbicg.fbcgs, 19832 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19833 author = {Judith A. Vogel}, 19834 journal = {Applied Mathematics and Computation}, 19835 volume = {188}, 19836 number = {1}, 19837 pages = {226--233}, 19838 year = {2007} 19839} 19840 19841@Article{ simoncini2003inexact, 19842 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 19843 Computing}, 19844 author = {Valeria Simoncini and Daniel B. Szyld}, 19845 journal = {SIAM Journal on Scientific Computing}, 19846 volume = {25}, 19847 number = {2}, 19848 pages = {454--477}, 19849 year = {2003} 19850} 19851 19852@Article{ fqmr, 19853 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 19854 author = {Daniel B. Szyld and Judith A. Vogel}, 19855 journal = {SIAM Journal on Scientific Computing}, 19856 volume = {23}, 19857 number = {2}, 19858 pages = {363--380}, 19859 year = {2001} 19860} 19861 19862@Article{ ipcg, 19863 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 19864 author = {Gene H. Golub and Qiang Ye}, 19865 journal = {SIAM Journal on Scientific Computing}, 19866 volume = {21}, 19867 number = {4}, 19868 pages = {1305--1320}, 19869 year = {1999} 19870} 19871 19872@Article{ idr.sonneveld, 19873 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 19874 Systems of Linear Equations}, 19875 author = {Peter Sonneveld and Martin B. van Gijzen}, 19876 journal = {SIAM Journal on Scientific Computing}, 19877 volume = {31}, 19878 number = {2}, 19879 pages = {1035--1062}, 19880 year = {2008} 19881} 19882 19883@Article{ flexiblecg, 19884 title = {Flexible Conjugate Gradients}, 19885 author = {Yvan Notay}, 19886 journal = {SIAM Journal on Scientific Computing}, 19887 volume = {22}, 19888 number = {4}, 19889 pages = {1444--1460}, 19890 year = {2000} 19891} 19892 19893@Article{ generalizedcg, 19894 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 19895 Variable-Step Preconditioning}, 19896 author = {O. Axelsson and P. S. Vassilevski}, 19897 journal = {SIAM Journal on Matrix Analysis and Applications}, 19898 volume = {12}, 19899 number = {4}, 19900 pages = {625--644}, 19901 year = {1991} 19902} 19903 19904@Article{ bicg, 19905 title = {{Conjugate Gradient} methods for indefinite systems}, 19906 author = {R. Fletcher}, 19907 journal = {Lecture Notes in Mathematics}, 19908 volume = {506}, 19909 pages = {73--89}, 19910 year = {1976} 19911} 19912 19913@Article{ idr.bcgs, 19914 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 19915 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 19916 journal = {Applied Numerical Mathematics}, 19917 volume = {60}, 19918 pages = {1100--1114}, 19919 year = {2010} 19920} 19921 19922@Article{ idr.bcgsl, 19923 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 19924 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 19925 journal = {SIAM J. Sci. Comput.}, 19926 volume = {32}, 19927 number = {5}, 19928 pages = {2687--2709}, 19929 year = {2010} 19930} 19931 19932@Article{ idr.min.sync, 19933 title = {Minimizing synchronization in {IDR(s)}}, 19934 author = {T.P. Collignon and M.B. van Gijzen}, 19935 journal = {Numerical Linear Algebra with Applications}, 19936 volume = {18}, 19937 number = {5}, 19938 pages = {805--825}, 19939 year = {2011} 19940} 19941 19942@TechReport{ flexible.idr, 19943 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 19944 Sparse Linear Systems}, 19945 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 19946 institution = {Delft University of Technology}, 19947 number = {11-06}, 19948 year = {2011} 19949} 19950 19951@Article{ vangenuchten1980, 19952 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 19953 Soils}, 19954 author = {M. Th. van Genuchten}, 19955 journal = {Soil Science Society of America Journal}, 19956 volume = {44}, 19957 pages = {892--898}, 19958 year = {1980} 19959} 19960 19961@Article{ gmresr94, 19962 title = {{GMRESR}: a family of nested {GMRES} methods}, 19963 author = {H. A. Van der Vorst and C. Vuik}, 19964 journal = {Numerical Linear Algebra with Applications}, 19965 volume = {1}, 19966 number = {4}, 19967 pages = {369--386}, 19968 year = {1994} 19969} 19970 19971@Article{ knepley10, 19972 author = {Matthew G. Knepley}, 19973 title = {Removing the Barrier to Scalability in Parallel FMM}, 19974 journal = {CoRR}, 19975 volume = {abs/1008.2410}, 19976 note = {\url{http://arxiv.org/abs/1008.2410}}, 19977 year = {2010} 19978} 19979 19980@Article{ teng1998, 19981 author = {Shang-Hua Teng}, 19982 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 19983 N-Body Simulation}, 19984 journal = {SIAM J. Sci. Comput.}, 19985 volume = {19}, 19986 number = {2}, 19987 month = mar, 19988 pages = {635--656}, 19989 year = {1998}, 19990 issn = {1064-8275}, 19991 numpages = {22}, 19992 doi = {10.1137/S1064827595288942}, 19993 acmid = {289842}, 19994 issue_date = {March 1998}, 19995 publisher = {Society for Industrial and Applied Mathematics}, 19996 address = {Philadelphia, PA}, 19997 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 19998 parallel processing, partitioning, scientific computing, the fast multipole 19999 method, tree-codes} 20000} 20001 20002@InProceedings{ skinnerkramer05, 20003 author = {David Skinner and William Kramer}, 20004 title = {Understanding the causes of performance variability in HPC workloads}, 20005 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 20006 International}, 20007 organization = {IEEE}, 20008 pages = {137--149}, 20009 year = {2005} 20010} 20011 20012@Article{ notay_2000, 20013 author = {Yvan Notay}, 20014 title = {Flexible {Conjugate Gradients}}, 20015 journal = {SIAM Journal on Scientific Computing}, 20016 volume = {22}, 20017 number = {4}, 20018 year = {2000}, 20019 pages = {1444--1460} 20020} 20021 20022@Article{ bereux1996, 20023 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 20024 computations}, 20025 author = {Fran{\c{c}}ois B{\'e}reux}, 20026 journal = {Computer Methods in Applied Mechanics and Engineering}, 20027 volume = {133}, 20028 number = {1-2}, 20029 pages = {93--124}, 20030 year = {1996} 20031} 20032 20033@Article{ pawlowski2006globalization, 20034 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 20035 fully coupled solution of the {N}avier-{S}tokes equations}, 20036 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 20037 journal = {SIAM Review}, 20038 volume = {48}, 20039 number = {4}, 20040 pages = {700--721}, 20041 year = {2006}, 20042 publisher = {SIAM} 20043} 20044 20045@Article{ roppshadid2009, 20046 title = {Stability of operator splitting methods for systems with indefinite operators: 20047 Advection--diffusion--reaction systems}, 20048 author = {David L Ropp and John N Shadid}, 20049 journal = {Journal of Computational Physics}, 20050 volume = {228}, 20051 number = {9}, 20052 pages = {3508--3516}, 20053 year = {2009} 20054} 20055 20056@Article{ brown1985experiments, 20057 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 20058 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 20059 journal = {SIAM Journal on Scientific and Statistical Computing}, 20060 volume = {6}, 20061 number = {2}, 20062 pages = {297--313}, 20063 year = {1985}, 20064 publisher = {SIAM} 20065} 20066 20067@Article{ bicgsl_1993, 20068 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 20069 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 20070 Spectrum}, 20071 journal = {Electronic Transactions on Numerical Analysis}, 20072 volume = {1}, 20073 year = {1993}, 20074 pages = {11--32} 20075} 20076 20077@Book{ brandt2011revised, 20078 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 20079 Edition}, 20080 author = {Achi Brandt and Oren Livne}, 20081 year = {2011}, 20082 publisher = {SIAM} 20083} 20084 20085@Article{ axelsson1990algebraic, 20086 title = {Algebraic multilevel preconditioning methods, {II}}, 20087 author = {Axelsson, O. and Vassilevski, P.S.}, 20088 journal = {SIAM Journal on Numerical Analysis}, 20089 volume = {27}, 20090 number = {6}, 20091 pages = {1569--1590}, 20092 year = {1990}, 20093 publisher = {SIAM} 20094} 20095 20096@Article{ zulehner2002analysis, 20097 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 20098 author = {Zulehner, W.}, 20099 journal = {Mathematics of computation}, 20100 volume = {71}, 20101 number = {238}, 20102 pages = {479--506}, 20103 year = {2002} 20104} 20105 20106@Article{ pralet2010, 20107 author = {L. Giraud and A. Haidar and S. Pralet}, 20108 title = {Using multiple levels of parallelism to enhance the performance of domain 20109 decomposition solvers}, 20110 journal = {Parallel Computing}, 20111 volume = {36}, 20112 number = {5-6}, 20113 pages = {285--296}, 20114 year = {2010} 20115} 20116 20117@Book{ brennerscottfem, 20118 title = {The Mathematical Theory of Finite Element Methods}, 20119 author = {Susanne C. Brenner and L. Ridgway Scott}, 20120 edition = {3rd Edition}, 20121 series = {Texts in Applied Mathematics}, 20122 year = {2008}, 20123 publisher = {Springer-Verlag} 20124} 20125 20126@Book{ ortega1987iterative, 20127 title = {Iterative solution of nonlinear equations in several variables}, 20128 author = {Ortega, James M and Rheinboldt, Werner C}, 20129 volume = {30}, 20130 publisher = {Society for Industrial and Applied Mathematics}, 20131 year = {1987} 20132} 20133 20134@InBook{ rheinboldtch6, 20135 author = {Werner C. Rheinboldt}, 20136 title = {6. Combinations of Processes}, 20137 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 20138 chapter = {6}, 20139 pages = {59--74}, 20140 doi = {10.1137/1.9781611970012.ch6}, 20141 year = {1998} 20142} 20143 20144@Article{ allgowerbohmerpotrarheinboldt86, 20145 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 20146 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 20147 journal = {SIAM Journal on Numerical Analysis}, 20148 volume = {23}, 20149 number = {1}, 20150 pages = {160-169}, 20151 year = {1986}, 20152 doi = {10.1137/0723011} 20153} 20154 20155@Article{ rheinboldt76, 20156 author = {Werner C. Rheinboldt}, 20157 title = {On measures of ill-conditioning for nonlinear equations}, 20158 journal = {Mathematics of Computation}, 20159 volume = {30}, 20160 number = {133}, 20161 pages = {104--111}, 20162 year = {1976} 20163} 20164 20165@Article{ little61, 20166 author = {John D. C. Little}, 20167 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 20168 journal = {Operations Research}, 20169 volume = {9}, 20170 number = {3}, 20171 pages = {383--387}, 20172 note = {\url{http://www.jstor.org/stable/167570}}, 20173 year = {1961} 20174} 20175 20176@Misc{ top500, 20177 author = {{TOP500 Supercomputer Sites}}, 20178 url = {http://www.top500.org}, 20179 year = {2013} 20180} 20181 20182@Misc{ hassediagram, 20183 author = {Wikipedia}, 20184 title = {Hasse Diagram}, 20185 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 20186 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 20187 year = {2015} 20188} 20189 20190@Misc{ groupoid, 20191 author = {Wikipedia}, 20192 title = {Groupoid}, 20193 url = {https://en.wikipedia.org/wiki/Groupoid}, 20194 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 20195 year = {2015} 20196} 20197 20198@Misc{ cwcomplex, 20199 author = {Wikipedia}, 20200 title = {{CW} complex}, 20201 url = {http://en.wikipedia.org/wiki/CW_complex}, 20202 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 20203 year = {2015} 20204} 20205 20206@Misc{ linearalgebra, 20207 author = {Wikipedia}, 20208 title = {Linear Algebra}, 20209 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 20210 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 20211 year = {2015} 20212} 20213 20214@Misc{ amdahlslaw, 20215 author = {Wikipedia}, 20216 title = {Amdahl's Law}, 20217 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 20218 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 20219 year = {2015} 20220} 20221 20222@Misc{ gustafsonslaw, 20223 author = {Wikipedia}, 20224 title = {Gustafson's Law}, 20225 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 20226 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 20227 year = {2015} 20228} 20229 20230@InProceedings{ amdahl1967, 20231 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 20232 Capabilities}, 20233 author = {Gene M. Amdahl}, 20234 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 20235 series = {AFIPS '67 (Spring)}, 20236 location = {Atlantic City, New Jersey}, 20237 pages = {483--485}, 20238 numpages = {3}, 20239 doi = {10.1145/1465482.1465560}, 20240 acmid = {1465560}, 20241 publisher = {ACM}, 20242 address = {New York, NY, USA}, 20243 year = {1967} 20244} 20245 20246@Article{ gustafson1988, 20247 title = {Reevaluating {Amdahl}'s Law}, 20248 author = {Gustafson, John L.}, 20249 journal = {Communications of the ACM}, 20250 volume = {31}, 20251 number = {5}, 20252 month = may, 20253 issn = {0001-0782}, 20254 pages = {532--533}, 20255 doi = {10.1145/42411.42415}, 20256 acmid = {42415}, 20257 year = {1988} 20258} 20259 20260@Book{ eijkhout2014, 20261 title = {Introduction to High Performance Scientific Computing}, 20262 author = {Victor Eijkhout}, 20263 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 20264 publisher = {TACC}, 20265 year = {2014} 20266} 20267 20268@Article{ korelc2002multilanguage, 20269 title = {Multi-language and multi-environment generation of nonlinear finite element 20270 codes}, 20271 author = {Korelc, J.}, 20272 journal = {Engineering with Computers}, 20273 volume = {18}, 20274 number = {4}, 20275 pages = {312--327}, 20276 year = {2002}, 20277 publisher = {Springer} 20278} 20279 20280@TechReport{ taylor2011feap, 20281 title = {{FEAP}: A Finite Element Analysis Program}, 20282 subtitle = {Version 8.3 User Manual}, 20283 author = {R. L. Taylor}, 20284 year = {2011}, 20285 institution = {University of California, Berkeley} 20286} 20287 20288@Article{ bergeraftosmismurman2005, 20289 title = {Analysis of slope limiters on irregular grids}, 20290 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 20291 journal = {AIAA paper}, 20292 volume = {490}, 20293 pages = {2005}, 20294 year = {2005} 20295} 20296 20297@InProceedings{ ferreirabridgesbrightwell08, 20298 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 20299 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 20300 Noise Injection}, 20301 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 20302 series = {SC '08}, 20303 year = {2008}, 20304 isbn = {978-1-4244-2835-9}, 20305 location = {Austin, Texas}, 20306 pages = {19:1--19:12}, 20307 articleno = {19}, 20308 numpages = {12}, 20309 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 20310 acmid = {1413390}, 20311 publisher = {IEEE Press}, 20312 address = {Piscataway, NJ} 20313} 20314 20315@Article{ banach22, 20316 author = {Stefan Banach}, 20317 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 20318 \'equations int\'egrales}, 20319 journal = {Fund. Math.}, 20320 volume = {3}, 20321 pages = {133--181}, 20322 year = {1922} 20323} 20324 20325@Article{ bangerthbursteddeheisterkronbichler2012, 20326 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 20327 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 20328 Element Codes}, 20329 journal = {ACM Trans. Math. Softw.}, 20330 issue_date = {December 2011}, 20331 volume = {38}, 20332 number = {2}, 20333 month = jan, 20334 year = {2012}, 20335 issn = {0098-3500}, 20336 pages = {14:1--14:28}, 20337 articleno = {14}, 20338 numpages = {28}, 20339 doi = {10.1145/2049673.2049678}, 20340 acmid = {2049678}, 20341 publisher = {ACM}, 20342 address = {New York, NY, USA}, 20343 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 20344 design} 20345} 20346 20347@Article{ eisenstatwalker1994, 20348 author = {Stanley Eisenstat and Homer Walker}, 20349 title = {Globally Convergent Inexact {N}ewton Methods}, 20350 journal = {SIAM Journal on Optimization}, 20351 volume = {4}, 20352 number = {2}, 20353 pages = {393--422}, 20354 year = {1994}, 20355 doi = {10.1137/0804022} 20356} 20357 20358@Book{ blumcuckershubsmale98, 20359 title = {Complexity and Real Computation}, 20360 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 20361 year = {1998}, 20362 publisher = {Springer} 20363} 20364 20365@Article{ caili2011, 20366 author = {Cai, X.-C. and Li, X.}, 20367 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 20368 Elimination for Problems with High Local Nonlinearity}, 20369 journal = {SIAM Journal on Scientific Computing}, 20370 volume = {33}, 20371 number = {2}, 20372 pages = {746-762}, 20373 year = {2011}, 20374 doi = {10.1137/080736272} 20375} 20376 20377@Article{ cai2009, 20378 author = {X.-C. Cai}, 20379 title = { Nonlinear overlapping domain decomposition methods}, 20380 journal = {Lecture Notes in Computational Science}, 20381 volume = {70}, 20382 pages = {217-224}, 20383 year = {2009} 20384} 20385 20386@Article{ lanzkronrosewilkes1996, 20387 title = {An analysis of approximate nonlinear elimination}, 20388 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 20389 journal = {SIAM Journal on Scientific Computing}, 20390 volume = {17}, 20391 number = {2}, 20392 pages = {538--559}, 20393 year = {1996}, 20394 publisher = {SIAM} 20395} 20396 20397@TechReport{ gropp1993sowing, 20398 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 20399 author = {Gropp, W}, 20400 year = {1995}, 20401 number = {ANL/MCS-TM-208}, 20402 institution = {Argonne National Laboratory} 20403} 20404 20405@TechReport{ gropp1993sowing2, 20406 title = {Users Manual for doctext: Producing Documentation from Source Code}, 20407 author = {Gropp, W}, 20408 year = {1995}, 20409 number = {ANL/MCS-TM-206}, 20410 institution = {Argonne National Laboratory} 20411} 20412 20413@TechReport{ gropp1993simplified, 20414 title = {Simplified Linear Equation Solvers users manual}, 20415 author = {Gropp, W and Smith, B}, 20416 year = {1993}, 20417 number = {ANL--93/8}, 20418 institution = {Argonne National Laboratory} 20419} 20420 20421@Misc{ simplifiedbsd, 20422 author = {{University of California, Berkeley}}, 20423 title = {Simplified {Berkeley} Software Distribution License}, 20424 note = {see 20425 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 20426} 20427 20428@Book{ chaconstraub14, 20429 author = {Scott Chacon and Ben Straub}, 20430 title = {Pro Git}, 20431 publisher = {Apress}, 20432 year = {2014}, 20433 pages = {456}, 20434 note = {Available online at \url{http://git-scm.com/book/}} 20435} 20436 20437@Misc{ bitbucket, 20438 author = {Atlassian}, 20439 title = {Bitbucket}, 20440 note = {Platform available from \url{http://bitbucket.org}} 20441} 20442 20443@Misc{ gitworkflows, 20444 author = {GitWorkflows}, 20445 note = {Available at 20446 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 20447} 20448 20449@Misc{ figshare, 20450 author = {FigShare}, 20451 note = {Available at \url{http://palgrave.figshare.com/}} 20452} 20453 20454@InProceedings{ beazley1996swig, 20455 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 20456 {C++}}, 20457 author = {Beazley, David M}, 20458 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 20459 pages = {129--139}, 20460 year = {1996} 20461} 20462 20463@Misc{ softwareproductivityworkshopreport14, 20464 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 20465 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 20466 title = {Software Productivity for Extreme-Scale Science}, 20467 note = {Report on DOE Workshop, January 13-14, 2014}, 20468 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 20469 year = {2014} 20470} 20471 20472@Misc{ softwareproductivitywhitepaper13, 20473 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 20474 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 20475 Tang}, 20476 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 20477 Capability of Extreme-Scale Computing}, 20478 note = {whitepaper submitted to DOE, available via 20479 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 20480 year = {2013} 20481} 20482 20483@Misc{ ideas:project, 20484 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 20485 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 20486 howpublished = {\url{http://ideas-productivity.org}}, 20487 year = {2015} 20488} 20489 20490@TechReport{ keyesmcinneswoodwardetal2012, 20491 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 20492 and B. Sheehan}, 20493 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 20494 institution = {Argonne National Laboratory}, 20495 number = {ANL/MCS-TM-330}, 20496 month = oct, 20497 year = {2012} 20498} 20499 20500@Misc{ sawsfs-web-page, 20501 author = {Surtai Han and Barry Smith and Hong Zhang}, 20502 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 20503 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 20504 year = {2015} 20505} 20506 20507@Misc{ sawshk-web-page, 20508 author = {Surtai Han and Barry Smith and Hong Zhang}, 20509 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 20510 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 20511 year = {2015} 20512} 20513 20514@Misc{ sawsnestk-web-page, 20515 author = {Surtai Han and Barry Smith and Hong Zhang}, 20516 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 20517 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 20518 year = {2015} 20519} 20520 20521@Misc{ m2acs:project, 20522 author = {M. {Anitescu et al.}}, 20523 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 20524 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 20525 year = {2015} 20526} 20527 20528@Misc{ hssmn13, 20529 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 20530 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 20531 Developing Mathematical Libraries and Simulation Codes}, 20532 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 20533 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 20534 year = {2013} 20535} 20536 20537@Misc{ atpesc:website, 20538 key = {{Argonne Training Program for Extreme-Scale Computing}}, 20539 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 20540 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 20541 year = {2018} 20542} 20543 20544@Article{ barraultmadaynguyenpatera2004, 20545 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 20546 title = {An empirical interpolation method: application to efficient reduced-basis 20547 discretization of partial differential equations}, 20548 journal = {Comptes Rendus Mathematique}, 20549 volume = {339}, 20550 number = {9}, 20551 pages = {667--672}, 20552 year = {2004}, 20553 issn = {1631-073X}, 20554 doi = {10.1016/j.crma.2004.08.006} 20555} 20556 20557@Article{ simongogotsi08, 20558 title = {Materials for electrochemical capacitors}, 20559 author = {Patrice Simon and Yury Gogotsi}, 20560 journal = {Nature Materials}, 20561 volume = {7}, 20562 number = {11}, 20563 pages = {845--854}, 20564 year = {2008}, 20565 doi = {10.1038/nmat2297} 20566} 20567 20568@Article{ vladsinghrollandmelinteajayangohy14, 20569 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 20570 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 20571 Gohy}, 20572 journal = {Scientific Reports}, 20573 volume = {4}, 20574 year = {2014}, 20575 doi = {10.1038/srep04315} 20576} 20577 20578@Article{ lichengshashurinkeidar12, 20579 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 20580 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 20581 journal = {Graphene}, 20582 volume = {1}, 20583 number = {1}, 20584 pages = {1--13}, 20585 year = {2012}, 20586 doi = {10.4236/graphene.2012.11001} 20587} 20588 20589@Article{ miller07, 20590 title = {A Brief History of Supercapacitors}, 20591 author = {John R. Miller}, 20592 journal = {Battery and Energy Storage Technology}, 20593 pages = {61--78}, 20594 year = {2007} 20595} 20596 20597@Book{ deshpande14, 20598 title = {Ultracapacitors: Future of Energy Storage}, 20599 author = {R. P. Deshpande}, 20600 publisher = {McGraw Hill Education}, 20601 isbn = {978-9339214050}, 20602 pages = {452}, 20603 year = {2014} 20604} 20605 20606@Article{ hojowboggs10, 20607 title = {Historical introduction to capacitor technology}, 20608 author = {J. Ho and T.R. Jow and S. Boggs}, 20609 journal = {IEEE Electrical Insulation Magazine}, 20610 month = jan, 20611 volume = {26}, 20612 number = {1}, 20613 pages = {20--25}, 20614 year = {2010}, 20615 doi = {10.1109/MEI.2010.5383924}, 20616 issn = {0883-7554} 20617} 20618 20619@Article{ gillespie14, 20620 title = {A review of steric interactions of ions: Why some theories succeed and others 20621 fail to acount for ion size}, 20622 author = {Dirk Gillespie}, 20623 journal = {Microfluidics and Nanofluidics}, 20624 volume = {18}, 20625 number = {5-6}, 20626 pages = {717--738}, 20627 year = {2015} 20628} 20629 20630@Article{ gillespievaliskoboda05, 20631 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 20632 title = {Density functional theory of the electrical double layer: the RFD functional}, 20633 journal = {J. Phys.: Condens. Matter}, 20634 volume = {17}, 20635 pages = {6609--6626}, 20636 year = {2005} 20637} 20638 20639@Article{ valiskobodagillespie07, 20640 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 20641 title = {Selective adsorption of ions with different diameter and valence at 20642 highly-charged interfaces}, 20643 journal = {J. Phys. Chem. C}, 20644 volume = {111}, 20645 pages = {15575--15585}, 20646 year = {2007} 20647} 20648 20649@Article{ gillespie08, 20650 author = {Dirk Gillespie}, 20651 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 20652 case study}, 20653 journal = {Biophys. J.}, 20654 volume = {94}, 20655 pages = {1169--1184}, 20656 year = {2008} 20657} 20658 20659@Article{ liwuwang15, 20660 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 20661 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 20662 journal = {Biophysical Journal}, 20663 volume = {94}, 20664 number = {3}, 20665 pages = {737--746}, 20666 doi = {10.1529/biophysj.107.112508}, 20667 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 20668 year = {2015} 20669} 20670 20671@Article{ gillespie12, 20672 title = {High energy conversion efficiency in nanofluidic channels}, 20673 author = {Dirk Gillespie}, 20674 journal = {Nano Letters}, 20675 volume = {12}, 20676 pages = {1410--1416}, 20677 year = {2012} 20678} 20679 20680@Article{ dieterich79, 20681 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 20682 author = {James H. Dieterich}, 20683 journal = {Journal of Geophysical Research: Solid Earth}, 20684 volume = {84}, 20685 number = {B5}, 20686 pages = {2161--2168}, 20687 year = {1979}, 20688 publisher = {Wiley Online Library} 20689} 20690 20691@Article{ bodakovacsgillespiekristof14, 20692 title = {Selective transport through a model calcium channel studied by Local Equilibrium 20693 Monte Carlo simulations coupled to the Nernst--Planck equation}, 20694 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 20695 Krist{\'o}f}, 20696 journal = {Journal of Molecular Liquids}, 20697 volume = {189}, 20698 pages = {100--112}, 20699 year = {2014}, 20700 publisher = {Elsevier} 20701} 20702 20703@Article{ brandt05, 20704 title = {Multiscale solvers and systematic upscaling in computational physics}, 20705 author = {Brandt, A}, 20706 journal = {Computer Physics Communications}, 20707 volume = {169}, 20708 number = {1}, 20709 pages = {438--441}, 20710 year = {2005}, 20711 publisher = {Elsevier} 20712} 20713 20714@Article{ rosenfeld89, 20715 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 20716 density-functional theory of freezing}, 20717 author = {Yaakov Rosenfeld}, 20718 journal = {Physical review letters}, 20719 volume = {63}, 20720 number = {9}, 20721 pages = {980}, 20722 year = {1989}, 20723 publisher = {APS} 20724} 20725 20726@Article{ schindlermitchellmccabecummingslevan13, 20727 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 20728 Approach}, 20729 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 20730 M Douglas LeVan}, 20731 journal = {The Journal of Physical Chemistry C}, 20732 volume = {117}, 20733 number = {41}, 20734 pages = {21337--21350}, 20735 year = {2013}, 20736 publisher = {ACS Publications} 20737} 20738 20739@Misc{ tramonto, 20740 author = {Laura Frink and et. al.}, 20741 title = {TRAMONTO 3.0 web site}, 20742 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 20743 year = {2014} 20744} 20745 20746@InCollection{ zhongyuenmoresiknepley15, 20747 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 20748 title = {Numerical Methods for Mantle Convection}, 20749 booktitle = {Treatise on Geophysics}, 20750 publisher = {Elsevier}, 20751 volume = {7}, 20752 editor = {Gerald Schubert}, 20753 edition = {second}, 20754 year = {2015} 20755} 20756 20757@Article{ richarson1911, 20758 author = {Lewis Fry Richardson}, 20759 title = {The approximate arithmetical solution by finite differences of physical problems 20760 including differential equations, with an application to the stresses in a masonry 20761 dam}, 20762 journal = {Philosophical Transactions of the Royal Society A}, 20763 volume = {210}, 20764 number = {459--470}, 20765 pages = {307--357}, 20766 doi = {10.1098/rsta.1911.0009}, 20767 year = {1911} 20768} 20769 20770@Article{ kirkwood34, 20771 author = {John G. Kirkwood}, 20772 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 20773 Application to Zwitterions}, 20774 journal = {The Journal of Chemical Physics}, 20775 volume = {2}, 20776 number = {7}, 20777 year = {1934} 20778} 20779 20780@TechReport{ schoof1994exodus, 20781 title = {{EXODUS II}: a finite element data model}, 20782 author = {Larry A Schoof and Victor R Yarberry}, 20783 institution = {Sandia National Laboratories}, 20784 number = {SAND92-2137}, 20785 address = {Albuquerque, NM}, 20786 year = {1994} 20787} 20788 20789@Misc{ poirier1998cgns, 20790 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 20791 and Fancis Y Enomoto}, 20792 title = {The CGNS system}, 20793 note = {AIAA Paper 98-3007}, 20794 year = {1998} 20795} 20796 20797@Article{ deyobarashephard2001, 20798 title = {Towards curvilinear meshing in 3D: the case of quadratic simplices}, 20799 author = {Saikat Dey and Robert M O'Bara and Mark S Shephard}, 20800 journal = {Computer-Aided Design}, 20801 volume = {33}, 20802 number = {3}, 20803 pages = {199--209}, 20804 year = {2001}, 20805} 20806 20807@InProceedings{ gomezhaimesgalbraith2022, 20808 title = {On Analysis Driven Shape Design Using B-Splines}, 20809 author = {Marlena Gomez and Robert Haimes and Marshall C Galbraith}, 20810 booktitle = {AIAA SciTech 2022 Forum}, 20811 pages = {1736}, 20812 year = {2022} 20813} 20814 20815@InProceedings{ cloughoberaizakrajsek2019, 20816 title = {Automated Wing Internal Structure Placement Guided by Finite Element Analysis}, 20817 author = {Justin L Clough and Assad A Oberai and Andrew J Zakrajsek}, 20818 booktitle = {AIAA Aviation 2019 Forum}, 20819 pages = {3369}, 20820 year = {2019} 20821} 20822 20823@InProceedings{ joegandhidannenhofferdalir2019, 20824 title = {Rapid generation of parametric aircraft structural models}, 20825 author = {John Joe and Viraj Gandhi and John Dannenhoffer and Hamid Dalir}, 20826 booktitle = {AIAA SciTech 2019 Forum}, 20827 pages = {2229}, 20828 year = {2019} 20829} 20830 20831@InProceedings{ haimesdannenhoffer2013, 20832 title = {The engineering sketch pad: A solid-modeling, feature-based, web-enabled system for building parametric geometry}, 20833 author = {Robert Haimes and John Dannenhoffer}, 20834 booktitle = {21st AIAA Computational Fluid Dynamics Conference}, 20835 pages = {3073}, 20836 year = {2013} 20837} 20838 20839@Article{ geuzaine2009gmsh, 20840 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 20841 facilities}, 20842 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 20843 journal = {International Journal for Numerical Methods in Engineering}, 20844 volume = {79}, 20845 number = {11}, 20846 pages = {1309--1331}, 20847 year = {2009}, 20848 publisher = {Wiley Online Library} 20849} 20850 20851@Article{ si2015, 20852 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 20853 author = {Hang Si}, 20854 journal = {ACM Trans. on Mathematical Software}, 20855 volume = {41}, 20856 number = {2}, 20857 month = feb, 20858 doi = {10.1145/2629697}, 20859 year = {2015} 20860} 20861 20862@TechReport{ blackerbohnhoffedwards1994, 20863 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 20864 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 20865 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 20866 year = {1994} 20867} 20868 20869@Article{ bjorck1994, 20870 title = {Numerics of Gram-Schmidt orthogonalization}, 20871 author = {{\AA}ke Bj{\"o}rck}, 20872 journal = {Linear Algebra and Its Applications}, 20873 volume = {197}, 20874 pages = {297--316}, 20875 year = {1994}, 20876 publisher = {Elsevier} 20877} 20878 20879@PhDThesis{ yood05, 20880 author = {Charles Nelson Yood}, 20881 title = {Argonne National Laboratory and the Emergence of Computer and Computational 20882 Science, 1946--1992}, 20883 school = {The Pennsylvania State University}, 20884 month = aug, 20885 year = {2005} 20886} 20887 20888@Article{ fearnleysander79, 20889 title = {Hermann Grassmann and the Creation of Linear Algebra}, 20890 author = {Desmond Fearnley-Sander}, 20891 journal = {The American Mathematical Monthly}, 20892 volume = {86}, 20893 pages = {809--817}, 20894 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 20895 year = {1979} 20896} 20897 20898@InCollection{ knepley2012, 20899 author = {Matthew G. Knepley}, 20900 title = {Programming Languages for Scientific Computing}, 20901 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20902 publisher = {Springer}, 20903 year = {2012}, 20904 editor = {Bj\"orn Engquist}, 20905 doi = {10.1007/978-3-540-70529-1}, 20906 url = {http://arxiv.org/abs/1209.1711} 20907} 20908 20909@InBook{ knepley2015, 20910 title = {Programming Languages for Scientific Computing}, 20911 author = {Matthew G. Knepley}, 20912 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20913 editor = {Bj{\"o}rn Engquist}, 20914 publisher = {Springer Berlin Heidelberg}, 20915 address = {Berlin, Heidelberg}, 20916 pages = {1173--1181}, 20917 isbn = {978-3-540-70529-1}, 20918 doi = {10.1007/978-3-540-70529-1_250}, 20919 year = {2015} 20920} 20921 20922@Book{ hughes2000, 20923 author = {Thomas J. R. Hughes}, 20924 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 20925 series = {Dover Civil and Mechanical Engineering}, 20926 pages = {704}, 20927 year = {2000}, 20928 isbn = {978-0486411811}, 20929 publisher = {Dover} 20930} 20931 20932@Article{ roache2002, 20933 title = {Code verification by the method of manufactured solutions}, 20934 author = {Patrick J. Roache}, 20935 journal = {Journal of Fluids Engineering}, 20936 volume = {124}, 20937 number = {1}, 20938 pages = {4--10}, 20939 year = {2002}, 20940 publisher = {American Society of Mechanical Engineers} 20941} 20942 20943@InCollection{ rokosgorman13, 20944 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 20945 author = {Georgios Rokos and Gerard Gorman}, 20946 booktitle = {Facing the Multicore-Challenge III}, 20947 series = {Lecture Notes in Computer Science}, 20948 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 20949 publisher = {Springer Berlin Heidelberg}, 20950 volume = {7686}, 20951 pages = {143-144}, 20952 doi = {10.1007/978-3-642-35893-7_22}, 20953 isbn = {978-3-642-35892-0}, 20954 year = {2013} 20955} 20956 20957@Misc{ hdf5:homepage, 20958 author = {{The HDF Group}}, 20959 title = {The {HDF5} Homepage}, 20960 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 20961 year = {2015} 20962} 20963 20964@Misc{ paraview:homepage, 20965 author = {Kitware}, 20966 title = {The {ParaView} Homepage}, 20967 howpublished = {\url{http://www.paraview.org/}}, 20968 year = {2015} 20969} 20970 20971@Misc{ xdmf:homepage, 20972 author = {Kitware}, 20973 title = {The Extensible Data Model and Format ({XDMF})}, 20974 howpublished = {\url{http://www.xdmf.org/}}, 20975 year = {2015} 20976} 20977 20978@Article{ cullerkarp1993, 20979 title = {LogP: Towards a realistic model of parallel computation}, 20980 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 20981 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 20982 journal = {SIGPLAN Notices}, 20983 volume = {28}, 20984 number = {7}, 20985 pages = {1--12}, 20986 year = {1993}, 20987 publisher = {ACM} 20988} 20989 20990@Article{ aggarwalvitter1988, 20991 title = {The input/output complexity of sorting and related problems}, 20992 author = {Alok Aggarwal and Jeffrey Vitter}, 20993 journal = {Communications of the ACM}, 20994 volume = {31}, 20995 number = {9}, 20996 pages = {1116--1127}, 20997 year = {1988}, 20998 publisher = {ACM} 20999} 21000 21001@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 21002 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 21003 Chandramowlishwaran and Richard Vuduc}, 21004 title = {Balance principles for algorithm-architecture co-design}, 21005 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 21006 month = may, 21007 address = {Berkeley, CA, USA}, 21008 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 21009 year = {2011} 21010} 21011 21012@Article{ williamswatermanpatterson2009, 21013 title = {Roofline: an insightful visual performance model for multicore architectures}, 21014 author = {Samuel Williams and Andrew Waterman and David Patterson}, 21015 journal = {Communications of the ACM}, 21016 volume = {52}, 21017 number = {4}, 21018 pages = {65--76}, 21019 year = {2009}, 21020 publisher = {ACM} 21021} 21022 21023@Misc{ roofline-web-page, 21024 author = {Samuel Williams and {et. al.}}, 21025 title = {{R}oofline {P}erformance {M}odel}, 21026 key = {Roofline}, 21027 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 21028 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 21029} 21030 21031@Misc{ roofline-talk2008, 21032 author = {Samuel Williams and David Patterson}, 21033 title = {{R}oofline {P}erformance {M}odel}, 21034 key = {Roofline}, 21035 year = {2008}, 21036 note = {ParLab Summer Retreat}, 21037 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 21038 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 21039} 21040 21041@Article{ lee2006, 21042 title = {The problem with threads}, 21043 author = {Edward A Lee}, 21044 journal = {Computer}, 21045 volume = {39}, 21046 number = {5}, 21047 pages = {33--42}, 21048 year = {2006}, 21049 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 21050 publisher = {IEEE Computer Society Press} 21051} 21052 21053@Article{ hoefler2012, 21054 title = {{Optimization principles for collective neighborhood communications}}, 21055 author = {Torsten Hoefler and Timo Schneider}, 21056 journal = {International Conference for High Performance Computing, Networking, Storage and 21057 Analysis, SC}, 21058 doi = {10.1109/SC.2012.86}, 21059 isbn = {9781467308069}, 21060 issn = {21674329}, 21061 year = {2012} 21062} 21063 21064@Book{ grahamknuthpatashnik1989, 21065 title = {Concrete Mathematics}, 21066 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 21067 publisher = {Addison-Wesley}, 21068 year = {1989} 21069} 21070 21071@Book{ jackson1962, 21072 title = {Classical Electrodynamics}, 21073 author = {John David Jackson}, 21074 publisher = {John Wiley \& Sons}, 21075 year = {1962} 21076} 21077 21078@Article{ leveque2013, 21079 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 21080 author = {Randall J. LeVeque}, 21081 journal = {SIAM News}, 21082 volume = {46}, 21083 number = {3}, 21084 month = apr, 21085 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 21086 year = {2013} 21087} 21088 21089@InProceedings{ wang2014, 21090 title = {Fjos: Practical, predictable, and efficient system support for fork/join 21091 parallelism}, 21092 author = {Qi Wang and Gabriel Parmer}, 21093 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 21094 20th}, 21095 pages = {25--36}, 21096 year = {2014}, 21097 organization = {IEEE} 21098} 21099 21100@Article{ fangsaad2009, 21101 author = {Haw-ren Fang and Yousef Saad}, 21102 title = {Two classes of multisecant methods for nonlinear acceleration}, 21103 journal = {Numerical Linear Algebra with Applications}, 21104 volume = {16}, 21105 number = {3}, 21106 pages = {197--221}, 21107 year = {2009}, 21108 doi = {10.1002/nla.617} 21109} 21110 21111@Misc{ hpcchallenge, 21112 title = {HPC Challenge}, 21113 author = {Jack Dongarra and Piotr Luszczek and others}, 21114 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 21115 year = {2015} 21116} 21117 21118@InProceedings{ hoeflerschneiderlumsdaine2008, 21119 title = {Accurately measuring collective operations at massive scale}, 21120 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 21121 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 21122 Processing (IPDPS)}, 21123 pages = {1--8}, 21124 year = {2008}, 21125 doi = {10.1109/IPDPS.2008.4536494}, 21126 organization = {IEEE} 21127} 21128 21129@Book{ potraptak1984, 21130 title = {Nondiscrete Induction and Iterative Processes}, 21131 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 21132 series = {Research Notes in Mathematics}, 21133 year = {1984}, 21134 publisher = {Pitman} 21135} 21136 21137@Book{ pilz1977, 21138 title = {Near-rings: the theory and its applications}, 21139 author = {G{\"u}nter Pilz}, 21140 year = {1977}, 21141 publisher = {New York} 21142} 21143 21144@Article{ birkenjameson2009, 21145 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 21146 author = {Philipp Birken and Antony Jameson}, 21147 journal = {International Journal for Numerical Methods in Fluids}, 21148 volume = {62}, 21149 number = {5}, 21150 pages = {565--573}, 21151 publisher = {John Wiley \& Sons, Ltd.}, 21152 doi = {10.1002/fld.2030}, 21153 issn = {1097-0363}, 21154 year = {2010} 21155} 21156 21157@Article{ anderson1965, 21158 title = {Iterative procedures for nonlinear integral equations}, 21159 author = {Donald G Anderson}, 21160 journal = {Journal of the ACM (JACM)}, 21161 volume = {12}, 21162 number = {4}, 21163 pages = {547--560}, 21164 year = {1965}, 21165 publisher = {ACM} 21166} 21167 21168@Article{ ptak1966, 21169 title = {Some metric aspects of the open mapping and closed graph theorems}, 21170 author = {Vlastimil Pt{\'a}k}, 21171 journal = {Mathematische Annalen}, 21172 volume = {163}, 21173 number = {2}, 21174 pages = {95--104}, 21175 year = {1966}, 21176 publisher = {Springer} 21177} 21178 21179@Article{ ptak1974, 21180 title = {A quantitative refinement of the closed graph theorem}, 21181 author = {Vlastimil Pt{\'a}k}, 21182 journal = {Czechoslovak Mathematical Journal}, 21183 volume = {24}, 21184 number = {3}, 21185 pages = {503--506}, 21186 year = {1974}, 21187 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 21188} 21189 21190@Article{ ptak1975, 21191 title = {The rate of convergence of {Newton's} process}, 21192 author = {Vlastimil Pt{\'a}k}, 21193 journal = {Numerische Mathematik}, 21194 volume = {25}, 21195 number = {3}, 21196 pages = {279--285}, 21197 year = {1975}, 21198 publisher = {Springer} 21199} 21200 21201@Article{ ptak1976, 21202 title = {Nondiscrete mathematical induction and iterative existence proofs}, 21203 author = {Vlastimil Pt{\'a}k}, 21204 journal = {Linear algebra and its applications}, 21205 volume = {13}, 21206 number = {3}, 21207 pages = {223--238}, 21208 year = {1976}, 21209 publisher = {Elsevier} 21210} 21211 21212@Article{ ptak1977, 21213 title = {What should be a rate of convergence?}, 21214 author = {Vlastimil Pt{\'a}k}, 21215 journal = {RAIRO-Analyse num{\'e}rique}, 21216 volume = {11}, 21217 number = {3}, 21218 pages = {279--286}, 21219 year = {1977} 21220} 21221 21222@Article{ potraptak1980, 21223 title = {Sharp error bounds for {Newton's} process}, 21224 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 21225 journal = {Numerische Mathematik}, 21226 volume = {34}, 21227 number = {1}, 21228 pages = {63--72}, 21229 year = {1980}, 21230 publisher = {Springer} 21231} 21232 21233@Article{ liesen2014, 21234 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 21235 author = {J{\"o}rg Liesen}, 21236 journal = {IMA Journal of Numerical Analysis}, 21237 doi = {10.1093/imanum/drv037}, 21238 archiveprefix = {arXiv}, 21239 eprint = {1405.2683}, 21240 primaryclass = {math-na}, 21241 year = {2015} 21242} 21243 21244@Book{ traub1964, 21245 title = {Iterative Methods for the Solution of Equations}, 21246 author = {Joseph F Traub}, 21247 year = {1964}, 21248 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 21249} 21250 21251@InProceedings{ shalfvecpar2010, 21252 title = {Exascale Computing Technology Challenges}, 21253 author = {John Shalf and Sudip Dosanjh and John Morrison}, 21254 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 21255 pages = {1–-25}, 21256 year = {2010} 21257} 21258 21259@Article{ frechet1907, 21260 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 21261 author = {Maurice Ren\'e Fr\'echet}, 21262 journal = {C. R. Acad. Sci. Paris}, 21263 volume = {144}, 21264 pages = {1414--1416}, 21265 year = {1907} 21266} 21267 21268@Article{ riesz1907, 21269 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 21270 author = {Frigyes Riesz}, 21271 journal = {C. R. Acad. Sci. Paris}, 21272 volume = {144}, 21273 pages = {1409--1411}, 21274 year = {1907} 21275} 21276 21277@Article{ riesz1909, 21278 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 21279 author = {Frigyes Riesz}, 21280 journal = {C. R. Acad. Sci. Paris}, 21281 volume = {149}, 21282 pages = {974--977}, 21283 year = {1909} 21284} 21285 21286@Misc{ rieszmarkovkakutanirepresentationtheorem, 21287 author = {Wikipedia}, 21288 title = {Riesz-Markov-Kakutani Representation Theorem}, 21289 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 21290 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 21291 year = {2015} 21292} 21293 21294@Article{ markov1938, 21295 title = {On mean values and exterior densities}, 21296 author = {Andrey Markov}, 21297 journal = {Rec. Math. Moscou}, 21298 volume = {4}, 21299 pages = {165--190}, 21300 year = {1938} 21301} 21302 21303@Article{ kakutani1941, 21304 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 21305 space of continuous functions.)}, 21306 author = {Shizuo Kakutani}, 21307 journal = {Ann. of Math.}, 21308 volume = {2}, 21309 number = {42}, 21310 pages = {994--1024}, 21311 doi = {10.2307/1968778}, 21312 year = {1941} 21313} 21314 21315@Article{ michoskimeyersonisaacwaelbroeck2014, 21316 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 21317 tokamaks}, 21318 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 21319 journal = {Journal of Computational Physics}, 21320 volume = {274}, 21321 pages = {898--919}, 21322 year = {2014}, 21323 publisher = {Elsevier} 21324} 21325 21326@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 21327 title = {Extreme-scale AMR}, 21328 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 21329 Stadler and Tim Warburton and Lucas Wilcox}, 21330 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 21331 Computing, Networking, Storage and Analysis}, 21332 pages = {1--12}, 21333 year = {2010}, 21334 organization = {IEEE Computer Society}, 21335 doi = {10.1109/SC.2010.25} 21336} 21337 21338@InProceedings{ isaacbursteddeghattas2012, 21339 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 21340 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 21341 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 21342 International}, 21343 pages = {426--437}, 21344 year = {2012}, 21345 organization = {IEEE}, 21346 doi = {10.1109/IPDPS.2012.47} 21347} 21348 21349@Article{ isaacpetrastadlerghattas2015, 21350 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 21351 through inference to prediction for large-scale problems, with application to flow 21352 of the {Antarctic} ice sheet}, 21353 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 21354 journal = {Journal of Computational Physics}, 21355 volume = {296}, 21356 pages = {348--368}, 21357 year = {2015}, 21358 publisher = {Elsevier}, 21359 doi = {10.1016/j.jcp.2015.04.047} 21360} 21361 21362@Article{ isaacbursteddewilcoxghattas2015, 21363 title = {Recursive Algorithms for Distributed Forests of Octrees}, 21364 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 21365 journal = {SIAM Journal on Scientific Computing}, 21366 volume = {37}, 21367 number = {5}, 21368 pages = {C497-C531}, 21369 eprint = {1406.0089}, 21370 eprinttype = {arXiv}, 21371 year = {2015}, 21372 doi = {10.1137/140970963} 21373} 21374 21375@Article{ isaacstadlerghattas2015, 21376 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 21377 elements on nonconforming and anisotropic meshes, with application to ice sheet 21378 dynamics}, 21379 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 21380 journal = {SIAM Journal on Scientific Computing}, 21381 number = {6}, 21382 pages = {804--833}, 21383 volume = {37}, 21384 year = {2015}, 21385 doi = {10.1137/140974407} 21386} 21387 21388@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 21389 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 21390 earth's mantle}, 21391 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 21392 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 21393 Alessandro Curioni and Omar Ghattas}, 21394 booktitle = {Proceedings of the International Conference for High Performance Computing, 21395 Networking, Storage and Analysis}, 21396 pages = {5}, 21397 year = {2015}, 21398 organization = {ACM}, 21399 doi = {10.1145/2807591.2807675} 21400} 21401 21402@Article{ bunchhopcroft1974, 21403 title = {Triangular factorization and inversion by fast matrix multiplication}, 21404 author = {James R Bunch and John E Hopcroft}, 21405 journal = {Mathematics of Computation}, 21406 volume = {28}, 21407 number = {125}, 21408 pages = {231--236}, 21409 doi = {10.2307/2005828}, 21410 year = {1974} 21411} 21412 21413@Article{ nemirovsky1991, 21414 title = {On optimality of Krylov's information when solving linear operator equations}, 21415 author = {A.S Nemirovsky}, 21416 journal = {Journal of Complexity}, 21417 volume = {7}, 21418 number = {2}, 21419 pages = {121--130}, 21420 doi = {10.1016/0885-064X(91)90001-E}, 21421 year = {1991} 21422} 21423 21424@Misc{siamcseprize, 21425 author = {{PETSc Team}}, 21426 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21427 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21428 url = {https://www.siam.org/prizes/sponsored/cse.php}, 21429 year = {2015} 21430} 21431 21432@Article{ rathgeber2017, 21433 title = {Firedrake: automating the finite element method by composing abstractions}, 21434 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 21435 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 21436 Graham R and Kelly, Paul HJ}, 21437 archiveprefix = {arXiv}, 21438 journal = {ACM Transaction on Mathematical Software}, 21439 eprint = {1501.01809}, 21440 volume = {43}, 21441 issue = {3}, 21442 number = {24}, 21443 year = {2017}, 21444 url = {http://arxiv.org/abs/1501.01809} 21445} 21446 21447@Article{ kirby2006b, 21448 title = {Topological optimization of the evaluation of finite element matrices}, 21449 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 21450 journal = {SIAM Journal on Scientific Computing}, 21451 volume = {28}, 21452 number = {1}, 21453 pages = {224--240}, 21454 year = {2006}, 21455 publisher = {SIAM} 21456} 21457 21458@Article{ luporini2015, 21459 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 21460 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 21461 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 21462 Assembly}, 21463 journal = {ACM Trans. Archit. Code Optim.}, 21464 issue_date = {January 2015}, 21465 volume = {11}, 21466 number = {4}, 21467 month = jan, 21468 year = {2015}, 21469 issn = {1544-3566}, 21470 pages = {57:1--57:25}, 21471 articleno = {57}, 21472 numpages = {25}, 21473 doi = {10.1145/2687415}, 21474 acmid = {2687415}, 21475 publisher = {ACM}, 21476 address = {New York, NY, USA}, 21477 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 21478 optimizations} 21479} 21480 21481@Article{ markall2012, 21482 title = {Finite element assembly strategies on multi- and many-core architectures}, 21483 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 21484 C. D. and Sherwin, S. J.}, 21485 journal = {International Journal for Numerical Methods in Fluids}, 21486 year = {2013}, 21487 volume = {71}, 21488 pages = {80--97}, 21489 doi = {10.1002/fld.3648} 21490} 21491 21492@Article{ markall2010, 21493 title = {Towards generating optimised finite element solvers for GPUs from high-level 21494 specifications}, 21495 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 21496 journal = {Procedia Computer Science}, 21497 volume = {1}, 21498 number = {1}, 21499 pages = {1815--1823}, 21500 year = {2010}, 21501 note = {{ICCS} 2010}, 21502 doi = {10.1016/j.procs.2010.04.203} 21503} 21504 21505@Article{ longkirbywaanders2010, 21506 title = {Unified embedded parallel finite element computations via software-based 21507 Fr{\'e}chet differentiation}, 21508 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 21509 journal = {SIAM Journal on Scientific Computing}, 21510 volume = {32}, 21511 number = {6}, 21512 pages = {3323--3351}, 21513 year = {2010}, 21514 publisher = {SIAM} 21515} 21516 21517@Article{ kirby2010, 21518 title = {From functional analysis to iterative methods}, 21519 author = {Robert C Kirby}, 21520 journal = {SIAM review}, 21521 volume = {52}, 21522 number = {2}, 21523 pages = {269--293}, 21524 year = {2010}, 21525 publisher = {SIAM} 21526} 21527 21528@Article{ kirby2014, 21529 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 21530 author = {Robert C Kirby}, 21531 journal = {SIAM Journal on Scientific Computing}, 21532 volume = {36}, 21533 number = {2}, 21534 pages = {A846--A868}, 21535 year = {2014}, 21536 publisher = {SIAM} 21537} 21538 21539@Article{ kirby2011, 21540 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 21541 author = {Robert C Kirby}, 21542 journal = {Numerische Mathematik}, 21543 volume = {117}, 21544 number = {4}, 21545 pages = {631--652}, 21546 year = {2011}, 21547 publisher = {Springer} 21548} 21549 21550@Article{ arnoldfalkwinther2006, 21551 title = {Finite element exterior calculus, homological techniques, and applications}, 21552 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 21553 journal = {Acta numerica}, 21554 volume = {15}, 21555 pages = {1--155}, 21556 year = {2006}, 21557 publisher = {Cambridge Univ Press} 21558} 21559 21560@Article{ arnoldlogg2014, 21561 title = {Periodic table of the finite elements}, 21562 author = {Douglas Arnold and Anders Logg}, 21563 month = nov, 21564 journal = {SIAM News}, 21565 year = {2014} 21566} 21567 21568@Article{ janssonhoffmanjansson2012, 21569 title = {Framework for massively parallel adaptive finite element computational fluid 21570 dynamics on tetrahedral meshes}, 21571 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 21572 journal = {SIAM Journal on Scientific Computing}, 21573 volume = {34}, 21574 number = {1}, 21575 pages = {C24--C41}, 21576 year = {2012}, 21577 publisher = {SIAM} 21578} 21579 21580@Article{ rogneshamcottermcrae2013, 21581 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 21582 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 21583 journal = {Geoscientific Model Development}, 21584 volume = {6}, 21585 number = {6}, 21586 pages = {2099--2119}, 21587 year = {2013}, 21588 publisher = {Copernicus GmbH} 21589} 21590 21591@Book{ loggmardalwells2012, 21592 title = {Automated solution of differential equations by the finite element method: The 21593 {FEniCS} book}, 21594 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 21595 volume = {84}, 21596 year = {2012}, 21597 publisher = {Springer Science \& Business Media} 21598} 21599 21600@Article{ cotterkirby2014, 21601 title = {Mixed finite elements for global tide models}, 21602 author = {Colin J Cotter and Robert C Kirby}, 21603 archiveprefix = {arXiv}, 21604 journal = {Submitted}, 21605 eprint = {1410.0045}, 21606 year = {2014}, 21607 url = {http://arxiv.org/abs/1410.0045} 21608} 21609 21610@Article{ kirbykieu2015, 21611 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 21612 author = {Robert C Kirby and Thinh Tri Kieu}, 21613 journal = {Numerische Mathematik}, 21614 volume = {130}, 21615 number = {2}, 21616 pages = {257--291}, 21617 year = {2015}, 21618 publisher = {Springer} 21619} 21620 21621@Article{ brennankirby2015, 21622 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 21623 model}, 21624 author = {Brian Brennan and Robert C Kirby}, 21625 journal = {Submitted to Computers and Mathematics with Applications}, 21626 year = {2015} 21627} 21628 21629@Article{ howlekirbydillon2013, 21630 title = {Block preconditioners for coupled physics problems}, 21631 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 21632 journal = {SIAM Journal on Scientific Computing}, 21633 volume = {35}, 21634 number = {5}, 21635 pages = {S368--S385}, 21636 year = {2013}, 21637 publisher = {SIAM} 21638} 21639 21640@Book{ malekstrakos2014, 21641 title = {Preconditioning and the conjugate gradient method in the context of solving 21642 PDEs}, 21643 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 21644 volume = {1}, 21645 year = {2014}, 21646 publisher = {SIAM} 21647} 21648 21649@Article{ desturler1995, 21650 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 21651 distributed memory computers}, 21652 author = {E. de Sturler and H.A. van der Vorst}, 21653 journal = {Applied Numerical Mathematics}, 21654 volume = {18}, 21655 number = {4}, 21656 pages = {441--459}, 21657 year = {1995}, 21658 doi = {10.1016/0168-9274(95)00079-A} 21659} 21660 21661@Article{ velicmaymoresi2009, 21662 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 21663 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 21664 journal = {Journal of Mathematical Modelling and Algorithms}, 21665 volume = {8}, 21666 number = {3}, 21667 pages = {343--355}, 21668 year = {2009}, 21669 publisher = {Springer} 21670} 21671 21672@Article{ may2012, 21673 title = {Volume reconstruction of point cloud data sets derived from computational 21674 geodynamic simulations}, 21675 author = {May, DA}, 21676 journal = {Geochemistry, Geophysics, Geosystems}, 21677 volume = {13}, 21678 number = {5}, 21679 year = {2012}, 21680 publisher = {Wiley Online Library} 21681} 21682 21683@Article{ quenettehodkinson2010, 21684 title = {StgDomain--scalable parallel domain software components for particle-in-cell 21685 finite element methods}, 21686 author = {Quenette, Steve and Hodkinson, Luke}, 21687 journal = {Concurrency and Computation: Practice and Experience}, 21688 volume = {22}, 21689 number = {12}, 21690 pages = {1593--1603}, 21691 year = {2010}, 21692 publisher = {Wiley Online Library} 21693} 21694 21695@Book{ velic2005, 21696 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 21697 author = {Velic, Mirko}, 21698 year = {2005}, 21699 publisher = {Monash University} 21700} 21701 21702@Article{ velicknepleymay2016, 21703 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 21704 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 21705 note = {in preparation}, 21706 year = {2016} 21707} 21708 21709@Article{ traubwozniakowski1979, 21710 title = {Convergence and complexity of Newton iteration for operator equations}, 21711 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 21712 journal = {Journal of the ACM (JACM)}, 21713 volume = {26}, 21714 number = {2}, 21715 pages = {250--258}, 21716 year = {1979}, 21717 publisher = {ACM} 21718} 21719 21720@Article{ sterck2013, 21721 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 21722 author = {Hans De Sterck}, 21723 journal = {Numerical Linear Algebra with Applications}, 21724 volume = {20}, 21725 number = {3}, 21726 pages = {453--471}, 21727 year = {2013} 21728} 21729 21730@Article{ sterckwinlaw2015, 21731 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 21732 tensor approximation}, 21733 author = {Hans De Sterck and Manda Winlaw}, 21734 journal = {Numerical Linear Algebra with Applications}, 21735 volume = {22}, 21736 number = {3}, 21737 pages = {410--432}, 21738 year = {2015} 21739} 21740 21741@Article{ sterckhowse2015, 21742 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 21743 approximate {Tucker} tensor decompositions}, 21744 author = {Hans De Sterck and Alexander Howse}, 21745 journal = {SIAM Journal on Scientific Computing}, 21746 note = {submitted}, 21747 year = {2015} 21748} 21749 21750@Book{ ladevezesimmonds1999, 21751 title = {Nonlinear computational structural mechanics: {N}ew approaches and 21752 non-incremental methods of calculation}, 21753 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 21754 series = {{M}echanical {E}ngineering {S}eries}, 21755 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 21756 isbn = {9780387985947}, 21757 lccn = {98029990}, 21758 year = {1999}, 21759 publisher = {Springer} 21760} 21761 21762@InProceedings{ walkerwoodwardyang2010, 21763 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 21764 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 21765 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 21766 year = {2010} 21767} 21768 21769@Article{ lottwalkerwoodwardyang2012, 21770 title = {An accelerated {P}icard method for nonlinear systems related to variably 21771 saturated flow}, 21772 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 21773 journal = {Advances in Water Resources}, 21774 volume = {38}, 21775 number = {0}, 21776 pages = {92--101}, 21777 doi = {10.1016/j.advwatres.2011.12.013}, 21778 year = {2012} 21779} 21780 21781@TechReport{ mohrrude1998, 21782 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 21783 author = {Marcus Mohr and Ulrich R\"ude}, 21784 type = {Technical Report}, 21785 number = {394}, 21786 institution = {University of Augsburg}, 21787 year = {1998} 21788} 21789 21790@InProceedings{ mohr2000, 21791 title = {Low Communication Parallel Multigrid}, 21792 author = {Mohr, Marcus}, 21793 booktitle = {Euro-Par 2000 Parallel Processing}, 21794 pages = {806--814}, 21795 year = {2000}, 21796 organization = {Springer} 21797} 21798 21799@Article{ brandtdiskin1994, 21800 title = {Multigrid solvers on decomposed domains}, 21801 author = {Achi Brandt and Boris Diskin}, 21802 journal = {Contemporary Mathematics}, 21803 volume = {157}, 21804 year = {1994}, 21805 publisher = {AMERICAN MATHEMATICAL SOCIETY} 21806} 21807 21808@InProceedings{ prabhuetal2011, 21809 title = {A Survey of the Practice of Computational Science}, 21810 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 21811 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 21812 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 21813 David I.}, 21814 booktitle = {State of the Practice Reports}, 21815 series = {SC '11}, 21816 year = {2011}, 21817 isbn = {978-1-4503-1139-7}, 21818 location = {Seattle, Washington}, 21819 pages = {19:1--19:12}, 21820 articleno = {19}, 21821 numpages = {12}, 21822 doi = {10.1145/2063348.2063374}, 21823 acmid = {2063374}, 21824 publisher = {ACM}, 21825 address = {New York, NY, USA} 21826} 21827 21828@PhDThesis{ dinarthesis1979, 21829 title = {Fast methods for the numerical solution of boundary value problems}, 21830 author = {N. Dinar}, 21831 school = {Weizmann Institute of Science}, 21832 year = {1979} 21833} 21834 21835@Article{ thomasdiskinbrandt2001, 21836 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 21837 high Reynolds number wakes and boundary layers}, 21838 author = {James L Thomas and Boris Diskin and Achi Brandt}, 21839 journal = {Computers \& fluids}, 21840 volume = {30}, 21841 number = {7}, 21842 pages = {853--874}, 21843 year = {2001}, 21844 publisher = {Elsevier} 21845} 21846 21847@Article{ greenbaumptakstrakos1996, 21848 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 21849 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 21850 journal = {SIAM Journal on Matrix Analysis and Applications}, 21851 volume = {17}, 21852 number = {3}, 21853 pages = {465--469}, 21854 year = {1996}, 21855 publisher = {SIAM} 21856} 21857 21858@Article{ nangiapatankarbhalla2019, 21859 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 21860 density ratio multiphase flows}, 21861 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 21862 journal = {Journal of Computational Physics}, 21863 volume = {398}, 21864 pages = {108804}, 21865 year = {2019} 21866} 21867 21868@Article{ bhallanangiadafnakisbraccomattiazzo2019, 21869 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 21870 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 21871 library}, 21872 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 21873 Bracco and Giuliana Mattiazzo}, 21874 journal = {Applied Ocean Research}, 21875 note = {In press}, 21876 year = {2019} 21877} 21878 21879@Article{ bhallagriffithpatankardonev2013, 21880 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 21881 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 21882 Alexander Donev}, 21883 journal = {Journal of Chemical Physics}, 21884 volume = {139}, 21885 number = {21}, 21886 pages = {214112}, 21887 year = {2013} 21888} 21889 21890@Article{ bhallabalegriffithpatankar2014, 21891 title = {Fully resolved immersed electrohydrodynamics for particle motion, 21892 electrolocation, and self-propulsion}, 21893 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 21894 Patankar}, 21895 journal = {Journal of Computational Physics}, 21896 volume = {256}, 21897 pages = {88--108}, 21898 year = {2014} 21899} 21900 21901@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 21902 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 21903 multiblob approach}, 21904 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 21905 and Boyce E. Griffith and Alexander Donev}, 21906 journal = {Communications in Applied Mathematics and Computational Science}, 21907 volume = {11}, 21908 number = {2}, 21909 pages = {217--296}, 21910 year = {2016} 21911} 21912 21913@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 21914 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 21915 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 21916 P.J. Kahrilas and Neelesh A. Patankar}, 21917 journal = {Journal of Computational Physics}, 21918 volume = {298}, 21919 pages = {446--465}, 21920 year = {2015} 21921} 21922 21923@Article{ balenevelnbhallamaciverpatankar2015, 21924 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 21925 and vertebrates}, 21926 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 21927 A. Patankar}, 21928 journal = {PLoS Biology}, 21929 volume = {13}, 21930 number = {4}, 21931 pages = {1--22}, 21932 year = {2015} 21933} 21934 21935@Article{ balehaobhallapatankar2014, 21936 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 21937 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 21938 journal = {Proceedings of the National Academy of Sciences}, 21939 volume = {111}, 21940 number = {21}, 21941 pages = {7517--7521}, 21942 year = {2014} 21943} 21944 21945@Article{ bhallabalegriffithpatankar2013, 21946 title = {A unified mathematical framework and an adaptive numerical method for 21947 fluid--structure interaction with rigid, deforming, and elastic bodies}, 21948 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 21949 Patankar}, 21950 journal = {Journal of Computational Physics}, 21951 volume = {250}, 21952 pages = {446--476}, 21953 year = {2013}, 21954 publisher = {Elsevier} 21955} 21956 21957@Article{ takeikatz2013, 21958 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 21959 Governing equations and linearized analysis}, 21960 author = {Yasuko Takei and Richard F. Katz}, 21961 journal = {Journal of Fluid Mechanics}, 21962 volume = {734}, 21963 issn = {1469-7645}, 21964 pages = {424--455}, 21965 numpages = {32}, 21966 doi = {10.1017/jfm.2013.482}, 21967 month = nov, 21968 year = {2013} 21969} 21970 21971@Misc{ stewart2011, 21972 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 21973 author = {G. W. Stewart}, 21974 note = {Translated with commentary by G. W. Stewart}, 21975 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 21976 year = {2011} 21977} 21978 21979@Article{ douglisnirenberg1955, 21980 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 21981 author = {Avron Douglis and Louis Nirenberg}, 21982 journal = {Communications on Pure and Applied Mathematics}, 21983 volume = {8}, 21984 pages = {503--538}, 21985 year = {1955} 21986} 21987 21988@Article{ gorelickgalunsharonbasribrandt2006, 21989 title = {Shape Representation and Classification Using the Poisson Equation}, 21990 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 21991 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 21992 volume = {28}, 21993 number = {12}, 21994 pages = {1991--2005}, 21995 year = {2006} 21996} 21997 21998@Article{ salsbury2006, 21999 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 22000 solvation energies}, 22001 author = {Freddie R. Salsbury Jr.}, 22002 journal = {Molecular Physics}, 22003 volume = {104}, 22004 number = {08}, 22005 pages = {1299--1309}, 22006 year = {2006} 22007} 22008 22009@Article{ sigalov2006, 22010 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 22011 approximation}, 22012 author = {G. Sigalov and A. Fenley and A. Onufriev}, 22013 journal = {Journal of Chemical Physics}, 22014 volume = {124}, 22015 number = {124902}, 22016 year = {2006} 22017} 22018 22019@Article{ dennard1974, 22020 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 22021 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 22022 Andre R LeBlanc}, 22023 journal = {IEEE Journal of Solid-State Circuits}, 22024 volume = {9}, 22025 number = {5}, 22026 pages = {256--268}, 22027 year = {1974} 22028} 22029 22030@Article{ zeegeijn2015, 22031 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 22032 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 22033 journal = {ACM Transactions on Mathematical Software}, 22034 volume = {41}, 22035 number = {3}, 22036 pages = {14:1--14:33}, 22037 month = jun, 22038 year = {2015}, 22039 issue_date = {jun}, 22040 doi = {10.1145/2764454} 22041} 22042 22043@Article{ campbell1976, 22044 title = {Assessing the Impact of Planned Social Change}, 22045 author = {Donald T. Campbell}, 22046 journal = {Occasional Paper Series, The Public Affairs Center}, 22047 number = {8}, 22048 publisher = {Dartmouth College}, 22049 year = {1976} 22050} 22051 22052@Article{ smaldinomcelreath2016, 22053 title = {The natural selection of bad science}, 22054 author = {Paul E. Smaldino and Richard McElreath}, 22055 journal = {Royal Society Open Science}, 22056 volume = {3}, 22057 number = {9}, 22058 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 22059 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 22060 doi = {10.1098/rsos.160384}, 22061 year = {2016}, 22062 publisher = {The Royal Society} 22063} 22064 22065@Article{ harlowwelch1965, 22066 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 22067 free surface}, 22068 author = {Francis H Harlow and J Eddie Welch}, 22069 journal = {Physics of fluids}, 22070 volume = {8}, 22071 number = {12}, 22072 pages = {2182--2189}, 22073 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 22074 year = {1965} 22075} 22076 22077@Article{ diskinthomasmineck2005, 22078 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 22079 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 22080 journal = {SIAM Journal on Scientific Computing}, 22081 volume = {27}, 22082 number = {1}, 22083 pages = {108--129}, 22084 doi = {10.1137/030601521}, 22085 issn = {1064-8275}, 22086 year = {2005} 22087} 22088 22089@TechReport{ scott2012, 22090 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 22091 Computer Science}, 22092 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 22093 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 22094 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 22095 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 22096 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 22097 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 22098 Yuen}, 22099 institution = {University of Chicago}, 22100 number = {2012-02}, 22101 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 22102 year = {2012} 22103} 22104 22105@Article{ roth2010, 22106 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 22107 author = {Roland Roth}, 22108 journal = {J. Phys. Cond. Mat.}, 22109 volume = {22}, 22110 pages = {063102}, 22111 year = {2010} 22112} 22113 22114@Article{ wu2008, 22115 title = {Density functional theory for liquid structure and thermodynamics}, 22116 author = {J. Z. Wu}, 22117 journal = {Struct. Bond.}, 22118 doi = {10.1007/430_2008_3}, 22119 year = {2008} 22120} 22121 22122@Article{ goel2008, 22123 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 22124 by {Monte Carlo} simulations and density functional theory}, 22125 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 22126 journal = {J. Chem. Phys.}, 22127 volume = {129}, 22128 pages = {154707}, 22129 year = {2008} 22130} 22131 22132@Article{ marchxiaoyubiros2015, 22133 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 22134 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 22135 journal = {SIAM Journal on Scientific Computing (to appear)}, 22136 year = {2015} 22137} 22138 22139@InProceedings{ yangduraiswamigumerovdavis2003, 22140 title = {Improved fast gauss transform and efficient kernel density estimation}, 22141 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 22142 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 22143 pages = {664--671}, 22144 year = {2003}, 22145 organization = {IEEE} 22146} 22147 22148@Article{ fornberglarssonflyer2011, 22149 title = {Stable computations with Gaussian radial basis functions}, 22150 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 22151 journal = {SIAM Journal on Scientific Computing}, 22152 volume = {33}, 22153 number = {2}, 22154 pages = {869--892}, 22155 year = {2011}, 22156 publisher = {SIAM} 22157} 22158 22159@InProceedings{ srinivasanqiduraiswami2010, 22160 title = {GPUML: Graphical processors for speeding up kernel machines}, 22161 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 22162 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 22163 Implementations, and Applications}, 22164 year = {2010} 22165} 22166 22167@Article{ jadamecbillen2010, 22168 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 22169 a slab edge}, 22170 author = {Margarete A Jadamec and Magali I Billen}, 22171 journal = {Nature}, 22172 volume = {465}, 22173 number = {7296}, 22174 pages = {338--341}, 22175 year = {2010} 22176} 22177 22178@Article{ jadamecbillen2012, 22179 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 22180 numerical models of the Alaska slab edge}, 22181 author = {Margarete A Jadamec and Magali I Billen}, 22182 journal = {Journal of Geophysical Research: Solid Earth}, 22183 volume = {117}, 22184 number = {B2}, 22185 year = {2012} 22186} 22187 22188@Article{ jadamec2015, 22189 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 22190 author = {Margarete A Jadamec}, 22191 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 22192 volume = {211}, 22193 pages = {135}, 22194 year = {2015} 22195} 22196 22197@Article{ durancejadamecfalloonnicholls2012, 22198 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 22199 olivine-hosted melt inclusions and geochemical modelling with insights from 22200 geodynamic models}, 22201 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 22202 journal = {Australian Journal of Earth Sciences}, 22203 volume = {59}, 22204 number = {6}, 22205 pages = {913--931}, 22206 year = {2012} 22207} 22208 22209@Article{ sharplesmoresijadamecrevote2015, 22210 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 22211 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 22212 journal = {Journal of Geophysical Research: Solid Earth}, 22213 volume = {120}, 22214 number = {6}, 22215 pages = {4379--4404}, 22216 year = {2015} 22217} 22218 22219@Article{ hayniejadamec2017, 22220 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 22221 geodynamic models}, 22222 author = {Kirstie L Haynie and Margarete A Jadamec}, 22223 journal = {Tectonics}, 22224 note = {in review}, 22225 year = {2017} 22226} 22227 22228@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 22229 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 22230 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 22231 Lithgow-Bertelloni and Wenbo Xu}, 22232 journal = {Geophysical Journal International}, 22233 volume = {179}, 22234 number = {2}, 22235 pages = {1169--1185}, 22236 year = {2009} 22237} 22238 22239@Article{ zhong2006, 22240 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 22241 plume excess temperature, and upper mantle temperature}, 22242 author = {Shijie Zhong}, 22243 journal = {Journal of Geophysical Research: Solid Earth}, 22244 volume = {111}, 22245 number = {B4}, 22246 year = {2006} 22247} 22248 22249@Article{ billenhirth2007, 22250 title = {Rheologic controls on slab dynamics}, 22251 author = {Magali I Billen and Greg Hirth}, 22252 journal = {Geochemistry, Geophysics, Geosystems}, 22253 volume = {8}, 22254 number = {8}, 22255 year = {2007} 22256} 22257 22258@Article{ hirthkohlstedt2003, 22259 title = {Rheology of the upper mantle and the mantle wedge: A view from the 22260 experimentalists}, 22261 author = {Greg Hirth and David Kohlstedt}, 22262 journal = {Inside the subduction Factory}, 22263 pages = {83--105}, 22264 year = {2003} 22265} 22266 22267@Article{ longsilver2008, 22268 title = {The subduction zone flow field from seismic anisotropy: A global view}, 22269 author = {Maureen D Long and Paul G Silver}, 22270 journal = {science}, 22271 volume = {319}, 22272 number = {5861}, 22273 pages = {315--318}, 22274 year = {2008} 22275} 22276 22277@Article{ karatowu1993, 22278 title = {Rheology of the upper mantle: A synthesis}, 22279 author = {Shun-ichiro Karato and Patrick Wu}, 22280 journal = {Science}, 22281 volume = {260}, 22282 number = {5109}, 22283 pages = {771--778}, 22284 year = {1993} 22285} 22286 22287@Article{ long2013mantle, 22288 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 22289 for wedge processes}, 22290 author = {Long, Maureen D and Wirth, Erin A}, 22291 journal = {Journal of Geophysical Research: Solid Earth}, 22292 volume = {118}, 22293 number = {2}, 22294 pages = {583--606}, 22295 year = {2013}, 22296 publisher = {Wiley Online Library} 22297} 22298 22299@Article{ hoernle2008arc, 22300 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 22301 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 22302 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 22303 Alvarado, Guillermo and Protti, Marino and others}, 22304 journal = {Nature}, 22305 volume = {451}, 22306 number = {7182}, 22307 pages = {1094--1097}, 22308 year = {2008}, 22309 publisher = {Nature Publishing Group} 22310} 22311 22312@Article{ savage1999, 22313 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 22314 splitting?}, 22315 author = {MK Savage}, 22316 journal = {Reviews of Geophysics}, 22317 volume = {37}, 22318 number = {1}, 22319 pages = {65--106}, 22320 year = {1999} 22321} 22322 22323@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 22324 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 22325 of airborne contaminants}, 22326 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 22327 Omar Ghattas and Bart Van Bloemen Waanders}, 22328 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 22329 pages = {43}, 22330 year = {2005}, 22331 organization = {IEEE Computer Society} 22332} 22333 22334@Article{ draganescusoane2013, 22335 title = {Multigrid solution of a distributed optimal control problem constrained by the 22336 {Stokes} equations}, 22337 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 22338 journal = {Applied Mathematics and Computation}, 22339 volume = {219}, 22340 number = {10}, 22341 pages = {5622--5634}, 22342 year = {2013} 22343} 22344 22345@Article{ zhonggurnis1995, 22346 title = {Mantle convection with plates and mobile, faulted plate margins}, 22347 author = {Shijie Zhong and Michael Gurnis}, 22348 journal = {Science}, 22349 volume = {267}, 22350 number = {5199}, 22351 pages = {838}, 22352 year = {1995} 22353} 22354 22355@Article{ studerbobinchahidmousavicandesdahan2012, 22356 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 22357 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 22358 and Emmanuel Candes and Maxime Dahan}, 22359 journal = {Proceedings of the National Academy of Sciences}, 22360 volume = {109}, 22361 number = {26}, 22362 pages = {E1679--E1687}, 22363 year = {2012} 22364} 22365 22366@Article{ borsukhigdonstowreckhow2001, 22367 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 22368 matter loading in estuaries and coastal zones}, 22369 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 22370 journal = {Ecological Modelling}, 22371 volume = {143}, 22372 number = {3}, 22373 pages = {165--181}, 22374 year = {2001} 22375} 22376 22377@Article{ liebermanwillcox2012, 22378 title = {Goal-oriented inference: Approach, linear theory, and application to advection 22379 diffusion}, 22380 author = {Chad Lieberman and Karen Willcox}, 22381 journal = {SIAM Journal on Scientific Computing}, 22382 volume = {34}, 22383 number = {4}, 22384 pages = {A1880--A1904}, 22385 year = {2012} 22386} 22387 22388@Article{ chaillatbiros2012, 22389 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 22390 frequencies and multiple sources for the scalar {Helmholtz} equation}, 22391 author = {St{\'e}phanie Chaillat and George Biros}, 22392 journal = {Journal of Computational Physics}, 22393 volume = {231}, 22394 number = {12}, 22395 pages = {4403--4421}, 22396 year = {2012} 22397} 22398 22399@Article{ farhattezaurdjellouli2002, 22400 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 22401 problems by a regularized {Newton} method}, 22402 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 22403 journal = {Inverse problems}, 22404 volume = {18}, 22405 number = {5}, 22406 pages = {1229}, 22407 year = {2002} 22408} 22409 22410@Article{ orozcoghattas1992, 22411 title = {Massively parallel aerodynamic shape optimization}, 22412 author = {Orozco, Carlos E and Ghattas, ON}, 22413 journal = {Computing Systems in Engineering}, 22414 volume = {3}, 22415 number = {1-4}, 22416 pages = {311--320}, 22417 year = {1992} 22418} 22419 22420@Article{ reutheralonsorimlingerjameson1999, 22421 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 22422 adjoint formulation on distributed memory parallel computers}, 22423 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 22424 journal = {Computers \& fluids}, 22425 volume = {28}, 22426 number = {4}, 22427 pages = {675--700}, 22428 year = {1999} 22429} 22430 22431@Article{ rudistadlerghattas2016, 22432 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 22433 Heterogeneous Viscosity}, 22434 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 22435 journal = {ArXiv e-prints}, 22436 archiveprefix = {arXiv}, 22437 primaryclass = {math.NA}, 22438 eprint = {1607.03936}, 22439 month = jul, 22440 year = {2016} 22441} 22442 22443@Article{ borzikunisch2006, 22444 title = {A globalization strategy for the multigrid solution of elliptic optimal control 22445 problems}, 22446 author = {Borzi, A and Kunisch, K}, 22447 journal = {Optimisation Methods and Software}, 22448 volume = {21}, 22449 number = {3}, 22450 pages = {445--459}, 22451 year = {2006} 22452} 22453 22454@Article{ nash2000, 22455 title = {A multigrid approach to discretized optimization problems}, 22456 author = {Stephen G Nash}, 22457 journal = {Optimization Methods and Software}, 22458 volume = {14}, 22459 number = {1-2}, 22460 pages = {99--116}, 22461 year = {2000} 22462} 22463 22464@Article{ jameson1983, 22465 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 22466 method}, 22467 author = {Antony Jameson}, 22468 journal = {Applied mathematics and computation}, 22469 volume = {13}, 22470 number = {3-4}, 22471 pages = {327--355}, 22472 year = {1983} 22473} 22474 22475@Article{ billen2008, 22476 title = {Modeling the dynamics of subducting slabs}, 22477 author = {Magali I Billen}, 22478 journal = {Annu. Rev. Earth Planet. Sci.}, 22479 volume = {36}, 22480 pages = {325--356}, 22481 year = {2008} 22482} 22483 22484@Article{ gerya2011, 22485 title = {Future directions in subduction modeling}, 22486 author = {Taras Gerya}, 22487 journal = {Journal of Geodynamics}, 22488 volume = {52}, 22489 number = {5}, 22490 pages = {344--378}, 22491 year = {2011} 22492} 22493 22494@Article{ tackley2000, 22495 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 22496 theory}, 22497 author = {Paul J Tackley}, 22498 journal = {Science}, 22499 volume = {288}, 22500 number = {5473}, 22501 pages = {2002--2007}, 22502 year = {2000} 22503} 22504 22505@Article{ caseydewey1984, 22506 title = {Initiation of subduction zones along transform and accreting plate boundaries, 22507 triple-junction evolution, and forearc spreading centres—implications for 22508 ophiolitic geology and obduction}, 22509 author = {JF Casey and JF Dewey}, 22510 journal = {Geological Society, London, Special Publications}, 22511 volume = {13}, 22512 number = {1}, 22513 pages = {269--290}, 22514 year = {1984} 22515} 22516 22517@Article{ doughertyclayton2014, 22518 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 22519 in the {South Cocos} plate}, 22520 author = {Sara L Dougherty and Robert W Clayton}, 22521 journal = {Journal of Geophysical Research: Solid Earth}, 22522 volume = {119}, 22523 number = {4}, 22524 pages = {3424--3447}, 22525 year = {2014} 22526} 22527 22528@Article{ syracusemaceiraprietozhangammon2016, 22529 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 22530 velocity from the joint inversion of seismic and gravity data}, 22531 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 22532 Charles J Ammon}, 22533 journal = {Earth and Planetary Science Letters}, 22534 volume = {444}, 22535 pages = {139--149}, 22536 year = {2016} 22537} 22538 22539@Article{ bowergurnisflament2015, 22540 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 22541 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 22542 journal = {Physics of the Earth and Planetary Interiors}, 22543 volume = {238}, 22544 pages = {8--22}, 22545 year = {2015} 22546} 22547 22548@Book{ ciarlet1976, 22549 title = {Numerical analysis of the finite element method}, 22550 author = {Philippe G Ciarlet}, 22551 volume = {59}, 22552 year = {1976}, 22553 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 22554} 22555 22556@InProceedings{ liumellorcrummey2013, 22557 title = {A data-centric profiler for parallel programs}, 22558 author = {Xu Liu and John Mellor-Crummey}, 22559 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 22560 Storage and Analysis (SC)}, 22561 pages = {1--12}, 22562 year = {2013}, 22563 organization = {IEEE} 22564} 22565 22566@InCollection{ ernstgander2012, 22567 title = {Why it is difficult to solve Helmholtz problems with classical iterative 22568 methods}, 22569 author = {Oliver G Ernst and Martin J Gander}, 22570 booktitle = {Numerical analysis of multiscale problems}, 22571 pages = {325--363}, 22572 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 22573 year = {2012} 22574} 22575 22576@Article{ warburtonkarniadakis1999, 22577 title = {A discontinuous {G}alerkin method for the viscous {MHD} equations}, 22578 author = {Timothy C Warburton and George E Karniadakis}, 22579 journal = {Journal of Computational Physics}, 22580 volume = {152}, 22581 number = {2}, 22582 pages = {608--641}, 22583 year = {1999} 22584} 22585 22586@Article{ salahsoulaimanihabashi2001, 22587 title = {A finite element method for magnetohydrodynamics}, 22588 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 22589 journal = {Computer Methods in Applied Mechanics and Engineering}, 22590 volume = {43}, 22591 number = {190}, 22592 pages = {5867--5892}, 22593 year = {2001} 22594} 22595 22596@Article{ nesliturktezersezgin2005, 22597 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 22598 author = {Ali I Nesliturk and M Tezer-Sezgin}, 22599 journal = {Computer methods in applied mechanics and engineering}, 22600 volume = {194}, 22601 number = {9}, 22602 pages = {1201--1224}, 22603 year = {2005} 22604} 22605 22606@Article{ strakschellart2016, 22607 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 22608 Upwellings: Insights from Analog Models}, 22609 author = {Vincent Strak and Wouter P Schellart}, 22610 journal = {Journal of Geophysical Research: Solid Earth}, 22611 year = {2016} 22612} 22613 22614@InBook{ kirbyloggrognesterrel2012, 22615 title = {Common and unusual finite elements}, 22616 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 22617 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22618 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22619 {FEniCS} Book}, 22620 publisher = {Springer Berlin Heidelberg}, 22621 address = {Berlin, Heidelberg}, 22622 pages = {95--119}, 22623 isbn = {978-3-642-23099-8}, 22624 doi = {10.1007/978-3-642-23099-8_3}, 22625 year = {2012} 22626} 22627 22628@InBook{ kirbymardal2012, 22629 author = {Robert C. Kirby and Kent-Andre Mardal}, 22630 title = {Constructing general reference finite elements}, 22631 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22632 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22633 {FEniCS} Book}, 22634 publisher = {Springer Berlin Heidelberg}, 22635 address = {Berlin, Heidelberg}, 22636 pages = {121--132}, 22637 isbn = {978-3-642-23099-8}, 22638 doi = {10.1007/978-3-642-23099-8_4}, 22639 year = {2012} 22640} 22641 22642@Book{ wriggers2008, 22643 title = {Nonlinear finite element methods}, 22644 author = {Peter Wriggers}, 22645 publisher = {Springer Science \& Business Media}, 22646 year = {2008} 22647} 22648 22649@Book{ zienkiewicztaylor1977, 22650 title = {The finite element method}, 22651 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 22652 publisher = {McGraw-hill London}, 22653 volume = {3}, 22654 year = {1977} 22655} 22656 22657@Article{ rogneskirbylogg2009, 22658 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 22659 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 22660 journal = {SIAM Journal on Scientific Computing}, 22661 volume = {31}, 22662 number = {6}, 22663 pages = {4130--4151}, 22664 year = {2009} 22665} 22666 22667@Book{ kelley03, 22668 title = {Solving nonlinear equations with Newton's method}, 22669 author = {Carl T. Kelley}, 22670 publisher = {SIAM}, 22671 year = {2003} 22672} 22673 22674@Article{ turing1937, 22675 title = {The Chemical Basis of Morphogenesis}, 22676 author = {A. M. Turing}, 22677 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 22678 volume = {237}, 22679 number = {641}, 22680 pages = {37--72}, 22681 doi = {10.1098/rstb.1952.0012}, 22682 issn = {0080-4622}, 22683 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 22684 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 22685 year = {1952} 22686} 22687 22688@Article{ fabienknepleymillsriviere2017, 22689 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 22690 multigrid method}, 22691 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 22692 Rivi\`ere}, 22693 journal = {SIAM Journal on Scientific Computing}, 22694 url = {https://arxiv.org/abs/1705.09907}, 22695 volume = {41}, 22696 number = {2}, 22697 pages = {C73--C96}, 22698 doi = {10.1137/17M1128903}, 22699 year = {2018} 22700} 22701 22702@Article{ fabienknepleyriviere2018, 22703 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 22704 porous media}, 22705 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 22706 journal = {International Journal for Numerical Methods in Engineering}, 22707 volume = {116}, 22708 number = {3}, 22709 pages = {161--177}, 22710 doi = {10.1002/nme.5919}, 22711 year = {2018} 22712} 22713 22714@Article{ fabienknepleyriviere2020, 22715 title = {A high order hybridizable discontinuous Galerkin method for incompressible 22716 miscible displacement in heterogeneous media}, 22717 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22718 journal = {Results in Applied Mathematics}, 22719 url = {https://arxiv.org/abs/1809.00747}, 22720 volume = {8}, 22721 pages = {100089}, 22722 doi = {10.1016/j.rinam.2019.100089}, 22723 year = {2020} 22724} 22725 22726@Article{ fabienknepleyriviere2019b, 22727 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 22728 second order elliptic problems}, 22729 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22730 journal = {Journal of Numerical Mathematics}, 22731 volume = {28}, 22732 number = {3}, 22733 pages = {161--174}, 22734 doi = {10.1515/jnma-2019-0027}, 22735 year = {2019} 22736} 22737 22738@Article{ fabien2019, 22739 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 22740 Elasticity}, 22741 author = {Maurice S. Fabien}, 22742 journal = {Communications in Computational Physics}, 22743 volume = {27}, 22744 number = {2}, 22745 pages = {513--545}, 22746 issn = {1991-7120}, 22747 doi = {10.4208/cicp.OA-2018-0235}, 22748 year = {2019} 22749} 22750 22751@Unpublished{ awanoufabienguzmanstern2020, 22752 title = {Hybridization and postprocessing in finite element exterior calculus}, 22753 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 22754 eprint = {2008.00149}, 22755 note = {preprint}, 22756 primaryclass = {math.NA}, 22757 year = {2020} 22758} 22759 22760@Article{ fabienguzmanneilanzytoon2022, 22761 title = {Low-order divergence-free approximations for the Stokes problem on Worsey--Farin and Powell--Sabin splits}, 22762 author = {Maurice Fabien and Johnny Guzm{\'a}n and Michael Neilan and Ahmed Zytoon}, 22763 journal = {Computer Methods in Applied Mechanics and Engineering}, 22764 volume = {390}, 22765 pages = {114444}, 22766 year = {2022}, 22767} 22768 22769@Article{ chaabanegiraultrivierethompson2018, 22770 title = {A stable enriched {G}alerkin element for the {S}tokes problem}, 22771 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 22772 journal = {Applied Numerical Mathematics}, 22773 volume = {132}, 22774 pages = {1--21}, 22775 issn = {0168-9274}, 22776 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 22777 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 22778 year = {2018} 22779} 22780 22781@Article{ thompsonriviereknepley2018, 22782 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 22783 Resuscitation In The Small Intestine}, 22784 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 22785 journal = {Mathematical Medicine and Biology}, 22786 volume = {36}, 22787 number = {4}, 22788 pages = {513--548}, 22789 doi = {10.1093/imammb/dqz00}, 22790 year = {2019} 22791} 22792 22793@Article{ kevrekidisthompsongoriely2020, 22794 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 22795 Diseases}, 22796 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 22797 journal = {Physics Letters A}, 22798 volume = {384}, 22799 number = {36}, 22800 pages = {126935}, 22801 year = {2020} 22802} 22803 22804@Article{ mardalrognesthompson2021, 22805 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 22806 {Stokes-Biot} Stability Revisited}, 22807 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 22808 journal = {BIT Numerical Mathematics}, 22809 pages = {1--36}, 22810 year = {2021} 22811} 22812 22813@Article{ piersantileethompsonmardalrognes2021, 22814 title = {Parameter robust preconditioning by congruence for multiple-network 22815 poroelasticity}, 22816 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 22817 Rognes, Marie E}, 22818 journal = {SIAM Journal on Scientific Computing}, 22819 volume = {43}, 22820 number = {4}, 22821 pages = {B984--B1007}, 22822 year = {2021}, 22823 publisher = {SIAM} 22824} 22825 22826@Article{ walkerknepleyaagaardwilliams2023, 22827 title = {Multiphysics Modeling in {PyLith}: Poroelasticity}, 22828 author = {Robert L. Walker and Matthew G. Knepley and Brad T. Aagaard and Charles A. Williams}, 22829 journal = {Geophysical Journal International}, 22830 volume = {235}, 22831 number = {3}, 22832 pages = {2442--2475}, 22833 doi = {10.1093/gji/ggad370}, 22834 year = {2023} 22835} 22836 22837@InProceedings{ actorfuentesriviere2020b, 22838 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 22839 Level Set Equation and Deep Learning for Image Segmentation}, 22840 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22841 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 22842 year = {2020} 22843} 22844 22845@Article{ actorfuentesriviere2020, 22846 title = {Robust Regularized Networks in the Presence of Noise}, 22847 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22848 journal = {Medical Image Analysis}, 22849 note = {In revision}, 22850 year = {2020} 22851} 22852 22853@Book{ byerly1893, 22854 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 22855 ellipsoidal harmonics, with applications to problems in mathematical physics}, 22856 author = {William Elwood Byerly}, 22857 publisher = {Dover}, 22858 year = {1893} 22859} 22860 22861@Book{ hobson1931, 22862 title = {The theory of spherical and ellipsoidal harmonics}, 22863 author = {Ernest William Hobson}, 22864 year = {1931}, 22865 publisher = {CUP Archive} 22866} 22867 22868@Book{ dassios2012, 22869 title = {Ellipsoidal harmonics: theory and applications}, 22870 author = {George Dassios}, 22871 volume = {146}, 22872 year = {2012}, 22873 publisher = {Cambridge University Press} 22874} 22875 22876@Book{ miller1977, 22877 title = {Symmetry and separation of variables}, 22878 author = {Miller, Jr, Willard}, 22879 year = {1977}, 22880 address = {Reading, MA}, 22881 publisher = {Addison-Wesley Publishing Co., Inc.} 22882} 22883 22884@TechReport{ epanet-users-manual, 22885 author = {Lewis A. Rossman}, 22886 title = {{EPANET 2} Users Manual}, 22887 institution = {Water Supply and Water Resources Division, National Risk Management Research 22888 Laboratory, Cincinnati, OH 45268}, 22889 year = {2000} 22890} 22891 22892@Article{ klocknerbarnettgreengardoneil2013, 22893 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 22894 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 22895 O'Neil}, 22896 journal = {Journal of Computational Physics}, 22897 volume = {252}, 22898 pages = {332--349}, 22899 year = {2013} 22900} 22901 22902@Article{ turcksinkronbichlerbangerth2016, 22903 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 22904 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 22905 journal = {ACM Transactions on Mathematical Software)}, 22906 volume = {43}, 22907 number = {1}, 22908 pages = {2}, 22909 year = {2016} 22910} 22911 22912@Article{ vitushkin1954, 22913 title = {On {Hilbert's} thirteenth problem}, 22914 author = {A. G. Vitushkin}, 22915 journal = {Dokl. Akad. Nauk SSSR}, 22916 volume = {95}, 22917 pages = {701--704}, 22918 year = {1954} 22919} 22920 22921@Article{ kolmogorov1957, 22922 title = {On the representation of continuous functions of several variables as 22923 superpositions of continuous functions of one variable and addition}, 22924 author = {Andrei N. Kolmogorov}, 22925 journal = {Dokl. Akad. Nauk SSSR}, 22926 pages = {953--956}, 22927 volume = {114:5}, 22928 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 22929 year = {1957} 22930} 22931 22932@Article{ fridman1967, 22933 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 22934 Theorem}}, 22935 author = {B. L. Fridman}, 22936 journal = {Dokl. Akad. Nauk SSR}, 22937 volume = {177:5}, 22938 pages = {1019--1022}, 22939 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 22940 year = {1967} 22941} 22942 22943@Article{ sprecher1972, 22944 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 22945 author = {David Sprecher}, 22946 journal = {Journal of Mathematical Analysis and Applications}, 22947 volume = {38}, 22948 pages = {208--213}, 22949 year = {1972} 22950} 22951 22952@Article{ diaconisshahshahani1984, 22953 title = {On nonlinear functions of linear combinations}, 22954 author = {Persi Diaconis and Mehrdad Shahshahani}, 22955 journal = {SIAM Journal on Scientific and Statistical Computing}, 22956 volume = {5}, 22957 number = {1}, 22958 pages = {175--191}, 22959 year = {1984}, 22960 publisher = {SIAM} 22961} 22962 22963@InProceedings{ hechtnielsen1987, 22964 title = {Kolmogorov's mapping neural network existence theorem}, 22965 author = {R. Hecht-Nielsen}, 22966 booktitle = {Proceedings of the International Conference on Neural Networks}, 22967 volume = {III}, 22968 pages = {11--14}, 22969 publisher = {IEEE Press}, 22970 year = {1987} 22971} 22972 22973@InProceedings{ hechtnielsen1989, 22974 title = {Theory of the back-propagation neural network}, 22975 author = {R. Hecht-Nielsen}, 22976 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 22977 volume = {I}, 22978 pages = {593--608}, 22979 publisher = {IEEE Press}, 22980 year = {1989} 22981} 22982 22983@Article{ girosipoggio1989, 22984 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 22985 author = {Federico Girosi and Tomaso Poggio}, 22986 journal = {Neural Computation}, 22987 volume = {1}, 22988 number = {4}, 22989 pages = {465--469}, 22990 year = {1989}, 22991 publisher = {MIT Press} 22992} 22993 22994@InBook{ koppen2002, 22995 title = {On the Training of a Kolmogorov Network}, 22996 author = {Mario K\"oppen}, 22997 pages = {474--9}, 22998 publisher = {ICANN 2002, LNCS 2415}, 22999 year = {2002} 23000} 23001 23002@PhDThesis{ bryant2008, 23003 title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in 23004 applications with low and high dimensional data}, 23005 author = {Donald W Bryant}, 23006 school = {University of Central Florida}, 23007 year = {2008} 23008} 23009 23010@InCollection{ griebel2006, 23011 title = {Sparse Grids for Higher Dimensional Problems}, 23012 author = {Michael Griebel}, 23013 booktitle = {Foundations of Computational Mathematics}, 23014 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 23015 publisher = {Cambridge University Press}, 23016 pages = {106--161}, 23017 doi = {10.1017/CBO9780511721571.004}, 23018 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 23019 month = jun, 23020 day = {29}, 23021 year = {2006} 23022} 23023 23024@Article{ braungriebel2009, 23025 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 23026 author = {Jurgen Bra\"un and Michael Griebel}, 23027 journal = {Constructive Approximation}, 23028 pages = {653--675}, 23029 volume = {30}, 23030 year = {2009} 23031} 23032 23033@InProceedings{ lenifougerolletruchetet2009, 23034 title = {Kolmogorov superposition theorem and its application to wavelet image 23035 decompositions}, 23036 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 23037 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 23038 of the SPIE}, 23039 pages = {724804--724804}, 23040 doi = {10.1117/12.805916}, 23041 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 23042 year = {2009} 23043} 23044 23045@Article{ oseledets2011, 23046 title = {Tensor-train decomposition}, 23047 author = {Ivan V Oseledets}, 23048 journal = {SIAM Journal on Scientific Computing}, 23049 volume = {33}, 23050 number = {5}, 23051 pages = {2295--2317}, 23052 year = {2011} 23053} 23054 23055@PhDThesis{ liu2015, 23056 title = {Kolmogorov superposition theorem and its applications}, 23057 author = {Xing Liu}, 23058 school = {Imperial College London}, 23059 year = {2015} 23060} 23061 23062@Article{ lecunbengiohinton2015, 23063 title = {Deep learning}, 23064 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 23065 journal = {Nature}, 23066 volume = {521}, 23067 number = {7553}, 23068 pages = {436--444}, 23069 year = {2015} 23070} 23071 23072@Book{ trefethen2013, 23073 title = {Approximation theory and approximation practice}, 23074 author = {Lloyd N Trefethen}, 23075 publisher = {SIAM}, 23076 year = {2013} 23077} 23078 23079@Article{ butlergrahammattiswalsh2017, 23080 title = {A measure-theoretic interpretation of sample based numerical integration with 23081 applications to inverse and prediction problems under uncertainty}, 23082 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 23083 journal = {SIAM Journal on Scientific Computing}, 23084 volume = {39}, 23085 number = {5}, 23086 pages = {A2072--A2098}, 23087 year = {2017} 23088} 23089 23090@Article{ logg2009, 23091 title = {Efficient representation of computational meshes}, 23092 author = {Anders Logg}, 23093 journal = {International Journal of Computational Science and Engineering}, 23094 volume = {4}, 23095 number = {4}, 23096 pages = {283--295}, 23097 year = {2009} 23098} 23099 23100@Article{ agelekandersonbangerthbarth2017, 23101 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 23102 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 23103 journal = {ACM Transactions on Mathematical Software (TOMS)}, 23104 volume = {44}, 23105 number = {1}, 23106 pages = {5}, 23107 year = {2017} 23108} 23109 23110@Article{ actorknepley2018, 23111 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 23112 Superposition Theorem}}, 23113 author = {Jonas Actor and Matthew G. Knepley}, 23114 eprint = {1712.08286}, 23115 archiveprefix = {arXiv}, 23116 primaryclass = {math.na}, 23117 note = {\url{http://arxiv.org/abs/1712.08286}}, 23118 year = {2018} 23119} 23120 23121@Book{ driscollhaletrefethen2014, 23122 title = {Chebfun guide}, 23123 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 23124 publisher = {Pafnuty Publications, Oxford}, 23125 year = {2014} 23126} 23127 23128@Article{ johntobiska2000, 23129 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 23130 solution of the incompressible Navier-Stokes equations}, 23131 author = {Volker John and Lutz Tobiska}, 23132 journal = {International Journal for Numerical Methods in Fluids}, 23133 volume = {33}, 23134 number = {4}, 23135 pages = {453--473}, 23136 year = {2000} 23137} 23138 23139@Article{ vanka1986, 23140 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 23141 author = {S. P. Vanka}, 23142 journal = {Computer Methods in Applied Mechanics and Engineering}, 23143 volume = {59}, 23144 number = {1}, 23145 pages = {29--48}, 23146 year = {1986} 23147} 23148 23149@Article{ bartelgunther2018, 23150 author = {Andreas Bartel and Michael G\"unther}, 23151 title = {{PDAEs} in refined electrical network modeling}, 23152 journal = {SIAM Review}, 23153 volume = {60}, 23154 number = {1}, 23155 pages = {56--91}, 23156 doi = {10.1137/17M1113643}, 23157 year = {2018} 23158} 23159 23160@Article{ matpower, 23161 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 23162 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 23163 systems research and education}, 23164 journal = {IEEE Transactions on Power Systems}, 23165 volume = {26}, 23166 number = {1}, 23167 pages = {12--19}, 23168 year = {2011}, 23169 doi = {10.1109/TPWRS.2010.2051168} 23170} 23171 23172@Article{ betrieyan2018, 23173 author = {G. Betrie and E. Yan}, 23174 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 23175 Energy and Water Nexus}, 23176 journal = {Applied Energy, Submitted}, 23177 volume = {}, 23178 number = {}, 23179 pages = {}, 23180 doi = {}, 23181 year = {2018} 23182} 23183 23184@Article{ faeth2012, 23185 author = {P. Faeth}, 23186 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 23187 journal = {Environment: Science and Policy for Sustainable Development}, 23188 volume = {54(1)}, 23189 number = {1}, 23190 pages = {4--19}, 23191 year = {2012}, 23192 doi = {10.1080/00139157.2012.639595} 23193} 23194 23195@InProceedings{ hagberg2008, 23196 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 23197 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 23198 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 23199 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 23200 year = {2008}, 23201 pages = {11--15} 23202} 23203 23204@Misc{ simulink-web-page, 23205 author = {Mathworks}, 23206 title = {{SIMULINK} web page}, 23207 note = {\url{https://www.mathworks.com/products/simulink.html}}, 23208 year = {2017} 23209} 23210 23211@Misc{ labview-web-page, 23212 author = {National Instruments}, 23213 title = {{LabVIEW} web page}, 23214 note = {\url{http://www.ni.com/labview/}}, 23215 key = {labview}, 23216 year = {2017} 23217} 23218 23219@Misc{ modelica-web-page, 23220 author = {Modelica Association}, 23221 title = {Modelica web page}, 23222 note = {\url{https://www.modelica.org/}}, 23223 year = {2017} 23224} 23225 23226@InProceedings{ yangsc16, 23227 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 23228 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 23229 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 23230 Computing, Networking, Storage and Analysis}, 23231 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 23232 Dynamics}, 23233 note = {Gordon Bell Award}, 23234 year = {2016} 23235} 23236 23237@InProceedings{ bekassc15, 23238 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 23239 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 23240 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 23241 Computing, Networking, Storage and Analysis}, 23242 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 23243 Earth's Mantle}, 23244 note = {Gordon Bell Award}, 23245 year = {2015} 23246} 23247 23248@Misc{ improving-software-whitepaper2017, 23249 author = {M. Heroux and L.C. McInnes}, 23250 title = {Improving and accelerating scientific discovery through better software}, 23251 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 23252 doi = {10.6084/m9.figshare.5339692}, 23253 year = {2017} 23254} 23255 23256@Misc{ doe:40thanniversarycollection, 23257 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 23258 changed the face of science}, 23259 key = {Department of Energy, Office of Science}, 23260 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 23261 year = {2017} 23262} 23263 23264@Misc{ siam:fellowsprogram, 23265 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 23266 key = {SIAM}, 23267 howpublished = {\url{http://www.siam.org/prizes/fellows}} 23268} 23269 23270@Misc{ r-and-d100:awards2009, 23271 title = {{R\&D100 Award Winners 2009}}, 23272 key = {{R\&D100 Award Winners 2009}}, 23273 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 23274} 23275 23276@Misc{ xsdk:website, 23277 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 23278 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 23279 howpublished = {\url{https://xsdk.info}} 23280} 23281 23282@Misc{ xsdk-community-installation-policies2017, 23283 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 23284 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 23285 note = {version 0.3, November 7, 2017}, 23286 doi = {10.6084/m9.figshare.4495133}, 23287 year = {2017} 23288} 23289 23290@Misc{ xsdk-community-package-policies2017, 23291 title = {{xSDK} Community Package Policies}, 23292 author = {B. Smith and R. Bartlett and {xSDK developers}}, 23293 note = {version 0.3, November 7, 2017}, 23294 doi = {10.6084/m9.figshare.4495136}, 23295 year = {2017} 23296} 23297 23298@Misc{ ideas-what-are-interoperable-libraries, 23299 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 23300 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 23301 Ulrike Yang and {all xSDK developers}}, 23302 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 23303 \url{https://ideas-productivity.org/resources/howtos/}}, 23304 year = {2016} 23305} 23306 23307@Misc{ ideas-productivity:website, 23308 title = {{IDEAS Scientific Software Productivity Project}}, 23309 key = {IDEAS Scientific Software Productivity Project}, 23310 howpublished = {\url{https://ideas-productivity.org}} 23311} 23312 23313@Misc{ ecp:website, 23314 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 23315 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 23316 note = {\url{https://exascaleproject.org}}, 23317 year = {2018} 23318} 23319 23320@Misc{ siam-cse-jan2018, 23321 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 23322 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 23323 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 23324 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 23325 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 23326 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 23327 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 23328 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 23329 title = {Research and Education in Computational Science and Engineering}, 23330 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 23331 Review}}, 23332 year = {2018} 23333} 23334 23335@Misc{ doe-appliedmathpimeeting2017, 23336 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 23337 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 23338 Willcox and Steven Lee}, 23339 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 23340 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 23341 year = {2017} 23342} 23343 23344@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 23345 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 23346 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 23347 Sciences}}, 23348 note = {available via 23349 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 23350 year = {2015} 23351} 23352 23353@Misc{ sisc-specialissueintro, 23354 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 23355 Software'} and {'Big Data in CSE'}}, 23356 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 23357 month = nov, 23358 year = {2016}, 23359 journal = {SIAM J. Sci. Comput.}, 23360 doi = {10.1137/16N974188} 23361} 23362 23363@Article{ xsdk-foundations2017, 23364 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 23365 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 23366 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 23367 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 23368 journal = {Supercomputing Frontiers and Innovations}, 23369 month = feb, 23370 year = {2017}, 23371 note = {available via \url{https://arxiv.org/abs/1702.08425}} 23372} 23373 23374@Misc{ openfoam:website, 23375 title = {{OpenFOAM}}, 23376 author = {OpenFOAM Team}, 23377 key = {OpenFOAM}, 23378 howpublished = {\url{https://openfoam.com}} 23379} 23380 23381@Misc{ mfem:website, 23382 title = {{MFEM}}, 23383 author = {Tzanio Kolev and MFEM Team}, 23384 key = {MFEM}, 23385 howpublished = {\url{https://mfem.org}} 23386} 23387 23388@Misc{ deal.ii:website, 23389 title = {{{deal.II}: An open-source finite element library}}, 23390 author = {Wolfgang Bangerth and Deal.II Team}, 23391 howpublished = {\url{http://www.dealii.org}}, 23392 year = {2018} 23393} 23394 23395@Misc{ ibamr:website, 23396 title = {{{IBAMR}: Immersed Boundary Method Adaptive Mesh Refinement Software Infrastructure}}, 23397 author = {Boyce Griffith and IBAMR Team}, 23398 howpublished = {\url{https://ibamr.github.io/}}, 23399 year = {2023} 23400} 23401 23402@Misc{ fission-gas-scidac:website, 23403 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 23404 author = {A. David {Andersson (PI)}}, 23405 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 23406 year = {2018} 23407} 23408 23409@Misc{ tokamak-disruption-scidac:project, 23410 title = {{Tokamak Disruption Simulation}}, 23411 author = {Xianzhu {Tang (PI)}}, 23412 howpublished = {SciDAC project}, 23413 year = {2018} 23414} 23415 23416@InProceedings{ duplyakin2018memory, 23417 title = {Evaluating Active Learning with Cost and Memory Awareness}, 23418 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 23419 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 23420 pages = {214--223}, 23421 year = {2018}, 23422 organization = {IEEE}, 23423 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 23424} 23425 23426@InProceedings{ duplyakin2016active, 23427 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 23428 title = {Active Learning in Performance Analysis}, 23429 booktitle = {Proceedings of the IEEE Cluster Conference}, 23430 year = {2016}, 23431 month = sep, 23432 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 23433 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 23434} 23435 23436@Misc{ xgc1:website, 23437 title = {{XGC1 project website}}, 23438 author = {C. S. Chang and others}, 23439 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 23440 year = {2018} 23441} 23442 23443@Misc{ wdmapp-bhattacharjee-ecp:website, 23444 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 23445 Plasmas}}, 23446 author = {A. Bhattacharjee and others}, 23447 note = {ECP application project}, 23448 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 23449 year = {2018} 23450} 23451 23452@Misc{ subsurface-steefel-ecp:website, 23453 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 23454 and Mechanics}}, 23455 note = {ECP application project}, 23456 author = {C. Steefel and others}, 23457 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 23458 year = {2018} 23459} 23460 23461@Article{ chombo-crunch:2014, 23462 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 23463 with Carbon Sequestration}, 23464 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 23465 journal = {Computing in Science and Engineering}, 23466 volume = {16}, 23467 issue = {6}, 23468 year = {2014}, 23469 pages = {22--31}, 23470 doi = {10.1109/MCSE.2014.77} 23471} 23472 23473@Article{ courantfriedrichslewy1967, 23474 title = {On the partial difference equations of mathematical physics}, 23475 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 23476 journal = {IBM journal of Research and Development}, 23477 volume = {11}, 23478 number = {2}, 23479 pages = {215--234}, 23480 year = {1967}, 23481 publisher = {IBM} 23482} 23483 23484@Article{ erway2017solving, 23485 title = {On solving large-scale limited-memory quasi-Newton equations}, 23486 author = {Erway, Jennifer B and Marcia, Roummel F}, 23487 journal = {Linear Algebra and its Applications}, 23488 volume = {515}, 23489 pages = {196--225}, 23490 year = {2017}, 23491 publisher = {Elsevier} 23492} 23493 23494@Article{ griewank2012broyden, 23495 title = {Broyden updating, the good and the bad!}, 23496 author = {Griewank, Andreas}, 23497 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 23498 pages = {301--315}, 23499 year = {2012} 23500} 23501 23502@Book{ tarantola2005, 23503 title = {Inverse problem theory and methods for model parameter estimation}, 23504 author = {Albert Tarantola}, 23505 volume = {89}, 23506 year = {2005}, 23507 publisher = {SIAM} 23508} 23509 23510@Article{ rutkaikristof2010, 23511 title = {Dynamic Monte Carlo simulation in mixtures}, 23512 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 23513 journal = {The Journal of Chemical Physics}, 23514 volume = {132}, 23515 number = {10}, 23516 pages = {104107}, 23517 year = {2010}, 23518 publisher = {AIP} 23519} 23520 23521@Book{ vogel2002, 23522 title = {Computational methods for inverse problems}, 23523 author = {Curtis R Vogel}, 23524 volume = {23}, 23525 year = {2002}, 23526 publisher = {SIAM} 23527} 23528 23529@Article{ malqvistpeterseim2014, 23530 title = {Localization of elliptic multiscale problems}, 23531 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 23532 journal = {Mathematics of Computation}, 23533 volume = {83}, 23534 number = {290}, 23535 pages = {2583--2603}, 23536 year = {2014} 23537} 23538 23539@Article{ brandtbrannickkahllivshits2011, 23540 title = {Bootstrap {AMG}}, 23541 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 23542 journal = {SIAM Journal on Scientific Computing}, 23543 volume = {33}, 23544 number = {2}, 23545 pages = {612--632}, 23546 year = {2011} 23547} 23548 23549@InProceedings{ barralalauzet2014, 23550 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 23551 moving mesh strategy}, 23552 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 23553 booktitle = {44th AIAA Fluid Dynamics Conference}, 23554 pages = {2773}, 23555 year = {2014} 23556} 23557 23558@InProceedings{ barralalauzetloseille2015, 23559 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 23560 problems involving moving geometries}, 23561 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 23562 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 23563 pages = {2039}, 23564 year = {2015} 23565} 23566 23567@Article{ barralolivieralauzet2017, 23568 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 23569 problems with body-fitted moving geometries}, 23570 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 23571 journal = {Journal of Computational Physics}, 23572 volume = {331}, 23573 pages = {157--187}, 23574 year = {2017} 23575} 23576 23577@Article{ ibanezbarralkrakosloseillemichalpark2017, 23578 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 23579 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 23580 Michal and Mike Park}, 23581 journal = {Procedia engineering}, 23582 volume = {203}, 23583 pages = {154--166}, 23584 year = {2017} 23585} 23586 23587@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 23588 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 23589 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 23590 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 23591 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 23592 pages = {1103}, 23593 year = {2018} 23594} 23595 23596@InProceedings{ barralangeloudiskramergormanpiggott2018, 23597 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 23598 modelling}, 23599 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 23600 and Matthew D Piggott}, 23601 booktitle = {EGU General Assembly Conference Abstracts}, 23602 volume = {20}, 23603 pages = {19168}, 23604 year = {2018} 23605} 23606 23607@Article{ principe2009, 23608 title = {{Mathematical models for thermally coupled low speed flows}}, 23609 author = {Javier Principe and Ramon Codina}, 23610 journal = {Advances in Theoretical and Applied Mechanics}, 23611 volume = {2}, 23612 number = {1-4}, 23613 pages = {93--112}, 23614 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 23615 year = {2009} 23616} 23617 23618@Book{ vandervorst2003, 23619 title = {Iterative {K}rylov Methods for Large Linear Systems}, 23620 author = {van der Vorst, H.}, 23621 isbn = {9780521818285}, 23622 publisher = {Cambridge University Press}, 23623 year = {2003} 23624} 23625 23626@Book{ peres2006, 23627 author = {Asher Peres}, 23628 title = {Quantum theory: concepts and methods}, 23629 volume = {57}, 23630 publisher = {Springer Science \& Business Media}, 23631 year = {2006} 23632} 23633 23634@Book{ kuttler2012, 23635 title = {Linear algebra: theory and applications}, 23636 author = {Kenneth Kuttler}, 23637 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 23638 year = {2012} 23639} 23640 23641@Book{ elman_silvester_wathen_2014, 23642 place = {Oxford}, 23643 title = {Finite elements and fast iterative solvers: with applications in incompressible 23644 fluid dynamics}, 23645 publisher = {Oxford University Press}, 23646 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 23647 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 23648 year = {2014} 23649} 23650 23651@Article{ alametal2007, 23652 title = {An evaluation of the ORNL Cray XT3}, 23653 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 23654 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 23655 journal = {International Journal of High Performance Computing Applications}, 23656 volume = {22}, 23657 number = {1}, 23658 pages = {52--80}, 23659 doi = {10.1177/1094342007085019}, 23660 year = {2007} 23661} 23662 23663@Article{ plazacarey2000, 23664 title = {Local refinement of simplicial grids based on the skeleton}, 23665 author = {Plaza, A. and Carey, Graham F.}, 23666 journal = {Applied Numerical Mathematics}, 23667 doi = {10.1016/S0168-9274(99)00022-7}, 23668 issn = {01689274}, 23669 volume = {32}, 23670 number = {2}, 23671 pages = {195--218}, 23672 year = {2000} 23673} 23674 23675@Article{ carsonstrakos2020, 23676 title = {On the cost of iterative computations}, 23677 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 23678 journal = {Phil. Trans. R. Soc. A}, 23679 volume = {378}, 23680 number = {20190050}, 23681 doi = {10.1098/rsta.2019.0050}, 23682 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 23683 year = {2020} 23684} 23685 23686@Article{ schoberl1999, 23687 title = {Multigrid methods for a parameter dependent problem in primal variables}, 23688 author = {Joachim Sch{\"o}berl}, 23689 journal = {Numerische Mathematik}, 23690 volume = {84}, 23691 number = {1}, 23692 pages = {97--119}, 23693 year = {1999} 23694} 23695 23696@Article{ wuleexuzikatanov2008, 23697 title = {Convergence analysis on iterative methods for semidefinite systems}, 23698 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 23699 journal = {Journal of Computational Mathematics}, 23700 pages = {797--815}, 23701 year = {2008} 23702} 23703 23704@Article{ maierrannacher2016, 23705 title = {Duality-based adaptivity in finite element discretization of heterogeneous 23706 multiscale problems}, 23707 author = {Maier, Matthias and Rannacher, Rolf}, 23708 journal = {Journal of Numerical Mathematics}, 23709 volume = {24}, 23710 number = {3}, 23711 pages = {167--187}, 23712 year = {2016} 23713} 23714 23715@Article{ maierrannacher2018, 23716 title = {A duality-based optimization approach for model adaptivity in heterogeneous 23717 multiscale problems}, 23718 author = {Maier, Matthias and Rannacher, Rolf}, 23719 journal = {Multiscale Modeling \& Simulation}, 23720 volume = {16}, 23721 number = {1}, 23722 pages = {412--428}, 23723 year = {2018} 23724} 23725 23726@Article{ margetismaierluskin2017, 23727 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 23728 metamaterial sheet}, 23729 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 23730 journal = {Studies in Applied Mathematics}, 23731 volume = {139}, 23732 number = {4}, 23733 pages = {599--625}, 23734 year = {2017} 23735} 23736 23737@Article{ maiermargetisluskin2017b, 23738 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 23739 approximation and validation}, 23740 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 23741 journal = {Journal of Computational Physics}, 23742 volume = {339}, 23743 pages = {126--145}, 23744 year = {2017} 23745} 23746 23747@Article{ maiermargetisluskin2018, 23748 title = {Generation of surface plasmon-polaritons by edge effects}, 23749 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 23750 journal = {Communications in Mathematical Sciences}, 23751 volume = {16}, 23752 number = {1}, 23753 pages = {77--95}, 23754 url = {http://arxiv.org/abs/1702.00848}, 23755 year = {2018} 23756} 23757 23758@Article{ maiermattheakiskaxirasluskinmargetis2018, 23759 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 23760 metamaterials}, 23761 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23762 Mitchell and Margetis, Dionisios}, 23763 journal = {Physical Review B}, 23764 volume = {97}, 23765 number = {3}, 23766 pages = {035307}, 23767 year = {2018} 23768} 23769 23770@Article{ maiermattheakiskaxirasluskinmargetis2019, 23771 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 23772 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23773 Mitchell and Margetis, Dionisios}, 23774 journal = {Proceedings of the Royal Society A}, 23775 volume = {475}, 23776 number = {2230}, 23777 pages = {20190220}, 23778 year = {2019} 23779} 23780 23781@Article{ maiermargetisluskin2020, 23782 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 23783 two scales}, 23784 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 23785 journal = {Physical Review B}, 23786 volume = {102}, 23787 number = {7}, 23788 pages = {075308}, 23789 year = {2020} 23790} 23791 23792@Article{ margetismaierstauberlowluskin2020, 23793 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 23794 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 23795 Luskin, Mitchell}, 23796 journal = {Journal of Physics A: Mathematical and Theoretical}, 23797 volume = {53}, 23798 number = {5}, 23799 pages = {055201}, 23800 year = {2020} 23801} 23802 23803@Article{ maiermargetismellet2020, 23804 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 23805 structures}, 23806 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 23807 journal = {Journal of Computational and Applied Mathematics}, 23808 volume = {377}, 23809 pages = {112909}, 23810 year = {2020} 23811} 23812 23813@Article{ maierkronbichler2021, 23814 title = {Efficient parallel 3D computation of the compressible Euler equations with an 23815 invariant-domain preserving second-order finite-element scheme}, 23816 author = {Maier, Matthias and Kronbichler, Martin}, 23817 journal = {ACM Transactions on Parallel Computing}, 23818 volume = {8}, 23819 number = {3}, 23820 pages = {1--30}, 23821 year = {2021} 23822} 23823 23824@Article{ guermondmaierpopovtomas2021, 23825 title = {Second-order invariant domain preserving approximation of the compressible 23826 Navier--Stokes equations}, 23827 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 23828 journal = {Computer Methods in Applied Mechanics and Engineering}, 23829 volume = {375}, 23830 pages = {113608}, 23831 year = {2021} 23832} 23833 23834@Article{ liliptonmaier2021, 23835 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 23836 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 23837 eprint = {2009.12166}, 23838 archiveprefix = {arXiv}, 23839 primaryclass = {phys.optics}, 23840 year = {2021} 23841} 23842 23843@Article{ songmaierluskin2020, 23844 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 23845 gradient-index graphene waveguides}, 23846 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23847 journal = {Journal of Computational Physics}, 23848 volume = {423}, 23849 pages = {109871}, 23850 year = {2020} 23851} 23852 23853@Article{ songmaierluskin2019, 23854 title = {Adaptive finite element simulations of waveguide configurations involving 23855 parallel 2D material sheets}, 23856 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23857 journal = {Computer Methods in Applied Mechanics and Engineering}, 23858 volume = {351}, 23859 pages = {20--34}, 23860 year = {2019} 23861} 23862 23863% 23864% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 23865% 23866% 23867@Unpublished{ rob1, 23868 author = {Rob Kunz}, 23869 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 23870 State University}, 23871 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 23872 sponsors = {U.S. Navy, NRC}, 23873 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 23874 simulations, including lake warming by power plants}, 23875 dates = {Oct 3 and 4, 2002}, 23876 email = {rfk@wt.arl.psu.edu} 23877} 23878 23879@Unpublished{ au1, 23880 author = {Feng Wang and William Appelbe}, 23881 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 23882 url = {http://www.vpac.org}, 23883 sponsors = { }, 23884 note = {Using PETSc for a Variety of Geophysical Simulations}, 23885 dates = {Nov 22, 2002} 23886} 23887 23888@Unpublished{ carl1, 23889 author = {Carl Sovinec}, 23890 institution = {Applied Physics, University of Wisconsin}, 23891 url = {http://nimrodteam.org}, 23892 sponsors = {DOE Office of Fusion Research}, 23893 note = {Investigating using PETSc for NIMROD}, 23894 dates = {Nov 21, 2002}, 23895 email = {sovinec@engr.wisc.edu} 23896} 23897 23898@Unpublished{ au1b, 23899 author = {Pablo Carrica and Robert Wilson}, 23900 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 23901 url = {http://}, 23902 sponsors = {Office of Naval Research}, 23903 note = {Using PETSc for a hydrodynamics of ships and submarines}, 23904 dates = {Sept, 2002}, 23905 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 23906} 23907 23908% ------------------- TAO References ---------------------- 23909@Article{ benson:2001:csp, 23910 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 23911 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 23912 journal = {{ACM} Transactions on Mathematical Software}, 23913 volume = {27}, 23914 number = {3}, 23915 month = sep, 23916 year = {2001}, 23917 pages = {361--376} 23918} 23919 23920@TechReport{ tao-user-ref-2000, 23921 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 23922 title = {{TAO} Users Manual}, 23923 year = {2000}, 23924 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23925 number = {ANL/MCS-TM-242}, 23926 note = {See \url{http://www.mcs.anl.gov/tao}} 23927} 23928 23929% ------------------- Optimization References ---------------------- 23930@Book{ optguide93, 23931 title = {Optimization Software Guide}, 23932 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 23933 publisher = {SIAM Publications}, 23934 address = {Philadelphia}, 23935 year = {1993} 23936} 23937 23938@InProceedings{ more84, 23939 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 23940 Hillstrom}, 23941 title = {The {MINPACK} Project}, 23942 booktitle = {Sources and Development of Mathematical Software}, 23943 editor = {Wayne R. Cowell}, 23944 year = {1984}, 23945 pages = {88--111} 23946} 23947 23948@Article{ steihaug:83, 23949 author = {Trond Steihaug}, 23950 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 23951 journal = {SIAM J. Numer. Anal.}, 23952 volume = {20}, 23953 year = {1983}, 23954 pages = {626--637}, 23955 key = {steihaug92 ! trust_region} 23956} 23957 23958@TechReport{ minpack2test, 23959 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 23960 title = {The {MINPACK-2} Test Problem Collection}, 23961 institution = {Argonne National Laboratory}, 23962 year = {1991}, 23963 number = {ANL/MCS-TM-150}, 23964 key = {more91 ! MINPACK-2} 23965} 23966 23967@TechReport{ hohmann:94, 23968 author = {Andreas Hohmann}, 23969 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 23970 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 23971 year = {1994}, 23972 number = {SC-94-4}, 23973 key = {Hohmann94} 23974} 23975 23976@TechReport{ meza:94, 23977 author = {Juan C. Meza}, 23978 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 23979 institution = {Sandia National Laboratory}, 23980 year = {1994}, 23981 number = {SAND94-8225}, 23982 key = {Meza94} 23983} 23984 23985@Book{ dennis:83, 23986 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 23987 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 23988 publisher = {Prentice-Hall, Inc.}, 23989 address = {Englewood Cliffs, NJ}, 23990 year = {1983} 23991} 23992 23993@TechReport{ more:92, 23994 author = {Jorge J. Mor\'{e} and David Thuente}, 23995 title = {Line search algorithms with guaranteed sufficient decrease}, 23996 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23997 year = {1992}, 23998 number = {MCS-P330-1092} 23999} 24000 24001@Article{ more-toraldo, 24002 author = {Jorge J. Mor\'e and G. Toraldo}, 24003 journal = {SIOPT}, 24004 pages = {93--113}, 24005 title = {On the solution of large quadratic programming problems with bound constraints}, 24006 volume = {1}, 24007 year = {1991} 24008} 24009 24010@Article{ byrd:1995:lma, 24011 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 24012 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 24013 journal = {SIAM Journal on Scientific Computing}, 24014 volume = {16}, 24015 number = {5}, 24016 pages = {1190--1208}, 24017 month = sep, 24018 year = {1995}, 24019 coden = {SJOCE3}, 24020 issn = {1064-8275 (print), 1095-7197 (electronic)}, 24021 mrclass = {90C30 (65K05)}, 24022 mrnumber = {96e:90039}, 24023 mrreviewer = {Henry Wolkowicz}, 24024 bibdate = {Fri Dec 4 16:17:35 MST 1998} 24025} 24026 24027@Article{ lin_c3, 24028 author = {C.-J. Lin and J. J. Mor\'e}, 24029 title = {Newton's method for large bound-constrained optimization problems}, 24030 year = {1999}, 24031 journal = {SIOPT}, 24032 volume = {9(4)}, 24033 pages = {1100--1127}, 24034 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 24035} 24036 24037@TechReport{ dolan2, 24038 author = {E. Dolan and J. J. Mor\'{e}}, 24039 title = {Benchmarking Optimization Software with Performance Profiles}, 24040 year = {2001}, 24041 month = jan, 24042 number = {ANL/MCS-P861-1200}, 24043 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 24044 address = {Argonne, IL}, 24045 url = {http://www.mcs.anl.gov/~more/cops/} 24046} 24047 24048@InProceedings{ owlqn, 24049 author = {Galen Andrew and Jianfeng Gao}, 24050 title = {Scalable training of L1-regularized log-linear models}, 24051 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 24052 pages = {33--40}, 24053 year = {2007} 24054} 24055 24056@Article{ bmrm, 24057 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 24058 title = {Bundle methods for regularized risk minimization}, 24059 year = {2010}, 24060 journal = {Journal of Machine Learning Research}, 24061 volume = {11}, 24062 pages = {311--365} 24063} 24064 24065% ------------------- Component Software References ---------------------- 24066@InProceedings{ cca99, 24067 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 24068 McInnes and S. Parker and B. Smolinski}, 24069 title = {Toward a Common Component Architecture for High-Performance Scientific 24070 Computing}, 24071 booktitle = {Proceedings of {High Performance Distributed Computing}}, 24072 pages = {115--124}, 24073 year = {1999}, 24074 note = {See \url{http://cca-forum.org}} 24075} 24076 24077@Book{ szyperski98, 24078 author = {Clemens Szyperski}, 24079 title = {Component Software: Beyond Object-Oriented Programming}, 24080 publisher = {ACM Press}, 24081 address = {New York}, 24082 year = {1998} 24083} 24084 24085@Article{ broy98, 24086 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 24087 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 24088 Stal and Clemens Szyperski}, 24089 title = {What Characterizes a (Software) Component?}, 24090 journal = {Software -- Concepts and Tools}, 24091 publisher = {Springer-Verlag}, 24092 year = {1998}, 24093 volume = {19}, 24094 pages = {49--56} 24095} 24096 24097@Article{ componentware:94, 24098 author = {Jon Udell}, 24099 title = {Componentware}, 24100 journal = {Byte}, 24101 volume = {may}, 24102 pages = {46--56}, 24103 year = {1994}, 24104 key = {Udell94 ! componentware} 24105} 24106 24107@Misc{ cca-web-page, 24108 author = {{Common Component Architecture Forum}}, 24109 note = {See \url{http://cca-forum.org}} 24110} 24111 24112% --------------- References for Tools Used by TAO Developers ----------------- 24113 24114% 24115% tohtml: Used to generate on-line TAO users manual and manual pages 24116% 24117@TechReport{ tohtml, 24118 author = {William Gropp}, 24119 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 24120 institution = {Argonne National Laboratory}, 24121 number = {ANL/MCS-TM-00}, 24122 month = jan, 24123 year = {1995}, 24124 key = {tohtml} 24125} 24126 24127% 24128% doctext: Used to generate tex version of TAO manual pages 24129% 24130@TechReport{ doctext, 24131 author = {William Gropp}, 24132 title = {Users Manual for doctext: Producing documentation from {C} source code}, 24133 institution = {Argonne National Laboratory}, 24134 number = {ANL/MCS-TM-00}, 24135 month = jan, 24136 year = {1995}, 24137 key = {doctext} 24138} 24139 24140% 24141% bfort: Used to generate TAO Fortran interface 24142% 24143@TechReport{ bfort, 24144 author = {William Gropp}, 24145 title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, 24146 institution = {Argonne National Laboratory}, 24147 number = {ANL/MCS-TM-208}, 24148 month = mar, 24149 year = {1995}, 24150 key = {doctext} 24151} 24152 24153% ------------------------- PETSc References ------------------------------ 24154@InProceedings{ petsc, 24155 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 24156 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 24157 Libraries}, 24158 booktitle = {Modern Software Tools in Scientific Computing}, 24159 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 24160 publisher = {Birkhauser Press}, 24161 pages = {163--202}, 24162 year = {1997} 24163} 24164 24165% ------------------------- Misc Other References ------------------------------ 24166@Misc{ indeps-web-page, 24167 title = {{InDEPS} {W}eb page}, 24168 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 24169 author = {et al. Robert Armstrong}, 24170 institution = {Sandia National Laboratory}, 24171 key = {{InDEPS} {W}eb page} 24172} 24173 24174@Misc{ pooma, 24175 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 24176 chitectures}, 24177 year = {1996}, 24178 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 24179 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 24180} 24181 24182@Misc{ isis++-web-page, 24183 title = {{ISIS++} {W}eb Page}, 24184 note = {See \url{http://ca.sandia.gov/isis}}, 24185 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 24186 institution = {Sandia National Laboratories} 24187} 24188 24189@Misc{ trilinos-web-page, 24190 title = {{Trilinos} {W}eb Page}, 24191 note = {See 24192 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 24193 author = {Mike Heroux et al.}, 24194 institution = {Sandia National Laboratories} 24195} 24196 24197@Misc{ alice-web-page, 24198 title = {{ALICE} {W}eb page}, 24199 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 24200 Argonne National Laboratory}, 24201 key = {{ALICE} {W}eb page} 24202} 24203 24204@Misc{ autodiff-webpage, 24205 author = {{Computational Differentiation Project}}, 24206 note = {See \url{http://www.mcs.anl.gov/autodiff}} 24207} 24208 24209@Misc{ coool-home-page, 24210 author = {Lydia Deng and Wences Gouveia and John Scales}, 24211 title = {{The CWP Object-Oriented Optimization Library}}, 24212 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 24213} 24214 24215@Misc{ rice-inversion-home-page, 24216 author = {Mark S. Gokenbach and William W. Symes}, 24217 title = {{The Hilbert Class Library}}, 24218 note = {See \url{http://www.trip.caam.rice.edu/}} 24219} 24220 24221@Misc{ opt++-home-page, 24222 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 24223 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 24224} 24225 24226@Article{ gockenbach:1999:ccl, 24227 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 24228 title = {C++ Classes for Linking Optimization with Complex Simulations}, 24229 journal = {{ACM} Transactions on Mathematical Software}, 24230 volume = {25}, 24231 number = {2}, 24232 month = jun, 24233 year = {1999}, 24234 pages = {191-212}, 24235 abstract = {The object-oriented programming paradigm can be used to overcome the 24236 incompatibilities between off-the-shelf optimization software and application 24237 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 24238 objects arising in optimization problems, such as vectors, linear operators, and 24239 so forth, as C++ classes, making it possible to write optimization code in a 24240 natural fashion, while allowing application software such as simulators to use the 24241 most convenient data structures and programming style. In spite of the poor 24242 reputation C++ has for runtime performance, the use of mixed-language programming 24243 allows performance equal to that achieved by standard Fortran packages, as 24244 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 24245 accepted = {April 1999}, 24246 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 24247} 24248 24249@Misc{ neos-guide, 24250 author = {{The Optimization Software Guide}}, 24251 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 24252} 24253 24254@Article{ boyd, 24255 title = {Distributed optimization and statistical learning via the alternating direction 24256 method of multipliers}, 24257 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 24258 Jonathan and others}, 24259 journal = {Foundations and Trends{\textregistered} in Machine learning}, 24260 volume = {3}, 24261 number = {1}, 24262 pages = {1-122}, 24263 year = {2011}, 24264 publisher = {Now Publishers, Inc.} 24265} 24266 24267@Misc{ :alertsys, 24268 title = {page{ALERT}}, 24269 organization = {Alert Systems, Inc}, 24270 address = {Madison, Wisconsin}, 24271 note = {http://www.alertsys.com/} 24272} 24273 24274@Manual{ :cmfortran, 24275 title = {{CM} {F}ortran Language Reference Manual}, 24276 organization = {Thinking Machines Corporation}, 24277 year = {1994}, 24278 address = {Cambridge, MA} 24279} 24280 24281@Manual{ :cmmd, 24282 title = {{CMMD} Reference Manual, Version 3.0}, 24283 organization = {Thinking Machines Corporation}, 24284 year = {1993}, 24285 address = {Cambridge, MA} 24286} 24287 24288@Manual{ :cmssl, 24289 title = {{CMSSL} for {CM} {F}ortran}, 24290 volume = {I}, 24291 organization = {Thinking Machines Corporation}, 24292 year = {1994}, 24293 address = {Cambridge, MA} 24294} 24295 24296@Misc{ :condor, 24297 author = {M. Livny}, 24298 title = {{PI}, The {Condor} Project, High Throughput Computing}, 24299 howpublished = {www.cs.wisc.edu/condor} 24300} 24301 24302@Manual{ :connection, 24303 title = {Connection Machine {CM}--5 Technical Summary}, 24304 organization = {Thinking Machines Corporation}, 24305 year = {1993}, 24306 address = {Cambridge, MA} 24307} 24308 24309@Manual{ :cplex, 24310 title = {{CPLEX} Optimizer}, 24311 organization = {ILOG CPLEX Division}, 24312 address = {889 Alder Avenue, Incline Village, Nevada}, 24313 note = {http://www.cplex.com/} 24314} 24315 24316@Manual{ :cplextm, 24317 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 24318 (Version 2.0)}, 24319 organization = {CPLEX Optimization Inc.}, 24320 year = {1992}, 24321 address = {Incline Village, Nevada} 24322} 24323 24324@Misc{ :fatcop, 24325 author = {M. C. Ferris}, 24326 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 24327 Solver}, 24328 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 24329} 24330 24331@Misc{ :metaneos, 24332 author = {S. J. Wright}, 24333 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 24334 howpublished = {www-unix.mcs.anl.gov/metaneos} 24335} 24336 24337@InCollection{ gropp.more:optimization, 24338 author = {W. Gropp and J. J. Mor\'e}, 24339 title = {Optimization environments and the {NEOS} Server}, 24340 booktitle = {Approximation Theory and Optimization}, 24341 pages = {167--182}, 24342 publisher = {Cambridge University Press}, 24343 year = {1997}, 24344 editor = {M. D. Buhmann and A. Iserles} 24345} 24346 24347@Article{ czyzyk.mesnier.ea:neos, 24348 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 24349 title = {The {NEOS} Server}, 24350 journal = {IEEE Journal on Computational Science and Engineering}, 24351 volume = {5}, 24352 year = {1998}, 24353 pages = {68--75} 24354} 24355 24356@Book{ :osl, 24357 title = {Handbook for {IBM OSL}}, 24358 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 24359 year = {1994}, 24360 publisher = {Boyd and Fraser}, 24361 address = {Danvers, Massachusetts} 24362} 24363 24364@Manual{ :pro-matlab, 24365 title = {{PRO}--{MATLAB} User's Guide}, 24366 organization = {The MathWorks, Inc.}, 24367 year = {1989}, 24368 address = {21 Eliot Street, South Natick, MA 01760} 24369} 24370 24371@Misc{ :prostate, 24372 key = {Biomedical}, 24373 title = {Biomedical Business International Newsletter}, 24374 howpublished = {pp. 72--75}, 24375 year = {1996} 24376} 24377 24378@Misc{ :sipcase, 24379 key = {Natural}, 24380 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 24381 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 24382} 24383 24384@Book{ aarts.korst:simulated, 24385 author = {E. Aarts and J. Korst}, 24386 title = {Simulated Annealing and Boltzman Machines}, 24387 year = {1990}, 24388 publisher = {John Wiley \& Sons}, 24389 address = {Chichester} 24390} 24391 24392@TechReport{ aarts.laarhoven.ea:local-search-based, 24393 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 24394 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 24395 institution = {Centre for Quantitative Methods}, 24396 year = {1991}, 24397 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 24398 number = {106}, 24399 type = {CQM-Not} 24400} 24401 24402@Article{ aashtiani.magnanti:equilibria, 24403 author = {H. Z. Aashtiani and T. L. Magnanti}, 24404 title = {Equilibria on a congested transportation network}, 24405 journal = {SIAM Journal on Algebraic and Discrete Methods}, 24406 volume = {2}, 24407 year = {1981}, 24408 pages = {213--226} 24409} 24410 24411@Article{ ablow.brigham:analog, 24412 author = {C. M. Ablow and G. Brigham}, 24413 title = {An Analog Solution of Programming Problems}, 24414 journal = {Operations Research}, 24415 year = {1955}, 24416 volume = {3}, 24417 pages = {388--394} 24418} 24419 24420@Article{ achuthan.grabowski.ea:optimal, 24421 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 24422 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 24423 journal = {Opsearch}, 24424 year = {1981}, 24425 volume = {18}, 24426 pages = {117--138} 24427} 24428 24429@Book{ adelman.robinson:income, 24430 author = {I. Adelman and S. Robinson}, 24431 title = {Income Distribution Policy in Developing Countries}, 24432 publisher = {Stanford University Press}, 24433 year = {1978}, 24434 address = {Stanford, California} 24435} 24436 24437@Article{ adler.resende.ea:implementation, 24438 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 24439 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 24440 journal = {Mathematical Programming}, 24441 year = {1989}, 24442 volume = {44}, 24443 pages = {297--336} 24444} 24445 24446@TechReport{ aeberhard.coomans.ea:comparison, 24447 author = {S. Aeberhard and D. Coomans and O. de Vel}, 24448 title = {Comparison of Classifiers in High Dimensional Settings}, 24449 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 24450 University of North Queensland}, 24451 year = {1992}, 24452 number = {92-02}, 24453 type = {Technical Report} 24454} 24455 24456@Article{ aganagic.cottle:constructive, 24457 author = {M. Aganagi\'{c} and R. W. Cottle}, 24458 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 24459 Minors}, 24460 journal = {Mathematical Programming}, 24461 year = {1987}, 24462 volume = {37}, 24463 pages = {223--231} 24464} 24465 24466@TechReport{ aganagic:iterative, 24467 author = {M. Aganagi\'{c}}, 24468 title = {Iterative Methods for the Linear Complementarity Problem}, 24469 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 24470 University}, 24471 year = {1978}, 24472 type = {SOL}, 24473 number = {78-10}, 24474 address = {Stanford, California} 24475} 24476 24477@Book{ ahlfors:complex, 24478 author = {L. V. Ahlfors}, 24479 title = {Complex Analysis}, 24480 publisher = {McGraw--Hill Book Company}, 24481 address = {New York}, 24482 series = {International Series in Pure and Applied Mathematics}, 24483 edition = {Second}, 24484 year = {1966} 24485} 24486 24487@Article{ ahn:solution, 24488 author = {B--H. Ahn}, 24489 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 24490 journal = {Journal of Optimization Theory and Applications}, 24491 year = {1981}, 24492 volume = {33}, 24493 pages = {175--185} 24494} 24495 24496@Article{ al-fahed.stavroulakis.ea:hard, 24497 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24498 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 24499 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 24500 volume = {71}, 24501 year = {1991}, 24502 pages = {257--265} 24503} 24504 24505@Article{ al-fahed.stavroulakis.ea:linear, 24506 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24507 title = {A linear complementarity approach to the frictionless gripper}, 24508 journal = {International Journal of Robotic Research}, 24509 volume = {11}, 24510 year = {1992}, 24511 pages = {112--122} 24512} 24513 24514@Article{ al-khayyal.falk:jointly, 24515 author = {F. A. Al--Khayyal and J. E. Falk}, 24516 title = {Jointly Constrained Biconvex Programming}, 24517 journal = {Mathematics of Operations Research}, 24518 year = {1983}, 24519 volume = {8}, 24520 pages = {273--286} 24521} 24522 24523@Article{ al-khayyal.kyparisis:finite, 24524 author = {F. A. Al--Khayyal and J. Kyparisis}, 24525 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 24526 Inequalities}, 24527 journal = {Journal of Optimization Theory and Applications}, 24528 year = {1991}, 24529 volume = {70}, 24530 pages = {319--332} 24531} 24532 24533@PhDThesis{ al-khayyal:biconvex, 24534 author = {F. A. Al--Khayyal}, 24535 title = {Biconvex Programming and Biconcave Minimization}, 24536 year = {1977}, 24537 school = {The George Washington University} 24538} 24539 24540@Article{ alart.curnier:mixed, 24541 author = {P. Alart and A. Curnier}, 24542 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 24543 solution methods}, 24544 journal = {Computer Methods in Applied Mechanics and Engineering}, 24545 volume = {92}, 24546 year = {1991}, 24547 pages = {353--375} 24548} 24549 24550@Misc{ alexander.kellog.ea:piecewise, 24551 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 24552 title = {Piecewise smooth continuation}, 24553 howpublished = {Manuscript}, 24554 year = {1979} 24555} 24556 24557@InCollection{ alexander.li.ea:piecewise, 24558 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 24559 title = {Piecewise smooth homotopies}, 24560 booktitle = {Homotopy Methods and Global Convergence}, 24561 pages = {1--14}, 24562 publisher = {Plenum Press}, 24563 year = {1983}, 24564 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 24565 address = {New York} 24566} 24567 24568@InCollection{ alexander:topological, 24569 author = {J.~C. Alexander}, 24570 title = {The topological theory of an embedding method}, 24571 booktitle = {Continuation Methods}, 24572 pages = {37--68}, 24573 publisher = {Academic Press}, 24574 year = {1978}, 24575 editor = {H. Wacker}, 24576 address = {New York} 24577} 24578 24579@Book{ allen:probability, 24580 author = {A. O. Allen}, 24581 title = {Probability, Statistics and Queueing Theory}, 24582 publisher = {Academic Press}, 24583 year = {1990}, 24584 address = {London}, 24585 edition = {Second} 24586} 24587 24588@Book{ allgower.georg:numerical, 24589 author = {E. L. Allgower and K. Georg}, 24590 title = {Numerical Continuation Methods, An Introduction}, 24591 publisher = {Springer-Verlag}, 24592 year = {1990}, 24593 address = {Berlin} 24594} 24595 24596@InProceedings{ allgower.georg:predictor-corrector, 24597 crossref = {bachem.grotschel.ea:mathematical}, 24598 author = {E. L. Allgower and K. Georg}, 24599 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 24600 Zero Points of Nonlinear Mappings}, 24601 pages = {15--56} 24602} 24603 24604@Article{ aluffi-pentini.parisi.ea:algorithm, 24605 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 24606 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 24607 Algorithm}, 24608 journal = {ACM Transactions on Mathematical Software}, 24609 year = {1988}, 24610 volume = {14}, 24611 pages = {366--380} 24612} 24613 24614@Article{ anandalingam.friesz:hierarchical, 24615 author = {G. Anandalingam and T. L. Friesz}, 24616 title = {Hierarchical Optimization: An Introduction}, 24617 journal = {Annals of Operations Research}, 24618 year = {1992}, 24619 volume = {34}, 24620 pages = {1--11} 24621} 24622 24623@Article{ anandalingam.white:solution, 24624 author = {G. Anandalingam and D. J. White}, 24625 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 24626 Functions}, 24627 journal = {IEEE Transactions on Automatic Control}, 24628 year = {1990}, 24629 volume = {35}, 24630 number = {10}, 24631 pages = {1170--1173} 24632} 24633 24634@Article{ andersen.andersen:presolving, 24635 author = {E. Andersen and K. Andersen}, 24636 title = {Presolving in Linear Programming}, 24637 year = {1995}, 24638 journal = {Mathematical Programming}, 24639 volume = {71}, 24640 pages = {221--245} 24641} 24642 24643@InProceedings{ andersen.ye:homogeneous, 24644 author = {E. Andersen and Y. Ye}, 24645 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 24646 Equality Constraints}, 24647 crossref = {ferris.pang:complementarity}, 24648 pages = {1--11} 24649} 24650 24651@Book{ anderson.bai.ea:lapack, 24652 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 24653 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 24654 Sorensen}, 24655 title = {{LAPACK} User's Guide}, 24656 publisher = {SIAM}, 24657 year = {1995}, 24658 address = {Philadelphia, Pennsylvania}, 24659 edition = {Second} 24660} 24661 24662@Article{ anderson.ferris:direct, 24663 author = {E. J. Anderson and M. C. Ferris}, 24664 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 24665 year = {2001}, 24666 journal = {SIAM Journal on Optimization, forthcoming}, 24667 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 24668 key = {55} 24669} 24670 24671@InProceedings{ anderson.ferris:genetic, 24672 author = {E. J. Anderson and M. C. Ferris}, 24673 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 24674 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 24675 Waterloo, Ontario, Canada, May 28--30}, 24676 publisher = {University of Waterloo Press}, 24677 key = {14}, 24678 year = {1990} 24679} 24680 24681@Article{ anderson.ferris:genetic*1, 24682 author = {E. J. Anderson and M. C. Ferris}, 24683 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 24684 Problem}, 24685 journal = {ORSA Journal on Computing}, 24686 year = {1994}, 24687 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 24688 volume = {6}, 24689 pages = {161--173}, 24690 key = {22} 24691} 24692 24693@InProceedings{ anderson.ferris:parallel, 24694 author = {E. J. Anderson and M. C. Ferris}, 24695 title = {Parallel Genetic Algorithms in Optimization}, 24696 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 24697 Computing, Chicago, Illinois, December 11-13}, 24698 year = {1989}, 24699 key = {12} 24700} 24701 24702@Unpublished{ anderson.lewis:primal, 24703 author = {E. J. Anderson and A. S. Lewis}, 24704 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24705 note = {In preparation} 24706} 24707 24708@Book{ anderson.nash:linear, 24709 author = {E. J. Anderson and P. Nash}, 24710 title = {Linear Programming in Infinite--Dimensional Spaces}, 24711 year = {1987}, 24712 publisher = {John Wiley \& Sons}, 24713 address = {Chichester} 24714} 24715 24716@InProceedings{ anderson:primal, 24717 author = {E. J. Anderson}, 24718 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24719 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 24720 Programming, Cambridge, September 1984}, 24721 year = {1985}, 24722 editor = {E. J. Anderson and A. B. Philpott}, 24723 publisher = {Springer-Verlag}, 24724 address = {Berlin} 24725} 24726 24727@Article{ andradottir:method, 24728 author = {S. Andrad\'{o}ttir}, 24729 title = {A Method of Discrete Stochastic Optimization}, 24730 journal = {Management Science}, 24731 year = {1995}, 24732 volume = {41}, 24733 pages = {1946--1961} 24734} 24735 24736@Article{ andradottir:global, 24737 author = {S. Andrad\'{o}ttir}, 24738 title = {A Global Search Method for Discrete Stochastic Optimization}, 24739 journal = {SIAM Journal on Optimization}, 24740 year = {1996}, 24741 volume = {6}, 24742 pages = {513--530} 24743} 24744 24745@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 24746 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 24747 title = {An infeasible--interior--point predictor--corrector algorithm for the 24748 {P}$_x$--geometric {LCP}}, 24749 institution = {Department of Mathematics, The University of Iowa}, 24750 address = {Iowa City, Iowa}, 24751 year = {1994}, 24752 number = {62}, 24753 type = {Reports on Computational Mathematics} 24754} 24755 24756@TechReport{ anitescu.potra:formulating, 24757 author = {M. Anitescu and F. A. Potra}, 24758 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 24759 Linear Complementarity Problems}, 24760 institution = {Department of Mathematics, The University of Iowa}, 24761 year = {1996}, 24762 type = {Report}, 24763 number = {93}, 24764 address = {Iowa City, Iowa} 24765} 24766 24767@Article{ anstreicher.lee.ea:crashing, 24768 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 24769 title = {Crashing a Maximum-Weight Complementarity Basis}, 24770 journal = {Mathematical Programming}, 24771 year = {1992}, 24772 volume = {54}, 24773 pages = {281--294} 24774} 24775 24776@Article{ anstreicher:combined, 24777 author = {K. M. Anstreicher}, 24778 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 24779 programming}, 24780 journal = {Mathematical Programming}, 24781 year = {1991}, 24782 volume = {52}, 24783 pages = {429--440} 24784} 24785 24786@Article{ anstreicher:combined*1, 24787 author = {K. M. Anstreicher}, 24788 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 24789 journal = {Mathematical Programming}, 24790 year = {1989}, 24791 volume = {43}, 24792 pages = {209--223} 24793} 24794 24795@InCollection{ arbenz.gander.ea:remote, 24796 author = {P. Arbenz and W. Gander and M. Oettli}, 24797 title = {The Remote Computational System}, 24798 booktitle = {High-Performance Computation and Networks}, 24799 publisher = {Springer-Verlag}, 24800 year = {1996}, 24801 volume = {1067}, 24802 series = {Lecture Notes in Computer Science}, 24803 pages = {662--667} 24804} 24805 24806@InCollection{ arcus:comsoal, 24807 author = {A. L. Arcus}, 24808 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 24809 booktitle = {Readings in Production and Operations Management}, 24810 year = {1966}, 24811 editor = {E. S. Buffa}, 24812 publisher = {John Wiley \& Sons}, 24813 address = {New York} 24814} 24815 24816@TechReport{ arioli.chan.ea:computing, 24817 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 24818 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 24819 Optimization Calculations}, 24820 institution = {CERFACS}, 24821 year = {1993}, 24822 number = {TR/PA/93/34} 24823} 24824 24825@Article{ armijo:minimization, 24826 author = {L. Armijo}, 24827 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 24828 Derivatives}, 24829 journal = {Pacific Journal of Mathematics}, 24830 year = {1966}, 24831 volume = {16}, 24832 pages = {1--3} 24833} 24834 24835@Article{ arrow.debreu:existence, 24836 author = {K. Arrow and G. Debreu}, 24837 title = {Existence of Equilibrium for a Competitive Economy}, 24838 journal = {Econometrica}, 24839 year = {1954}, 24840 volume = {22}, 24841 pages = {265--290} 24842} 24843 24844@InCollection{ arrow.solow:gradient, 24845 author = {K. J. Arrow and R. M. Solow}, 24846 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 24847 booktitle = {Studies in Linear and Nonlinear Programming}, 24848 year = {1958}, 24849 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 24850 publisher = {Stanford University Press}, 24851 address = {Stanford, California}, 24852 pages = {166--176} 24853} 24854 24855@Book{ aubin.ekeland:nonlinear, 24856 author = {J.-P. Aubin and I. Ekeland}, 24857 title = {Applied nonlinear analysis}, 24858 publisher = {John Wiley \& Sons}, 24859 address = {New York}, 24860 year = {1984} 24861} 24862 24863@Article{ auchmuty:variational, 24864 author = {G. Auchmuty}, 24865 title = {Variational Principles for Variational Inequalities}, 24866 journal = {Numerical Functional Analysis and Optimization}, 24867 year = {1989}, 24868 volume = {10}, 24869 pages = {863--874} 24870} 24871 24872@Book{ auerbach.kotlikoff:dynamic, 24873 author = {A. J. Auerbach and L. J. Kotlikoff}, 24874 title = {Dynamic Fiscal Policy}, 24875 publisher = {Cambridge University Press}, 24876 address = {Cambridge, England}, 24877 year = {1987} 24878} 24879 24880@InProceedings{ ault.deutsch.ea:interpolating, 24881 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 24882 title = {Interpolating Subspaces in Approximation Theory}, 24883 booktitle = {Approximation Theory}, 24884 year = {1970}, 24885 editor = {A. Talbot}, 24886 publisher = {Academic Press}, 24887 address = {London} 24888} 24889 24890@Article{ auslender.crouzeix:global, 24891 author = {A. A. Auslender and J.--P. Crouzeix}, 24892 title = {Global Regularity Theorems}, 24893 journal = {Mathematics of Operations Research}, 24894 year = {1988}, 24895 volume = {13}, 24896 pages = {243--253} 24897} 24898 24899@Article{ auslender.haddou:interior-proximal, 24900 author = {A. Auslender and M. Haddou}, 24901 title = {An interior-proximal method for convex linearly constrained problems and its 24902 extension to variational inequalities}, 24903 year = {1995}, 24904 journal = {Mathematical Programming}, 24905 pages = {77--100}, 24906 volume = {71} 24907} 24908 24909@Article{ auslender:convergence, 24910 author = {A. Auslender}, 24911 title = {Convergence of stationary sequences for variational inequalities with maximal 24912 monotone operators}, 24913 journal = {Applied Mathematics and Optimization}, 24914 volume = {28}, 24915 year = {1993}, 24916 pages = {161--172} 24917} 24918 24919@Book{ auslender:optimization, 24920 author = {A. Auslender}, 24921 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 24922 year = {1976}, 24923 publisher = {Masson}, 24924 address = {Paris} 24925} 24926 24927@TechReport{ averick.carter.ea:minpack-2, 24928 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 24929 title = {The {MINPACK-2} Test Problem Collection}, 24930 institution = {Argonne National Laboratory}, 24931 year = {1992}, 24932 address = {Argonne, Illinois}, 24933 number = {MCS-P153-0692} 24934} 24935 24936@TechReport{ axline.billups.ea:guidelines, 24937 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 24938 title = {Guidelines for Software Security ({U})}, 24939 institution = {SNL}, 24940 year = {1989}, 24941 month = oct, 24942 address = {Albuquerque, New Mexico}, 24943 number = {SAND88-2955} 24944} 24945 24946@Article{ ayres.walter:greenhouse, 24947 author = {R. U. Ayres and J. Walter}, 24948 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 24949 journal = {Environmental and Resource Economics}, 24950 year = {1991}, 24951 volume = {1}, 24952 pages = {237--270} 24953} 24954 24955@PhDThesis{ bagley:behaviour, 24956 author = {J. D. Bagley}, 24957 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 24958 Algorithms}, 24959 year = {1967}, 24960 school = {University of Michigan} 24961} 24962 24963@Article{ bain.stewart:application, 24964 author = {R. S. Bain and W. E. Stewart}, 24965 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 24966 Algebraic Equation Systems}, 24967 journal = {Computers in Chemical Engineering}, 24968 year = {1991}, 24969 volume = {15}, 24970 pages = {203--208} 24971} 24972 24973@Article{ baker.lasdon:successive, 24974 author = {T. E. Baker and L. S. Lasdon}, 24975 title = {Successive Linear Programming at {E}xxon}, 24976 journal = {Management Science}, 24977 year = {1985}, 24978 volume = {31}, 24979 pages = {264--274} 24980} 24981 24982@InProceedings{ baker:reducing, 24983 crossref = {grefenstette:genetic}, 24984 author = {J. E. Baker}, 24985 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 24986 pages = {14--21} 24987} 24988 24989@Article{ balas.zemel:algorithm, 24990 author = {E. Balas and E. Zemel}, 24991 title = {An Algorithm for Large Zero--One Knapsack Problems}, 24992 journal = {Operations Research}, 24993 year = {1980}, 24994 volume = {28}, 24995 pages = {1132--1154} 24996} 24997 24998@Book{ ballard.fullerton.ea:general, 24999 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 25000 title = {A General Equilibrium Model for Tax Policy Evaluation}, 25001 publisher = {The University of Chicago Press}, 25002 year = {1985}, 25003 series = {National Bureau of Economic Research Monograph} 25004} 25005 25006@InProceedings{ balog.angelos.ea:dose, 25007 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 25008 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 25009 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 25010 Radiation Therapy, Salt Lake City}, 25011 year = {1997}, 25012 editor = {D. D. Leavitt and G. Starkshall}, 25013 publisher = {Medical Physics Publishing}, 25014 address = {St. Louis, Missouri}, 25015 pages = {323--326} 25016} 25017 25018@Article{ baraff:fast, 25019 author = {D. Baraff}, 25020 title = {Fast contact force computation for nonpenetrating rigid bodies}, 25021 journal = {Computer Graphics (Proceedings SIGRAPH)}, 25022 year = {1994}, 25023 pages = {23--34}, 25024 volume = {28} 25025} 25026 25027@Article{ baraff:issues, 25028 author = {D. Baraff}, 25029 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 25030 journal = {Algorithmica}, 25031 volume = {10}, 25032 year = {1993}, 25033 pages = {292--352} 25034} 25035 25036@Book{ barrett.berry.ea:templates, 25037 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 25038 Methods}, 25039 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 25040 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 25041 year = {1994}, 25042 publisher = {SIAM}, 25043 address = {Philadelphia, Pennsylvania} 25044} 25045 25046@Article{ bard:algorithm, 25047 author = {J. F. Bard}, 25048 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 25049 journal = {Mathematics of Operations Research}, 25050 year = {1983}, 25051 volume = {8}, 25052 pages = {260--272} 25053} 25054 25055@Article{ bard:convex, 25056 author = {J. F. Bard}, 25057 title = {Convex Two-Level Optimization}, 25058 journal = {Mathematical Programming}, 25059 year = {1988}, 25060 volume = {40}, 25061 pages = {15--27} 25062} 25063 25064@InCollection{ bard:eclectic, 25065 author = {Y. Bard}, 25066 title = {An Eclectic Approach to Nonlinear Programming}, 25067 booktitle = {Optimization}, 25068 publisher = {University of Queensland Press}, 25069 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 25070 year = {1972}, 25071 address = {St. Lucia, Queensland, Australia}, 25072 pages = {116--128} 25073} 25074 25075@Article{ barnes:variation, 25076 author = {E. R. Barnes}, 25077 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 25078 journal = {Mathematical Programming}, 25079 year = {1986}, 25080 volume = {36}, 25081 pages = {174--182} 25082} 25083 25084@Article{ bartels.golub:simplex, 25085 author = {R. H. Bartels and G. H. Golub}, 25086 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 25087 journal = {Communications of the Asociation for Computing Machinery}, 25088 year = {1969}, 25089 volume = {12}, 25090 pages = {266--268} 25091} 25092 25093@Article{ barton.ivey:nelder, 25094 author = {R. Barton and J. S. Ivey}, 25095 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 25096 journal = {Management Science}, 25097 year = {1996}, 25098 volume = {42}, 25099 number = {7}, 25100 pages = {954--973} 25101} 25102 25103@Article{ battiti:first-, 25104 author = {R. Battiti}, 25105 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 25106 {N}ewton's Method}, 25107 journal = {Neural Computation}, 25108 year = {1992}, 25109 volume = {4}, 25110 pages = {141--166} 25111} 25112 25113@Article{ baudet:asynchronous, 25114 author = {G. M. Baudet}, 25115 title = {Asynchronous iterative methods for multiprocesors}, 25116 journal = {Journal of the Association for Computing Machinery}, 25117 year = {1978}, 25118 volume = {25}, 25119 pages = {226--244} 25120} 25121 25122@InProceedings{ baum.haussler:what, 25123 author = {E. B. Baum and D. Haussler}, 25124 title = {What Size Net Gives Valid Generalization}, 25125 booktitle = {Advances in Neural Information Processing Systems I}, 25126 year = {1989}, 25127 editor = {D. S. Touretzky}, 25128 publisher = {Morgan Kaufmann}, 25129 address = {San Mateo, California}, 25130 pages = {81--90} 25131} 25132 25133@Misc{ baum:private, 25134 author = {E. B. Baum}, 25135 title = {Private Communication}, 25136 year = {1992}, 25137 address = {NEC Research Institute, Princeton, New Jersey} 25138} 25139 25140@Book{ bazaraa.sherali.ea:nonlinear, 25141 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 25142 title = {Nonlinear Programming}, 25143 edition = {Second}, 25144 publisher = {John Wiley and Sons}, 25145 address = {New York}, 25146 year = {1993} 25147} 25148 25149@Book{ bazaraa.shetty:nonlinear, 25150 author = {M. S. Bazaraa and C. M. Shetty}, 25151 title = {Nonlinear Programming: Theory and Algorithms}, 25152 publisher = {John Wiley \& Sons}, 25153 year = {1979}, 25154 address = {New York, New York} 25155} 25156 25157@Article{ beale:cycling, 25158 author = {E. M. L. Beale}, 25159 title = {Cycling in the Dual Simplex Method}, 25160 journal = {Naval Research Logistics Quarterly}, 25161 year = {1955}, 25162 volume = {2}, 25163 pages = {103--107} 25164} 25165 25166@InProceedings{ becker.cun:improving, 25167 author = {S. Becker and Y. le Cun}, 25168 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 25169 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 25170 year = {1988}, 25171 editor = {D. S. Touretzky}, 25172 publisher = {Morgan Kaufmann}, 25173 address = {San Mateo, California}, 25174 pages = {29--37} 25175} 25176 25177@Book{ ben-israel.ben-tal.ea:optimality, 25178 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 25179 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 25180 year = {1981}, 25181 publisher = {John Wiley \& Sons}, 25182 address = {New York} 25183} 25184 25185@Article{ ben-israel:newton-raphson, 25186 author = {A. Ben--Israel}, 25187 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 25188 journal = {Journal of Mathematical Analysis and its Applications}, 25189 year = {1966}, 25190 volume = {15}, 25191 pages = {243--252} 25192} 25193 25194@Article{ ben-tal.melman.ea:curved, 25195 author = {A. Ben--Tal and A. Melman and J. Zowe}, 25196 title = {Curved Search Methods for Unconstrained Optimization}, 25197 journal = {Optimization}, 25198 year = {1990}, 25199 volume = {21}, 25200 pages = {669--695}, 25201 publisher = {John Wiley \& Sons}, 25202 address = {New York} 25203} 25204 25205@InProceedings{ bennett.ferris.ea:genetic, 25206 crossref = {belew.booker:fourth}, 25207 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 25208 title = {A Genetic Algorithm for Database Query Optimization}, 25209 pages = {400--407}, 25210 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 25211 key = {19} 25212} 25213 25214@Article{ bennett.mangasarian:bilinear, 25215 author = {K. P. Bennett and O. L. Mangasarian}, 25216 title = {Bilinear Separation of Two Sets in n-Space}, 25217 journal = {Computational Optimization and Applications}, 25218 year = {1993}, 25219 volume = {2}, 25220 pages = {207--227} 25221} 25222 25223@Article{ bennett.mangasarian:multicategory, 25224 author = {K. P. Bennett and O. L. Mangasarian}, 25225 title = {Multicategory Separation via Linear Programming}, 25226 journal = {Optimization Methods and Software}, 25227 year = {1993}, 25228 volume = {3}, 25229 pages = {27--39} 25230} 25231 25232@InProceedings{ bennett.mangasarian:neural, 25233 author = {K. P. Bennett and O. L. Mangasarian}, 25234 title = {Neural Network Training via Linear Programming}, 25235 booktitle = {Advances in Optimization and Parallel Computing}, 25236 year = {1992}, 25237 editor = {P. M. Pardalos}, 25238 publisher = {North Holland}, 25239 address = {Amsterdam}, 25240 pages = {56--67} 25241} 25242 25243@Article{ bennett.mangasarian:robust, 25244 author = {K. P. Bennett and O. L. Mangasarian}, 25245 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 25246 journal = {Optimization Methods and Software}, 25247 year = {1992}, 25248 volume = {1}, 25249 pages = {23--34} 25250} 25251 25252@Article{ bennett.mangasarian:serial, 25253 author = {K. P. Bennett and O. L. Mangasarian}, 25254 title = {Serial and Parallel Multicategory Separation}, 25255 journal = {SIAM Journal on Optimization}, 25256 year = {1994}, 25257 volume = {4}, 25258 pages = {722--734} 25259} 25260 25261@TechReport{ bennett.wu.ea:support, 25262 author = {K. P. Bennett and D. Wu and L. Auslender}, 25263 title = {On Support Vector Decision Trees for Database Marketing}, 25264 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 25265 year = {1998}, 25266 optkey = {}, 25267 opttype = {RPI Math Report}, 25268 optnumber = {98-100}, 25269 optaddress = {Troy, New York}, 25270 optmonth = {}, 25271 optnote = {}, 25272 optannote = {} 25273} 25274 25275@InProceedings{ bennett:decision, 25276 author = {K. P. Bennett}, 25277 title = {Decision Tree Construction Via Linear Programming}, 25278 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 25279 Society Conference}, 25280 year = {1992}, 25281 editor = {M. Evans}, 25282 address = {Utica, Illinois}, 25283 pages = {97--101} 25284} 25285 25286@Book{ berge.ghouila-houri:programming, 25287 author = {C. Berge and A. Ghouila-Houri}, 25288 title = {Programming, Games and Transportation Networks}, 25289 year = {1965}, 25290 publisher = {John Wiley \& Sons}, 25291 address = {New York} 25292} 25293 25294@Book{ berge:topological, 25295 author = {C. Berge}, 25296 title = {Topological Spaces}, 25297 year = {1963}, 25298 publisher = {McMillan}, 25299 address = {New York} 25300} 25301 25302@TechReport{ berkelaar.jansen.ea:basis, 25303 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 25304 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 25305 Complementarity Problems}, 25306 institution = {Department of Econometrics and Operations Research}, 25307 year = {1996}, 25308 address = {Erasmus University, Rotterdam, The Netherlands} 25309} 25310 25311@Article{ bertsekas.baz:distributed, 25312 author = {D. P. Bertsekas and D. El Baz}, 25313 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 25314 journal = {SIAM Journal on Control and Optimization}, 25315 year = {1987}, 25316 volume = {25}, 25317 pages = {74--85} 25318} 25319 25320@Article{ bertsekas.gafni:projection, 25321 author = {D. P. Bertsekas and E. M. Gafni}, 25322 title = {Projection Methods for Variational Inequalities with Application to the Traffic 25323 Assignment Problem}, 25324 journal = {Mathematical Programming Study}, 25325 year = {1982}, 25326 volume = {17}, 25327 pages = {139--159} 25328} 25329 25330@Article{ bertsekas.hossein.ea:relaxation, 25331 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 25332 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 25333 journal = {SIAM Journal on Control and Optimization}, 25334 year = {1987}, 25335 volume = {25}, 25336 pages = {1219--1243} 25337} 25338 25339@Unpublished{ bertsekas.tseng:partial, 25340 author = {D. P. Bertsekas and P. Tseng}, 25341 title = {Partial Proximal Minimization for Convex Programming}, 25342 year = {1991}, 25343 note = {Manuscript} 25344} 25345 25346@Article{ bertsekas.tsitsiklis:analysis, 25347 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25348 title = {An Analysis of Stochastic Shortest Path Problems}, 25349 journal = {Mathematics of Operations Research}, 25350 year = {1991}, 25351 volume = {16}, 25352 pages = {580--595} 25353} 25354 25355@Book{ bertsekas.tsitsiklis:parallel, 25356 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25357 title = {Parallel and Distributed Computation: Numerical Methods}, 25358 publisher = {Prentice-Hall, Inc}, 25359 year = {1989}, 25360 address = {Englewood Cliffs, New Jersey} 25361} 25362 25363@Book{ bertsekas:constrained, 25364 author = {D. P. Bertsekas}, 25365 title = {Constrained Optimization and Lagrange Multiplier Methods}, 25366 year = {1982}, 25367 publisher = {Academic Press}, 25368 address = {New York} 25369} 25370 25371@Book{ bertsekas:dynamic, 25372 author = {D. P. Bertsekas}, 25373 title = {Dynamic Programming and Optimal Control}, 25374 publisher = {Athena Scientific}, 25375 year = {1995}, 25376 address = {Belmont MA} 25377} 25378 25379@Article{ bertsekas:enlarging, 25380 author = {D. P. Bertsekas}, 25381 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 25382 Optimization}, 25383 journal = {Journal of Optimization Theory and Applications}, 25384 year = {1982}, 25385 volume = {36}, 25386 pages = {221--252} 25387} 25388 25389@Article{ bertsekas:goldstein-levitin-poljak, 25390 author = {D. P. Bertsekas}, 25391 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 25392 journal = {IEEE Transactions on Automatic Control}, 25393 year = {1976}, 25394 volume = {AC-21}, 25395 pages = {174--184} 25396} 25397 25398@Article{ bertsekas:multiplier, 25399 author = {D. P. Bertsekas}, 25400 title = {Multiplier Methods: {A} Survey}, 25401 journal = {Automatica}, 25402 year = {1976}, 25403 volume = {12}, 25404 pages = {133--145} 25405} 25406 25407@Article{ bertsekas:necessary, 25408 author = {D. P. Bertsekas}, 25409 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 25410 journal = {Mathematical Programming}, 25411 year = {1975}, 25412 volume = {9}, 25413 pages = {87--99} 25414} 25415 25416@Book{ bertsekas:nonlinear, 25417 author = {D. P. Bertsekas}, 25418 title = {Nonlinear Programming}, 25419 publisher = {Athena Scientific}, 25420 year = {1995}, 25421 address = {Belmont, Massachusetts} 25422} 25423 25424@Article{ bertsekas:projected, 25425 author = {Dimitri P. Bertsekas}, 25426 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 25427 journal = {SIAM Journal on Control and Optimization}, 25428 year = {1982}, 25429 volume = {20}, 25430 pages = {221--246} 25431} 25432 25433@Article{ billups.dirkse.ea:comparison, 25434 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 25435 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 25436 journal = {Computational Optimization and Applications}, 25437 year = {1997}, 25438 pages = {3--25}, 25439 volume = {7}, 25440 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 25441 key = {51} 25442} 25443 25444@Article{ billups.ferris:convergence, 25445 author = {S. C. Billups and M. C. Ferris}, 25446 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 25447 Starting Points}, 25448 journal = {SIAM Journal on Optimization}, 25449 year = {1996}, 25450 volume = {6}, 25451 pages = {316--325}, 25452 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 25453 key = {34} 25454} 25455 25456@TechReport{ billups.ferris:convergence*1, 25457 author = {S. C. Billups and M. C. Ferris}, 25458 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 25459 Points}, 25460 institution = {Computer Sciences Department, University of Wisconsin}, 25461 year = {1993}, 25462 address = {Madison, Wisconsin}, 25463 number = {1180}, 25464 note = {Revised version in SIAM Journal on Optimization.} 25465} 25466 25467@Article{ billups.ferris:qpcomp, 25468 author = {S. C. Billups and M. C. Ferris}, 25469 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 25470 year = {1997}, 25471 journal = {Mathematical Programming}, 25472 pages = {533--562}, 25473 volume = {76}, 25474 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 25475 key = {47} 25476} 25477 25478@Article{ billups.ferris:solutions, 25479 author = {S. C. Billups and M. C. Ferris}, 25480 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 25481 journal = {Mathematics of Operations Research}, 25482 volume = {24}, 25483 pages = {219--236}, 25484 year = {1999}, 25485 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 25486 key = {42}, 25487 institution = {Computer Sciences Department, University of Wisconsin}, 25488 address = {Madison, Wisconsin}, 25489 type = {Mathematical Programming Technical Report}, 25490 number = {94--15} 25491} 25492 25493@TechReport{ billups.murata.ea:users, 25494 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 25495 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 25496 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 25497 institution = {SNL}, 25498 year = {1994}, 25499 month = jan, 25500 address = {Albuquerque, New Mexico}, 25501 number = {SAND91--1482} 25502} 25503 25504@TechReport{ billups.speight.ea:nonmonotone, 25505 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 25506 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 25507 Problems}, 25508 institution = {Department of Mathematics, University of Colorado}, 25509 year = {1999}, 25510 address = {Denver, Colorado} 25511} 25512 25513@PhDThesis{ billups:algorithms, 25514 author = {S. C. Billups}, 25515 title = {Algorithms for Complementarity Problems and Generalized Equations}, 25516 school = {University of Wisconsin--Madison}, 25517 year = {1995}, 25518 address = {Madison, Wisconsin}, 25519 month = aug 25520} 25521 25522@MastersThesis{ billups:augmented, 25523 author = {S. C. Billups}, 25524 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 25525 school = {Virginia Tech}, 25526 year = {1985}, 25527 address = {Blacksburg, Virginia} 25528} 25529 25530@TechReport{ billups:homotopy, 25531 author = {S. C. Billups}, 25532 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 25533 institution = {Department of Mathematics, University of Colorado}, 25534 year = {1998}, 25535 address = {Denver, Colorado} 25536} 25537 25538@Article{ billups:improving, 25539 author = {S. C. Billups}, 25540 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 25541 Proximal Perturbations}, 25542 year = {2000}, 25543 journal = {Mathematical Programming}, 25544 volume = {87}, 25545 pages = {153--176} 25546} 25547 25548@Book{ birge.louveaux:introduction, 25549 author = {J. R. Birge and R. Louveaux}, 25550 title = {Introduction to Stochastic Programming}, 25551 publisher = {Springer}, 25552 address = {New York}, 25553 year = {1997} 25554} 25555 25556@TechReport{ bischof.carle.ea:adifor, 25557 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 25558 title = {{ADIFOR} 2.0 User's Guide}, 25559 institution = {Argonne National Laboratory}, 25560 year = {1995}, 25561 address = {Argonne, Illinois}, 25562 number = {ANL/MCS--TM--192}, 25563 type = {Mathematics and Computer Science Division Report} 25564} 25565 25566@Book{ bisschop.entriken:aimms, 25567 author = {J. Bisschop and R. Entriken}, 25568 title = {{AIMMS} -- The Modeling System}, 25569 year = {1993}, 25570 publisher = {Paragon Decision Technology}, 25571 address = {Haarlem, The Netherlands} 25572} 25573 25574@Article{ bisschop.meeraus:development, 25575 author = {J. Bisschop and A. Meeraus}, 25576 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 25577 Environment}, 25578 journal = {Mathematical Programming Study}, 25579 year = {1982}, 25580 volume = {20}, 25581 pages = {1--29} 25582} 25583 25584@Misc{ bixby.ceria.ea:miplib, 25585 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 25586 title = {{MIPLIB} 3.0}, 25587 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 25588} 25589 25590@InProceedings{ bjorkman.klarbring.ea:sequential, 25591 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 25592 Sj{\"{o}}din}, 25593 title = {Sequential quadratic programming for non-linear elastic contact problems}, 25594 editor = {J. Herskovits}, 25595 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 25596 Systems}, 25597 volume = {2}, 25598 year = {1993}, 25599 pages = {301--308} 25600} 25601 25602@Article{ bjorkman:path, 25603 author = {G. Bj{\"o}rkman}, 25604 title = {Path Following and Critical Points for Contact Problems}, 25605 journal = {Computational Mechanics}, 25606 volume = {10}, 25607 pages = {231--246}, 25608 year = {1992} 25609} 25610 25611@Article{ bjorkman:solution, 25612 author = {G. Bj{\"o}rkman}, 25613 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 25614 of Linear Complementarity Problems}, 25615 journal = {International Journal for Numerical Methods in Engineering}, 25616 volume = {31}, 25617 pages = {1553--1566}, 25618 year = {1991} 25619} 25620 25621@Article{ bland:pivot, 25622 author = {R. G. Bland}, 25623 title = {New Pivot Rules for the Simplex Method}, 25624 journal = {Mathematics of Operations Research}, 25625 year = {1977}, 25626 volume = {2}, 25627 pages = {103--107} 25628} 25629 25630@Article{ block.levin:boundedness, 25631 author = {H. D. Block and S. A. Levin}, 25632 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 25633 Inequalities}, 25634 journal = {Proceedings of the American Mathematical Society}, 25635 year = {1970}, 25636 volume = {26}, 25637 pages = {229--235} 25638} 25639 25640@Book{ bloomer:power, 25641 author = {J. Bloomer}, 25642 title = {Power Programming with {RPC}}, 25643 publisher = {O'Reilly and Associates, Inc.}, 25644 address = {Sebastopol, CA}, 25645 year = {1992} 25646} 25647 25648@InProceedings{ blum.rivest:training, 25649 author = {A. Blum and R. L. Rivest}, 25650 title = {Training a 3-Node Neural Network is {NP}-Complete}, 25651 booktitle = {Advances in Neural Information Processing Systems I}, 25652 year = {1989}, 25653 editor = {D. S. Touretzky}, 25654 publisher = {Morgan Kaufmann}, 25655 address = {San Mateo, California}, 25656 pages = {494--501} 25657} 25658 25659@InProceedings{ boehringer.ferris.ea:exemptions, 25660 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 25661 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 25662 from a General Equilibrium Model for Six {EU} Countries}, 25663 key = {49}, 25664 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 25665 year = {1995} 25666} 25667 25668@Article{ boender.kan:bayesian, 25669 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 25670 title = {Bayesian Stopping Rules for Global Optimization}, 25671 journal = {Mathematical Programming}, 25672 year = {1987}, 25673 volume = {37}, 25674 pages = {59--80} 25675} 25676 25677@Article{ boggs:convergence, 25678 author = {P. T. Boggs}, 25679 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 25680 Problems}, 25681 journal = {Mathematics of Computation}, 25682 year = {1976}, 25683 volume = {30}, 25684 pages = {512--522} 25685} 25686 25687@InProceedings{ bolzon.cochetti.ea:computing, 25688 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 25689 title = {On computing all solutions in decohesion}, 25690 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 25691 International Congress of Theoretical and Applied Mechanics}, 25692 year = {1996}, 25693 address = {Kyoto} 25694} 25695 25696@InProceedings{ bolzon.maier.ea:holonomic, 25697 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25698 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 25699 study of mathematical programming approaches}, 25700 booktitle = {Fracture Mechanics of Concrete Structures}, 25701 editor = {F. H. Wittmann}, 25702 series = {Second International Conference on Fracture Mechanics of Concrete Structures 25703 (FRAMCOS 2)}, 25704 year = {1995}, 25705 publisher = {Aedificatio Publishers}, 25706 pages = {885--898} 25707} 25708 25709@InProceedings{ bolzon.maier.ea:holonomic*1, 25710 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25711 title = {On holonomic structural analysis as a complementarity problem}, 25712 booktitle = {APCOM96, Seoul}, 25713 year = {1996} 25714} 25715 25716@Article{ bolzon.maier.ea:multiplicity, 25717 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25718 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 25719 journal = {Computational Mechanics}, 25720 year = {1997}, 25721 volume = {19}, 25722 pages = {511--516} 25723} 25724 25725@Article{ bongartz.conn.ea:cute, 25726 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 25727 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 25728 year = {1995}, 25729 journal = {{ACM} Transactions on Mathematical Software}, 25730 volume = {21}, 25731 pages = {123--160} 25732} 25733 25734@Article{ boppana:eigenvalues, 25735 author = {R. Boppana}, 25736 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 25737 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 25738 pages = {280--285}, 25739 year = {1987} 25740} 25741 25742@Article{ bortfeld.kahler.ea:x-ray, 25743 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 25744 title = {{X}-ray field compensation with multileaf collimators}, 25745 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25746 year = {1994}, 25747 volume = {28}, 25748 number = {3}, 25749 pages = {723--730} 25750} 25751 25752@Article{ bortfeld.schlegel:optimization, 25753 author = {T. Bortfeld and W. Schlegel}, 25754 title = {Optimization of beam orientations in radiation therapy: some theoretical 25755 considerations}, 25756 journal = {Physics in Medicine and Biology}, 25757 year = {1993}, 25758 volume = {38}, 25759 number = {2}, 25760 pages = {291--304} 25761} 25762 25763@Article{ borwein:stability, 25764 author = {J. M. Borwein}, 25765 title = {Stability and regular points of inequality systems}, 25766 journal = {Journal of Optimization Theory and Applications}, 25767 year = {1986}, 25768 volume = {48}, 25769 pages = {9--52} 25770} 25771 25772@Article{ boyer:present, 25773 author = {A. L. Boyer}, 25774 title = {Present and Future Developments in Radiotherapy Treatment Units}, 25775 journal = {Seminars in Radiation Oncology}, 25776 year = {1995}, 25777 volume = {5}, 25778 number = {2}, 25779 pages = {146--155} 25780} 25781 25782@Article{ bracken.mcgill:mathematical, 25783 author = {J. Bracken and J. T. McGill}, 25784 title = {Mathematical programs with optimization problems in the constraints}, 25785 journal = {Operations Research}, 25786 volume = {21}, 25787 year = {1973}, 25788 pages = {37--44} 25789} 25790 25791@Article{ bradley.fayyad.ea:mathematical, 25792 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 25793 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 25794 journal = {INFORMS Journal on Computing}, 25795 year = {1999}, 25796 volume = {11}, 25797 pages = {217--238} 25798} 25799 25800@TechReport{ bradley.mangasarian.ea:clustering, 25801 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25802 title = {Clustering via Concave Minimization}, 25803 institution = {Computer Sciences Department, University of Wisconsin}, 25804 year = {1996}, 25805 type = {Mathematical Programming Technical Report}, 25806 number = {96-03}, 25807 address = {Madison, Wisconsin} 25808} 25809 25810@TechReport{ bradley.mangasarian.ea:feature, 25811 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25812 title = {Feature Selection via Mathematical Programming}, 25813 institution = {Computer Sciences Department, University of Wisconsin}, 25814 year = {1995}, 25815 type = {Mathematical Programming Technical Report}, 25816 number = {95-21}, 25817 address = {Madison, Wisconsin} 25818} 25819 25820@Article{ bradley.mangasarian:massive, 25821 author = {P. S. Bradley and O. L. Mangasarian}, 25822 title = {Massive Data Discrimination via Linear Support Vector Machines}, 25823 year = {2000}, 25824 journal = {Optimization Methods and Software}, 25825 volume = {13}, 25826 pages = {1-10} 25827} 25828 25829@PhDThesis{ brady:condition, 25830 author = {L. Brady}, 25831 title = {Condition Constants for Solutions of Convex Inequalities}, 25832 year = {1988}, 25833 address = {Madison, Wisconsin}, 25834 school = {Computer Sciences Department, University of Wisconsin} 25835} 25836 25837@Article{ braess:uber, 25838 author = {D. Braess}, 25839 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 25840 journal = {Unternehmensforschung}, 25841 year = {1968}, 25842 volume = {12}, 25843 pages = {258--268} 25844} 25845 25846@Article{ brahme:optimization, 25847 author = {A. Brahme}, 25848 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 25849 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25850 year = {1993}, 25851 volume = {25}, 25852 pages = {373--375} 25853} 25854 25855@Article{ brahme:stationary, 25856 author = {A. Brahme}, 25857 title = {Optimization of stationary and moving beam radiation therapy techniques}, 25858 journal = {Radiother. Oncol.}, 25859 year = {1988}, 25860 volume = {12}, 25861 pages = {129--140} 25862} 25863 25864@InCollection{ brahme:treatment, 25865 author = {A. Brahme}, 25866 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 25867 booktitle = {Radiation Therapy Physics}, 25868 publisher = {Springer-Verlag}, 25869 year = {1995}, 25870 editor = {A. R. Smith}, 25871 address = {Berlin}, 25872 pages = {209--246} 25873} 25874 25875@TechReport{ branch:getting, 25876 author = {M. A. Branch}, 25877 title = {Getting {CUTE} with {M}atlab}, 25878 institution = {Cornell University}, 25879 year = {1994}, 25880 type = {Cornell Theory Center Report}, 25881 number = {CTC94TR194}, 25882 address = {Ithaca, New York} 25883} 25884 25885@Article{ brearley.mitra.ea:analysis, 25886 author = {A. Brearley and G. Mitra and H. Williams}, 25887 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 25888 Algorithm}, 25889 journal = {Mathematical Programming}, 25890 year = {1975}, 25891 volume = {8}, 25892 pages = {54--83} 25893} 25894 25895@Article{ bredensteiner.bennett:feature, 25896 author = {E. Bredensteiner and K. Bennett}, 25897 title = {Feature Minimization within Decision Trees}, 25898 journal = {Computational Optimization and Applications}, 25899 year = {1998}, 25900 volume = {10}, 25901 pages = {111--126} 25902} 25903 25904@Article{ bregman:relaxation, 25905 author = {L. M. Bregman}, 25906 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 25907 Application to the Solution of Problems in Convex Programming}, 25908 journal = {USSR Computational Mathematics and Mathematical Physics}, 25909 year = {1967}, 25910 volume = {7}, 25911 pages = {200--217} 25912} 25913 25914@Book{ brenner.hall:making, 25915 author = {D. J. Brenner and E. J. Hall}, 25916 title = {Making the Radiation Therapy Decision}, 25917 publisher = {Contemporary Books}, 25918 year = {1996}, 25919 address = {Chicago, IL} 25920} 25921 25922@Book{ brent:algorithms, 25923 author = {R. P. Brent}, 25924 title = {Algorithms for Minimization without Derivatives}, 25925 publisher = {Prentice-Hall, Inc}, 25926 year = {1973}, 25927 address = {Englewood Cliffs, New Jersey} 25928} 25929 25930@Article{ brewster.mohan.ea:three, 25931 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 25932 title = {Three dimensional conformal treatment planning with multileaf collimators}, 25933 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25934 year = {1995}, 25935 volume = {33}, 25936 number = {5}, 25937 pages = {1081--1089} 25938} 25939 25940@Article{ brezis.lions:produits, 25941 author = {H. Br\'{e}zis and P.--L. Lions}, 25942 title = {Produits Infinis de Resolvantes}, 25943 journal = {Israel Journal of Mathematics}, 25944 year = {1978}, 25945 volume = {29}, 25946 pages = {329--345} 25947} 25948 25949@Book{ brezis:operateurs, 25950 author = {H. Br\'{e}zis}, 25951 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 25952 Espaces de Hilbert}, 25953 publisher = {North-Holland}, 25954 address = {Amsterdam}, 25955 year = {1973} 25956} 25957 25958@Book{ brooke.kendrick.ea:gams, 25959 author = {A. Brooke and D. Kendrick and A. Meeraus}, 25960 title = {{GAMS}: {A} User's Guide}, 25961 year = {1988}, 25962 publisher = {The Scientific Press}, 25963 address = {South San Francisco, CA} 25964} 25965 25966@Article{ brown.demarzo.ea:computing, 25967 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 25968 title = {Computing Equilibria when Asset Markets Are Incomplete}, 25969 journal = {Econometrica}, 25970 year = {1996}, 25971 volume = {64}, 25972 pages = {1--28} 25973} 25974 25975@Article{ bruck:iterative, 25976 author = {R. E. Bruck}, 25977 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 25978 in {H}ilbert Space}, 25979 journal = {Bulletin of the American Mathematical Society}, 25980 year = {1975}, 25981 volume = {81}, 25982 pages = {890--892} 25983} 25984 25985@Article{ bunch.parlett:direct, 25986 author = {J. R. Bunch and B. N. Parlett}, 25987 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 25988 journal = {SIAM Journal on Numerical Analysis}, 25989 year = {1971}, 25990 volume = {8}, 25991 pages = {639--655} 25992} 25993 25994@Article{ burachik.iusem.ea:enlargement, 25995 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 25996 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 25997 year = {1997}, 25998 journal = {Set-Valued Analysis, forthcoming} 25999} 26000 26001@TechReport{ burachik.iusem:generalized, 26002 author = {R. S. Burachik and A. N. Iusem}, 26003 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 26004 Problem}, 26005 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 26006 year = {1995}, 26007 type = {Working Paper}, 26008 address = {Rio de Janeiro} 26009} 26010 26011@Article{ burachik.iusem:generalized*1, 26012 author = {R. S. Burachik and A. N. Iusem}, 26013 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 26014 {A} {H}ilbert Space}, 26015 year = {1998}, 26016 journal = {SIAM Journal on Optimization}, 26017 volume = {8}, 26018 pages = {197--216} 26019} 26020 26021@Article{ burdakov:globally, 26022 author = {O. P. Burdakov}, 26023 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 26024 of Nonlinear Equations}, 26025 journal = {Soviet Mathematics Doklady}, 26026 year = {1980}, 26027 volume = {22}, 26028 pages = {376--379} 26029} 26030 26031@Article{ burges:tutorial, 26032 author = {C. J. C. Burges}, 26033 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 26034 journal = {Data Mining and Knowledge Discovery}, 26035 volume = {2}, 26036 number = {2}, 26037 pages = {121-167}, 26038 year = {1998} 26039} 26040 26041@Article{ burke.ferris.ea:clarke, 26042 author = {J. V. Burke and M. C. Ferris and M. Qian}, 26043 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 26044 journal = {Journal of Mathematical Analysis and its Applications}, 26045 year = {1992}, 26046 volume = {166}, 26047 pages = {199--213}, 26048 key = {16} 26049} 26050 26051@Unpublished{ burke.ferris.ea:least, 26052 author = {J. V. Burke and M. C. Ferris and L. Qi}, 26053 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 26054 year = {1994}, 26055 month = mar, 26056 note = {Manuscript}, 26057 key = {999} 26058} 26059 26060@Article{ burke.ferris:characterization, 26061 author = {J. V. Burke and M. C. Ferris}, 26062 title = {Characterization of Solution Sets of Convex Programs}, 26063 journal = {Operations Research Letters}, 26064 year = {1991}, 26065 volume = {10}, 26066 pages = {57--60}, 26067 key = {10} 26068} 26069 26070@Article{ burke.ferris:gauss-newton, 26071 author = {J. V. Burke and M. C. Ferris}, 26072 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 26073 journal = {Mathematical Programming}, 26074 year = {1995}, 26075 volume = {71}, 26076 pages = {179--194}, 26077 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 26078 key = {32} 26079} 26080 26081@Article{ burke.ferris:weak, 26082 author = {J. V. Burke and M. C. Ferris}, 26083 title = {Weak Sharp Minima in Mathematical Programming}, 26084 journal = {SIAM Journal on Control and Optimization}, 26085 year = {1993}, 26086 volume = {31}, 26087 pages = {1340--1359}, 26088 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 26089 key = {23} 26090} 26091 26092@Article{ burke.more.ea:convergence, 26093 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 26094 title = {Convergence Properties of Trust Region Methods for Linear and Convex 26095 Constraints}, 26096 journal = {Mathematical Programming}, 26097 year = {1990}, 26098 volume = {47}, 26099 pages = {305--336} 26100} 26101 26102@Article{ burke.more:exposing, 26103 author = {J. V. Burke and J. J. Mor\'{e}}, 26104 title = {Exposing Constraints}, 26105 journal = {SIAM Journal on Optimization}, 26106 year = {1994}, 26107 volume = {4}, 26108 pages = {573--595} 26109} 26110 26111@Article{ burke.more:identification, 26112 author = {J. V. Burke and J. J. Mor\'{e}}, 26113 title = {On the Identification of Active Constraints}, 26114 journal = {SIAM Journal on Numerical Analysis}, 26115 year = {1988}, 26116 volume = {25}, 26117 pages = {1197--1211} 26118} 26119 26120@Article{ burke.poliquin:optimality, 26121 author = {J. V. Burke and R. A. Poliquin}, 26122 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 26123 journal = {Mathematical Programming}, 26124 year = {1992}, 26125 volume = {57}, 26126 pages = {103--120} 26127} 26128 26129@Article{ burke.tseng:unified, 26130 author = {J. V. Burke and P. Tseng}, 26131 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 26132 journal = {SIAM Journal on Optimization}, 26133 year = {1996}, 26134 volume = {6}, 26135 pages = {265--282} 26136} 26137 26138@Article{ burke.xu:global, 26139 author = {J. V. Burke and S. Xu}, 26140 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 26141 Linear Complementarity Problems}, 26142 year = {1998}, 26143 journal = {Mathematics of Operations Research}, 26144 volume = {23}, 26145 pages = {719--735} 26146} 26147 26148@TechReport{ burke:algorithms, 26149 author = {J. V. Burke}, 26150 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 26151 Inequalities that have both Global and Quadratic Convergence Properties}, 26152 institution = {Argonne National Laboratory}, 26153 year = {1985}, 26154 address = {Argonne, Illinois}, 26155 number = {ANL/MCS--TM--54}, 26156 type = {Mathematics and Computer Science Division Report} 26157} 26158 26159@Article{ burke:descent, 26160 author = {J. V. Burke}, 26161 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 26162 journal = {Mathematical Programming}, 26163 year = {1985}, 26164 volume = {33}, 26165 pages = {260--279} 26166} 26167 26168@Article{ burke:exact, 26169 author = {J. V. Burke}, 26170 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 26171 journal = {SIAM Journal on Control and Optimization}, 26172 year = {1991}, 26173 volume = {29}, 26174 pages = {968--998} 26175} 26176 26177@Article{ burke:identification, 26178 author = {J. V. Burke}, 26179 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 26180 journal = {SIAM Journal on Numerical Analysis}, 26181 year = {1990}, 26182 volume = {27}, 26183 pages = {1081--1102} 26184} 26185 26186@Article{ burke:robust, 26187 author = {J. V. Burke}, 26188 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 26189 journal = {SIAM Journal on Optimization}, 26190 year = {1992}, 26191 volume = {2}, 26192 pages = {325--347} 26193} 26194 26195@Article{ burke:second, 26196 author = {J. V. Burke}, 26197 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 26198 journal = {Mathematical Programming}, 26199 year = {1987}, 26200 volume = {38}, 26201 pages = {287--302} 26202} 26203 26204@Article{ burke:sequential, 26205 author = {J. V. Burke}, 26206 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 26207 Programs}, 26208 journal = {Journal of Mathematical Analysis and its Applications}, 26209 year = {1989}, 26210 volume = {139}, 26211 pages = {319--351} 26212} 26213 26214@Article{ burman.kutcher.ea:fitting, 26215 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 26216 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 26217 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26218 year = {1991}, 26219 optvolume = {21}, 26220 optpages = {123-135} 26221} 26222 26223@TechReport{ busovaca:handling, 26224 author = {S. Busovaca}, 26225 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 26226 institution = {University of Waterloo}, 26227 year = {1985}, 26228 address = {Ontario}, 26229 number = {CS85 34}, 26230 type = {Technical Report} 26231} 26232 26233@Article{ butler.martin:method, 26234 author = {T. Butler and A. V. Martin}, 26235 title = {On a Method of {C}ourant for Minimizing Functionals}, 26236 journal = {Journal of Mathematical Physics}, 26237 year = {1962}, 26238 volume = {41}, 26239 pages = {291--299} 26240} 26241 26242@Article{ calamai.more:projected, 26243 author = {P. H. Calamai and J. J. Mor\'{e}}, 26244 title = {Projected Gradient Methods for Linearly Constrained Problems}, 26245 journal = {Mathematical Programming}, 26246 year = {1987}, 26247 volume = {39}, 26248 pages = {93--116} 26249} 26250 26251@Article{ cao.ferris:genetic, 26252 author = {M. Cao and M. C. Ferris}, 26253 title = {Genetic Algorithms in Optimization}, 26254 journal = {Journal of Undergraduate Mathematics and its Applications}, 26255 year = {1991}, 26256 volume = {12}, 26257 pages = {81--90}, 26258 key = {17} 26259} 26260 26261@Article{ cao.ferris:interior, 26262 author = {M. Cao and M. C. Ferris}, 26263 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 26264 journal = {Journal of Optimization Theory and Applications}, 26265 year = {1994}, 26266 volume = {83}, 26267 pages = {269--283}, 26268 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 26269 key = {28} 26270} 26271 26272@Article{ cao.ferris:lineality, 26273 author = {M. Cao and M. C. Ferris}, 26274 title = {Lineality Removal for Copositive--Plus Normal Maps}, 26275 year = {1995}, 26276 volume = {2}, 26277 pages = {1--10}, 26278 journal = {Communications on Applied Nonlinear Analysis}, 26279 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 26280 key = {38} 26281} 26282 26283@Article{ cao.ferris:pc, 26284 author = {M. Cao and M. C. Ferris}, 26285 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 26286 journal = {Linear Algebra and Its Applications}, 26287 year = {1996}, 26288 volume = {246}, 26289 pages = {299--312}, 26290 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 26291 key = {37} 26292} 26293 26294@Article{ cao.ferris:pivotal, 26295 author = {M. Cao and M. C. Ferris}, 26296 title = {A Pivotal Method for Affine Variational Inequalities}, 26297 journal = {Mathematics of Operations Research}, 26298 year = {1996}, 26299 volume = {21}, 26300 pages = {44--64}, 26301 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 26302 key = {29} 26303} 26304 26305@PhDThesis{ cao:piecewise, 26306 author = {M. Cao}, 26307 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 26308 school = {Computer Sciences Department, University of Wisconsin}, 26309 year = {1994}, 26310 address = {Madison, Wisconsin}, 26311 note = {Technical Report 1210} 26312} 26313 26314@Article{ caroe.schultz:dual, 26315 author = {C. C. Car{\o}e and R. Schultz}, 26316 title = {Dual Decomposition in Stochastic Integer Programming}, 26317 journal = {Operations Research Letters}, 26318 volume = {24}, 26319 pages = {37-45}, 26320 year = {1999} 26321} 26322 26323@Article{ carol.targovnik.ea:initial, 26324 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 26325 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 26326 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 26327 conformal radiation therapy system}, 26328 journal = {Stereotactic and Functional Neurosurgery}, 26329 year = {1996}, 26330 volume = {66}, 26331 pages = {30--34} 26332} 26333 26334@Article{ carolan.hill.ea:empirical, 26335 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 26336 Wichmann}, 26337 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 26338 Applications}, 26339 journal = {Operations Research}, 26340 year = {1990}, 26341 volume = {38}, 26342 pages = {240--248} 26343} 26344 26345@Article{ carroll:created, 26346 author = {C. W. Carroll}, 26347 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 26348 Systems}, 26349 journal = {Operations Research}, 26350 year = {1961}, 26351 volume = {9}, 26352 pages = {169--184} 26353} 26354 26355@PhDThesis{ carroll:operations, 26356 author = {C. W. Carroll}, 26357 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 26358 Process}, 26359 year = {1959}, 26360 address = {Appleton, Wisconsin}, 26361 school = {Institute of Paper Chemistry} 26362} 26363 26364@TechReport{ casanova.dongarra:netsolve, 26365 author = {H. Casanova and J. Dongarra}, 26366 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 26367 institution = {University of Tennessee}, 26368 year = {1996}, 26369 type = {Technical Report} 26370} 26371 26372@TechReport{ cavalier.soyster:computational, 26373 author = {T. M. Cavalier and A. L. Soyster}, 26374 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 26375 institution = {Pennsylvania State University}, 26376 year = {1985}, 26377 address = {Pennsylvania}, 26378 number = {85-105}, 26379 type = {ISME Working Paper} 26380} 26381 26382@TechReport{ censor.iusem.ea:interior-point, 26383 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 26384 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 26385 Problem with Paramonotone Operators}, 26386 institution = {University of Haifa}, 26387 year = {1994}, 26388 type = {Working Paper} 26389} 26390 26391@Article{ censor.lent:iterative, 26392 author = {Y. Censor and A. Lent}, 26393 title = {An Iterative Row-Action Method for Interval Convex Programming}, 26394 journal = {Journal of Optimization Theory and Applications}, 26395 year = {1981}, 26396 volume = {34}, 26397 pages = {275--291} 26398} 26399 26400@InCollection{ censor.pierro.ea:iterative, 26401 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 26402 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 26403 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 26404 XXIV}, 26405 publisher = {Banach Center}, 26406 year = {1987}, 26407 editor = {A. J. Wakulicz}, 26408 address = {Warsaw, Poland} 26409} 26410 26411@Article{ censor.segman:block-iterative, 26412 author = {Y. Censor and J. Segman}, 26413 title = {On Block-Iterative Entropy Maximization}, 26414 journal = {Journal of Information and Optimization Science}, 26415 year = {1987}, 26416 volume = {8}, 26417 pages = {275--291} 26418} 26419 26420@Article{ censor.zenios:proximal, 26421 author = {Y. Censor and S. A. Zenios}, 26422 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 26423 journal = {Journal of Optimization Theory and Applications}, 26424 year = {1992}, 26425 volume = {73}, 26426 pages = {451--464} 26427} 26428 26429@Article{ censor:parallel, 26430 author = {Yair Censor}, 26431 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 26432 Therapy}, 26433 journal = {Mathematical Programming}, 26434 year = {1988}, 26435 volume = {42}, 26436 pages = {307--325} 26437} 26438 26439@Article{ censor:row-action, 26440 author = {Yair Censor}, 26441 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 26442 journal = {SIAM Review}, 26443 year = {1981}, 26444 volume = {23}, 26445 pages = {444--466} 26446} 26447 26448@Article{ chajakis.zenios:synchronous, 26449 author = {E. D. Chajakis and S. A. Zenios}, 26450 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 26451 Nonlinear Network Optimization}, 26452 journal = {Parallel Computing}, 26453 year = {1990}, 26454 note = {To appear} 26455} 26456 26457@Article{ chamberlain.powell.ea:watchdog, 26458 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 26459 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 26460 Optimization}, 26461 journal = {Mathematical Programming Study}, 26462 year = {1982}, 26463 volume = {16}, 26464 pages = {1--17} 26465} 26466 26467@Article{ chan.pang:generalized, 26468 author = {D. Chan and J. S. Pang}, 26469 title = {The Generalized Quasi-Variational Inequality Problem}, 26470 journal = {Mathematics of Operations Research}, 26471 volume = {7}, 26472 pages = {211--222}, 26473 year = {1982} 26474} 26475 26476@Article{ charalambous:nonlinear, 26477 author = {C. Charalambous}, 26478 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 26479 journal = {Mathematical Programming}, 26480 year = {1977}, 26481 volume = {12}, 26482 pages = {195--225} 26483} 26484 26485@Article{ charnes.cooper.ea:duality, 26486 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 26487 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 26488 journal = {Proceedings of the National Academy of Sciences of the United States}, 26489 year = {1962}, 26490 pages = {783--786} 26491} 26492 26493@Book{ charnes.cooper.ea:introduction, 26494 author = {A. Charnes and W. W. Cooper and A. Henderson}, 26495 title = {An Introduction to Linear Programming}, 26496 year = {1953}, 26497 publisher = {John Wiley \& Sons}, 26498 address = {New York} 26499} 26500 26501@TechReport{ charnes.semple:practical, 26502 author = {A. Charnes and J. Semple}, 26503 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 26504 institution = {CCS}, 26505 year = {1991}, 26506 address = {Austin, Texas}, 26507 number = {663}, 26508 type = {Research Report} 26509} 26510 26511@InProceedings{ charnes:fundamental, 26512 author = {A. Charnes}, 26513 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 26514 booktitle = {Computer and Information Sciences}, 26515 year = {1964}, 26516 editor = {J. T. Lou and R. H. Wilcox}, 26517 publisher = {Spartan Books}, 26518 address = {Washington, D.C.}, 26519 pages = {67--74} 26520} 26521 26522@TechReport{ chen.chen.ea:penalized, 26523 author = {B. Chen and X. Chen and C. Kanzow}, 26524 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 26525 Numerical Results}, 26526 institution = {Institute of Applied Mathematics, University of Hamburg}, 26527 year = {1997}, 26528 type = {Preprint}, 26529 number = {126}, 26530 address = {Hamburg, Germany} 26531} 26532 26533@Article{ chen.chen:global, 26534 author = {B. Chen and X. Chen}, 26535 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 26536 ${R}_0$ {NCP} or Monotone {NCP}}, 26537 journal = {SIAM Journal on Optimization}, 26538 year = {1999}, 26539 volume = {9}, 26540 pages = {624--645} 26541} 26542 26543@Article{ chen.ferris.ea:fatcop, 26544 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 26545 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 26546 Solver}, 26547 journal = {Annals of Operations Research, forthcoming}, 26548 year = {2000}, 26549 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 26550 key = {89}, 26551 type = {Data Mining Institute Technical Report}, 26552 institution = {Computer Sciences Department, University of Wisconsin}, 26553 address = {Madison, Wisconsin}, 26554 number = {99-11} 26555} 26556 26557@TechReport{ chen.ferris:fatcop, 26558 author = {Q. Chen and M. C. Ferris}, 26559 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 26560 type = {Mathematical Programming Technical Report}, 26561 institution = {Computer Sciences Department, University of Wisconsin}, 26562 address = {Madison, Wisconsin}, 26563 year = {1999}, 26564 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 26565 number = {99-05}, 26566 key = {81}, 26567 annote = {Submitted to {\em SIOPT}} 26568} 26569 26570@Article{ chen.florian:nonlinear, 26571 author = {Y. Chen and M. Florian}, 26572 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 26573 Optimality Conditions}, 26574 journal = {Optimization}, 26575 year = {1995}, 26576 volume = {32}, 26577 pages = {193--209} 26578} 26579 26580@TechReport{ chen.florian:o-d, 26581 author = {Y. Chen and M. Florian}, 26582 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 26583 optimality conditions}, 26584 type = {Publication}, 26585 number = {CRT-94-56}, 26586 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 26587 address = {Montr\'eal, Canada}, 26588 year = {1994} 26589} 26590 26591@Article{ chen.harker:continuation, 26592 author = {B. Chen and P. T. Harker}, 26593 title = {A Continuation Method for Monotone Variational Inequalities}, 26594 journal = {Mathematical Programming}, 26595 volume = {69}, 26596 pages = {237--253}, 26597 year = {1995} 26598} 26599 26600@Article{ chen.harker:non-interior, 26601 author = {B. Chen and P. T. Harker}, 26602 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 26603 journal = {SIAM Journal on Matrix Analysis and Applications}, 26604 year = {1993}, 26605 volume = {14}, 26606 pages = {1168--1190} 26607} 26608 26609@Article{ chen.harker:smooth, 26610 author = {B. Chen and P. T. Harker}, 26611 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 26612 journal = {SIAM Journal on Optimization}, 26613 year = {1997}, 26614 volume = {7}, 26615 pages = {403--420} 26616} 26617 26618@Article{ chen.mangasarian:class, 26619 author = {Chunhui Chen and O. L. Mangasarian}, 26620 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 26621 journal = {Computational Optimization and Applications}, 26622 year = {1996}, 26623 volume = {5}, 26624 pages = {97--138} 26625} 26626 26627@Article{ chen.mangasarian:smoothing, 26628 author = {Chunhui Chen and O. L. Mangasarian}, 26629 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 26630 journal = {Mathematical Programming}, 26631 year = {1995}, 26632 volume = {78}, 26633 pages = {51--70} 26634} 26635 26636@Article{ chen.nashed.ea:convergence, 26637 author = {X. Chen and Z. Nashed and L. Qi}, 26638 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 26639 using Adaptive Outer Inverses}, 26640 year = {1997}, 26641 journal = {SIAM Journal on Optimization}, 26642 volume = {7}, 26643 pages = {445--462} 26644} 26645 26646@Article{ chen.qi.ea:global, 26647 author = {X. Chen and L. Qi and D. Sun}, 26648 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 26649 Application to General Box Constrained Variational Inequalities}, 26650 year = {1998}, 26651 journal = {Mathematics of Computation}, 26652 volume = {67}, 26653 pages = {519--540} 26654} 26655 26656@Article{ chen.teboulle:convergence, 26657 author = {G. Chen and M. Teboulle}, 26658 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 26659 Functions}, 26660 journal = {SIAM Journal on Optimization}, 26661 year = {1993}, 26662 volume = {3}, 26663 pages = {538--543} 26664} 26665 26666@Article{ chen.ye:homotopy-smoothing, 26667 author = {X.~Chen and Y.~Ye}, 26668 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 26669 year = {1999}, 26670 journal = {SIAM Journal on Control and Optimization}, 26671 volume = {37}, 26672 pages = {589--616} 26673} 26674 26675@PhDThesis{ chen:forward-backward, 26676 author = {G. H.--G. Chen}, 26677 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 26678 school = {University of Washington}, 26679 year = {1994} 26680} 26681 26682@PhDThesis{ chen:smoothing, 26683 author = {Chunhui Chen}, 26684 title = {Smoothing Methods in Mathematical Programming}, 26685 school = {Computer Sciences Department, University of Wisconsin}, 26686 year = {1995}, 26687 address = {Madison, Wisconsin}, 26688 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26689 annote = {Mathematical Programming Technical Report 95-12} 26690} 26691 26692@Book{ cheney:introduction, 26693 author = {E. W. Cheney}, 26694 title = {Introduction to Approximation Theory}, 26695 year = {1966}, 26696 publisher = {McGraw--Hill}, 26697 address = {New York} 26698} 26699 26700@Article{ cho.kuterdem.ea:spherical, 26701 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 26702 title = {A spherical dose model for radiosurgery treatment planning}, 26703 journal = {Physics in Medicine and Biology}, 26704 year = {1998}, 26705 volume = {43}, 26706 pages = {3145--3148} 26707} 26708 26709@Article{ cho.lee.ea:optimization, 26710 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 26711 title = {Optimization of intensity modulated beams with volume constraints using two 26712 methods: cost function minimization and projection onto convex sets}, 26713 journal = {Medical Physics}, 26714 year = {1998}, 26715 volume = {25}, 26716 number = {4}, 26717 pages = {435--443} 26718} 26719 26720@Article{ choi.desarbo.ea:product, 26721 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 26722 title = {Product Positioning Under Price Competition}, 26723 journal = {Management Science}, 26724 year = {1990}, 26725 volume = {36}, 26726 pages = {175--199} 26727} 26728 26729@Article{ chow.mallet-parret.ea:finding, 26730 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 26731 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 26732 One}, 26733 journal = {Mathematics of Computing}, 26734 year = {1978}, 26735 volume = {32}, 26736 pages = {887--899} 26737} 26738 26739@Article{ christopherson:mathematical, 26740 author = {D. G. Christopherson}, 26741 title = {A new mathematical method for the solution of film lubrication problems}, 26742 journal = {Proceedings of the Institute of Mechanical Engineers}, 26743 volume = {146}, 26744 year = {1941}, 26745 pages = {126--135} 26746} 26747 26748@TechReport{ chun.lee.ea:implementation, 26749 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 26750 title = {An Implementation of the Bundle Decomposition Algorithm}, 26751 institution = {Department of Industrial Engineering, University of Wisconsin}, 26752 year = {1991}, 26753 address = {Madison, Wisconsin}, 26754 number = {91-6} 26755} 26756 26757@Article{ chung:np-completeness, 26758 author = {S.--J. Chung}, 26759 title = {{NP}-Completeness of the Linear Complementarity Problem}, 26760 journal = {Journal of Optimization Theory and Applications}, 26761 volume = {60}, 26762 year = {1989}, 26763 pages = {393--399} 26764} 26765 26766@Book{ chvatal:linear, 26767 author = {V. Chv\'atal}, 26768 title = {Linear Programming}, 26769 year = {1983}, 26770 publisher = {W. H. Freeman and Company}, 26771 address = {New York} 26772} 26773 26774@Book{ ciarlet:finite, 26775 author = {P. G. Ciarlet}, 26776 title = {The Finite Element Method for Elliptic Problems}, 26777 year = {1978}, 26778 publisher = {North-Holland}, 26779 address = {New York} 26780} 26781 26782@Article{ cinquini.contro:optimal, 26783 author = {C. Cinquini and R. Contro}, 26784 title = {Optimal design of beams discretized by elastic plastic finite element}, 26785 journal = {Computers \& Structures}, 26786 volume = {20}, 26787 year = {1985}, 26788 pages = {475--585} 26789} 26790 26791@Book{ clarke:optimization, 26792 author = {F. H. Clarke}, 26793 title = {Optimization and Nonsmooth Analysis}, 26794 year = {1983}, 26795 publisher = {John Wiley \& Sons}, 26796 address = {New York} 26797} 26798 26799@InProceedings{ cleveland.smith:genetic, 26800 crossref = {schaeffer:third}, 26801 author = {G. A. Cleveland and S. F. Smith}, 26802 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 26803 pages = {160--169} 26804} 26805 26806@Book{ cochran:sampling, 26807 author = {W. Cochran}, 26808 title = {Sampling Techniques}, 26809 publisher = {Wiley}, 26810 year = {1977}, 26811 address = {New York}, 26812 edition = {Third} 26813} 26814 26815@Article{ coleman.conn:nonlinear, 26816 author = {T. F. Coleman and A. R. Conn}, 26817 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 26818 journal = {Mathematical Programming}, 26819 year = {1982}, 26820 volume = {24}, 26821 pages = {123--136} 26822} 26823 26824@Article{ coleman.conn:nonlinear*1, 26825 author = {T. F. Coleman and A. R. Conn}, 26826 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 26827 journal = {Mathematical Programming}, 26828 year = {1982}, 26829 volume = {24}, 26830 pages = {137--161} 26831} 26832 26833@TechReport{ coleman.liu:interior, 26834 author = {T. F. Coleman and J. Liu}, 26835 title = {An interior newton method for quadratic programming}, 26836 institution = {Dept. of Computer Science, Cornell University}, 26837 year = {1993}, 26838 number = {TR 93-1388}, 26839 address = {Ithaca, NY}, 26840 month = oct 26841} 26842 26843@Article{ coleman.more:estimation, 26844 author = {T. F. Coleman and J. J. Mor\'{e}}, 26845 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 26846 journal = {SIAM Journal on Numerical Analysis}, 26847 year = {1983}, 26848 volume = {20}, 26849 pages = {187--209} 26850} 26851 26852@Manual{ coleman.verma:admat, 26853 author = {T. F. Coleman and A. Verma}, 26854 title = {{ADMAT} User Guide}, 26855 year = {2000} 26856} 26857 26858@TechReport{ colville:comparative, 26859 author = {A. R. Colville}, 26860 title = {A Comparative Study on Nonlinear Programming Codes}, 26861 institution = {IBM New York Scientific Center}, 26862 year = {1968}, 26863 month = jun, 26864 number = {320--2949}, 26865 type = {Technical Report} 26866} 26867 26868@Article{ comi.maier:extremum, 26869 author = {C. Comi and G. Maier}, 26870 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 26871 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 26872 journal = {European Journal Mechanics A/Solids}, 26873 volume = {9}, 26874 year = {1990}, 26875 pages = {563--585} 26876} 26877 26878@Misc{ condon.dahl.ea:implementing, 26879 author = {T. Condon and H. Dahl and S. Devarajan}, 26880 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 26881 Model}, 26882 year = {1987}, 26883 howpublished = {{DRD} Discussion Paper 290}, 26884 note = {The World Bank, Washington DC} 26885} 26886 26887@Book{ conn.gould.ea:lancelot, 26888 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26889 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 26890 (Release {A})}, 26891 year = {1992}, 26892 publisher = {Springer Verlag}, 26893 address = {Heidelberg, Berlin}, 26894 series = {Springer Series in Computational Mathematics}, 26895 number = {17} 26896} 26897 26898@Article{ conn.gould.ea:numerical, 26899 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26900 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 26901 Nonlinear Optimization}, 26902 journal = {Mathematical Programming}, 26903 year = {1996}, 26904 volume = {75}, 26905 pages = {73--110} 26906} 26907 26908@Book{ cgt, 26909 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26910 title = {Trust-Region Methods}, 26911 year = {2000}, 26912 publisher = {SIAM}, 26913 address = {Philadelphia, Pennsylvania} 26914} 26915 26916@InCollection{ conn.toint:algorithm, 26917 author = {A. R. Conn and Ph. L. Toint}, 26918 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 26919 Optimization}, 26920 booktitle = {Nonlinear Optimization and Applications}, 26921 editor = {G. Di Pillo and F. Giannessi}, 26922 year = {1996}, 26923 publisher = {Plenum Press}, 26924 address = {New York} 26925} 26926 26927@Article{ conry.seireg:mathematical, 26928 author = {T. F. Conry and A. Seireg}, 26929 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 26930 journal = {{ASME} Transactions Journal of Applied Mechanics}, 26931 volume = {93}, 26932 year = {1971}, 26933 pages = {387--392} 26934} 26935 26936@Article{ cook.gerards.ea:sensitivity, 26937 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 26938 title = {Sensitivity Results in Integer Linear Programming}, 26939 journal = {Mathematical Programming}, 26940 year = {1986}, 26941 volume = {34}, 26942 pages = {251--264} 26943} 26944 26945@Article{ cook:taxonomy, 26946 author = {S. A. Cook}, 26947 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 26948 journal = {Information and Control}, 26949 year = {1985}, 26950 volume = {64}, 26951 pages = {2--22} 26952} 26953 26954@Article{ cooper:gradient, 26955 author = {R. E. M. Cooper}, 26956 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 26957 journal = {Radiology}, 26958 year = {1978}, 26959 volume = {128}, 26960 pages = {235--243} 26961} 26962 26963@Article{ cormack:problem, 26964 author = {A. M. Cormack}, 26965 title = {A problem in roatation therapy with x-rays}, 26966 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26967 year = {1987}, 26968 volume = {13}, 26969 pages = {623--630} 26970} 26971 26972@Article{ cormack:problem*1, 26973 author = {A. M. Cormack}, 26974 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 26975 symmetry}, 26976 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26977 year = {1987}, 26978 volume = {13}, 26979 pages = {1921--1925} 26980} 26981 26982@Article{ cottle.dantzig:complementary, 26983 author = {R. W. Cottle and G. B. Dantzig}, 26984 title = {Complementary Pivot Theory of Mathematical Programming}, 26985 journal = {Linear Algebra and Its Applications}, 26986 year = {1968}, 26987 volume = {1}, 26988 pages = {103--125} 26989} 26990 26991@Article{ cottle.dantzig:generalization, 26992 author = {R. W. Cottle and G. B. Dantzig}, 26993 title = {A Generalization of the Linear Complementarity Problem}, 26994 journal = {Journal of Combinatorial Theory}, 26995 year = {1970}, 26996 volume = {8}, 26997 pages = {79--90} 26998} 26999 27000@Book{ cottle.giannessi.ea:variational, 27001 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 27002 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 27003 year = {1980}, 27004 publisher = {John Wiley \& Sons}, 27005 address = {New York} 27006} 27007 27008@InCollection{ cottle.goheen:special, 27009 author = {R. W. Cottle and M. S. Goheen}, 27010 title = {A Special Class of Large Quadratic Programs}, 27011 pages = {361--390}, 27012 crossref = {mangasarian.meyer.ea:nonlinear*3} 27013} 27014 27015@Article{ cottle.golub.ea:solution, 27016 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 27017 title = {On the Solution of Large Structured Complementarity Problems: The Block 27018 Partitioned Case}, 27019 journal = {Applied Mathematics and Optimization}, 27020 year = {1978}, 27021 volume = {4}, 27022 pages = {347--363} 27023} 27024 27025@Book{ cottle.pang.ea:linear, 27026 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 27027 title = {The Linear Complementarity Problem}, 27028 year = {1992}, 27029 publisher = {Academic Press}, 27030 address = {Boston} 27031} 27032 27033@Article{ cottle.pang.ea:sufficient, 27034 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 27035 title = {Sufficient Matrices and the Linear Complementarity Problem}, 27036 journal = {Linear Algebra and Its Applications}, 27037 year = {1989}, 27038 volume = {114/115}, 27039 pages = {231--249} 27040} 27041 27042@PhDThesis{ cottle:nonlinear, 27043 author = {R. W. Cottle}, 27044 title = {Nonlinear programs with positively bounded {J}acobians}, 27045 school = {Department of Mathematics, University of California}, 27046 year = {1964}, 27047 address = {Berkeley, California} 27048} 27049 27050@Article{ cottle:nonlinear*1, 27051 author = {R. W. Cottle}, 27052 title = {Nonlinear programs with positively bounded {J}acobians}, 27053 journal = {Journal of the Society for Industrial and Applied Mathematics}, 27054 volume = {14}, 27055 year = {1966}, 27056 pages = {147--158} 27057} 27058 27059@InCollection{ cottle:principal, 27060 author = {R. W. Cottle}, 27061 title = {The principal pivoting method of quadratic programming}, 27062 booktitle = {Mathematics of the Decision Sciences, Part 1}, 27063 publisher = {American Mathematical Society}, 27064 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 27065 address = {Providence, Rhode Island}, 27066 year = {1968}, 27067 pages = {144--162} 27068} 27069 27070@Unpublished{ courant:calculus, 27071 author = {R. Courant}, 27072 title = {Calculus of Variations and Supplementary Notes and Exercises}, 27073 year = {1956}, 27074 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 27075 New York University} 27076} 27077 27078@Article{ courant:variational, 27079 author = {R. Courant}, 27080 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 27081 journal = {Bulletin of the American Mathematical Society}, 27082 year = {1943}, 27083 volume = {49}, 27084 pages = {1--23} 27085} 27086 27087@Book{ cristianini.shawe-taylor:introduction, 27088 author = {N. Cristianini and J. Shawe-Taylor}, 27089 title = {An Introduction to Support Vector Machines}, 27090 publisher = {Cambridge University Press}, 27091 address = {Cambridge}, 27092 year = {2000} 27093} 27094 27095@Article{ cromme:strong, 27096 author = {L. Cromme}, 27097 title = {Strong Uniqueness}, 27098 journal = {Numerische Mathematik}, 27099 year = {1978}, 27100 volume = {29}, 27101 pages = {179--193} 27102} 27103 27104@Article{ crowder.johnson.ea:solving, 27105 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 27106 title = {Solving Large Scale Zero-One Linear Programming Problems}, 27107 journal = {Operations Research}, 27108 year = {1983}, 27109 volume = {31}, 27110 pages = {803--834} 27111} 27112 27113@Article{ cryer.dempster:equivalence, 27114 author = {C. W. Cryer and M. A. H. Dempster}, 27115 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 27116 Lattice {H}ilbert Spaces}, 27117 journal = {SIAM Journal on Control and Optimization}, 27118 year = {1980}, 27119 volume = {18}, 27120 pages = {76--89} 27121} 27122 27123@Article{ cryer:method, 27124 author = {C. W. Cryer}, 27125 title = {The method of {C}hristopherson for solving free boundary problems for infinite 27126 journal bearings by means of finite differences}, 27127 journal = {Mathematics of Computation}, 27128 volume = {25}, 27129 year = {1971}, 27130 pages = {435--553} 27131} 27132 27133@Article{ cryer:solution, 27134 author = {C. W. Cryer}, 27135 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 27136 journal = {SIAM Journal on Control and Optimization}, 27137 year = {1971}, 27138 volume = {9}, 27139 pages = {385--392} 27140} 27141 27142@Article{ cryer:solution*1, 27143 author = {C. W. Cryer}, 27144 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 27145 journal = {SIAM Journal on Control}, 27146 year = {1971}, 27147 volume = {9}, 27148 pages = {385--392} 27149} 27150 27151@Manual{ culler:split-c, 27152 author = {D. Culler}, 27153 title = {The Split--{C} Programming Language}, 27154 organization = {Computer Science Department, University of California, Berkeley} 27155} 27156 27157@InProceedings{ cun.denker.ea:optimal, 27158 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 27159 title = {Optimal Brain Damage}, 27160 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 27161 year = {1990}, 27162 editor = {D. S. Touretzky}, 27163 publisher = {Morgan Kaufmann}, 27164 address = {San Mateo, California}, 27165 pages = {598--605} 27166} 27167 27168@TechReport{ czyzyk.mehrotra.ea:pcx, 27169 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 27170 title = {{PCx} Users Guide}, 27171 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 27172 University}, 27173 year = {1996}, 27174 type = {Technical Report}, 27175 number = {OTC 96/01} 27176} 27177 27178@TechReport{ czyzyk.mesnier.ea:network-enabled, 27179 address = {Argonne, Illinois}, 27180 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 27181 institution = {Argonne National Laboratory}, 27182 number = {MCS-P615-0996}, 27183 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 27184 type = {Preprint}, 27185 year = {1996} 27186} 27187 27188@Article{ czyzyk.wisniewski.ea:optimization, 27189 title = {Optimization Case Studies in the {NEOS} Guide}, 27190 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 27191 journal = {SIAM Review}, 27192 volume = {41}, 27193 pages = {148--163}, 27194 year = {1999} 27195} 27196 27197@Article{ dai.laan.ea:simplicial, 27198 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 27199 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 27200 Polyhedron}, 27201 journal = {SIAM Journal on Optimization}, 27202 year = {1991}, 27203 volume = {1}, 27204 pages = {151--165} 27205} 27206 27207@Article{ dai.talman:linear, 27208 author = {Y. Dai and D. Talman}, 27209 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 27210 journal = {Mathematics of Operations Research}, 27211 year = {1993}, 27212 pages = {635--644} 27213} 27214 27215@Book{ daniel:approximate, 27216 author = {J. W. Daniel}, 27217 title = {The approximate minimization of functionals}, 27218 year = {1971}, 27219 publisher = {Prentice-Hall, Inc}, 27220 address = {Englewood Cliffs, New Jersey} 27221} 27222 27223@Article{ danskin:theory, 27224 author = {J. M. Danskin}, 27225 title = {The Theory of Min--Max, with Applications}, 27226 journal = {SIAM Journal on Applied Mathematics}, 27227 year = {1964}, 27228 volume = {14}, 27229 pages = {641--664} 27230} 27231 27232@Book{ danskin:theory*1, 27233 author = {J. M. Danskin}, 27234 title = {The Theory of Min--Max}, 27235 year = {1967}, 27236 publisher = {Springer-Verlag}, 27237 address = {New York} 27238} 27239 27240@InCollection{ dantzig.cottle:positive, 27241 author = {G. B. Dantzig and R. W. Cottle}, 27242 title = {Positive (semi-)definite programming}, 27243 booktitle = {Nonlinear Programming}, 27244 publisher = {North-Holland}, 27245 editor = {J. Abadie}, 27246 address = {Amsterdam}, 27247 year = {1967}, 27248 pages = {55--73} 27249} 27250 27251@Article{ dantzig.manne:complementarity, 27252 author = {G. B. Dantzig and A. S. Manne}, 27253 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 27254 Proportions}, 27255 journal = {Journal of Economic Theory}, 27256 year = {1974}, 27257 volume = {9}, 27258 pages = {312--323} 27259} 27260 27261@Article{ dantzig.wolfe:decomposition, 27262 author = {G. B. Dantzig and P. Wolfe}, 27263 title = {Decomposition Principle for Linear Programs}, 27264 journal = {Operations Research}, 27265 year = {1960}, 27266 volume = {8}, 27267 pages = {101--111} 27268} 27269 27270@Book{ dantzig:linear, 27271 author = {G. B. Dantzig}, 27272 title = {Linear Programming and Extensions}, 27273 year = {1963}, 27274 publisher = {Princeton University Press}, 27275 address = {Princeton, New Jersey} 27276} 27277 27278@Manual{ dash:xpress-mp, 27279 title = {{XPRESS-MP} User Guide}, 27280 organization = {Dash Associates}, 27281 address = {Blisworth House, Blisworth, Northants, UK}, 27282 note = {http://www.dashopt.com/} 27283} 27284 27285@Book{ davis:handbook, 27286 author = {L. D. Davis}, 27287 title = {The Handbook of Genetic Algorithms}, 27288 year = {1990}, 27289 publisher = {Van Nostrand Reinhold} 27290} 27291 27292@TechReport{ davis:users, 27293 author = {T. A. Davis}, 27294 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 27295 type = {{Technical Report}}, 27296 year = {1993}, 27297 institution = {Computer and Information Sciences Department, University of Florida}, 27298 address = {Gainesville, Florida} 27299} 27300 27301@TechReport{ dax:computation, 27302 author = {A. Dax}, 27303 title = {The Computation of Descent Directions at Degenerate Points}, 27304 institution = {Hydrological Service of Israel}, 27305 year = {1985}, 27306 type = {Technical Report} 27307} 27308 27309@Article{ dax:note, 27310 author = {A. Dax}, 27311 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 27312 Problem}, 27313 journal = {Mathematical Programming}, 27314 year = {1986}, 27315 volume = {36}, 27316 pages = {72--80} 27317} 27318 27319@Article{ deasy:multiple, 27320 author = {J. O. Deasy}, 27321 title = {Multiple local minima in radiotherapy optimization problems with dose volume 27322 constraints}, 27323 journal = {Medical Physics}, 27324 year = {1997}, 27325 optvolume = {24}, 27326 optnumber = {7}, 27327 optpages = {1157-1161} 27328} 27329 27330@Article{ deboor.ron:computational, 27331 author = {C. {deBoor} and A. Ron}, 27332 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 27333 journal = {Mathematics of Computation}, 27334 year = {1992}, 27335 volume = {58}, 27336 pages = {705--727} 27337} 27338 27339@Article{ debremaecker.ferris.ea:compressional, 27340 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 27341 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 27342 Problems}, 27343 year = {2000}, 27344 key = {82}, 27345 journal = {Engineering Fracture Mechanics}, 27346 volume = {66}, 27347 pages = {287--303} 27348} 27349 27350@Article{ debremaecker.ferris:comparison, 27351 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 27352 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 27353 year = {2000}, 27354 key = {90}, 27355 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 27356 journal = {Engineering Fracture Mechanics}, 27357 volume = {66}, 27358 pages = {601--605}, 27359 institution = {Computer Sciences Department, University of Wisconsin}, 27360 address = {Madison, Wisconsin}, 27361 number = {00-01} 27362} 27363 27364@Article{ dedonato.maier:mathematical, 27365 author = {O. {De~Donato} and G. Maier}, 27366 title = {Mathematical programming methods for the inelastic analysis of reinforced 27367 concrete frames allowing for limited rotation capacity}, 27368 journal = {International Journal for Numerical Methods in Engineering}, 27369 volume = {4}, 27370 year = {1972}, 27371 pages = {307--329} 27372} 27373 27374@Book{ deimling:nonlinear, 27375 author = {K. Deimling}, 27376 title = {Nonlinear Functional Analysis}, 27377 publisher = {Springer-Verlag}, 27378 year = {1985} 27379} 27380 27381@PhDThesis{ dejong:analysis, 27382 author = {K. A. De~Jong}, 27383 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 27384 year = {1975}, 27385 school = {University of Michigan}, 27386 note = {Dissertation Abstracts International 36(10), 5140B} 27387} 27388 27389@Article{ deleone.mangasarian.ea:multi-sweep, 27390 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 27391 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 27392 Linear Complementarity Problem}, 27393 journal = {Annals of Operations Research}, 27394 year = {1990}, 27395 volume = {22}, 27396 pages = {43--54} 27397} 27398 27399@InCollection{ deleone.mangasarian:serial, 27400 author = {R. {De~Leone} and O. L. Mangasarian}, 27401 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 27402 {L}agrangian Successive Overrelaxation}, 27403 booktitle = {Optimization, Parallel Processing and Applications}, 27404 publisher = {Springer-Verlag}, 27405 year = {1988}, 27406 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 27407 volume = {304}, 27408 series = {Lecture Notes in Economics and Mathematical Systems}, 27409 pages = {103--124}, 27410 address = {Berlin} 27411} 27412 27413@TechReport{ deluca.facchinei.ea:combining, 27414 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27415 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 27416 Complementarity Problems: Theory and Numerical Results}, 27417 type = {Preprint}, 27418 institution = {Institute of Applied Mathematics, University of Hamburg}, 27419 year = {1996} 27420} 27421 27422@TechReport{ deluca.facchinei.ea:general, 27423 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27424 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 27425 Numerical Results}, 27426 type = {Preprint}, 27427 institution = {Institute of Applied Mathematics, University of Hamburg}, 27428 year = {1997} 27429} 27430 27431@Article{ deluca.facchinei.ea:semismooth, 27432 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27433 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 27434 Problems}, 27435 journal = {Mathematical Programming}, 27436 volume = {75}, 27437 pages = {407--439}, 27438 year = {1996} 27439} 27440 27441@Article{ deluca.facchinei.ea:theoretical, 27442 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27443 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 27444 Complementarity Problems}, 27445 year = {1999}, 27446 journal = {Computational Optimization and Applications, forthcoming} 27447} 27448 27449@Article{ demarzo.eaves:computing, 27450 author = {P. M. DeMarzo and B. C. Eaves}, 27451 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 27452 journal = {Journal of Mathematical Economics}, 27453 year = {1996}, 27454 volume = {26}, 27455 pages = {479--497} 27456} 27457 27458@Article{ dembo.steihaug:truncated, 27459 author = {R. S. Dembo and T. Steihaug}, 27460 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 27461 Optimization}, 27462 journal = {Mathematical Programming}, 27463 year = {1983}, 27464 volume = {26}, 27465 pages = {190--212} 27466} 27467 27468@Article{ dembo:performance, 27469 author = {R. S. Dembo}, 27470 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 27471 journal = {Mathematical Programming Study}, 27472 year = {1986}, 27473 volume = {26}, 27474 pages = {245--248} 27475} 27476 27477@Article{ demoor.vandenberghe.ea:generalized, 27478 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 27479 title = {The generalized linear complementarity problem and an algorithm to find all its 27480 solutions}, 27481 journal = {Mathematical Programming}, 27482 volume = {57}, 27483 year = {1992}, 27484 pages = {415--426} 27485} 27486 27487@Book{ demyanov.vasilev:nondifferentiable, 27488 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 27489 title = {Nondifferentiable Optimization}, 27490 publisher = {Optimization Software, Inc.}, 27491 year = {1985}, 27492 address = {New York} 27493} 27494 27495@Article{ dennis.torczon:direct, 27496 author = {J. E. Dennis and V. Torczon}, 27497 title = {Direct Search Methods on Parallel Machines}, 27498 journal = {SIAM Journal on Optimization}, 27499 year = {1991}, 27500 volume = {1}, 27501 pages = {448--474} 27502} 27503 27504@TechReport{ depierro.iusem:convergence, 27505 author = {A. R. {De~Pierro} and A. N. Iusem}, 27506 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 27507 Linear Complementarity Problems}, 27508 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 27509 year = {1990}, 27510 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 27511} 27512 27513@Article{ depierro.iusem:relaxed, 27514 author = {A. R. {De~Pierro} and A. N. Iusem}, 27515 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 27516 journal = {Journal of Optimization Theory and Applications}, 27517 year = {1986}, 27518 volume = {51}, 27519 pages = {421--440} 27520} 27521 27522@Book{ dervis.melo.ea:general, 27523 author = {K. Dervis and J. de Melo and S. Robinson}, 27524 title = {General Equilibrium Models of Development Policy}, 27525 publisher = {Cambridge University Press}, 27526 year = {1982}, 27527 address = {Cambridge, England} 27528} 27529 27530@Article{ deschutter.demoor:minimal, 27531 author = {B. {De~Schutter} and B. {De~Moor}}, 27532 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 27533 Problem}, 27534 journal = {Systems \& Control Letters}, 27535 year = {1995}, 27536 pages = {103--111} 27537} 27538 27539@Article{ desilets.golden.ea:predicting, 27540 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 27541 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 27542 journal = {Computers \& Operations Research}, 27543 year = {1992}, 27544 volume = {19}, 27545 pages = {277--285} 27546} 27547 27548@PhDThesis{ desilva:sensitivity, 27549 author = {A. H. DeSilva}, 27550 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 27551 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 27552 Production}, 27553 school = {George Washington University}, 27554 address = {Washington, D.C.}, 27555 year = {1978} 27556} 27557 27558@TechReport{ dijkstra:cooperating, 27559 author = {E. W. Dijkstra}, 27560 title = {Cooperating Sequential Processes}, 27561 institution = {Technological University}, 27562 year = {1965}, 27563 address = {Eindhoven, The Netherlands}, 27564 number = {EWD--123}, 27565 type = {Technical Report} 27566} 27567 27568@Article{ dikin:iterative, 27569 author = {I. I. Dikin}, 27570 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 27571 journal = {Soviet Mathematics Doklady}, 27572 year = {1967}, 27573 volume = {8}, 27574 pages = {674--675} 27575} 27576 27577@InCollection{ dipillo.grippo.ea:class, 27578 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 27579 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 27580 booktitle = {System Modelling and Optimization}, 27581 year = {1981}, 27582 editor = {R. F. Drenick and F. Kozin}, 27583 publisher = {Springer-Verlag}, 27584 address = {Berlin} 27585} 27586 27587@Article{ dipillo.grippo:augmented, 27588 author = {G. Di~Pillo and L. Grippo}, 27589 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 27590 Problems}, 27591 journal = {Journal of Optimization Theory and Applications}, 27592 year = {1982}, 27593 volume = {36}, 27594 pages = {495--519} 27595} 27596 27597@Article{ dipillo.grippo:class, 27598 author = {G. Di~Pillo and L. Grippo}, 27599 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 27600 journal = {SIAM Journal on Control and Optimization}, 27601 year = {1979}, 27602 volume = {17}, 27603 pages = {618--628} 27604} 27605 27606@Article{ dipillo.grippo:continuously, 27607 author = {G. Di~Pillo and L. Grippo}, 27608 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 27609 Problems with Inequality Constraints}, 27610 journal = {SIAM Journal on Control and Optimization}, 27611 year = {1985}, 27612 volume = {23}, 27613 pages = {72--84} 27614} 27615 27616@Article{ dipillo.grippo:exact, 27617 author = {G. Di~Pillo and L. Grippo}, 27618 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 27619 Programming Problems}, 27620 journal = {Mathematical Programming}, 27621 year = {1986}, 27622 volume = {36}, 27623 pages = {1--18} 27624} 27625 27626@TechReport{ dirkse.ferris.ea:gams, 27627 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 27628 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 27629 institution = {Computer Sciences Department, University of Wisconsin}, 27630 year = {1994}, 27631 address = {Madison, Wisconsin}, 27632 number = {94-07}, 27633 type = {Mathematical Programming Technical Report}, 27634 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 27635 key = {25} 27636} 27637 27638@InProceedings{ dirkse.ferris:crash, 27639 crossref = {ferris.pang:complementarity}, 27640 author = {S. P. Dirkse and M. C. Ferris}, 27641 title = {Crash Techniques for Large-Scale Complementarity Problems}, 27642 pages = {40--61}, 27643 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 27644 key = {52} 27645} 27646 27647@Article{ dirkse.ferris:mcplib, 27648 author = {S. P. Dirkse and M. C. Ferris}, 27649 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 27650 journal = {Optimization Methods and Software}, 27651 pages = {319--345}, 27652 volume = {5}, 27653 year = {1995}, 27654 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 27655 key = {36} 27656} 27657 27658@InCollection{ dirkse.ferris:modeling, 27659 author = {S. P. Dirkse and M. C. Ferris}, 27660 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 27661 year = {1999}, 27662 pages = {127--148}, 27663 editor = {M. Fukushima and L. Qi}, 27664 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 27665 publisher = {Kluwer Academic Publishers}, 27666 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 27667 key = {62} 27668} 27669 27670@Article{ dirkse.ferris:path, 27671 author = {S. P. Dirkse and M. C. Ferris}, 27672 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 27673 Complementarity Problems}, 27674 journal = {Optimization Methods and Software}, 27675 pages = {123--156}, 27676 volume = {5}, 27677 year = {1995}, 27678 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 27679 key = {33} 27680} 27681 27682@Article{ dirkse.ferris:pathsearch, 27683 author = {S. P. Dirkse and M. C. Ferris}, 27684 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 27685 journal = {Annals of Operations Research}, 27686 vol = {68}, 27687 year = {1996}, 27688 pages = {211--232}, 27689 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 27690 key = {39} 27691} 27692 27693@InCollection{ dirkse.ferris:traffic, 27694 author = {S. P. Dirkse and M. C. Ferris}, 27695 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 27696 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 27697 Management}, 27698 publisher = {Springer-Verlag}, 27699 year = {1998}, 27700 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 27701 series = {NATO ASI Series F}, 27702 volume = {166}, 27703 pages = {136--163}, 27704 key = {61}, 27705 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 27706} 27707 27708@PhDThesis{ dirkse:robust, 27709 author = {S. P. Dirkse}, 27710 title = {Robust Solution of Mixed Complementarity Problems}, 27711 school = {Computer Sciences Department, University of Wisconsin}, 27712 year = {1994}, 27713 address = {Madison, Wisconsin}, 27714 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 27715 annote = {Mathematical Programming Technical Report 94-12} 27716} 27717 27718@TechReport{ dixon.mills:neural, 27719 author = {L. C. Dixon and D. J. Mills}, 27720 title = {Neural Nets for Massively Parallel Optimisation}, 27721 institution = {Hatfield Polytechnic}, 27722 year = {1992}, 27723 address = {Hatfield, Hertforshire, England}, 27724 number = {Numerical Optimisation Centre Technical Report No. 259} 27725} 27726 27727@Article{ dontchev:local, 27728 author = {A. L. Dontchev}, 27729 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 27730 journal = {C.R. Acad. Sci. Paris Series I}, 27731 year = {1996}, 27732 volume = {332}, 27733 pages = {327--331} 27734} 27735 27736@Article{ douglas.rachford:numerical, 27737 author = {J. Douglas and H. H. Rachford}, 27738 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 27739 Variables}, 27740 journal = {Transactions of the American Mathematical Society}, 27741 year = {1956}, 27742 volume = {82}, 27743 pages = {421--439} 27744} 27745 27746@Article{ drud:conopt, 27747 author = {A. Drud}, 27748 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 27749 Problems}, 27750 journal = {Mathematical Programming}, 27751 year = {1985}, 27752 volume = {31}, 27753 pages = {153--191} 27754} 27755 27756@Article{ dsouza.meyer.ea:mixed, 27757 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27758 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27759 Optimization}, 27760 journal = {Medical Physics}, 27761 year = {1999}, 27762 key = {85}, 27763 volume = {26}, 27764 number = {6}, 27765 pages = {1099} 27766} 27767 27768@TechReport{ dsouza.meyer.ea:mixed*1, 27769 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27770 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27771 Optimization}, 27772 year = {1999}, 27773 key = {87}, 27774 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 27775 institution = {Computer Sciences Department, University of Wisconsin}, 27776 address = {Madison, Wisconsin}, 27777 number = {99-08}, 27778 type = {Mathematical Programming Technical Report}, 27779 annote = {Submitted to } 27780} 27781 27782@Article{ dsouza.meyer.ea:iterative, 27783 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 27784 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 27785 Brachytherapy Treatment Optimization}, 27786 year = {2000}, 27787 key = {96}, 27788 journal = {Physics and Medicine in Biology, forthcoming} 27789} 27790 27791@Article{ du.yu.ea:multileaf, 27792 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 27793 G. Gustafson and A. Martinez and J. W. Wong}, 27794 title = {A multileaf collimator field prescription preparation system for conventional 27795 radiotherapy}, 27796 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27797 year = {1994}, 27798 volume = {30}, 27799 number = {3}, 27800 pages = {707--714} 27801} 27802 27803@Article{ duda.fossum:pattern, 27804 author = {R. O. Duda and H. Fossum}, 27805 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 27806 Discriminant Functions}, 27807 journal = {IEEE Transactions on Electronic Computers}, 27808 year = {1966}, 27809 volume = {15}, 27810 pages = {220--232} 27811} 27812 27813@Book{ duda.hart:pattern, 27814 author = {R. O. Duda and P. E. Hart}, 27815 title = {Pattern Classification and Scene Analysis}, 27816 year = {1973}, 27817 publisher = {John Wiley \& Sons}, 27818 address = {New York} 27819} 27820 27821@Book{ duff.erisman.ea:direct, 27822 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 27823 title = {Direct Methods for Sparse Matrices}, 27824 publisher = {Oxford University Press}, 27825 year = {1986}, 27826 address = {Oxford, England} 27827} 27828 27829@InCollection{ duffin:infinite, 27830 author = {R. J. Duffin}, 27831 title = {Infinite Programs}, 27832 booktitle = {Linear Inequalities and Related Systems}, 27833 year = {1975}, 27834 editor = {H. W. Kuhn and A. W. Tucker}, 27835 publisher = {Princeton University Press}, 27836 address = {Princeton, New Jersey}, 27837 pages = {157--170} 27838} 27839 27840@Article{ dunn.sachs:effect, 27841 author = {J. C. Dunn and E. Sachs}, 27842 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 27843 journal = {Applied Mathematics and Optimization}, 27844 year = {1983}, 27845 volume = {10}, 27846 pages = {143--157} 27847} 27848 27849@Article{ dunn:convergence, 27850 author = {J. C. Dunn}, 27851 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 27852 journal = {Journal of Optimization Theory and Applications}, 27853 year = {1987}, 27854 volume = {55}, 27855 pages = {203--216} 27856} 27857 27858@Article{ dunn:global, 27859 author = {J. C. Dunn}, 27860 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 27861 Gradient Processes}, 27862 journal = {SIAM Journal on Control and Optimization}, 27863 year = {1981}, 27864 volume = {19}, 27865 pages = {368--400} 27866} 27867 27868@Article{ dunn:rates, 27869 author = {J. C. Dunn}, 27870 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 27871 Nonsingular Extremals}, 27872 journal = {SIAM Journal on Control and Optimization}, 27873 year = {1979}, 27874 volume = {17}, 27875 pages = {187--211} 27876} 27877 27878@Article{ dupuis.simha:sampling, 27879 author = {P. Dupuis and R. Simha}, 27880 title = {On Sampling-Controlled Stochastic Approximation}, 27881 journal = {{IEEE} Transactions on Automatic Control}, 27882 year = {1991}, 27883 volume = {36}, 27884 pages = {915--924} 27885} 27886 27887@TechReport{ eager.ferris.ea:models, 27888 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27889 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 27890 institution = {Computer Sciences Department, University of Wisconsin}, 27891 year = {1999}, 27892 type = {Technical Report}, 27893 number = {1402}, 27894 address = {Madison, Wisconsin}, 27895 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 27896 key = {84} 27897} 27898 27899@InProceedings{ eager.ferris.ea:optimized, 27900 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27901 title = {Optimized Regional Caching for On-Demand Data Delivery}, 27902 year = {1999}, 27903 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 27904 volume = {3654}, 27905 address = {Bellingham, Washington}, 27906 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 27907 key = {69}, 27908 pages = {301--316}, 27909 annote = {18 percent acceptance rate} 27910} 27911 27912@Article{ eager.ferris.ea:optimized*1, 27913 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27914 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 27915 journal = {Performance Evaluation}, 27916 year = {2000}, 27917 key = {72}, 27918 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 27919 volume = {42}, 27920 pages = {163--185} 27921} 27922 27923@InProceedings{ eager.vernon:dynamic, 27924 author = {D. L. Eager and M. K. Vernon}, 27925 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 27926 year = {1998}, 27927 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 27928 ({MIS '98})}, 27929 pages = {18--32}, 27930 address = {Istanbul, Turkey} 27931} 27932 27933@Article{ eaves.lemke:equivalence, 27934 author = {B. C. Eaves and C. E. Lemke}, 27935 title = {Equivalence of {LCP} and {PLS}}, 27936 journal = {Mathematics of Operations Research}, 27937 year = {1981}, 27938 volume = {6}, 27939 pages = {475--484} 27940} 27941 27942@Article{ eaves.rothblum:relationships, 27943 author = {B. C. Eaves and U. G. Rothblum}, 27944 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 27945 journal = {Linear Algebra and Its Applications}, 27946 year = {1990}, 27947 volume = {132}, 27948 pages = {1--63} 27949} 27950 27951@Article{ eaves:basic, 27952 author = {B. C. Eaves}, 27953 title = {On the Basic Theorem of Complementarity}, 27954 journal = {Mathematical Programming}, 27955 year = {1971}, 27956 volume = {1}, 27957 pages = {68--87} 27958} 27959 27960@Article{ eaves:computing, 27961 author = {B. C. Eaves}, 27962 title = {Computing Stationary Points}, 27963 journal = {Mathematical Programming Study}, 27964 year = {1978}, 27965 volume = {7}, 27966 pages = {1--14} 27967} 27968 27969@InCollection{ eaves:computing*1, 27970 author = {B. C. Eaves}, 27971 title = {Computing Stationary Points, Again}, 27972 pages = {391--405}, 27973 crossref = {mangasarian.meyer.ea:nonlinear*3} 27974} 27975 27976@Article{ eaves:homotopies, 27977 author = {B. C. Eaves}, 27978 title = {Homotopies for Computation of Fixed Points}, 27979 journal = {Mathematical Programming}, 27980 year = {1972}, 27981 volume = {3}, 27982 pages = {1--22} 27983} 27984 27985@Article{ eaves:linear, 27986 author = {B. C. Eaves}, 27987 title = {The Linear Complementarity Problem}, 27988 journal = {Management Science}, 27989 year = {1971}, 27990 volume = {17}, 27991 pages = {612--634} 27992} 27993 27994@Article{ eaves:quadratic, 27995 author = {B. C. Eaves}, 27996 title = {On Quadratic Programming}, 27997 journal = {Management Science}, 27998 year = {1971}, 27999 volume = {17}, 28000 pages = {698--711} 28001} 28002 28003@InProceedings{ eaves:short, 28004 author = {B. C. Eaves}, 28005 title = {A Short Course in Solving Equations with {PL} Homotopies}, 28006 booktitle = {Nonlinear Programming}, 28007 organization = {American Mathematical Society}, 28008 year = {1976}, 28009 editor = {R. W. Cottle and C. E. Lemke}, 28010 publisher = {SIAM--AMS Proceedings}, 28011 address = {Providence, RI}, 28012 pages = {73--143} 28013} 28014 28015@InCollection{ ebiefung.kostreva:global, 28016 author = {A. A. Ebiefung and M. M. Kostreva}, 28017 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 28018 Class of Polynomial Complementarity Problems}, 28019 editors = {C. Floudas and P. Pardalos}, 28020 booktitle = {Recent Advances in Global Optimization}, 28021 publisher = {Princeton University Press}, 28022 pages = {102--124}, 28023 year = {1991} 28024} 28025 28026@TechReport{ ebiefung.kostreva:z-matrices, 28027 author = {A. A. Ebiefung and M. M. Kostreva}, 28028 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 28029 institution = {Department of Mathematical Sciences, Clemson University}, 28030 year = {1991}, 28031 number = {608}, 28032 address = {Clemson, South Carolina} 28033} 28034 28035@TechReport{ eckstein.bertsekas:alternating, 28036 author = {J. Eckstein and D. P. Bertsekas}, 28037 title = {An Alternating Direction Method for Linear Programming}, 28038 institution = {Harvard Business School}, 28039 year = {1990}, 28040 type = {Working Paper}, 28041 number = {90-063}, 28042 address = {Boston, MA} 28043} 28044 28045@Article{ eckstein.bertsekas:douglas-rachford, 28046 author = {J. Eckstein and D. P. Bertsekas}, 28047 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 28048 Maximal Monotone Operators}, 28049 journal = {Mathematical Programming}, 28050 year = {1992}, 28051 pages = {293--318}, 28052 volume = {55} 28053} 28054 28055@Article{ eckstein.bertsekas:douglas-rachford*1, 28056 author = {J. Eckstein and D. P. Bertsekas}, 28057 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 28058 for Maximal Monotone Operators}, 28059 journal = {Mathematical Programming}, 28060 year = {1991}, 28061 note = {To appear} 28062} 28063 28064@TechReport{ eckstein.ferris:operator, 28065 author = {J. Eckstein and M. C. Ferris}, 28066 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 28067 institution = {Thinking Machines Corporation}, 28068 year = {1992}, 28069 address = {Cambridge, MA 02142}, 28070 number = {239}, 28071 type = {TMC}, 28072 key = {26} 28073} 28074 28075@Article{ eckstein.ferris:operator*1, 28076 author = {J. Eckstein and M. C. Ferris}, 28077 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 28078 Parallel Application to Optimal Control}, 28079 volume = {10}, 28080 pages = {218--235}, 28081 year = {1998}, 28082 journal = {INFORMS Journal on Computing}, 28083 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 28084 key = {44} 28085} 28086 28087@Article{ eckstein.ferris:smooth, 28088 author = {J. Eckstein and M. C. Ferris}, 28089 title = {Smooth Methods of Multipliers for Complementarity Problems}, 28090 key = {58}, 28091 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 28092 year = {1999}, 28093 journal = {Mathematical Programming}, 28094 volume = {86}, 28095 pages = {65--90} 28096} 28097 28098@InProceedings{ eckstein.hart.ea:resource, 28099 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 28100 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 28101 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 28102 year = {1997}, 28103 note = {www.cs.sandia.gov/ISUG97} 28104} 28105 28106@Article{ eckstein:alternating, 28107 author = {J. Eckstein}, 28108 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 28109 CM-2}}, 28110 journal = {ORSA Journal on Computing}, 28111 year = {to appear} 28112} 28113 28114@Article{ eckstein:approximate, 28115 author = {J. Eckstein}, 28116 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 28117 year = {1998}, 28118 journal = {Mathematical Programming}, 28119 volume = {83}, 28120 pages = {113--124} 28121} 28122 28123@Article{ eckstein:communication, 28124 author = {J. Eckstein}, 28125 title = {How Much Communication Does Parallel Branch and Bound Need}, 28126 journal = {{INFORMS} Journal on Computing}, 28127 volume = {9}, 28128 year = {1997}, 28129 pages = {15--29} 28130} 28131 28132@Article{ eckstein:distributed, 28133 author = {J. Eckstein}, 28134 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 28135 Integer Programming on the {CM}-5}, 28136 journal = {Computational Optimization and Applications}, 28137 volume = {7}, 28138 pages = {199--220}, 28139 year = {1997} 28140} 28141 28142@TechReport{ eckstein:lions-mercier, 28143 author = {J. Eckstein}, 28144 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 28145 as instances of the Proximal Point Algorithm}, 28146 institution = {MIT}, 28147 year = {1988}, 28148 address = {Cambridge, Massachusetts}, 28149 number = {LIDS-P-1769} 28150} 28151 28152@Article{ eckstein:nonlinear, 28153 author = {J. Eckstein}, 28154 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 28155 to Convex Programming}, 28156 journal = {Mathematics of Operations Research}, 28157 year = {1993}, 28158 pages = {202--226}, 28159 volume = {18} 28160} 28161 28162@Article{ eckstein:parallel, 28163 author = {J. Eckstein}, 28164 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 28165 {CM}-5}, 28166 journal = {SIAM Journal on Optimization}, 28167 volume = {4}, 28168 pages = {794--814}, 28169 year = {1994} 28170} 28171 28172@TechReport{ eckstein:smooth, 28173 author = {J. Eckstein}, 28174 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 28175 institution = {Rutgers Center for Operations Research, Rutgers University}, 28176 address = {New Brunswick, New Jersey}, 28177 year = {1996}, 28178 type = {Research Report}, 28179 number = {27-96} 28180} 28181 28182@PhDThesis{ eckstein:splitting, 28183 author = {J. Eckstein}, 28184 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 28185 Optimization}, 28186 school = {Massachusetts Institute of Technology}, 28187 year = {1989}, 28188 address = {Cambridge, MA}, 28189 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 28190} 28191 28192@Article{ eglese:simulated, 28193 author = {R. W. Eglese}, 28194 title = {Simulated Annealing: {A} Tool for Operational Research}, 28195 journal = {European Journal of Operations Research}, 28196 year = {1990}, 28197 volume = {46}, 28198 pages = {271--281} 28199} 28200 28201@Book{ ekeland.temam:convex, 28202 author = {I. Ekeland and R. Temam}, 28203 title = {Convex Analysis and Variational Problems}, 28204 year = {1976}, 28205 publisher = {North--Holland}, 28206 address = {Amsterdam} 28207} 28208 28209@Article{ ekeland:variational, 28210 author = {I. Ekeland}, 28211 title = {On the Variational Principle}, 28212 journal = {Journal of Mathematical Analysis and Applications}, 28213 year = {1974}, 28214 volume = {47}, 28215 pages = {324--353} 28216} 28217 28218@TechReport{ el-bakry.tapia.ea:formulation, 28219 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 28220 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 28221 for nonlinear programming}, 28222 type = {{Technical Report TR92-40}}, 28223 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 28224 year = {1992} 28225} 28226 28227@Article{ eldersveld.saunders:block, 28228 author = {S. K. Eldersveld and M. A. Saunders}, 28229 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 28230 journal = {SIAM Journal on Matrix Analysis and Applications}, 28231 year = {1992}, 28232 volume = {13}, 28233 pages = {191--201} 28234} 28235 28236@Article{ elster.neumaier:grid, 28237 author = {C. Elster and A. Neumaier}, 28238 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 28239 journal = {{IMA} Journal of Numerical Analysis}, 28240 year = {1995}, 28241 volume = {15}, 28242 pages = {585--608} 28243} 28244 28245@Article{ epema.livny.ea:worldwide, 28246 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 28247 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 28248 journal = {Journal on Future Generations of Computer Systems}, 28249 year = {1996}, 28250 volume = {12}, 28251 pages = {53--65} 28252} 28253 28254@Book{ ermoliev.editors:numerical, 28255 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 28256 title = {Numerical Techniques for Stochastic Optimization Problems}, 28257 year = {1988}, 28258 publisher = {Springer-Verlag}, 28259 address = {Berlin} 28260} 28261 28262@TechReport{ evett.spiehler:rule, 28263 author = {I. W. Evett and E. J. Spiehler}, 28264 title = {Rule Induction in Forensic Science}, 28265 institution = {Central Research Establishment, Home Office Forensic Science Service}, 28266 year = {1987}, 28267 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 28268 type = {Technical Report} 28269} 28270 28271@Article{ evtushenko.purtov:sufficient, 28272 author = {Y. G. Evtushenko and V. A. Purtov}, 28273 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 28274 journal = {Soviet Mathematics Doklady}, 28275 year = {1984}, 28276 volume = {30}, 28277 pages = {313--316} 28278} 28279 28280@Article{ facchinei.fischer.ea:regularity, 28281 author = {F. Facchinei and A. Fischer and C. Kanzow}, 28282 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 28283 journal = {SIAM Journal on Optimization}, 28284 year = {1998}, 28285 volume = {8}, 28286 pages = {850--869} 28287} 28288 28289@Article{ facchinei.fischer.ea:semismooth, 28290 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 28291 Constraints}, 28292 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 28293 journal = {Complementarity and Variational Problems: State of the Art}, 28294 volume = {92}, 28295 pages = {76}, 28296 year = {1997} 28297} 28298 28299@TechReport{ facchinei.fischer.ea:simply, 28300 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 28301 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 28302 Variational Inequalities}, 28303 institution = {University of Hamburg}, 28304 year = {1996} 28305} 28306 28307@Article{ facchinei.jiang.ea:smoothing, 28308 author = {F. Facchinei and H. Jiang and L. Qi}, 28309 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 28310 year = {1999}, 28311 journal = {Mathematical Programming}, 28312 volume = {85}, 28313 pages = {107--134} 28314} 28315 28316@Article{ facchinei.kanzow:nonsmooth, 28317 author = {F. Facchinei and C. Kanzow}, 28318 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 28319 Complementarity Problems}, 28320 year = {1997}, 28321 journal = {Mathematical Programming}, 28322 volume = {76}, 28323 pages = {493--512} 28324} 28325 28326@Article{ facchinei.kanzow:unconstrained, 28327 author = {F. Facchinei and C. Kanzow}, 28328 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 28329 {L}agrangian}, 28330 year = {1997}, 28331 journal = {Journal of Optimization Theory and Applications}, 28332 volume = {92}, 28333 pages = {99--115} 28334} 28335 28336@TechReport{ facchinei.pang:total, 28337 author = {F. Facchinei and J. S. Pang}, 28338 title = {Total stability of variational inequalities}, 28339 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 28340 year = {1988}, 28341 type = {Manuscript}, 28342 address = {Roma, Italy} 28343} 28344 28345@Article{ facchinei.soares:merit, 28346 author = {F. Facchinei and J. Soares}, 28347 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 28348 Algorithm}, 28349 journal = {SIAM Journal on Optimization}, 28350 year = {1997}, 28351 volume = {7}, 28352 pages = {225--247} 28353} 28354 28355@InCollection{ facchinei.soares:testing, 28356 author = {F. Facchinei and J. Soares}, 28357 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 28358 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 28359 publisher = {Plenum Press}, 28360 address = {New York}, 28361 editor = {F. Giannessi and A. Maugeri}, 28362 year = {1995}, 28363 pages = {69--83} 28364} 28365 28366@InProceedings{ fahlman.lebiere:cascade-correlation, 28367 author = {S. E. Fahlman and C. Lebiere}, 28368 title = {The cascade-correlation learning architecture}, 28369 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 28370 year = {1990}, 28371 editor = {D. S. Touretzky}, 28372 publisher = {Morgan Kaufmann}, 28373 address = {San Mateo, California}, 28374 pages = {524--532} 28375} 28376 28377@InProceedings{ fang.geiser.ea:software, 28378 author = {G. Fang and B. Geiser and T. R. Mackie}, 28379 title = {Software system for {UW}/{GE} tomotherapy prototype}, 28380 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 28381 Radiation Therapy, Salt Lake City}, 28382 year = {1997}, 28383 editor = {D. D. Leavitt and G. Starkshall}, 28384 publisher = {Medical Physics Publishing}, 28385 address = {St. Louis, Missouri}, 28386 pages = {332--334} 28387} 28388 28389@Book{ fang.puthenpura:linear, 28390 author = {S.--C. Fang and S. Puthenpura}, 28391 title = {Linear Optimization and Extensions}, 28392 year = {1993}, 28393 publisher = {Prentice-Hall, Inc}, 28394 address = {Englewood Cliffs, New Jersey} 28395} 28396 28397@Article{ fayard.plateau:algorithm, 28398 author = {D. Fayard and G. Plateau}, 28399 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 28400 journal = {Computing}, 28401 year = {1982}, 28402 volume = {28}, 28403 pages = {269--287} 28404} 28405 28406@Book{ feller:introduction, 28407 author = {W. Feller}, 28408 title = {An Introduction to Probability Theory and its Applications}, 28409 publisher = {John Wiley \& Sons}, 28410 year = {1968}, 28411 address = {New York} 28412} 28413 28414@Article{ ferris.fourer.ea:expressing, 28415 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 28416 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 28417 journal = {SIAM Journal on Optimization}, 28418 volume = {9}, 28419 pages = {991--1009}, 28420 year = {1999}, 28421 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 28422 key = {65}, 28423 institution = {Computer Sciences Department, University of Wisconsin}, 28424 address = {Madison, Wisconsin}, 28425 number = {98-02}, 28426 type = {Mathematical Programming Technical Report} 28427} 28428 28429@TechReport{ ferris.horn:nlp2mcp, 28430 author = {M. C. Ferris and J. D. Horn}, 28431 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 28432 problems}, 28433 year = {1998}, 28434 institution = {Computer Sciences Department, University of Wisconsin}, 28435 note = {In preparation} 28436} 28437 28438@Article{ ferris.horn:partitioning, 28439 author = {M. C. Ferris and J. D. Horn}, 28440 title = {Partitioning Mathematical Programs for Parallel Solution}, 28441 year = {1998}, 28442 volume = {80}, 28443 pages = {35--62}, 28444 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 28445 journal = {Mathematical Programming}, 28446 key = {40} 28447} 28448 28449@Article{ ferris.kanzow.ea:feasible, 28450 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 28451 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 28452 year = {1999}, 28453 journal = {Mathematical Programming}, 28454 volume = {86}, 28455 pages = {475--497}, 28456 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 28457 key = {67} 28458} 28459 28460@InCollection{ ferris.kanzow:complementarity, 28461 author = {M. C. Ferris and C. Kanzow}, 28462 title = {Complementarity and Related Problems: {A} Survey}, 28463 booktitle = {Handbook of Applied Optimization, forthcoming}, 28464 key = {74}, 28465 publisher = {Oxford University Press}, 28466 year = {2000}, 28467 editor = {P. M. Pardalos and M. G. C. Resende}, 28468 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 28469 institution = {Computer Sciences Department, University of Wisconsin}, 28470 address = {Madison, Wisconsin}, 28471 number = {98-17}, 28472 type = {Mathematical Programming Technical Report} 28473} 28474 28475@Article{ ferris.lucidi.ea:nonmonotone, 28476 author = {M. C. Ferris and S. Lucidi and M. Roma}, 28477 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 28478 journal = {Computational Optimization and Applications}, 28479 volume = {6}, 28480 pages = {117--136}, 28481 year = {1996}, 28482 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 28483 key = {43} 28484} 28485 28486@TechReport{ ferris.lucidi:globally, 28487 author = {M. C. Ferris and S. Lucidi}, 28488 title = {Globally Convergent Methods for Nonlinear Equations}, 28489 institution = {Computer Sciences Department, University of Wisconsin}, 28490 year = {1991}, 28491 address = {Madison, Wisconsin}, 28492 number = {1030}, 28493 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 28494 key = {21} 28495} 28496 28497@Article{ ferris.lucidi:nonmonotone, 28498 author = {M. C. Ferris and S. Lucidi}, 28499 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 28500 journal = {Journal of Optimization Theory and Applications}, 28501 year = {1994}, 28502 volume = {81}, 28503 pages = {53--71}, 28504 key = {30} 28505} 28506 28507@Article{ ferris.mangasarian:breast, 28508 author = {M. C. Ferris and O. L. Mangasarian}, 28509 title = {Breast Cancer Diagnosis via Linear Programming}, 28510 key = {50}, 28511 journal = {{IEEE} Computational Science and Engineering}, 28512 year = {1995}, 28513 volume = {2}, 28514 pages = {70--71} 28515} 28516 28517@Article{ ferris.mangasarian:error, 28518 author = {M. C. Ferris and O. L. Mangasarian}, 28519 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 28520 Inequalities}, 28521 journal = {Annals of Operations Research}, 28522 year = {1993}, 28523 volume = {47}, 28524 pages = {293--305}, 28525 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 28526 key = {24} 28527} 28528 28529@Article{ ferris.mangasarian:finite, 28530 author = {M. C. Ferris and O. L. Mangasarian}, 28531 title = {Finite Perturbation of Convex Programs}, 28532 journal = {Applied Mathematics and Optimization}, 28533 year = {1991}, 28534 volume = {23}, 28535 pages = {263--273}, 28536 key = {08} 28537} 28538 28539@Book{ ferris.mangasarian:linear, 28540 author = {M. C. Ferris and O. L. Mangasarian}, 28541 title = {Linear Programming via {MATLAB}}, 28542 publisher = {in preparation}, 28543 year = {1995}, 28544 address = {Madison, Wisconsin} 28545} 28546 28547@Article{ ferris.mangasarian:minimum, 28548 author = {M. C. Ferris and O. L. Mangasarian}, 28549 title = {Minimum Principle Sufficiency}, 28550 journal = {Mathematical Programming}, 28551 year = {1992}, 28552 volume = {57}, 28553 pages = {1--14}, 28554 key = {11} 28555} 28556 28557@Article{ ferris.mangasarian:parallel, 28558 author = {M. C. Ferris and O. L. Mangasarian}, 28559 title = {Parallel Constraint Distribution}, 28560 journal = {SIAM Journal on Optimization}, 28561 year = {1991}, 28562 volume = {1}, 28563 pages = {487--500}, 28564 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 28565 key = {18} 28566} 28567 28568@Article{ ferris.mangasarian:parallel*1, 28569 author = {M. C. Ferris and O. L. Mangasarian}, 28570 title = {Parallel Variable Distribution}, 28571 journal = {SIAM Journal on Optimization}, 28572 year = {1994}, 28573 volume = {4}, 28574 pages = {815--832}, 28575 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 28576 key = {31} 28577} 28578 28579@Article{ ferris.meeraus.ea:computing, 28580 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 28581 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 28582 journal = {Optimization Methods and Software}, 28583 year = {1999}, 28584 volume = {10}, 28585 pages = {669--685}, 28586 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 28587 key = {45} 28588} 28589 28590@Article{ ferris.mesnier.ea:neos, 28591 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 28592 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 28593 {I}nternet}, 28594 year = {2000}, 28595 journal = {{ACM} Transactions on Mathematical Software}, 28596 key = {54}, 28597 volume = {26}, 28598 pages = {1--18}, 28599 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 28600 institution = {Computer Sciences Department, University of Wisconsin}, 28601 address = {Madison, Wisconsin}, 28602 number = {96-08}, 28603 type = {Mathematical Programming Technical Report}, 28604 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 28605 Argonne National Laboratory}, 28606 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 28607 1996} 28608} 28609 28610@InCollection{ ferris.meyer:models, 28611 author = {M. C. Ferris and R. R. Meyer}, 28612 title = {Models and Solution for On-Demand Data Delivery Problems}, 28613 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 28614 key = {80}, 28615 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 28616 Problems}, 28617 editor = {P. M. Pardalos}, 28618 series = {Nonconvex Optimization and its Applications}, 28619 volume = {42}, 28620 address = {Dordrect}, 28621 year = {2000}, 28622 pages = {175--188}, 28623 publisher = {Kluwer}, 28624 type = {Mathematical Programming Technical Report}, 28625 institution = {Computer Sciences Department, University of Wisconsin}, 28626 number = {99-04} 28627} 28628 28629@InProceedings{ ferris.munson.ea:homotopy, 28630 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 28631 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 28632 booktitle = {Numerical Analysis 1999}, 28633 key = {88}, 28634 year = {2000}, 28635 editor = {D. F. Griffiths and G. A. Watson}, 28636 series = {Research Notes in Mathematics}, 28637 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 28638 address = {London}, 28639 pages = {143--167}, 28640 publisher = {Chapman and Hall}, 28641 institution = {Computer Sciences Department, University of Wisconsin}, 28642 number = {99-09}, 28643 type = {Mathematical Programming Technical Report} 28644} 28645 28646@TechReport{ ferris.munson.ea:practical, 28647 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 28648 title = {A Practical Approach to Sample-Path Simulation Optimization}, 28649 type = {Data Mining Institute Technical Report}, 28650 institution = {Computer Sciences Department, University of Wisconsin}, 28651 address = {Madison, Wisconsin}, 28652 year = {2000}, 28653 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 28654 number = {00-03}, 28655 key = {92}, 28656 annote = {To appear in WSC 2000} 28657} 28658 28659@InCollection{ ferris.munson:case, 28660 author = {M. C. Ferris and T. S. Munson}, 28661 title = {Case Studies in Complementarity: Improving Model Formulation}, 28662 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 28663 key = {73}, 28664 pages = {79--98}, 28665 publisher = {Springer Verlag}, 28666 year = {1999}, 28667 editor = {M. Th\'{e}ra and R. Tichatschke}, 28668 number = {477}, 28669 series = {Lecture Notes in Economics and Mathematical Systems}, 28670 address = {Berlin}, 28671 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 28672 type = {Mathematical Programming Technical Report}, 28673 institution = {Computer Sciences Department, University of Wisconsin} 28674} 28675 28676@Article{ ferris.munson:complementarity, 28677 author = {M. C. Ferris and T. S. Munson}, 28678 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 28679 year = {2000}, 28680 volume = {24}, 28681 pages = {165--188}, 28682 journal = {Journal of Economic Dynamics and Control}, 28683 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 28684 key = {70}, 28685 type = {Mathematical Programming Technical Report}, 28686 institution = {Computer Sciences Department, University of Wisconsin}, 28687 address = {Madison, Wisconsin}, 28688 number = {98-12} 28689} 28690 28691@Misc{ ferris.munson:condor, 28692 author = {M. C. Ferris and T. S. Munson}, 28693 title = {Condor Modeling Language Interface}, 28694 organization = {Computer Sciences Department, University of Wisconsin}, 28695 address = {Madison, Wisconsin}, 28696 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 28697} 28698 28699@Manual{ ferris.munson:gams, 28700 author = {M. C. Ferris and T. S. Munson}, 28701 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 28702 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 28703} 28704 28705@Article{ ferris.munson:interfaces, 28706 author = {M. C. Ferris and T. S. Munson}, 28707 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 28708 journal = {Computational Optimization and Applications}, 28709 volume = {12}, 28710 pages = {207--227}, 28711 year = {1999}, 28712 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 28713 key = {63}, 28714 institution = {Computer Sciences Department, University of Wisconsin}, 28715 address = {Madison, Wisconsin}, 28716 number = {97-12}, 28717 type = {Mathematical Programming Technical Report} 28718} 28719 28720@TechReport{ ferris.munson:interior, 28721 author = {M. C. Ferris and T. S. Munson}, 28722 title = {Interior Point Methods for Massive Support Vector Machines}, 28723 institution = {Computer Sciences Department, University of Wisconsin}, 28724 year = {2000}, 28725 key = {94}, 28726 type = {Data Mining Institute Technical Report}, 28727 number = {00-05}, 28728 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 28729 address = {Madison, Wisconsin}, 28730 annote = {Submitted to SIOPT} 28731} 28732 28733@Article{ ferris.munson:linear, 28734 author = {M. C. Ferris and T. S. Munson}, 28735 title = {Linear Programming for Emergency Broadcast Systems}, 28736 year = {1999}, 28737 journal = {{SIAG/OPT} Newsletter}, 28738 volume = {10}, 28739 pages = {6--8}, 28740 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 28741 key = {76}, 28742 type = {Mathematical Programming Technical Report}, 28743 institution = {Computer Sciences Department, University of Wisconsin}, 28744 address = {Madison, Wisconsin}, 28745 number = {98-20} 28746} 28747 28748@Article{ ferris.munson:modeling, 28749 author = {M. C. Ferris and T. S. Munson}, 28750 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 28751 year = {2000}, 28752 journal = {Mathematical Programming}, 28753 volume = {88}, 28754 pages = {487--506}, 28755 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 28756 key = {71}, 28757 type = {Mathematical Programming Technical Report}, 28758 institution = {Computer Sciences Department, University of Wisconsin}, 28759 address = {Madison, Wisconsin}, 28760 number = {98-13} 28761} 28762 28763@TechReport{ ferris.munson:preprocessing, 28764 author = {M. C. Ferris and T. S. Munson}, 28765 title = {Preprocessing Complementarity Problems}, 28766 type = {Mathematical Programming Technical Report}, 28767 institution = {Computer Sciences Department, University of Wisconsin}, 28768 address = {Madison, Wisconsin}, 28769 year = {1999}, 28770 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 28771 number = {99-07}, 28772 key = {86}, 28773 annote = {Submitted to ICCP 99} 28774} 28775 28776@TechReport{ ferris.munson:semismooth, 28777 author = {M. C. Ferris and T. S. Munson}, 28778 title = {Semismooth Support Vector Machines}, 28779 institution = {Computer Sciences Department, University of Wisconsin}, 28780 year = {2000}, 28781 key = {97}, 28782 type = {Data Mining Institute Technical Report}, 28783 number = {00-09}, 28784 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 28785 address = {Madison, Wisconsin}, 28786 annote = {Submitted to Math Prog B} 28787} 28788 28789@Article{ ferris.pang:engineering, 28790 author = {M. C. Ferris and J. S. Pang}, 28791 title = {Engineering and Economic Applications of Complementarity Problems}, 28792 year = {1997}, 28793 journal = {SIAM Review}, 28794 volume = {39}, 28795 pages = {669--713}, 28796 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 28797 key = {46} 28798} 28799 28800@Article{ ferris.pang:nondegenerate, 28801 author = {M. C. Ferris and J. S. Pang}, 28802 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 28803 journal = {SIAM Journal on Control and Optimization}, 28804 year = {1996}, 28805 volume = {34}, 28806 pages = {244--263}, 28807 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 28808 key = {35} 28809} 28810 28811@Article{ ferris.philpott:affine, 28812 author = {M. C. Ferris and A. B. Philpott}, 28813 title = {On Affine Scaling and Semi--Infinite Programming}, 28814 journal = {Mathematical Programming}, 28815 year = {1992}, 28816 volume = {56}, 28817 pages = {361--364}, 28818 key = {15} 28819} 28820 28821@Article{ ferris.philpott:interior, 28822 author = {M. C. Ferris and A. B. Philpott}, 28823 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 28824 journal = {Mathematical Programming}, 28825 year = {1989}, 28826 volume = {43}, 28827 pages = {257--276}, 28828 key = {04} 28829} 28830 28831@Article{ ferris.philpott:performance, 28832 author = {M. C. Ferris and A. B. Philpott}, 28833 title = {On the Performance of {K}armarkar's Algorithm}, 28834 journal = {Journal of the Operational Research Society}, 28835 year = {1988}, 28836 volume = {39}, 28837 pages = {257--270}, 28838 key = {03} 28839} 28840 28841@InCollection{ ferris.ralph:projected, 28842 author = {M. C. Ferris and D. Ralph}, 28843 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 28844 Maps}, 28845 booktitle = {Recent Advances in Nonsmooth Optimization}, 28846 publisher = {World Scientific Publishers}, 28847 year = {1995}, 28848 pages = {57--87}, 28849 editor = {D. Du and L. Qi and R. Womersley}, 28850 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 28851 key = {41} 28852} 28853 28854@Article{ ferris.ruszczynski:robust, 28855 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 28856 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 28857 year = {2000}, 28858 journal = {Networks}, 28859 volume = {35}, 28860 pages = {181--194}, 28861 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 28862 key = {60} 28863} 28864 28865@InCollection{ ferris.rutherford:accessing, 28866 author = {M. C. Ferris and T. F. Rutherford}, 28867 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 28868 booktitle = {Nonlinear Optimization and Applications}, 28869 key = {48}, 28870 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 28871 editor = {G. Di Pillo and F. Giannessi}, 28872 year = {1996}, 28873 pages = {141--153}, 28874 publisher = {Plenum Press}, 28875 address = {New York} 28876} 28877 28878@InCollection{ ferris.shepard:optimizing, 28879 author = {M. C. Ferris and D. M. Shepard}, 28880 title = {Optimization of Gamma Knife Radiosurgery}, 28881 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 28882 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 28883 publisher = {AMS}, 28884 year = {2000}, 28885 optseries = {DIMACS}, 28886 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 28887 key = {91}, 28888 type = {Data Mining Institute Technical Report}, 28889 institution = {Computer Sciences Department, University of Wisconsin}, 28890 address = {Madison, Wisconsin}, 28891 number = {00-01} 28892} 28893 28894@InCollection{ ferris.sinapiromsaran:formulating, 28895 author = {M. C. Ferris and K. Sinapiromsaran}, 28896 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 28897 booktitle = {Optimization}, 28898 key = {77}, 28899 publisher = {Springer-Verlag}, 28900 year = {2000}, 28901 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 28902 volume = {481}, 28903 series = {Lecture Notes in Economics and Mathematical Systems}, 28904 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 28905 type = {Mathematical Programming Technical Report}, 28906 institution = {Computer Sciences Department, University of Wisconsin}, 28907 address = {Madison, Wisconsin}, 28908 number = {98-21} 28909} 28910 28911@Article{ ferris.tin-loi:limit, 28912 author = {M. C. Ferris and F. Tin-Loi}, 28913 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 28914 Complementarity Constraints}, 28915 year = {2001}, 28916 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 28917 key = {78}, 28918 journal = {International Journal of Mechanical Sciences}, 28919 pages = {209--224}, 28920 volume = {43}, 28921 type = {Mathematical Programming Technical Report}, 28922 institution = {Computer Sciences Department, University of Wisconsin}, 28923 address = {Madison, Wisconsin}, 28924 number = {99-01} 28925} 28926 28927@Article{ ferris.tin-loi:nonlinear, 28928 author = {M. C. Ferris and F. Tin-Loi}, 28929 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 28930 Elastoplasticity}, 28931 year = {1998}, 28932 key = {64}, 28933 volume = {6}, 28934 pages = {857--870}, 28935 journal = {Structural Engineering and Mechanics} 28936} 28937 28938@Article{ ferris.tin-loi:solution, 28939 author = {M. C. Ferris and F. Tin-Loi}, 28940 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 28941 and Complementarity Constraints}, 28942 year = {1999}, 28943 journal = {Computer Methods in Applied Mechanics and Engineering}, 28944 volume = {174}, 28945 pages = {107--120}, 28946 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 28947 key = {66} 28948} 28949 28950@Article{ ferris.vlach:scheduling, 28951 author = {M. C. Ferris and M. Vlach}, 28952 title = {Scheduling with Earliness and Tardiness Penalties}, 28953 journal = {Naval Research Logistics Quarterly}, 28954 year = {1992}, 28955 volume = {39}, 28956 pages = {229--245}, 28957 key = {13} 28958} 28959 28960@TechReport{ ferris.zavriev:linear, 28961 author = {M. C. Ferris and S. K Zavriev}, 28962 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 28963 institution = {Computer Sciences Department, University of Wisconsin}, 28964 year = {1996}, 28965 key = {56}, 28966 address = {Madison, Wisconsin}, 28967 type = {Mathematical Programming Technical Report}, 28968 number = {96--12}, 28969 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 28970} 28971 28972@Article{ ferris:finite, 28973 author = {M. C. Ferris}, 28974 title = {Finite Termination of the Proximal Point Algorithm}, 28975 journal = {Mathematical Programming}, 28976 year = {1991}, 28977 volume = {50}, 28978 pages = {359--366}, 28979 key = {06} 28980} 28981 28982@Article{ ferris:iterative, 28983 author = {M. C. Ferris}, 28984 title = {Iterative Linear Programming Solution of Convex Programs}, 28985 journal = {Journal of Optimization Theory and Applications}, 28986 year = {1990}, 28987 volume = {65}, 28988 pages = {53--65}, 28989 key = {07} 28990} 28991 28992@Article{ ferris:linear, 28993 author = {M. C. Ferris}, 28994 title = {The Linear Complementarity Problem}, 28995 journal = {Bulletin of the American Mathematical Society}, 28996 year = {1993}, 28997 volume = {28}, 28998 pages = {169--175}, 28999 key = {27} 29000} 29001 29002@MastersThesis{ ferris:linear*1, 29003 author = {M. C. Ferris}, 29004 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 29005 Solving a Class of Structural Optimization Problems}, 29006 year = {1985}, 29007 school = {University of Cambridge}, 29008 address = {England}, 29009 key = {01} 29010} 29011 29012@TechReport{ ferris:matlab, 29013 author = {M. C. Ferris}, 29014 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 29015 institution = {Computer Sciences Department, University of Wisconsin}, 29016 year = {1998}, 29017 address = {Madison, Wisconsin}, 29018 type = {Mathematical Programming Technical Report}, 29019 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 29020 number = {98-19}, 29021 key = {75} 29022} 29023 29024@Article{ ferris:parallel, 29025 author = {M. C. Ferris}, 29026 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 29027 journal = {Mathematics of Operations Research}, 29028 year = {1994}, 29029 volume = {19}, 29030 pages = {645--658}, 29031 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 29032 key = {20} 29033} 29034 29035@TechReport{ ferris:parallel*1, 29036 author = {M. C. Ferris}, 29037 title = {Parallel Solution of Extremely Large Knapsack Problems}, 29038 institution = {Computer Sciences Department, University of Wisconsin}, 29039 year = {1989}, 29040 address = {Madison, Wisconsin}, 29041 number = {842}, 29042 key = {09} 29043} 29044 29045@PhDThesis{ ferris:weak, 29046 author = {M. C. Ferris}, 29047 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29048 year = {1988}, 29049 school = {University of Cambridge}, 29050 address = {England}, 29051 key = {02} 29052} 29053 29054@TechReport{ ferris:weak*1, 29055 author = {M. C. Ferris}, 29056 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29057 institution = {Computer Sciences Department, University of Wisconsin}, 29058 year = {1988}, 29059 address = {Madison, Wisconsin}, 29060 number = {779}, 29061 key = {05} 29062} 29063 29064@Book{ fiacco.mccormick:nonlinear, 29065 author = {A. V. Fiacco and G. P. McCormick}, 29066 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 29067 year = {1968}, 29068 publisher = {John Wiley \& Sons}, 29069 address = {New York}, 29070 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 29071} 29072 29073@Book{ fiacco:introduction, 29074 author = {A. V. Fiacco}, 29075 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 29076 year = {1983}, 29077 publisher = {Academic Press}, 29078 address = {New York} 29079} 29080 29081@Article{ fiedler.ptak:matrices, 29082 author = {M. Fiedler and V. Pt\'{a}k}, 29083 title = {On matrices with nonpositive off-diagonal elements and positive principal 29084 minors}, 29085 journal = {Czechoslovak Mathematics Journal}, 29086 volume = {12}, 29087 pages = {382--400}, 29088 year = {1962} 29089} 29090 29091@Article{ fischer.kanzow:finite, 29092 author = {A. Fischer and C. Kanzow}, 29093 title = {On Finite Termination of an Iterative Method for Linear Complementarity 29094 Problems}, 29095 journal = {Mathematical Programming}, 29096 volume = {74}, 29097 pages = {279--292}, 29098 year = {1996} 29099} 29100 29101@TechReport{ fischer:constrained, 29102 author = {A. Fischer}, 29103 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 29104 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 29105 year = {1995}, 29106 type = {Technical Report}, 29107 number = {MATH-NM-10-1995}, 29108 address = {Dresden} 29109} 29110 29111@Article{ fischer:local, 29112 author = {A. Fischer}, 29113 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 29114 weak conditions}, 29115 journal = {Optimization Methods and Software}, 29116 year = {1995}, 29117 volume = {6}, 29118 pages = {83--107} 29119} 29120 29121@InCollection{ fischer:ncp-function, 29122 author = {A. Fischer}, 29123 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 29124 booktitle = {Recent Advances in Nonsmooth Optimization}, 29125 publisher = {World Scientific Publishers}, 29126 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 29127 year = {1995}, 29128 pages = {88--105} 29129} 29130 29131@Article{ fischer:newton-type, 29132 author = {A. Fischer}, 29133 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 29134 Problems}, 29135 journal = {Journal of Optimization Theory and Applications}, 29136 year = {1995}, 29137 volume = {86}, 29138 pages = {585--608} 29139} 29140 29141@Article{ fischer:solution, 29142 author = {A. Fischer}, 29143 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 29144 Functions}, 29145 year = {1997}, 29146 journal = {Mathematical Programming}, 29147 pages = {513--532} 29148} 29149 29150@Article{ fischer:special, 29151 author = {A. Fischer}, 29152 title = {A Special {N}ewton--Type Optimization Method}, 29153 journal = {Optimization}, 29154 year = {1992}, 29155 volume = {24}, 29156 pages = {269--284} 29157} 29158 29159@Article{ fisher:use, 29160 author = {R. A. Fisher}, 29161 title = {The Use of Multiple Measurements in Taxonomic Problems}, 29162 journal = {Annual Eugenics}, 29163 year = {1936}, 29164 volume = {7}, 29165 number = {Part II}, 29166 pages = {179--188} 29167} 29168 29169@Book{ fishman:principles, 29170 author = {G. Fishman}, 29171 title = {Principles of Discrete Event Simulation}, 29172 publisher = {Wiley}, 29173 address = {New York, NY}, 29174 year = {1978} 29175} 29176 29177@Article{ fitchard.aldridge.ea:registration, 29178 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 29179 title = {Registration of Synthetic Tomographic Projection Data Sets Using 29180 Cross-Correlation}, 29181 journal = {Physics in Medicine and Biology}, 29182 year = {1998}, 29183 volume = {43}, 29184 pages = {1645--1657} 29185} 29186 29187@Article{ fletcher.matthews:stable, 29188 author = {R. Fletcher and S. P. J. Matthews}, 29189 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 29190 journal = {Mathematical Programming}, 29191 year = {1984}, 29192 volume = {30}, 29193 pages = {267--284} 29194} 29195 29196@TechReport{ fletcher.maza:nonlinear, 29197 author = {R. Fletcher and E. Sainz de la Maza}, 29198 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 29199 Programming}, 29200 institution = {Department of Mathematical Sciences}, 29201 year = {1987}, 29202 address = {The University, Dundee, Scotland}, 29203 number = {NA/100}, 29204 type = {Numerical Analysis Report} 29205} 29206 29207@InCollection{ fletcher:class, 29208 author = {R. Fletcher}, 29209 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 29210 Properties}, 29211 booktitle = {Integer and Nonlinear Programming}, 29212 year = {1970}, 29213 editor = {J. Abadie}, 29214 publisher = {North--Holland}, 29215 address = {Amsterdam}, 29216 pages = {157--173} 29217} 29218 29219@Article{ fletcher:exact, 29220 author = {R. Fletcher}, 29221 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 29222 journal = {Mathematical Programming}, 29223 year = {1973}, 29224 volume = {5}, 29225 pages = {129--150} 29226} 29227 29228@Article{ fletcher:generalized, 29229 author = {R. Fletcher}, 29230 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 29231 Equations}, 29232 journal = {The Computer Journal}, 29233 year = {1968}, 29234 volume = {10}, 29235 pages = {392--399} 29236} 29237 29238@InProceedings{ fletcher:penalty, 29239 crossref = {bachem.grotschel.ea:mathematical}, 29240 author = {R. Fletcher}, 29241 title = {Penalty Functions}, 29242 pages = {87--114} 29243} 29244 29245@Book{ fletcher:practical, 29246 author = {R. Fletcher}, 29247 title = {Practical Methods of Optimization}, 29248 year = {1981}, 29249 publisher = {John Wiley \& Sons}, 29250 address = {Chichester}, 29251 volume = {1} 29252} 29253 29254@Book{ fletcher:practical*1, 29255 author = {R. Fletcher}, 29256 title = {Practical Methods of Optimization}, 29257 year = {1981}, 29258 publisher = {John Wiley \& Sons}, 29259 address = {Chichester}, 29260 volume = {2} 29261} 29262 29263@Book{ fletcher:practical*2, 29264 author = {R. Fletcher}, 29265 title = {Practical Methods of Optimization}, 29266 year = {1987}, 29267 publisher = {John Wiley \& Sons}, 29268 address = {New York}, 29269 edition = {second} 29270} 29271 29272@Unpublished{ fletcher:recent, 29273 author = {R. Fletcher}, 29274 title = {Recent Developments in Nonlinear Programming}, 29275 note = {Presentation at SOR 96, Braunchweig, Germany}, 29276 year = {1996} 29277} 29278 29279@InCollection{ fletcher:second, 29280 author = {R. Fletcher}, 29281 title = {Second Order Correction for Nondifferentiable Optimization}, 29282 booktitle = {Numerical Analysis}, 29283 year = {1982}, 29284 editor = {G. A. Watson}, 29285 publisher = {Springer-Verlag}, 29286 address = {Berlin}, 29287 pages = {85--114} 29288} 29289 29290@InCollection{ florian:mathematical, 29291 author = {M. Florian}, 29292 title = {Mathematical programming applications in national, regional, and urban planning}, 29293 editors = {M. Iri and K. Tanabe}, 29294 booktitle = {Mathematical Programming: Recent Developments and Applications}, 29295 publisher = {Kluwer Academic Publishers}, 29296 address = {Tokyo}, 29297 year = {1989} 29298} 29299 29300@Article{ florian:nonlinear, 29301 author = {M. Florian}, 29302 title = {Nonlinear Cost Network Models in Transportation Analysis}, 29303 journal = {Mathematical Programming Study}, 29304 year = {1986}, 29305 volume = {26}, 29306 pages = {167--196} 29307} 29308 29309@Article{ flynn:computer, 29310 author = {M.~J. Flynn}, 29311 title = {Some Computer Organizations and their Effectiveness}, 29312 journal = {IEEE Transactions on Computers}, 29313 year = {1972}, 29314 volume = {C-21}, 29315 pages = {948--960} 29316} 29317 29318@InProceedings{ fogarty:varying, 29319 crossref = {schaeffer:third}, 29320 author = {T. C. Fogarty}, 29321 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 29322 pages = {422--427} 29323} 29324 29325@Article{ forrest.goldfarb:steepest-edge, 29326 author = {J. J. Forrest and D. Goldfarb}, 29327 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 29328 journal = {Mathematical Programming}, 29329 year = {1992}, 29330 volume = {57}, 29331 pages = {341--374} 29332} 29333 29334@Article{ forrest.tomlin:updating, 29335 author = {J. J. H. Forrest and J. A. Tomlin}, 29336 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 29337 Simplex Method}, 29338 journal = {Mathematical Programming}, 29339 year = {1972}, 29340 volume = {2}, 29341 pages = {263--278} 29342} 29343 29344@TechReport{ forsgren.gill.ea:computing, 29345 author = {A. Forsgren and P. E. Gill and W. Murray}, 29346 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 29347 institution = {Department of Mathematics, Royal Institute of Technology}, 29348 year = {1993}, 29349 number = {TRITA-MAT-1993-9}, 29350 address = {Stockholm, Sweden} 29351} 29352 29353@TechReport{ forsgren.gill:primal-dual, 29354 author = {A. Forsgren and P. E. Gill}, 29355 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 29356 institution = {Department of Mathematics, University of California}, 29357 year = {1996}, 29358 type = {Report NA}, 29359 number = {96-3}, 29360 address = {San Diego} 29361} 29362 29363@InCollection{ fortin.glowinski:decomposition-coordination, 29364 author = {M. Fortin and R. Glowinski}, 29365 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 29366 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 29367 Problems}, 29368 publisher = {North-Holland}, 29369 year = {1983}, 29370 editor = {M. Fortin and R. Glowinski}, 29371 address = {Amsterdam} 29372} 29373 29374@Misc{ foster.kesselman:globus, 29375 author = {I. Foster and C. Kesselman}, 29376 title = {The Globus Project}, 29377 howpublished = {www.globus.org} 29378} 29379 29380@Article{ foster.kesselman:globus*1, 29381 author = {I. Foster and C. Kesselman}, 29382 title = {Globus: A Metacomputing Infrastructure Toolkit}, 29383 journal = {International Journal of Supercomputer Applications}, 29384 volume = {11}, 29385 pages = {115--128}, 29386 year = {1997} 29387} 29388 29389@Book{ foster.kesselman:grid, 29390 editor = {I. Foster and C. Kesselman}, 29391 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 29392 publisher = {Morgan Kaufmann Publishers}, 29393 year = {1999} 29394} 29395 29396@Book{ fourer.gay.ea:ampl, 29397 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29398 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 29399 year = {1993}, 29400 publisher = {Duxbury Press} 29401} 29402 29403@Article{ fourer.gay.ea:modeling, 29404 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29405 title = {A Modeling Language for Mathematical Programming}, 29406 journal = {Management Science}, 29407 year = {1990}, 29408 volume = {36}, 29409 pages = {519--554} 29410} 29411 29412@Article{ fraass:development, 29413 author = {A. Fraass}, 29414 title = {The development of conformal radiation therapy}, 29415 journal = {Medical Physics}, 29416 year = {1995}, 29417 volume = {22}, 29418 number = {11}, 29419 pages = {1911--1921} 29420} 29421 29422@TechReport{ fraley:algorithms, 29423 author = {C. Fraley}, 29424 title = {Algorithms for Nonlinear Least Squares}, 29425 institution = {Stanford University}, 29426 year = {1988}, 29427 number = {{SOL} 88.16}, 29428 type = {Technical Report} 29429} 29430 29431@InCollection{ francois.mcdonald.ea:uruguay, 29432 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29433 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 29434 booktitle = {The {U}ruguay Round and the Developing Economies}, 29435 address = {New York}, 29436 editors = {W. Martin and L. A. Winters}, 29437 publisher = {Cambridge University Press} 29438} 29439 29440@InCollection{ francois.mcdonald.ea:uruguay*1, 29441 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29442 title = {The {U}ruguay Round: {A} Global Analysis}, 29443 booktitle = {Challenges and Opportunities for East Asian Trade}, 29444 address = {Cambridge}, 29445 editors = {D. Robertson}, 29446 publisher = {Cambridge University Press} 29447} 29448 29449@Article{ frank.wolfe:algorithm, 29450 author = {M. Frank and P. Wolfe}, 29451 title = {An Algorithm for Quadratic Programming}, 29452 journal = {Naval Research Logistics Quarterly}, 29453 year = {1956}, 29454 volume = {3}, 29455 pages = {95--110} 29456} 29457 29458@Article{ freund.nachtigal:qmrpack, 29459 author = {R. W. Freund and N. M. Nachtigal}, 29460 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 29461 journal = {{ACM} Transactions on Mathematical Software}, 29462 year = {1996}, 29463 volume = {22}, 29464 pages = {46--77} 29465} 29466 29467@InProceedings{ freund.schapire:experiments, 29468 author = {Y. Freund and R. E. Schapire}, 29469 title = {Experiments with a New Boosting Algorithm}, 29470 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 29471 pages = {148--156}, 29472 year = {1996}, 29473 editor = {L. Saitta}, 29474 publisher = {Morgan Kaufmann} 29475} 29476 29477@Unpublished{ freund.todd:barrier, 29478 author = {Robert M. Freund and Michael J. Todd}, 29479 title = {Barrier functions and interior-point algorithms for linear programming with 29480 zero-, one-, or two-sided bounds on the variables}, 29481 year = {1992}, 29482 month = jul 29483} 29484 29485@Article{ friedman.chernina:iterative, 29486 author = {V. M. Friedman and V. S. Chernina}, 29487 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 29488 note = {In Russian}, 29489 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 29490 volume = {1}, 29491 pages = {116--120}, 29492 year = {1967} 29493} 29494 29495@Article{ friesz.bernstein.ea:day-to-day, 29496 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 29497 Ganjalizadeh}, 29498 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 29499 Systems}, 29500 journal = {Operations Research}, 29501 year = {1994}, 29502 volume = {42}, 29503 pages = {1120--1136} 29504} 29505 29506@Article{ friesz.tobin.ea:nonlinear, 29507 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 29508 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 29509 Derived Demand Network Equilibrium Problem}, 29510 journal = {Journal of Regional Science}, 29511 year = {1983}, 29512 volume = {23}, 29513 pages = {337--359} 29514} 29515 29516@Article{ friesz:network, 29517 author = {T. L. Friesz}, 29518 title = {Network Equilibrium, Design and Aggregation}, 29519 journal = {Transportation Research}, 29520 volume = {19A}, 29521 year = {1985}, 29522 pages = {413--427} 29523} 29524 29525@Unpublished{ frisch:logarithmic, 29526 author = {K. R. Frisch}, 29527 title = {The Logarithmic Potential Method of Convex Programming}, 29528 year = {1955}, 29529 note = {Unpublished manuscript, University Institute of Economics, Oslo} 29530} 29531 29532@Book{ fukunaga:statistical, 29533 author = {K. Fukunaga}, 29534 title = {Statistical Pattern Recognition}, 29535 year = {1990}, 29536 publisher = {Academic Press}, 29537 address = {New York} 29538} 29539 29540@Article{ fukushima.luo.ea:globally, 29541 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 29542 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 29543 Programs with Linear Complementarity Constraints}, 29544 journal = {Computational Optimization and Applications}, 29545 year = {1998}, 29546 volume = {10}, 29547 pages = {5--34} 29548} 29549 29550@Article{ fukushima:equivalent, 29551 author = {M. Fukushima}, 29552 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 29553 Asymmetric Variational Inequality Problems}, 29554 journal = {Mathematical Programming}, 29555 year = {1992}, 29556 volume = {53}, 29557 pages = {99--110} 29558} 29559 29560@Article{ fukushima:primal, 29561 author = {M. Fukushima}, 29562 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 29563 Mappings with Application to the Traffic Equilibrium Problem}, 29564 journal = {Mathematical Programming}, 29565 year = {1996}, 29566 volume = {72}, 29567 pages = {1--15} 29568} 29569 29570@Article{ gabay.mercier:dual, 29571 author = {D. Gabay and B. Mercier}, 29572 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 29573 Finite Element Approximations}, 29574 journal = {Computational Mathematics and Applications}, 29575 year = {1976}, 29576 volume = {2}, 29577 pages = {17--48} 29578} 29579 29580@InCollection{ gabay:applications, 29581 author = {D. Gabay}, 29582 title = {Applications of the Method of Multipliers to Variational Inequalities}, 29583 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 29584 Problems}, 29585 publisher = {North-Holland}, 29586 year = {1983}, 29587 editor = {M. Fortin and R. Glowinski}, 29588 address = {Amsterdam} 29589} 29590 29591@Unpublished{ gabriel.bernstein:path, 29592 author = {S. A. Gabriel and D. Berstein}, 29593 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 29594 Equilibrium Problem}, 29595 note = {Draft, 1995} 29596} 29597 29598@TechReport{ gabriel.kydes:nonlinear, 29599 author = {S. A. Gabriel and A. S. Kydes}, 29600 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 29601 System}, 29602 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 29603 year = {1995}, 29604 type = {Preprint}, 29605 number = {MCS-P504-0395}, 29606 address = {Argonne, Illinois}, 29607 month = mar 29608} 29609 29610@InProceedings{ gabriel.more:smoothing, 29611 crossref = {ferris.pang:complementarity}, 29612 author = {S. A. Gabriel and J. J. Mor\'{e}}, 29613 title = {Smoothing of Mixed Complementarity Problems} 29614} 29615 29616@Article{ gabriel.pang:inexact, 29617 author = {S. A. Gabriel and J. S. Pang}, 29618 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 29619 journal = {Computational Optimization and Applications}, 29620 year = {1992}, 29621 volume = {1}, 29622 pages = {67--91} 29623} 29624 29625@InCollection{ gabriel.pang:trust, 29626 author = {S. A. Gabriel and J. S. Pang}, 29627 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 29628 booktitle = {Large--Scale Optimization: State of the Art}, 29629 publisher = {Kluwer Academic Publishers}, 29630 year = {1994}, 29631 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 29632 pages = {159--186} 29633} 29634 29635@PhDThesis{ gabriel:algorithms, 29636 author = {S. A. Gabriel}, 29637 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 29638 Extensions}, 29639 school = {The Johns Hopkins University}, 29640 year = {1992}, 29641 address = {Baltimore, Maryland} 29642} 29643 29644@Article{ gafni.bertsekas:two-metric, 29645 author = {E. M. Gafni and D. P. Bertsekas}, 29646 title = {Two-Metric Projection Methods for Constrained Optimization}, 29647 journal = {SIAM Journal on Control and Optimization}, 29648 year = {1984}, 29649 volume = {22}, 29650 pages = {936--964} 29651} 29652 29653@InProceedings{ gaivoronski:convergence, 29654 author = {A. A. Gaivoronski}, 29655 title = {Convergence of Parallel Backpropagation for Neural Networks}, 29656 booktitle = {SIAM Journal on Optimization}, 29657 year = {1994}, 29658 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 29659 submitted} 29660} 29661 29662@Misc{ gaivoronski:private, 29663 author = {A. A. Gaivoronski}, 29664 title = {Private Communication}, 29665 year = {1992}, 29666 month = nov, 29667 address = {ITALTEL, Milan} 29668} 29669 29670@Book{ gale:theory, 29671 author = {D. Gale}, 29672 title = {The Theory of Linear Economic Models}, 29673 year = {1960}, 29674 publisher = {McGraw-Hill Book Company}, 29675 address = {New York} 29676} 29677 29678@Book{ gallant:neural, 29679 author = {S. I. Gallant}, 29680 title = {Neural Network Learning and Expert Systems}, 29681 year = {1993}, 29682 publisher = {MIT Press}, 29683 address = {Cambridge, Massachusetts} 29684} 29685 29686@InProceedings{ ganti.gehrke.ea:framework, 29687 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 29688 title = {A Framework for Measuring Changes in Data Characteristics}, 29689 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 29690 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 29691 publisher = {ACM Press}, 29692 year = {1999}, 29693 isbn = {1-58113-062-7}, 29694 pages = {126--137} 29695} 29696 29697@Book{ ganz:gamma, 29698 author = {J. C. Ganz}, 29699 title = {Gamma Knife Surgery}, 29700 publisher = {Springer-Verlag Wien}, 29701 year = {1997}, 29702 address = {Austria} 29703} 29704 29705@TechReport{ gao:nonlinear, 29706 author = {Y. Gao}, 29707 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 29708 Conditions}, 29709 type = {Manuscript}, 29710 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 29711 month = oct, 29712 year = {1994} 29713} 29714 29715@Article{ garcia-palomares.mangasarian:superlinearly, 29716 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 29717 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 29718 Optimization Problems}, 29719 journal = {Mathematical Programming}, 29720 year = {1976}, 29721 volume = {11}, 29722 pages = {1--13} 29723} 29724 29725@Article{ garcia-palomares.restuccia:global, 29726 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 29727 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 29728 journal = {Mathematical Programming}, 29729 year = {1981}, 29730 volume = {21}, 29731 pages = {290--300} 29732} 29733 29734@InProceedings{ garcia-palomares:superlinearly, 29735 author = {U. M. {Garcia--Palomares}}, 29736 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 29737 crossref = {mangasarian.meyer.ea:nonlinear*2}, 29738 pages = {101--119} 29739} 29740 29741@Article{ garcia.gould:theorem, 29742 author = {C. B. Garcia and F. J. Gould}, 29743 title = {A Theorem on Homotopy Paths}, 29744 journal = {Mathematics of Operations Research}, 29745 year = {1978}, 29746 volume = {3}, 29747 pages = {282--289} 29748} 29749 29750@Book{ garcia.zangwill:pathways, 29751 author = {C. B. Garcia and W. I. Zangwill}, 29752 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 29753 year = {1981}, 29754 publisher = {Prentice-Hall, Inc}, 29755 address = {Englewood Cliffs, New Jersey} 29756} 29757 29758@Book{ garey.johnson:computers, 29759 author = {M. R. Garey and D. S. Johnson}, 29760 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 29761 year = {1979}, 29762 publisher = {W.H. Freeman and Company}, 29763 address = {San Francisco} 29764} 29765 29766@Article{ garey.tarjan.ea:one-processor, 29767 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 29768 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 29769 journal = {Mathematics of Operations Research}, 29770 year = {1988}, 29771 volume = {13}, 29772 pages = {330--348} 29773} 29774 29775@Book{ garfinkel.nemhauser:integer, 29776 author = {R. S. Garfinkel and G. L. Nemhauser}, 29777 title = {Integer Programming}, 29778 year = {1972}, 29779 publisher = {John Wiley \& Sons}, 29780 address = {New York} 29781} 29782 29783@Book{ gass:linear, 29784 author = {S. Gass}, 29785 title = {Linear Programming Methods and Applications}, 29786 edition = {Fifth}, 29787 publisher = {Boyd and Fraser Publishing Company}, 29788 address = {Danvers, Massachusetts}, 29789 year = {1985} 29790} 29791 29792@InProceedings{ gay:combining, 29793 author = {D. M. Gay}, 29794 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 29795 booktitle = {Sparse Matrix Proceedings 1978}, 29796 editor = {I. S. Duff and G. W. Stewart}, 29797 year = {1978}, 29798 organization = {SIAM}, 29799 address = {Philadelphia, Pennsylvania}, 29800 pages = {313--334} 29801} 29802 29803@Article{ gay:electronic, 29804 author = {D. M. Gay}, 29805 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 29806 journal = {{COAL} Newsletter}, 29807 year = {1985}, 29808 volume = {13}, 29809 pages = {10--12} 29810} 29811 29812@TechReport{ gay:hooking, 29813 author = {D. M. Gay}, 29814 title = {Hooking Your Solver to {AMPL}}, 29815 year = {1997}, 29816 institution = {Bell Laboratories}, 29817 address = {Murray Hill, New Jersey}, 29818 note = {Revised 1994, 1997} 29819} 29820 29821@Article{ gay:variant, 29822 author = {D. Gay}, 29823 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 29824 Form}, 29825 journal = {Mathematical Programming}, 29826 year = {1987}, 29827 volume = {37}, 29828 pages = {81--90} 29829} 29830 29831@Article{ geiger.kanzow:resolution, 29832 author = {C. Geiger and C. Kanzow}, 29833 title = {On the Resolution of Monotone Complementarity Problems}, 29834 journal = {Computational Optimization and Applications}, 29835 volume = {5}, 29836 year = {1996}, 29837 pages = {155--173} 29838} 29839 29840@Book{ geist.beguelin.ea:pvm, 29841 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 29842 V. S. Sunderam}, 29843 title = {{PVM}: Parallel Virtual Machine}, 29844 publisher = {MIT Press}, 29845 address = {Cambridge, Massachusetts}, 29846 year = {1994} 29847} 29848 29849@Article{ gendron.crainic:parallel, 29850 author = {B. Gendron and T. G. Crainic}, 29851 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 29852 journal = {Operations Research}, 29853 year = {1994}, 29854 volume = {42}, 29855 pages = {1042--1060} 29856} 29857 29858@Article{ george:automatic, 29859 author = {A. George}, 29860 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 29861 journal = {SIAM Journal on Numerical Analysis}, 29862 vol = {17}, 29863 pages = {740--751}, 29864 year = {1980} 29865} 29866 29867@InProceedings{ georges-schleuter:asparagos, 29868 crossref = {schaeffer:third}, 29869 author = {M. Georges--Schleuter}, 29870 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 29871 pages = {416--421} 29872} 29873 29874@Article{ georgiou:comments, 29875 author = {G. M. Georgiou}, 29876 title = {Comments On Hidden Nodes in Neural Nets}, 29877 journal = {IEEE Transactions on Circuits and Systems}, 29878 year = {1991}, 29879 volume = {38}, 29880 pages = {1410} 29881} 29882 29883@TechReport{ gertz.linderoth.ea:object-oriented, 29884 author = {M. Gertz and J. Linderoth and S. Wright}, 29885 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 29886 institution = {MCS Division, Argonne National Laboratory}, 29887 year = {in preparation} 29888} 29889 29890@Article{ ghellinck.vial:polynomial, 29891 author = {G. de Ghellinck and J.--Ph. Vial}, 29892 title = {A Polynomial {N}ewton Method for Linear Programming}, 29893 journal = {Algorithmica}, 29894 year = {1986}, 29895 volume = {1}, 29896 pages = {425--453} 29897} 29898 29899@InCollection{ gilbert.ng:predicting, 29900 author = {J. R. Gilbert and E. Ng}, 29901 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 29902 year = {1993}, 29903 booktitle = {Graph Theory and Sparse Matrix Computation}, 29904 editor = {A. George and J. Gilbert and J. Liu}, 29905 publisher = {Springer-Verlag} 29906} 29907 29908@Article{ gilbert-lemarechal, 29909 author = {J. C. Gilbert and C. Lemarechal}, 29910 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 29911 journal = {Mathematical Programming}, 29912 year = {1989}, 29913 volume = {45}, 29914 pages = {407--434} 29915} 29916 29917@Article{ gill.murray.ea:computing, 29918 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29919 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 29920 journal = {SIAM Journal on Scientific and Statistical Computing}, 29921 year = {1983}, 29922 volume = {4}, 29923 pages = {310--321} 29924} 29925 29926@Article{ gill.murray.ea:maintaining, 29927 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29928 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 29929 year = {1987}, 29930 journal = {Linear Algebra and Its Applications}, 29931 volume = {88/89}, 29932 pages = {239--270} 29933} 29934 29935@Book{ gill.murray.ea:practical, 29936 author = {P. E. Gill and W. Murray and M. H. Wright}, 29937 title = {Practical Optimization}, 29938 year = {1981}, 29939 publisher = {Academic Press}, 29940 address = {London} 29941} 29942 29943@Article{ gill.murray.ea:practical*1, 29944 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29945 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 29946 journal = {Mathematical Programming}, 29947 year = {1989}, 29948 volume = {45}, 29949 pages = {437--474} 29950} 29951 29952@Article{ gill.murray.ea:projected, 29953 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 29954 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 29955 to {K}armarkar's Projective Method}, 29956 journal = {Mathematical Programming}, 29957 year = {1986}, 29958 volume = {36}, 29959 pages = {183--209} 29960} 29961 29962@Article{ gill.murray:newton-type, 29963 author = {P. E. Gill and W. Murray}, 29964 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 29965 journal = {Mathematical Programming}, 29966 year = {1974}, 29967 volume = {7}, 29968 pages = {311--350} 29969} 29970 29971@InProceedings{ gill.murray:nonlinear, 29972 author = {P. E. Gill and W. Murray}, 29973 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 29974 booktitle = {Numerical Analysis, Dundee 1975}, 29975 year = {1976}, 29976 editor = {G. A. Watson}, 29977 publisher = {Springer-Verlag}, 29978 address = {Berlin}, 29979 note = {Lecture Notes in Mathematics 506} 29980} 29981 29982@Book{ ginsburgh.waelbroeck:activity, 29983 author = {V. Ginsburgh and J. Waelbroeck}, 29984 title = {Activity Analysis and General Equilibrium Modelling}, 29985 publisher = {North--Holland}, 29986 year = {1981}, 29987 address = {Amsterdam} 29988} 29989 29990@Article{ glad.goldstein:errors, 29991 author = {T. Glad and A. Goldstein}, 29992 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 29993 journal = {BIT}, 29994 year = {1977}, 29995 volume = {17}, 29996 pages = {160--169} 29997} 29998 29999@Article{ glad.polak:multiplier, 30000 author = {T. Glad and E. Polak}, 30001 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 30002 journal = {Mathematical Programming}, 30003 year = {1979}, 30004 volume = {17}, 30005 pages = {140--155} 30006} 30007 30008@Book{ glashoff.gustafson:linear, 30009 author = {K. Glashoff and S.--\AA. Gustafson}, 30010 title = {Linear Optimization and Approximation}, 30011 year = {1983}, 30012 publisher = {Springer-Verlag}, 30013 address = {New York} 30014} 30015 30016@Article{ glover:improved, 30017 author = {F. Glover}, 30018 title = {Improved Linear Programming Models for Discriminant Analysis}, 30019 journal = {Decision Sciences}, 30020 year = {1990}, 30021 volume = {21}, 30022 pages = {771--785} 30023} 30024 30025@Book{ glasserman:gradient, 30026 author = {P. Glasserman}, 30027 title = {Gradient Estimation via Perturbation Analysis}, 30028 publisher = {Kluwer}, 30029 year = {1991}, 30030 address = {Norwell, MA} 30031} 30032 30033@Article{ glover:tabu, 30034 author = {F. Glover}, 30035 title = {Tabu Search -- Part 1}, 30036 journal = {ORSA Journal on Computing}, 30037 year = {1989}, 30038 volume = {1}, 30039 pages = {190--206} 30040} 30041 30042@Article{ glowinski.marroco:sur, 30043 author = {R. Glowinski and A. Marroco}, 30044 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 30045 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 30046 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 30047 year = {1975}, 30048 volume = {9(R-2)}, 30049 pages = {41--76} 30050} 30051 30052@TechReport{ goeleven.nguyen:convergence, 30053 author = {D. Goeleven and V. H. Nguyen}, 30054 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 30055 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 30056 year = {1992}, 30057 address = {B-5000 Namur, Belgium} 30058} 30059 30060@Book{ goldberg:genetic, 30061 author = {D. E. Goldberg}, 30062 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 30063 year = {1989}, 30064 publisher = {Addison-Wesley}, 30065 address = {Reading MA} 30066} 30067 30068@Article{ golden.skiscim:simulated, 30069 author = {B. L. Golden and C. C. Skiscim}, 30070 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 30071 journal = {Naval Research Logistics Quarterly}, 30072 year = {1989}, 30073 volume = {33}, 30074 pages = {261--279} 30075} 30076 30077@Article{ goldfarb.reid:practical, 30078 author = {D. Goldfarb and J. K. Reid}, 30079 title = {A Practical Steepest--Edge Simplex Algorithm}, 30080 journal = {Mathematical Programming}, 30081 year = {1977}, 30082 volume = {12}, 30083 pages = {361--371} 30084} 30085 30086@InProceedings{ goldman.tucker:theory, 30087 author = {A. J. Goldman and A. W. Tucker}, 30088 title = {Theory of Linear Programming}, 30089 booktitle = {Linear Inequalities and Related Systems}, 30090 year = {1956}, 30091 editor = {H. W. Kuhn and A. W. Tucker}, 30092 publisher = {Princeton University Press}, 30093 address = {Princeton, New Jersey}, 30094 pages = {53--97} 30095} 30096 30097@Book{ goldstein:constructive, 30098 author = {A. A. Goldstein}, 30099 title = {Constructive Real Analysis}, 30100 year = {1967}, 30101 publisher = {Harper and Row}, 30102 address = {New York} 30103} 30104 30105@Article{ golshtein:block, 30106 author = {Ye. G. Golshtein}, 30107 title = {The Block Method of Convex Programming}, 30108 journal = {Soviet Mathematics Doklady}, 30109 year = {1986}, 30110 volume = {33}, 30111 pages = {584--587} 30112} 30113 30114@Article{ golshtein:general, 30115 author = {Ye. G. Golshtein}, 30116 title = {A General Approach to Decomposition of Optimization Systems}, 30117 journal = {Soviet Journal of Computer and Systems Sciences}, 30118 year = {1987}, 30119 volume = {3}, 30120 pages = {105--114} 30121} 30122 30123@Article{ golub.kahan:calculating, 30124 author = {G. H. Golub and W. Kahan}, 30125 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 30126 journal = {SIAM Journal on Numerical Analysis}, 30127 year = {1965}, 30128 volume = {2}, 30129 pages = {205--224} 30130} 30131 30132@Book{ golub.vanloan:matrix, 30133 author = {G. H. Golub and C. F. {Van Loan}}, 30134 title = {Matrix Computations}, 30135 year = {1996}, 30136 publisher = {The John Hopkins University Press}, 30137 address = {Baltimore, Maryland}, 30138 edition = {Third} 30139} 30140 30141@TechReport{ gomez.barron:exponential, 30142 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 30143 title = {The Exponential Tunneling Method}, 30144 institution = {Universidad Nacional Autonoma de Mexico}, 30145 year = {1991}, 30146 type = {Serie Reportes de Investigacion}, 30147 number = {3}, 30148 address = {Mexico} 30149} 30150 30151@Article{ gondzio:multiple, 30152 author = {J. Gondzio}, 30153 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 30154 journal = {Computational Optimization and Applications}, 30155 year = {1996}, 30156 volume = {6}, 30157 pages = {137--156} 30158} 30159 30160@TechReport{ gonzaga:algorithm, 30161 author = {C. C. Gonzaga}, 30162 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 30163 operations}, 30164 institution = {Electronics Research Laboratory, University of California}, 30165 year = {1987}, 30166 address = {Berkeley, California}, 30167 number = {UCB/ERL M87/10}, 30168 type = {Memorandum} 30169} 30170 30171@Article{ gould.tolle:necessary, 30172 author = {F. J. Gould and J. W. Tolle}, 30173 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 30174 journal = {SIAM Journal on Applied Mathematics}, 30175 year = {1971}, 30176 volume = {20}, 30177 pages = {164--172} 30178} 30179 30180@InProceedings{ goux.kulkarni.ea:enabling, 30181 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 30182 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 30183 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 30184 Distributed Computing}, 30185 year = {2000} 30186} 30187 30188@Article{ gowda.pang:basic, 30189 author = {M. S. Gowda and J. S. Pang}, 30190 title = {The Basic Theorem of Complementarity Revisited}, 30191 journal = {Mathematical Programming}, 30192 year = {1993}, 30193 volume = {58}, 30194 pages = {161--178} 30195} 30196 30197@Article{ gowda.pang:boundedness, 30198 author = {M. S. Gowda and J. S. Pang}, 30199 title = {On the Boundedness and Stability of Solutions to the Affine Variational 30200 Inequality Problem}, 30201 journal = {SIAM Journal on Control and Optimization}, 30202 year = {1994}, 30203 volume = {32}, 30204 pages = {421--441} 30205} 30206 30207@Article{ gowda.pang:stability, 30208 author = {M. S. Gowda and J. S. Pang}, 30209 title = {Stability analysis of variational inequalities and nonlinear complementarity 30210 problems, via the mixed linear complementarity problem and degree theory}, 30211 journal = {Mathematics of Operations Research}, 30212 year = {1994}, 30213 volume = {19}, 30214 pages = {831--879} 30215} 30216 30217@Article{ gowda.sznajder:generalizations, 30218 author = {M. S. Gowda and R. Sznajder}, 30219 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 30220 Horizontal {LCP}s}, 30221 journal = {Linear Algebra and Its Applications}, 30222 year = {1995}, 30223 volume = {223/224}, 30224 pages = {695--715} 30225} 30226 30227@Article{ gowda.sznajder:generalized, 30228 author = {M. S. Gowda and R. Sznajder}, 30229 title = {The Generalized Order Linear Complementarity Problem}, 30230 journal = {SIAM Journal on Matrix Analysis and Applications}, 30231 year = {1994} 30232} 30233 30234@Article{ gowda:analysis, 30235 author = {M. S. Gowda}, 30236 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 30237 Function via its Recession Function}, 30238 journal = {SIAM Journal on Matrix Analysis and Applications}, 30239 year = {1996}, 30240 volume = {17}, 30241 pages = {594--609} 30242} 30243 30244@Article{ gowda:applications, 30245 author = {M. S. Gowda}, 30246 title = {Applications of Degree Theory to Linear Complementarity Problems}, 30247 journal = {Mathematics of Operations Research}, 30248 year = {1993}, 30249 volume = {18}, 30250 pages = {868--879} 30251} 30252 30253@Article{ grant.woo:clinical, 30254 author = {W. I. Grant and S. Y. Woo}, 30255 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 30256 Delivery}, 30257 journal = {Seminars in Radiation Oncology}, 30258 year = {1999}, 30259 volume = {9}, 30260 pages = {99--107} 30261} 30262 30263@Article{ greenberg.hegerich:branch, 30264 author = {H. Greenberg and R. L. Hegerich}, 30265 title = {A Branch Search Algorithm for the Knapsack Problem}, 30266 journal = {Management Science}, 30267 year = {1970}, 30268 volume = {16}, 30269 pages = {327--332} 30270} 30271 30272@InCollection{ grefenstette:incorporating, 30273 crossref = {davis:genetic}, 30274 author = {J. J. Grefenstette}, 30275 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 30276} 30277 30278@Book{ griewank.corliss:automatic, 30279 editor = {A. Griewank and G. F. Corliss}, 30280 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 30281 publisher = {SIAM}, 30282 year = {1991}, 30283 address = {Philadelphia, Pennsylvania} 30284} 30285 30286@Article{ griewank.juedes.ea:adol-c, 30287 author = {A. Griewank and D. Juedes and J. Utke}, 30288 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 30289 in {C}/{C}++}, 30290 journal = {{ACM} Transactions on Mathematical Software}, 30291 year = {1996}, 30292 volume = {22}, 30293 pages = {131--167} 30294} 30295 30296@Article{ griffith.stewart:nonlinear, 30297 author = {R. E. Griffith and R. A. Stewart}, 30298 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 30299 Systems}, 30300 journal = {Management Science}, 30301 year = {1961}, 30302 volume = {7}, 30303 pages = {379--392} 30304} 30305 30306@Article{ grinold:mathematical, 30307 author = {R. C. Grinold}, 30308 title = {Mathematical Methods for {PA}ttern Classification}, 30309 journal = {Management Science}, 30310 year = {1972}, 30311 volume = {19}, 30312 pages = {272--289} 30313} 30314 30315@Article{ grippo.lampariello.ea:class, 30316 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30317 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 30318 journal = {Numerische Mathematik}, 30319 year = {1991}, 30320 volume = {59}, 30321 pages = {779--805} 30322} 30323 30324@Article{ grippo.lampariello.ea:global, 30325 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30326 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 30327 Without Derivatives}, 30328 journal = {Journal of Optimization Theory and Applications}, 30329 year = {1988}, 30330 volume = {56}, 30331 pages = {385--406} 30332} 30333 30334@Article{ grippo.lampariello.ea:nonmonotone, 30335 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30336 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 30337 journal = {SIAM Journal on Numerical Analysis}, 30338 year = {1986}, 30339 volume = {23}, 30340 pages = {707--716} 30341} 30342 30343@Misc{ grippo:private, 30344 author = {L. Grippo}, 30345 title = {Private Communication}, 30346 year = {1992}, 30347 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 30348} 30349 30350@Article{ grotschel.lovasz.ea:ellipsoid, 30351 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 30352 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 30353 journal = {Combinatorica}, 30354 year = {1981}, 30355 volume = {1}, 30356 pages = {169--197} 30357} 30358 30359@Article{ guignard:generalized, 30360 author = {M. Guignard}, 30361 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 30362 {B}anach Space}, 30363 journal = {SIAM Journal on Control and Optimization}, 30364 year = {1969}, 30365 volume = {7}, 30366 pages = {232--241} 30367} 30368 30369@Article{ guler.ye:convergence, 30370 author = {O. G{\"{u}}ler and Y. Ye}, 30371 title = {Convergence Behavior of Interior--Point Algorithms}, 30372 journal = {Mathematical Programming}, 30373 year = {1993}, 30374 volume = {60}, 30375 pages = {215--228} 30376} 30377 30378@Article{ guler:existence, 30379 author = {O. G{\"{u}}ler}, 30380 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 30381 Complementarity Problems}, 30382 journal = {Mathematics of Operations Research}, 30383 year = {1993}, 30384 volume = {18}, 30385 pages = {128--147} 30386} 30387 30388@Article{ guler:generalized, 30389 author = {O. G{\"{u}}ler}, 30390 title = {Generalized Linear Complementarity Problems}, 30391 journal = {Mathematics of Operations Research}, 30392 year = {1995}, 30393 volume = {20}, 30394 pages = {441--448} 30395} 30396 30397@Article{ gupta.sen:minimizing, 30398 author = {S. Gupta and T. Sen}, 30399 title = {Minimizing the Range of Lateness on a Single Machine}, 30400 journal = {Journal of the Operational Research Society}, 30401 year = {1984}, 30402 volume = {35}, 30403 pages = {853--857} 30404} 30405 30406@InCollection{ gustafson:numerical, 30407 author = {S.-\AA. Gustafson}, 30408 title = {On Numerical Analysis in Semi-Infinite Programming}, 30409 booktitle = {Semi-Infinite Programming}, 30410 year = {1979}, 30411 editor = {R. Hettich}, 30412 publisher = {Springer-Verlag}, 30413 address = {Berlin} 30414} 30415 30416@Article{ gustafsson.lind.ea:simultaneous, 30417 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 30418 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 30419 or compensation filters using a generalized pencil beam algorithm}, 30420 journal = {Medical Physics}, 30421 year = {1995}, 30422 volume = {22}, 30423 number = {7}, 30424 pages = {1141--1156} 30425} 30426 30427@PhDThesis{ ha:decomposition, 30428 author = {C. D. Ha}, 30429 title = {Decomposition Methods for Structured Convex Programming}, 30430 year = {1980}, 30431 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30432} 30433 30434@TechReport{ haakonsen.mathiesen:toward, 30435 author = {L. Haakonsen and L. Mathiesen}, 30436 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 30437 institution = {NHH, Bergen}, 30438 year = {1995}, 30439 type = {Discussion Paper}, 30440 number = {3/95} 30441} 30442 30443@Article{ haaland.norman.ea:vemod, 30444 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 30445 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 30446 journal = {Scandinavian Journal of Economics}, 30447 year = {1987} 30448} 30449 30450@Article{ haarhoff.buys:method, 30451 author = {P. C. Haarhoff and J. D. Buys}, 30452 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 30453 Constraints}, 30454 journal = {Computer Journal}, 30455 year = {1970}, 30456 volume = {12}, 30457 pages = {178--184} 30458} 30459 30460@Article{ habetler.kostreva:direct, 30461 author = {G. J. Habetler and M. M. Kostreva}, 30462 title = {On a direct algorithm for nonlinear complementarity problems}, 30463 journal = {SIAM Journal on Control and Optimization}, 30464 volume = {16}, 30465 year = {1978}, 30466 pages = {504--511} 30467} 30468 30469@Book{ hadamard:cauchys, 30470 author = {J. Hadamard}, 30471 title = {Cauchy's Problem in Linear Partial Differential Equations}, 30472 year = {1923}, 30473 publisher = {Yale University Press} 30474} 30475 30476@Article{ haddock.mittenthal:simulation, 30477 author = {J. Haddock and J. Mittenthal}, 30478 title = {Simulation optimization using simulated annealing}, 30479 journal = {Comput. Ind. Eng.}, 30480 year = {1992}, 30481 volume = {22}, 30482 pages = {387--395} 30483} 30484 30485@TechReport{ hamala:general, 30486 author = {M. Hamala}, 30487 title = {A General Approach to Interior Point Methods with Linear Parameter for 30488 Mathematical Programming}, 30489 institution = {Royal Institute of Technology}, 30490 year = {1978}, 30491 number = {1978--20}, 30492 type = {Department of Mathematics Paper TRITA--MAT} 30493} 30494 30495@Article{ han.mangasarian:dual, 30496 author = {S.--P. Han and O. L. Mangasarian}, 30497 title = {A Dual Differentiable Exact Penalty Function}, 30498 journal = {Mathematical Programming}, 30499 year = {1983}, 30500 volume = {25}, 30501 pages = {293--301} 30502} 30503 30504@Article{ han.mangasarian:exact, 30505 author = {S.--P. Han and O. L. Mangasarian}, 30506 title = {Exact Penalty Functions in Nonlinear Programming}, 30507 journal = {Mathematical Programming}, 30508 year = {1979}, 30509 volume = {17}, 30510 pages = {251--269} 30511} 30512 30513@Article{ han.pang.ea:globally, 30514 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 30515 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 30516 journal = {Mathematics of Operations Research}, 30517 year = {1992}, 30518 volume = {17}, 30519 pages = {586--607} 30520} 30521 30522@Article{ han:decomposition, 30523 author = {S.--P. Han}, 30524 title = {A Decomposition Method and its Application to Convex Programming}, 30525 journal = {Mathematics of Operations Research}, 30526 year = {1989}, 30527 volume = {14}, 30528 pages = {237--248} 30529} 30530 30531@Article{ han:globally, 30532 author = {S.--P. Han}, 30533 title = {A Globally Convergent Method for Nonlinear Programming}, 30534 journal = {Journal of Optimization Theory and Applications}, 30535 year = {1977}, 30536 volume = {22}, 30537 pages = {297--309} 30538} 30539 30540@Article{ han:superlinearly, 30541 author = {S.--P. Han}, 30542 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 30543 Programming Problems}, 30544 journal = {Mathematical Programming}, 30545 year = {1976}, 30546 volume = {11}, 30547 pages = {263--282} 30548} 30549 30550@Article{ hansen.koopmans:definition, 30551 author = {T. Hansen and T. C. Koopmans}, 30552 title = {On the Definition and Computation of a Capital Stock Invariant Under 30553 Optimization}, 30554 journal = {Journal of Economic Theory}, 30555 year = {1972}, 30556 volume = {5}, 30557 pages = {487--523} 30558} 30559 30560@InCollection{ harker.pang:damped, 30561 author = {P. T. Harker and J. S. Pang}, 30562 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 30563 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 30564 publisher = {AMS}, 30565 year = {1990}, 30566 editor = {E. L. Allgower and K. Georg}, 30567 number = {26}, 30568 series = {Lectures on Applied Mathematics}, 30569 address = {Providence, Rhode Island}, 30570 pages = {265--284} 30571} 30572 30573@Article{ harker.pang:existence, 30574 author = {P. T. Harker and J. S. Pang}, 30575 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 30576 Constraints}, 30577 journal = {Operations Research Letters}, 30578 year = {1988}, 30579 volume = {7}, 30580 pages = {61--64} 30581} 30582 30583@Article{ harker.pang:finite-dimensional, 30584 author = {P. T. Harker and J. S. Pang}, 30585 title = {Finite--dimensional variational inequality and nonlinear complementarity 30586 problems: {A} survey of theory, algorithms and applications}, 30587 journal = {Mathematical Programming}, 30588 year = {1990}, 30589 volume = {48}, 30590 pages = {161--220} 30591} 30592 30593@Article{ harker.xiao:newtons, 30594 author = {P. T. Harker and B. Xiao}, 30595 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 30596 {B}--Differentiable Equation Approach}, 30597 journal = {Mathematical Programming}, 30598 year = {1990}, 30599 volume = {48}, 30600 pages = {339--358} 30601} 30602 30603@Article{ harker:accelerating, 30604 author = {P. T. Harker}, 30605 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 30606 Finite--Dimensional Variational Inequalities}, 30607 journal = {Mathematical Programming}, 30608 year = {1988}, 30609 volume = {41}, 30610 pages = {29--50} 30611} 30612 30613@Article{ harker:generalized, 30614 author = {P. T. Harker}, 30615 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 30616 journal = {European Journal of Operations Research}, 30617 volume = {54}, 30618 pages = {81--94}, 30619 year = {1987} 30620} 30621 30622@Book{ harker:lectures, 30623 author = {P. T. Harker}, 30624 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 30625 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 30626 year = {1993}, 30627 series = {CORE Lecture Series} 30628} 30629 30630@Article{ harris:pivot, 30631 author = {P. M. J. Harris}, 30632 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 30633 journal = {Mathematical Programming}, 30634 year = {1973}, 30635 volume = {5}, 30636 pages = {1--28} 30637} 30638 30639@InCollection{ harrison.kristrom:carbon, 30640 author = {G. W. Harrison and B. Kristrom}, 30641 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 30642 booktitle = {Environment and Transport in Economic Modelling}, 30643 publisher = {Kluwer Academic Publishers}, 30644 year = {1997}, 30645 editor = {R. Roson and K. A. Small}, 30646 address = {Amsterdam} 30647} 30648 30649@Article{ harrison.rutherford.ea:increased, 30650 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30651 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 30652 journal = {Journal of Economic Integration}, 30653 year = {1996}, 30654 volume = {11}, 30655 pages = {332--365} 30656} 30657 30658@Article{ harrison.rutherford.ea:liberalizing, 30659 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 30660 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 30661 journal = {Journal of Policy Modeling}, 30662 year = {1995}, 30663 volume = {17} 30664} 30665 30666@Article{ harrison.rutherford.ea:quantifying, 30667 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30668 title = {Quantifying the {U}ruguay Round}, 30669 journal = {Finance and Development}, 30670 year = {1995}, 30671 volume = {32}, 30672 pages = {38--41} 30673} 30674 30675@InProceedings{ harrison.rutherford.ea:quantifying*1, 30676 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30677 title = {Quantifying the {U}ruguay Round}, 30678 year = {1996}, 30679 booktitle = {The {U}ruguay Round and the Developing Economies}, 30680 address = {New York}, 30681 editors = {W. Martin and L. A. Winters}, 30682 publisher = {Cambridge University Press} 30683} 30684 30685@Article{ harrison.rutherford.ea:quantifying*2, 30686 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30687 title = {Quantifying the {U}ruguay Round}, 30688 journal = {The Economic Journal}, 30689 year = {1997}, 30690 volume = {107}, 30691 pages = {1405--1430} 30692} 30693 30694@Article{ harrison.rutherford.ea:trade, 30695 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30696 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 30697 journal = {The World Bank Economic Review}, 30698 year = {1993}, 30699 volume = {7}, 30700 pages = {191--217} 30701} 30702 30703@Article{ hartman.stampacchia:nonlinear, 30704 author = {P. Hartman and G. Stampacchia}, 30705 title = {On some nonlinear differential-functional equations}, 30706 journal = {Acta Mathematica}, 30707 year = {1966}, 30708 volume = {115}, 30709 pages = {271--310} 30710} 30711 30712@Book{ harvey:forecasting, 30713 author = {Andrew C. Harvey}, 30714 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 30715 publisher = {Cambridge University Press}, 30716 address = {New York, NY}, 30717 year = {1989} 30718} 30719 30720@Article{ haurie.marcotte:relationship, 30721 author = {A. Haurie and P. Marcotte}, 30722 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 30723 journal = {Networks}, 30724 year = {1985}, 30725 volume = {15}, 30726 pages = {295--308} 30727} 30728 30729@Article{ hearn.lawphongpanich.ea:restricted, 30730 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 30731 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 30732 journal = {Mathematical Programming Study}, 30733 year = {1987}, 30734 volume = {31}, 30735 pages = {99--118} 30736} 30737 30738@Article{ hearn:gap, 30739 author = {D. W. Hearn}, 30740 title = {The Gap Function of a Convex Program}, 30741 journal = {Operations Research Letters}, 30742 year = {1982}, 30743 volume = {1}, 30744 pages = {67--71} 30745} 30746 30747@Article{ hedlund.gustavsson:design, 30748 author = {P. Hedlund and A. Gustavsson}, 30749 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 30750 Ability}, 30751 journal = {Analytica Chimica Acta}, 30752 year = {1992}, 30753 volume = {259}, 30754 pages = {243--256} 30755} 30756 30757@Article{ helgason.kennington.ea:parallelization, 30758 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 30759 title = {A Parallelization of the Simplex Method}, 30760 journal = {Annals of Operations Research}, 30761 year = {1988}, 30762 volume = {14}, 30763 pages = {17--40} 30764} 30765 30766@Article{ helgason.kennington.ea:polynomially, 30767 author = {Richard Helgason and James Kennington and H. Lall}, 30768 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 30769 journal = {Mathematical Programming}, 30770 year = {1980}, 30771 volume = {18}, 30772 pages = {338--343} 30773} 30774 30775@Book{ henderson.quandt:microeconomic, 30776 author = {J. M. Henderson and R. E. Quandt}, 30777 title = {Microeconomic Theory}, 30778 publisher = {McGraw--Hill}, 30779 address = {New York}, 30780 year = {1980}, 30781 edition = {Third} 30782} 30783 30784@TechReport{ hendrickson.leland:chaco, 30785 author = {B. Hendrickson and R. Leland}, 30786 title = {The {C}haco User's Guide: Version 2}, 30787 institution = {Sandia National Laboratories}, 30788 type = {Technical Report}, 30789 number = {SAND94-2692}, 30790 address = {Albuquerque, New Mexico}, 30791 year = {1994} 30792} 30793 30794@InProceedings{ hendrickson.leland:multilevel, 30795 author = {B. Hendrickson and R. Leland}, 30796 title = {A Multilevel Algorithm for Partitioning Graphs}, 30797 booktitle = {Proceedings of Supercomputing '95}, 30798 year = {1995} 30799} 30800 30801@Book{ hertz.krogh.ea:introduction, 30802 author = {J. Hertz and A. Krogh and R. G. Palmer}, 30803 title = {Introduction to the Theory of Neural Computation}, 30804 year = {1991}, 30805 publisher = {Addison-Wesley}, 30806 address = {Redwood City, California} 30807} 30808 30809@Article{ hertz.werra:tabu, 30810 author = {A. Hertz and D. de Werra}, 30811 title = {Using {T}abu Search techniques for Graph Coloring}, 30812 journal = {Computing}, 30813 year = {1987}, 30814 volume = {29}, 30815 pages = {345--351} 30816} 30817 30818@InCollection{ hettich:review, 30819 author = {R. Hettich}, 30820 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 30821 booktitle = {Semi-Infinite Programming and Applications}, 30822 year = {1983}, 30823 editor = {A. V. Fiacco and K. O. Kortanek}, 30824 publisher = {Springer-Verlag}, 30825 address = {Berlin} 30826} 30827 30828@Article{ highleyman:note, 30829 author = {W. H. Highleyman}, 30830 title = {A Note on Linear Separation}, 30831 journal = {IRE Transactions on Electronic Computers}, 30832 year = {1961}, 30833 volume = {10}, 30834 pages = {777--778} 30835} 30836 30837@Article{ hildreth:quadratic, 30838 author = {C. Hildreth}, 30839 title = {A Quadratic Programming Procedure}, 30840 journal = {Naval Research Logistics Quarterly}, 30841 year = {1957}, 30842 volume = {4}, 30843 pages = {79--85}, 30844 note = {Erratum, p. 361} 30845} 30846 30847@Book{ himmelblau:applied, 30848 author = {D. M. Himmelblau}, 30849 title = {Applied Nonlinear Programming}, 30850 year = {1972}, 30851 publisher = {McGraw--Hill}, 30852 address = {New York} 30853} 30854 30855@Book{ hiriart-urruty.lemarechal:convex, 30856 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 30857 title = {Convex Analysis and Minimization Algorithms {I}}, 30858 year = {1993}, 30859 publisher = {Springer Verlag}, 30860 address = {Berlin}, 30861 volume = {305}, 30862 series = {Grundlehren der mathematischen Wissenschaften} 30863} 30864 30865@TechReport{ hironaka:introduction, 30866 author = {H. Hironaka}, 30867 title = {Introduction to real-analytic sets and real-analytic maps}, 30868 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 30869 year = {1973}, 30870 type = {Technical Report}, 30871 address = {Pisa, Italy} 30872} 30873 30874@Article{ ho.lee.ea:decomposition, 30875 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 30876 title = {Decomposition of Linear Programs Using Parallel Computation}, 30877 journal = {Mathematical Programming}, 30878 year = {1988}, 30879 volume = {42}, 30880 pages = {391--405} 30881} 30882 30883@Article{ ho.loute:computational, 30884 author = {J. K. Ho and E. Loute}, 30885 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 30886 for Linear Programming}, 30887 journal = {Mathematical Programming}, 30888 year = {1983}, 30889 volume = {27}, 30890 pages = {283--290} 30891} 30892 30893@Book{ hock.schittkowski:test, 30894 author = {W. Hock and K. Schittkowski}, 30895 title = {Test Examples for Nonlinear Programming Codes}, 30896 volume = {187}, 30897 series = {Lecture Notes in Economics and Mathematical Systems}, 30898 year = {1981}, 30899 publisher = {Springer Verlag}, 30900 address = {Berlin, Germany} 30901} 30902 30903@Book{ hockney.jesshope:parallel, 30904 author = {R. W. Hockney and C. R. Jesshope}, 30905 title = {Parallel Computers 2}, 30906 publisher = {Adam Hilger}, 30907 year = {1988}, 30908 address = {Bristol} 30909} 30910 30911@Article{ hoffman:approximate, 30912 author = {A. J. Hoffman}, 30913 title = {On Approximate Solutions of Systems of Linear Inequalities}, 30914 journal = {Journal of Research of the National Bureau of Standards}, 30915 year = {1952}, 30916 volume = {49}, 30917 pages = {263--265} 30918} 30919 30920@Article{ hogan:comments, 30921 author = {W. W. Hogan}, 30922 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 30923 for the {USA}}, 30924 journal = {The Energy Journal}, 30925 year = {1990}, 30926 volume = {11}, 30927 pages = {75--84} 30928} 30929 30930@Article{ hogan:energy, 30931 author = {W. W. Hogan}, 30932 title = {Energy Policy Models for {P}roject {I}ndependence}, 30933 journal = {Computers \& Operations Research}, 30934 year = {1975}, 30935 volume = {2}, 30936 pages = {251--271} 30937} 30938 30939@Book{ holland:adaptation, 30940 author = {J. Holland}, 30941 title = {Adaptation in Natural and Artificial Systems}, 30942 year = {1975}, 30943 publisher = {The University of Michigan Press}, 30944 address = {Ann Arbor, Michigan} 30945} 30946 30947@Article{ holmes.mackie:comparison, 30948 author = {T. Holmes and T. R. Mackie}, 30949 title = {A comparison of three inverse treatment planning algorithms}, 30950 journal = {Physics in Medicine and Biology}, 30951 year = {1994}, 30952 volume = {39}, 30953 number = {1}, 30954 pages = {91--106} 30955} 30956 30957@Article{ holmes.mackie:filtered, 30958 author = {T. Holmes and T. R. Mackie}, 30959 title = {A filtered backprojection dose calculation method for inverse treatment 30960 planning}, 30961 journal = {Medical Physics}, 30962 year = {1994}, 30963 volume = {21}, 30964 number = {2}, 30965 pages = {303--313} 30966} 30967 30968@Article{ hooke.jeeves:direct, 30969 author = {R. Hooke and T. A. Jeeves}, 30970 title = {Direct Search Solution of Numerical and Statistical Problems}, 30971 journal = {Journal of Associated Computing Machinery}, 30972 year = {1961}, 30973 volume = {8}, 30974 pages = {212--229} 30975} 30976 30977@Article{ hoppe.mittelmann:multi-grid, 30978 author = {R. H. W. Hoppe and H. D. Mittelmann}, 30979 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 30980 Inequalities}, 30981 journal = {Journal of Computational and Applied Mathematics}, 30982 year = {1989}, 30983 volume = {26}, 30984 pages = {35--46} 30985} 30986 30987@Book{ horn.johnson:matrix, 30988 author = {R. A. Horn and C. R. Johnson}, 30989 title = {Matrix Anaysis}, 30990 publisher = {Cambridge University Press}, 30991 year = {1985}, 30992 address = {Cambridge, England} 30993} 30994 30995@Article{ hornik.stinchcombe.ea:multilayer, 30996 author = {K. Hornik and M. Stinchcombe and H. White}, 30997 title = {Multilayer Feedforward Networks are Universal Approximators}, 30998 journal = {Neural Networks}, 30999 year = {1989}, 31000 volume = {2}, 31001 pages = {359--366} 31002} 31003 31004@Article{ horowitz.sahni:computing, 31005 author = {E. Horowitz and S. Sahni}, 31006 title = {Computing Partitions with Applications to the Knapsack Problem}, 31007 journal = {jacm}, 31008 year = {1974}, 31009 volume = {21}, 31010 pages = {277--292} 31011} 31012 31013@Article{ hristov.fallone:continuous, 31014 author = {D. H. Hristov and B. G. Fallone}, 31015 title = {A continuous penalty function method for inverse treatment planning}, 31016 journal = {Medical Physics}, 31017 year = {1998}, 31018 volume = {25}, 31019 number = {2}, 31020 pages = {208--223} 31021} 31022 31023@Article{ hu.cheng.ea:numerical, 31024 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 31025 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 31026 analysis}, 31027 journal = {Transactions of the {ASME}}, 31028 volume = {116}, 31029 year = {1994}, 31030 pages = {470--478} 31031} 31032 31033@InProceedings{ hua.sheu:skyscraper, 31034 author = {K. A. Hua and S. Sheu}, 31035 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 31036 Video-On-Demand Systems}, 31037 year = {1997}, 31038 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 31039 address = {Cannes, France}, 31040 pages = {89--100} 31041} 31042 31043@Article{ huang.pang:option, 31044 author = {J. Huang and J. S. Pang}, 31045 title = {Option Pricing and Linear Complementarity}, 31046 journal = {Journal of Computational Finance}, 31047 volume = {2}, 31048 year = {1998}, 31049 pages = {31--60} 31050} 31051 31052@InCollection{ huard:resolution, 31053 author = {P. Huard}, 31054 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 31055 of Centers}, 31056 booktitle = {Nonlinear Programming}, 31057 year = {1967}, 31058 editor = {J. Abadie}, 31059 publisher = {North--Holland}, 31060 address = {Amsterdam}, 31061 pages = {207--219} 31062} 31063 31064@Book{ huber:robust, 31065 author = {P. J. Huber}, 31066 title = {Robust Statistics}, 31067 year = {1981}, 31068 publisher = {John Wiley}, 31069 address = {New York} 31070} 31071 31072@Book{ hudson:piecewise, 31073 author = {J. F. P. Hudson}, 31074 title = {Piecewise Linear Topology}, 31075 publisher = {Benjamin}, 31076 address = {New York}, 31077 year = {1969} 31078} 31079 31080@InCollection{ hunter.markusen.ea:north, 31081 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 31082 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 31083 booktitle = {Modeling North American Economic Integration}, 31084 publisher = {Kluwer Academic Publishers}, 31085 year = {1995}, 31086 editor = {T. Kehoe and P. Kehoe}, 31087 pages = {117--130} 31088} 31089 31090@Article{ ibarra.kim:fast, 31091 author = {O. H. Ibarra and C. E. Kim}, 31092 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 31093 journal = {jacm}, 31094 year = {1975}, 31095 volume = {22}, 31096 pages = {463--468} 31097} 31098 31099@Article{ ijiri:fundamental, 31100 author = {Y. Ijiri}, 31101 title = {Fundamental Queries in Aggregation Theory}, 31102 journal = {Journal of the American Statistical Association}, 31103 year = {1971}, 31104 volume = {66}, 31105 pages = {766--782} 31106} 31107 31108@Article{ ingargiola.korsh:reduction, 31109 author = {G. P. Ingargiola and J. F. Korsh}, 31110 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 31111 journal = {Management Science}, 31112 year = {1973}, 31113 volume = {20}, 31114 pages = {460--463} 31115} 31116 31117@Article{ ioffe:variational, 31118 author = {A. D. Ioffe}, 31119 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 31120 Second--Order Directional Derivative}, 31121 journal = {Journal of Mathematical Analysis and its Applications}, 31122 year = {1993} 31123} 31124 31125@Article{ iri.imai:multiplicative, 31126 author = {M. Iri and H. Imai}, 31127 title = {A Multiplicative Barrier Function Method for Linear Programming}, 31128 journal = {Algorithmica}, 31129 year = {1986}, 31130 volume = {1}, 31131 pages = {455--482} 31132} 31133 31134@Article{ isac.goeleven:implicit, 31135 author = {G. Isac and D. Goeleven}, 31136 title = {The Implicit General Order Complementarity Problem, Models and Iterative 31137 Methods}, 31138 journal = {Annals of Operations Research}, 31139 year = {1993} 31140} 31141 31142@Article{ isac.kostreva:generalized, 31143 author = {G. Isac and M. M. Kostreva}, 31144 title = {The Generalized Order Complementarity Problem}, 31145 journal = {Journal of Optimization Theory and Applications}, 31146 volume = {19}, 31147 pages = {227--232}, 31148 year = {1991} 31149} 31150 31151@Book{ isac:complementarity, 31152 author = {G. Isac}, 31153 title = {Complementarity Problems}, 31154 publisher = {Springer-Verlag}, 31155 year = {1992}, 31156 series = {Lecture Notes in Mathematics}, 31157 address = {New York} 31158} 31159 31160@Article{ iusem.svaiter:variant, 31161 author = {A. N. Iusem and B. F. Svaiter}, 31162 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 31163 Search Strategy}, 31164 journal = {Optimization}, 31165 year = {1997}, 31166 volume = {42}, 31167 pages = {309--321} 31168} 31169 31170@Article{ iusem:convergence, 31171 author = {A. N. Iusem}, 31172 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 31173 Problems}, 31174 journal = {Mathematical Programming}, 31175 year = {1993}, 31176 volume = {59}, 31177 pages = {33--48} 31178} 31179 31180@Article{ jackson.kutcher.ea:probability, 31181 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 31182 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 31183 Architecture subject to Non-Uniform Irradiation}, 31184 journal = {Medical Physics}, 31185 year = {1993}, 31186 volume = {20}, 31187 pages = {613--625} 31188} 31189 31190@Article{ jackson:optimization, 31191 author = {A. Jackson and X. H. Wang and R. Mohan}, 31192 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 31193 (abstract)}, 31194 journal = {Medical Physics}, 31195 year = {1994}, 31196 volume = {21}, 31197 pages = {1006} 31198} 31199 31200@TechReport{ jackson:scheduling, 31201 author = {J. R. Jackson}, 31202 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 31203 institution = {University of California}, 31204 year = {1955}, 31205 address = {Los Angeles}, 31206 number = {43}, 31207 type = {Research Report} 31208} 31209 31210@Article{ jansen.roos.ea:polynomiality, 31211 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 31212 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 31213 Complementarity Problems}, 31214 journal = {Mathematical Programming}, 31215 volume = {78}, 31216 pages = {315--346}, 31217 year = {1997} 31218} 31219 31220@Article{ jiang.fukushima.ea:trust, 31221 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 31222 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 31223 journal = {SIAM Journal on Optimization}, 31224 volume = {8}, 31225 pages = {140--157}, 31226 year = {1998} 31227} 31228 31229@Article{ jiang.qi:nonsmooth, 31230 author = {H. Jiang and L. Qi}, 31231 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 31232 journal = {SIAM Journal on Control and Optimization}, 31233 volume = {35}, 31234 pages = {178--193}, 31235 year = {1997} 31236} 31237 31238@TechReport{ jiang.ralph:qpecgen, 31239 author = {H. Jiang and D. Ralph}, 31240 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 31241 Objectives and Affine Variational Inequality Constraints}, 31242 year = {1997}, 31243 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31244 address = {Australia} 31245} 31246 31247@TechReport{ jiang.ralph:smooth, 31248 author = {H. Jiang and D. Ralph}, 31249 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 31250 Constraints}, 31251 year = {1997}, 31252 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31253 address = {Australia} 31254} 31255 31256@Article{ jiang:unconstrained, 31257 author = {H. Jiang}, 31258 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 31259 journal = {Journal of Global Optimization, forthcoming}, 31260 year = {1997} 31261} 31262 31263@Article{ jittorntrum.osborne:strong, 31264 author = {K. Jittorntrum and M. R. Osborne}, 31265 title = {Strong uniqueness and second order convergence in nonlinear discrete 31266 approximation}, 31267 journal = {Numerische Mathematik}, 31268 year = {1980}, 31269 volume = {34}, 31270 pages = {439--455} 31271} 31272 31273@InProceedings{ jog.suh.ea:effects, 31274 crossref = {schaeffer:third}, 31275 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31276 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 31277 Genetic Algorithm for the Travelling Salesman Problem}, 31278 pages = {110--115} 31279} 31280 31281@Article{ jog.suh.ea:parallel, 31282 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31283 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 31284 journal = {SIAM Journal on Optimization}, 31285 year = {1991}, 31286 volume = {1} 31287} 31288 31289@Article{ johansson.klarbring:rigid, 31290 author = {L. Johansson and A. Klarbring}, 31291 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 31292 Complementarity}, 31293 journal = {Mechanics of Structures \& Machines}, 31294 volume = {20}, 31295 pages = {293--319}, 31296 year = {1992} 31297} 31298 31299@Article{ johnson.aragon.ea:optimization, 31300 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 31301 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 31302 Partitioning}, 31303 journal = {Operations Research}, 31304 year = {1989}, 31305 volume = {37}, 31306 pages = {865--892} 31307} 31308 31309@Article{ johnson:optimally, 31310 author = {R. Johnson}, 31311 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 31312 journal = {Management Science}, 31313 year = {1988}, 31314 volume = {34}, 31315 pages = {240--253} 31316} 31317 31318@Article{ johnsson:solving, 31319 author = {S. L. Johnsson}, 31320 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 31321 journal = {SIAM Journal on Scientific and Statistical Computing}, 31322 year = {1987}, 31323 volume = {8}, 31324 pages = {475--489} 31325} 31326 31327@Article{ jorgenson.wilcoxen:reducing, 31328 author = {D. W. Jorgenson and P. J. Wilcoxen}, 31329 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 31330 journal = {Resource and Energy Economics}, 31331 year = {1993}, 31332 volume = {15}, 31333 pages = {7--25} 31334} 31335 31336@TechReport{ josephy:hogans, 31337 author = {N. H. Josephy}, 31338 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 31339 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31340 year = {1979}, 31341 address = {Madison, Wisconsin}, 31342 number = {1972}, 31343 type = {Technical Summary Report} 31344} 31345 31346@TechReport{ josephy:newton, 31347 author = {N. H. Josephy}, 31348 title = {A {N}ewton Method for the {PIES} Energy Model}, 31349 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31350 year = {1979}, 31351 address = {Madison, Wisconsin}, 31352 number = {1971}, 31353 type = {Technical Summary Report} 31354} 31355 31356@PhDThesis{ josephy:newtons, 31357 author = {N. H. Josephy}, 31358 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 31359 year = {1979}, 31360 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 31361} 31362 31363@TechReport{ josephy:newtons*1, 31364 author = {N. H. Josephy}, 31365 title = {{N}ewton's Method for Generalized Equations}, 31366 institution = {Mathematics Research Center, University of Wisconsin}, 31367 year = {1979}, 31368 address = {Madison, Wisconsin}, 31369 number = {1965}, 31370 type = {Technical Summary Report} 31371} 31372 31373@TechReport{ josephy:quasi-newton, 31374 author = {N. H. Josephy}, 31375 title = {Quasi--{N}ewton Methods for Generalized Equations}, 31376 institution = {Mathematics Research Center, University of Wisconsin}, 31377 year = {1979}, 31378 address = {Madison, Wisconsin}, 31379 number = {1966}, 31380 type = {Technical Summary Report} 31381} 31382 31383@PhDThesis{ kabbadj:methodes, 31384 author = {S. Kabbadj}, 31385 title = {Methodes Proximales Entropiques}, 31386 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 31387 year = {1994}, 31388 type = {Doctoral Thesis} 31389} 31390 31391@Book{ kall.wallace:stochastic, 31392 author = {P. Kall and S. W. Wallace}, 31393 title = {Stochastic Programming}, 31394 publisher = {John Wiley \& Sons}, 31395 year = {1994}, 31396 address = {Chichester} 31397} 31398 31399@Article{ kallman.agren.ea:tumor, 31400 author = {P. Kallman and A. Agren and A. Brahme}, 31401 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 31402 journal = {International Journal of Radiation Biology}, 31403 year = {1992}, 31404 volume = {62}, 31405 pages = {249--262} 31406} 31407 31408@Misc{ kalvelagen:gams, 31409 author = {Erwin Kalvelagen}, 31410 title = {The {GAMS} {I/O} Library}, 31411 howpublished = {mimeo, GAMS Development Corporation}, 31412 year = {1992}, 31413 note = {Preliminary Version} 31414} 31415 31416@Article{ kaneko:complete, 31417 author = {I. Kaneko}, 31418 title = {Complete solution of a class of elastic-plastic structures}, 31419 journal = {Computer Methods in Applied Mechanics and Engineering}, 31420 volume = {21}, 31421 year = {1980}, 31422 pages = {193--209} 31423} 31424 31425@Article{ kaneko:mathematical, 31426 author = {I. Kaneko}, 31427 title = {A mathematical programming method for the inelastic analysis of reinforced 31428 concrete frames}, 31429 journal = {International Journal for Numerical Methods in Engineering}, 31430 volume = {11}, 31431 year = {1977}, 31432 pages = {1137--1154} 31433} 31434 31435@Article{ kaneko:piecewise, 31436 author = {I. Kaneko}, 31437 title = {Piecewise linear elastic-plastic analysis}, 31438 journal = {International Journal for Numerical Methods in Engineering}, 31439 volume = {14}, 31440 year = {1979}, 31441 pages = {757--767} 31442} 31443 31444@Article{ kanet:minimizing, 31445 author = {J. J. Kanet}, 31446 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 31447 Date}, 31448 journal = {Naval Research Logistics Quarterly}, 31449 year = {1981}, 31450 volume = {28}, 31451 pages = {643--651} 31452} 31453 31454@Article{ kantorovich:mathematical, 31455 author = {L. V. Kantorovich}, 31456 title = {Mathematical Methods in the Organization and Planning of Production}, 31457 journal = {Management Science}, 31458 year = {1960}, 31459 volume = {6}, 31460 pages = {366--422}, 31461 note = {English translation, Russian version 1939} 31462} 31463 31464@Article{ kanzow.fukushima:equivalence, 31465 author = {C. Kanzow and M. Fukushima}, 31466 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 31467 Unconstrained Minimization}, 31468 journal = {Journal of Optimization Theory and Applications}, 31469 year = {1996}, 31470 volume = {90}, 31471 pages = {581--603} 31472} 31473 31474@Article{ kanzow.fukushima:theoretical, 31475 author = {C. Kanzow and M. Fukushima}, 31476 title = {Theoretical and Numerical Investigation of the {D}-gap function for 31477 Box-Constrained Variational Inequalities}, 31478 journal = {Mathematical Programming}, 31479 year = {1998}, 31480 volume = {83}, 31481 pages = {55--88} 31482} 31483 31484@Article{ kanzow.jiang:continuation, 31485 author = {C. Kanzow and H. Jiang}, 31486 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 31487 journal = {Mathematical Programming}, 31488 year = {1998}, 31489 volume = {81}, 31490 pages = {103--125} 31491} 31492 31493@Article{ kanzow.kleinmichel:class, 31494 author = {C. Kanzow and H. Kleinmichel}, 31495 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 31496 Optimization}, 31497 journal = {Optimization Methods and Software}, 31498 year = {1995}, 31499 volume = {5}, 31500 pages = {173--198} 31501} 31502 31503@Article{ kanzow.kleinmichel:new, 31504 author = {C. Kanzow and H. Kleinmichel}, 31505 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 31506 Problems}, 31507 journal = {Computational Optimization and Applications}, 31508 volume = {11}, 31509 pages = {227--251}, 31510 year = {1998} 31511} 31512 31513@Article{ kanzow.pieper:jacobian, 31514 author = {C. Kanzow and H. Pieper}, 31515 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 31516 journal = {SIAM Journal on Optimization}, 31517 year = {1999}, 31518 volume = {9}, 31519 pages = {342--373} 31520} 31521 31522@Article{ kanzow.qi:qp-free, 31523 author = {C. Kanzow and H. -D. Qi}, 31524 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 31525 problems}, 31526 journal = {Mathematical Programming}, 31527 year = {1999}, 31528 volume = {85}, 31529 pages = {81--106} 31530} 31531 31532@Article{ kanzow.yamashita.ea:ncp-functions, 31533 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 31534 title = {New {NCP}-functions and their properties}, 31535 journal = {Journal of Optimization Theory and Applications}, 31536 year = {1997}, 31537 volume = {94}, 31538 pages = {115--135} 31539} 31540 31541@TechReport{ kanzow.zupke:inexact, 31542 author = {C. Kanzow and M. Zupke}, 31543 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 31544 year = {1997}, 31545 institution = {Institute of Applied Mathematics, University of Hamburg}, 31546 type = {Preprint}, 31547 number = {127}, 31548 address = {Hamburg, Germany} 31549} 31550 31551@Article{ kanzow:approach, 31552 author = {C. Kanzow}, 31553 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 31554 {P}-Functions}, 31555 journal = {Operations Research Letters}, 31556 volume = {20}, 31557 year = {1997}, 31558 pages = {85--92} 31559} 31560 31561@Article{ kanzow:equation-based, 31562 author = {C. Kanzow}, 31563 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 31564 journal = {Optimization Methods and Software}, 31565 year = {1994}, 31566 volume = {3}, 31567 pages = {327--340} 31568} 31569 31570@Article{ kanzow:global, 31571 author = {C. Kanzow}, 31572 title = {Global Convergence Properties of Some Iterative Methods for Linear 31573 Complementarity Problems}, 31574 journal = {SIAM Journal on Optimization}, 31575 year = {1996}, 31576 volume = {6}, 31577 pages = {326--341} 31578} 31579 31580@Article{ kanzow:inexact, 31581 author = {C. Kanzow}, 31582 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 31583 journal = {Numerische Mathematik, forthcoming}, 31584 year = {1999} 31585} 31586 31587@Article{ kanzow:noninterior, 31588 author = {C. Kanzow}, 31589 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 31590 journal = {SIAM Journal on Matrix Analysis and Applications}, 31591 volume = {17}, 31592 pages = {851--868}, 31593 year = {1996} 31594} 31595 31596@Article{ kanzow:nonlinear, 31597 author = {C. Kanzow}, 31598 title = {Nonlinear Complementarity as Unconstrained Optimization}, 31599 journal = {Journal of Optimization Theory and Applications}, 31600 year = {1996}, 31601 volume = {88}, 31602 pages = {139--155} 31603} 31604 31605@TechReport{ kanzow:semismooth, 31606 author = {C. Kanzow}, 31607 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 31608 Problems}, 31609 institution = {Institute of Applied Mathematics, University of Hamburg}, 31610 year = {1997}, 31611 type = {Preprint}, 31612 address = {Hamburg, Germany} 31613} 31614 31615@TechReport{ kanzow:tools, 31616 annote = {This should be replaced by kanzow:noninterior}, 31617 author = {C. Kanzow}, 31618 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 31619 institution = {Institute of Applied Mathematics, University of Hamburg}, 31620 year = {1994}, 31621 address = {Germany} 31622} 31623 31624@Article{ kaplan.meier:nonparametric, 31625 author = {E. L. Kaplan and P. Meier}, 31626 title = {Nonparametric Estimation from Incomplete Observations}, 31627 journal = {J. Am. Stat. Assoc.}, 31628 year = {1958}, 31629 volume = {53}, 31630 pages = {457--481} 31631} 31632 31633@Article{ karamardian:complementarity, 31634 author = {S. Karamardian}, 31635 title = {The Complementarity Problem}, 31636 journal = {Mathematical Programming}, 31637 year = {1972}, 31638 volume = {2}, 31639 pages = {107--129} 31640} 31641 31642@Article{ karamardian:complementarity*1, 31643 author = {S. Karamardian}, 31644 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 31645 journal = {Journal of Optimization Theory and Applications}, 31646 year = {1976}, 31647 volume = {18}, 31648 pages = {445--454} 31649} 31650 31651@Article{ karamardian:generalized, 31652 author = {S. Karamardian}, 31653 title = {Generalized Complementarity Problem}, 31654 journal = {Journal of Optimization Theory and Applications}, 31655 year = {1971}, 31656 volume = {8}, 31657 pages = {161--167} 31658} 31659 31660@Article{ karmarkar.karp.ea:probabilistic, 31661 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 31662 title = {Probabilistic Analysis of Optimum Partitioning}, 31663 journal = {Journal of Applied Probability}, 31664 year = {1986}, 31665 volume = {23}, 31666 pages = {626--645} 31667} 31668 31669@Article{ karmarkar:polynomial, 31670 author = {N. Karmarkar}, 31671 title = {A New Polynomial Time Algorithm for Linear Programming}, 31672 journal = {Combinatorica}, 31673 year = {1984}, 31674 volume = {4}, 31675 pages = {373--395} 31676} 31677 31678@Unpublished{ karp:probabilistic, 31679 author = {R. M. Karp}, 31680 title = {Probabilistic Analysis of Algorithms}, 31681 note = {(Lecture Notes)} 31682} 31683 31684@InCollection{ karp:reducibility, 31685 author = {R. M. Karp}, 31686 title = {Reducibility among Combinatorial Problems}, 31687 booktitle = {Complexity of Computer Computations}, 31688 year = {1972}, 31689 editor = {R. E. Miller and J. W. Thatcher}, 31690 publisher = {Plenum Press}, 31691 address = {New York}, 31692 pages = {85--103} 31693} 31694 31695@MastersThesis{ karush:minima, 31696 author = {W. Karush}, 31697 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 31698 year = {1939}, 31699 school = {Department of Mathematics, University of Chicago} 31700} 31701 31702@TechReport{ karypis.kumar:metis, 31703 author = {G. Karypis and V. Kumar}, 31704 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 31705 Version 2.0}, 31706 institution = {University of Minnesota, Department of Computer Science}, 31707 type = {Technical Report}, 31708 address = {Minnesota}, 31709 year = {1995} 31710} 31711 31712@TechReport{ karypis.kumar:multilevel, 31713 author = {G. Karypis and V. Kumar}, 31714 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 31715 institution = {University of Minnesota, Department of Computer Science}, 31716 type = {Technical Report}, 31717 number = {95-064}, 31718 address = {Minnesota}, 31719 year = {1995} 31720} 31721 31722@Article{ katukani:generalization, 31723 author = {S. Katukani}, 31724 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 31725 journal = {Duke Mathematical Journal}, 31726 year = {1941}, 31727 volume = {8}, 31728 pages = {457--459} 31729} 31730 31731@Article{ keifer.wolfowitz:stochastic, 31732 author = {J. Keifer and J. Wolfowitz}, 31733 title = {Stochastic Estimation of the Maximum of a Regression Function}, 31734 journal = {Annals of Mathematical Statistics}, 31735 year = {1952}, 31736 volume = {23}, 31737 pages = {462--466} 31738} 31739 31740@InCollection{ kellog.li.ea:method, 31741 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 31742 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 31743 booktitle = {Computing Fixed Points with Applications}, 31744 year = {1977}, 31745 editor = {S. Karamardian}, 31746 publisher = {Academic Press}, 31747 pages = {133--147} 31748} 31749 31750@Book{ kennington.helgason:algorithms, 31751 author = {J. L. Kennington and R. V. Helgason}, 31752 title = {Algorithms for Network Programming}, 31753 year = {1980}, 31754 publisher = {John Wiley \& Sons}, 31755 address = {New York} 31756} 31757 31758@Article{ kernighan.lin:efficient, 31759 author = {B. W. Kernighan and S. Lin}, 31760 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 31761 journal = {The Bell System Technical Journal}, 31762 pages = {291--307}, 31763 volume = {29}, 31764 year = {1970} 31765} 31766 31767@Article{ khachian:polynomial, 31768 author = {L. G. Khachian}, 31769 title = {A Polynomial Algorithm for Linear Programming}, 31770 journal = {Soviet Mathematics Doklady}, 31771 year = {1979}, 31772 volume = {20}, 31773 pages = {191--194} 31774} 31775 31776@Article{ khobotov:modification, 31777 author = {E. N. Khobotov}, 31778 title = {A Modification of the Extragradient Method for the Solution of Variational 31779 Inequalities and some Optimization Problems}, 31780 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 31781 year = {1987}, 31782 volume = {27}, 31783 pages = {1462--1473} 31784} 31785 31786@Book{ khuri.cornell:response, 31787 author = {A. I. Khuri and J. A. Cornell}, 31788 title = {Response Surfaces: Designs and Analyses}, 31789 publisher = {Marcel Dekker}, 31790 year = {1987}, 31791 address = {New York} 31792} 31793 31794@Article{ kibardin:decomposition, 31795 author = {V. M. Kibardin}, 31796 title = {Decomposition into Functions in the Minimization Problems}, 31797 journal = {Automation and Remote Control}, 31798 year = {1980}, 31799 volume = {40}, 31800 pages = {1311--1323} 31801} 31802 31803@TechReport{ king:sposl, 31804 author = {A. J. King}, 31805 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 31806 institution = {IBM T.J. Watson Research Center}, 31807 year = {1994}, 31808 number = {RC 19757}, 31809 address = {Yorktown Heights, New York} 31810} 31811 31812@Article{ kirkpatrick.gelatt.ea:optimization, 31813 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 31814 title = {Optimization by Simulated Annealing}, 31815 journal = {Science}, 31816 year = {1983}, 31817 volume = {220}, 31818 pages = {671--680} 31819} 31820 31821@Book{ kiwiel:methods, 31822 author = {K. C. Kiwiel}, 31823 title = {Methods of Descent for Nondifferentiable Optimization}, 31824 year = {1985}, 31825 publisher = {Springer-Verlag}, 31826 address = {Berlin}, 31827 series = {Lecture Notes in Mathematics}, 31828 number = {1133} 31829} 31830 31831@Article{ kiwiel:twice, 31832 author = {K. C. Kiwiel}, 31833 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 31834 journal = {Journal of Optimization Theory and Applications}, 31835 year = {1996}, 31836 volume = {88}, 31837 pages = {233--236} 31838} 31839 31840@Article{ klarbring.bjorkman:mathematical, 31841 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31842 title = {A mathematical programming approach to contact problems with friction and varying 31843 contact surface}, 31844 journal = {Computers \& Structures}, 31845 volume = {30}, 31846 year = {1988}, 31847 pages = {1185--1198} 31848} 31849 31850@Article{ klarbring.bjorkman:solution, 31851 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31852 title = {Solution of large displacement contact problems with friction using {N}ewton's 31853 method for generalized equations}, 31854 journal = {International Journal for Numerical Methods in Engineering}, 31855 volume = {34}, 31856 year = {1992}, 31857 pages = {249--269} 31858} 31859 31860@Article{ klarbring.pang:existence, 31861 author = {A. Klarbring and J. S. Pang}, 31862 title = {Existence of solution to discrete semicoercive frictional contact problems}, 31863 journal = {{SIAM} Journal on Optimization, under review}, 31864 year = {1996} 31865} 31866 31867@Article{ klarbring:discrete, 31868 author = {A. Klarbring}, 31869 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 31870 (Stability, Uniqueness and Variational Principles)}, 31871 journal = {International Journal on Solids and Structures}, 31872 volume = {24}, 31873 pages = {459--479}, 31874 year = {1988} 31875} 31876 31877@TechReport{ klarbring:large, 31878 author = {A. Klarbring}, 31879 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 31880 Discretization}, 31881 number = {LiTH-IKP-R-798}, 31882 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 31883 address = {Link{\"o}ping}, 31884 year = {1994} 31885} 31886 31887@Article{ klarbring:mathematical, 31888 author = {A. Klarbring}, 31889 title = {A mathematical programming approach to three dimensional contact problems with 31890 friction}, 31891 journal = {Computer Methods in Applied Mechanics and Engineering}, 31892 volume = {58}, 31893 year = {1986}, 31894 pages = {175--200} 31895} 31896 31897@InCollection{ klarbring:mathematical*1, 31898 author = {A. Klarbring}, 31899 title = {Mathematical programming and augmented {L}agrangian methods for frictional 31900 contact problems}, 31901 editor = {A. Curnier}, 31902 booktitle = {Proceedings Contact Mechanics International Symposium}, 31903 publisher = {Presse Polytechniques et Universitaires Romandes}, 31904 address = {Lausanne}, 31905 year = {1992}, 31906 pages = {409--422} 31907} 31908 31909@InCollection{ klarbring:mathematical*2, 31910 author = {A. Klarbring}, 31911 title = {Mathematical programming in contact problems}, 31912 editors = {M. H. Aliabadi and C. A. Brebbia}, 31913 booktitle = {Computational Methods for Contact Problems}, 31914 publisher = {Computational Mechanics Publications}, 31915 address = {Southampton}, 31916 year = {1993}, 31917 pages = {233--264} 31918} 31919 31920@Article{ klarbring:quadratic, 31921 author = {A. Klarbring}, 31922 title = {A quadratic program in frictionless contact problems}, 31923 journal = {International Journal of Engineering Science}, 31924 volume = {24}, 31925 pages = {1207--1217}, 31926 year = {1986} 31927} 31928 31929@InCollection{ klee.minty:how, 31930 author = {V. Klee and G. J. Minty}, 31931 title = {How Good is the Simplex Algorithm?}, 31932 booktitle = {Inequalities--III}, 31933 year = {1972}, 31934 publisher = {Academic Press}, 31935 pages = {159--175} 31936} 31937 31938@Article{ kleywegt.shapiro:sample, 31939 author = {A. Kleywegt and A. Shapiro}, 31940 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 31941 journal = {Stochastic Programming E-Print Series}, 31942 year = {1999}, 31943 note = {Available from dochost.rz.hu-berlin.de/speps} 31944} 31945 31946@Book{ knuth:art, 31947 author = {D. E. Knuth}, 31948 title = {The Art of Computer Programming}, 31949 publisher = {Addison-Wesley Longman Inc.}, 31950 address = {Reading, Massachusetts}, 31951 year = {1998}, 31952 edition = {Third}, 31953 volume = {2} 31954} 31955 31956@InProceedings{ kocvara.outrata:nonsmooth, 31957 author = {M. Ko\v{c}vara and J. V. Outrata}, 31958 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 31959 crossref = {ferris.pang:complementarity}, 31960 pages = {148--164} 31961} 31962 31963@Article{ kocvara.outrata:optimization, 31964 author = {M. Ko\v{c}vara and J. V. Outrata}, 31965 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 31966 volume = {15}, 31967 journal = {Numerical Fucntional Analysis and Optimization}, 31968 year = {1994}, 31969 pages = {869--887} 31970} 31971 31972@InCollection{ kocvara.outrata:solution, 31973 author = {M. Ko\v{c}vara and J. V. Outrata}, 31974 title = {On the solution of optimum design problems with variational inequalities}, 31975 editors = {D. Z. Du and L. Qi and R. Womersley}, 31976 booktitle = {Recent Advances in Nonsmooth Optimization}, 31977 publisher = {World Scientific Publishers}, 31978 address = {Singapore}, 31979 year = {1995}, 31980 pages = {172--192} 31981} 31982 31983@Article{ kojima.hirabayashi:homotopy, 31984 author = {M. Kojima and R. Hirabayashi}, 31985 title = {Continuous deformation of nonlinear programs}, 31986 journal = {Mathematical Programming Study}, 31987 editor = {A.~V. Fiacco}, 31988 publisher = {North--Holland}, 31989 address = {Amsterdam}, 31990 year = {1984}, 31991 volume = {21}, 31992 pages = {150--198} 31993} 31994 31995@Article{ kojima.megiddo.ea:homotopy, 31996 author = {M. Kojima and N. Megiddo and T. Noma}, 31997 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 31998 journal = {Mathematics of Operations Research}, 31999 year = {1991}, 32000 volume = {16}, 32001 pages = {754--774} 32002} 32003 32004@TechReport{ kojima.megiddo.ea:primal-dual, 32005 author = {M. Kojima and N. Megiddo and S. Mizuno}, 32006 title = {A primal-dual exterior point algorithm for linear programming}, 32007 institution = {IBM Alamaden Research Center}, 32008 year = {1991}, 32009 number = {RJ 8500}, 32010 address = {San Jose, California} 32011} 32012 32013@Book{ kojima.megiddo.ea:unified, 32014 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 32015 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 32016 Problems}, 32017 year = {1991}, 32018 publisher = {Springer-Verlag}, 32019 address = {Berlin}, 32020 volume = {538}, 32021 series = {Lecture Notes in Computer Science} 32022} 32023 32024@Article{ kojima.mizuno.ea:continuation, 32025 author = {M. Kojima and S. Mizuno and T. Noma}, 32026 title = {A New Continuation Method for Complementarity Problems with Uniform 32027 {P}-function}, 32028 journal = {Mathematical Programming}, 32029 year = {1989}, 32030 volume = {43}, 32031 pages = {107--113} 32032} 32033 32034@TechReport{ kojima.mizuno.ea:infeasible, 32035 author = {M. Kojima and S. Mizuno and M. Todd}, 32036 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 32037 programming}, 32038 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 32039 year = {1992}, 32040 number = {1023}, 32041 address = {Ithaca, New York}, 32042 month = aug 32043} 32044 32045@Article{ kojima.mizuno.ea:onl, 32046 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32047 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 32048 complementarity problems}, 32049 journal = {Mathematical Programming}, 32050 year = {1991}, 32051 volume = {50}, 32052 pages = {331--342} 32053} 32054 32055@Article{ kojima.mizuno.ea:polynomial-time, 32056 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32057 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 32058 journal = {Mathematical Programming}, 32059 year = {1989}, 32060 volume = {44}, 32061 pages = {1--20} 32062} 32063 32064@Article{ kojima.noma.ea:global, 32065 author = {M. Kojima and T. Noma and A. Yoshise}, 32066 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 32067 journal = {Mathematical Programming}, 32068 volume = {65}, 32069 pages = {43--72}, 32070 year = {1994} 32071} 32072 32073@Article{ kojima.shindo.ea:interior-point, 32074 author = {M. Kojima and S. Shindo and S. Hara}, 32075 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 32076 Problem in Symmetric Matrices}, 32077 journal = {SIAM Journal on Optimization}, 32078 volume = {7}, 32079 pages = {86--125} 32080} 32081 32082@Article{ kojima.shindo:extensions, 32083 author = {M. Kojima and S. Shindo}, 32084 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 32085 Equations}, 32086 journal = {Journal of Operations Research Society of Japan}, 32087 year = {1986}, 32088 volume = {29}, 32089 pages = {352--374} 32090} 32091 32092@Article{ kojima:computational, 32093 author = {M. Kojima}, 32094 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 32095 journal = {Keio Engineering Reports}, 32096 year = {1974}, 32097 volume = {27}, 32098 pages = {1--41} 32099} 32100 32101@Article{ kojima:recent, 32102 author = {M. Kojima}, 32103 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 32104 continuation methods}, 32105 journal = {Systems and Control}, 32106 year = {1981}, 32107 volume = {25}, 32108 pages = {421--430} 32109} 32110 32111@Article{ kolesar:branch, 32112 author = {P. J. Kolesar}, 32113 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 32114 journal = {Management Science}, 32115 year = {1967}, 32116 volume = {13}, 32117 pages = {723--735} 32118} 32119 32120@Book{ kolman.beck:elementary, 32121 author = {B. Kolman and R. E. Beck}, 32122 title = {Elementary Linear Programming with Applications}, 32123 year = {1980}, 32124 publisher = {Academic Press} 32125} 32126 32127@Book{ koopmans:activity, 32128 editor = {T. C. Koopmans}, 32129 title = {Activity Analysis of Production and Allocation}, 32130 publisher = {John Wiley}, 32131 address = {New York}, 32132 year = {1951} 32133} 32134 32135@Article{ korpelevich:extragradient, 32136 author = {G. M. Korpelevich}, 32137 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 32138 journal = {Matecon}, 32139 year = {1976}, 32140 volume = {12}, 32141 pages = {747--756} 32142} 32143 32144@Article{ kortanek.shi:convergence, 32145 author = {K. O. Kortanek and M. Shi}, 32146 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 32147 Algorithm}, 32148 journal = {European Journal of Operational Research}, 32149 year = {1987}, 32150 volume = {32}, 32151 pages = {47--61} 32152} 32153 32154@TechReport{ kortanek.shi:remarks, 32155 author = {K. O. Kortanek and M. Shi}, 32156 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 32157 Hybrid Algorithm 1985-6'}, 32158 institution = {College of Business Administration, University of Iowa}, 32159 year = {1987}, 32160 address = {Iowa City}, 32161 number = {87--1}, 32162 type = {Working Paper} 32163} 32164 32165@TechReport{ kortanek:vector-supercomputer, 32166 author = {K. O. Kortanek}, 32167 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 32168 institution = {College of Business Administration, University of Iowa}, 32169 year = {1987}, 32170 address = {Iowa City}, 32171 number = {87--2}, 32172 type = {Working Paper} 32173} 32174 32175@Article{ kostreva:block, 32176 author = {M. M. Kostreva}, 32177 title = {Block Pivot Methods for Solving the Complementarity Problem}, 32178 journal = {Linear Algebra and Its Applications}, 32179 volume = {21}, 32180 pages = {207--215}, 32181 year = {1978} 32182} 32183 32184@Article{ kostreva:elasto-hydrodynamic, 32185 author = {M. M. Kostreva}, 32186 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 32187 journal = {International Journal for Numerical Methods in Fluids}, 32188 year = {1984}, 32189 volume = {4}, 32190 pages = {377--397} 32191} 32192 32193@Article{ kostreva:recent, 32194 author = {M. M. Kostreva}, 32195 title = {Recent Results on Complementarity Models for Engineering and Economics}, 32196 journal = {Infor, Journal of the Canadian {OR} Society}, 32197 year = {1990}, 32198 volume = {28}, 32199 pages = {324--334} 32200} 32201 32202@Article{ kotiah.steinberg:occurrences, 32203 author = {T. C. T. Kotiah and D. I. Steinberg}, 32204 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 32205 Programming Models}, 32206 journal = {Communications of the ACM}, 32207 volume = {20}, 32208 year = {1977}, 32209 pages = {107--112} 32210} 32211 32212@Article{ kotiah.steinberg:possibility, 32213 author = {T. C. T. Kotiah and D. I. Steinberg}, 32214 title = {On the Possibility of Cycling with the Simplex Method}, 32215 journal = {Operations Research}, 32216 volume = {26}, 32217 year = {1978}, 32218 pages = {374--376} 32219} 32220 32221@InCollection{ kuhn.tucker:nonlinear, 32222 author = {H. W. Kuhn and A. W. Tucker}, 32223 title = {Nonlinear Programming}, 32224 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 32225 Probability}, 32226 year = {1951}, 32227 editor = {J. Neyman}, 32228 publisher = {University of California Press}, 32229 address = {Berkeley and Los Angeles}, 32230 pages = {481--492} 32231} 32232 32233@Article{ kummer:metric, 32234 author = {B. Kummer}, 32235 title = {Metric regularity: characterizations, nonsmooth variations, and successive 32236 approximation}, 32237 journal = {Journal of Mathematical Analysis and its Applications}, 32238 year = {}, 32239 optkey = {}, 32240 optvolume = {}, 32241 optnumber = {}, 32242 optpages = {}, 32243 optmonth = {}, 32244 optnote = {}, 32245 optannote = {} 32246} 32247 32248@InCollection{ kummer:newtons, 32249 author = {B. Kummer}, 32250 title = {{N}ewton's Method for Non--Differentiable Functions}, 32251 booktitle = {Advances in Mathematical Optimization}, 32252 publisher = {Akademie--Verlag}, 32253 year = {1988}, 32254 editors = {J. Guddat et al.}, 32255 pages = {114--125}, 32256 address = {Berlin} 32257} 32258 32259@Unpublished{ kuntsevich.kappel:solvopt, 32260 author = {A. Kuntsevich and F. Kappel}, 32261 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 32262 year = {1997}, 32263 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 32264 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 32265} 32266 32267@Book{ kushner.clark:stochastic, 32268 author = {H. J. Kushner and D. S. Clark}, 32269 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 32270 publisher = {Springer-Verlag}, 32271 year = {1978}, 32272 address = {New York} 32273} 32274 32275@Article{ kutcher.burman.ea:histogram, 32276 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 32277 title = {Histogram reduction method for calculating complication probabilities for 32278 three-dimensional treatment planning evaluation}, 32279 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32280 year = {1991}, 32281 optvolume = {21}, 32282 optpages = {137-146} 32283} 32284 32285@Article{ kutcher.burman:calculation, 32286 author = {G. J. Kutcher and C. Burman}, 32287 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 32288 Irradiation: The Effective Volume Method}, 32289 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32290 year = {1989}, 32291 volume = {16}, 32292 pages = {1623--1630} 32293} 32294 32295@Article{ kwak.lee:complementarity, 32296 author = {B. M. Kwak and B. C. Lee.}, 32297 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 32298 Problem}, 32299 journal = {Computers and Structures}, 32300 volume = {18}, 32301 pages = {469--480}, 32302 year = {1988} 32303} 32304 32305@Article{ kwak:complementarity, 32306 author = {B. M. Kwak}, 32307 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 32308 journal = {Journal of Applied Mechanics}, 32309 volume = {58}, 32310 pages = {134--140}, 32311 year = {1991} 32312} 32313 32314@Article{ lagarias.reeds.ea:convergence, 32315 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 32316 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 32317 journal = {SIAM Journal on Optimization}, 32318 year = {1998}, 32319 volume = {9}, 32320 pages = {112--147} 32321} 32322 32323@Article{ lahaye:methode, 32324 author = {E. Lahaye}, 32325 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 32326 transcendantes}, 32327 journal = {C. R. Acad. Sci. Paris}, 32328 year = {1934}, 32329 volume = {198}, 32330 pages = {1840--1842} 32331} 32332 32333@Article{ lahaye:solution, 32334 author = {E. Lahaye}, 32335 title = {Solution of Systems of Transcendental Equations}, 32336 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 32337 year = {1948}, 32338 volume = {5}, 32339 pages = {805--822} 32340} 32341 32342@Article{ lahenbruch.mickey:estimation, 32343 author = {P. A. Lahenbruch and R. M. Mickey}, 32344 title = {Estimation of Error Rates in Discriminant Analysis}, 32345 journal = {Technometrics}, 32346 year = {1968}, 32347 volume = {10}, 32348 pages = {1--11} 32349} 32350 32351@Article{ lakshminarayan.lakshmanan.ea:optimal, 32352 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 32353 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 32354 journal = {Operations Research}, 32355 year = {1978}, 32356 volume = {26}, 32357 pages = {1079--1082} 32358} 32359 32360@Article{ land.doig:automatic, 32361 author = {A. H. Land and A. G. Doig}, 32362 title = {An Automatic Method for Solving Discrete Programming Problems}, 32363 journal = {Econometrica}, 32364 volume = {28}, 32365 year = {1960}, 32366 pages = {497-520} 32367} 32368 32369@Article{ langer.morrill:comparison, 32370 author = {M. Langer and S. Morrill}, 32371 title = {A comparison of mixed integer programming and fast simulated annealing for 32372 optimized beam weights in radiation therapy}, 32373 journal = {Medical Physics}, 32374 year = {1996}, 32375 volume = {23}, 32376 number = {6}, 32377 pages = {957--964} 32378} 32379 32380@Article{ larsson.patriksson:class, 32381 author = {T. Larsson and M. Patriksson}, 32382 title = {A Class of Gap Functions for Variational Inequalities}, 32383 journal = {Mathematical Programming}, 32384 year = {1994}, 32385 volume = {64}, 32386 pages = {53--79} 32387} 32388 32389@Article{ lasdon.waren.ea:solving, 32390 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 32391 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 32392 Linear Programming Algorithms}, 32393 journal = {ACM SIGMAP Bulletin}, 32394 year = {1979}, 32395 volume = {27}, 32396 pages = {9--15} 32397} 32398 32399@TechReport{ lawler.lenstra.ea:sequencing, 32400 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 32401 title = {Sequencing and Scheduling: Algorithms and Complexity}, 32402 institution = {Centre for Mathematics and Computer Science}, 32403 year = {1989}, 32404 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 32405 number = {BS--R89xx} 32406} 32407 32408@Article{ lawler:fast, 32409 author = {E. L. Lawler}, 32410 title = {Fast Approximations Algorithms for Knapsack Problems}, 32411 journal = {Mathematics of Operations Research}, 32412 year = {1979}, 32413 volume = {4}, 32414 pages = {339--356} 32415} 32416 32417@Book{ lawless:statistical, 32418 author = {J. F. Lawless}, 32419 title = {Statistical Models and Methods for Lifetime Data}, 32420 year = {1982}, 32421 publisher = {John Wiley and Sons}, 32422 address = {New York, NY} 32423} 32424 32425@Article{ lawrence.spingarn:fixed, 32426 author = {J. Lawrence and J. E. Spingarn}, 32427 title = {On fixed points of non-expansive piecewise isometric mappings}, 32428 journal = {Proceedings of the London Mathematical Society}, 32429 year = {1987}, 32430 volume = {55}, 32431 number = {3}, 32432 pages = {605--624} 32433} 32434 32435@Article{ leavitt.martin.ea:dynamic, 32436 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 32437 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 32438 dose delivery}, 32439 journal = {Medical Physics}, 32440 year = {1990}, 32441 volume = {17}, 32442 number = {1}, 32443 pages = {87--92} 32444} 32445 32446@Article{ leblanc.morlok.ea:efficient, 32447 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 32448 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 32449 Problem}, 32450 journal = {Transportation Research}, 32451 volume = {9}, 32452 year = {1975}, 32453 pages = {309--318} 32454} 32455 32456@Article{ lee:computational, 32457 author = {S. S. Lee}, 32458 title = {A computational method for frictional contact problem using finite element 32459 method}, 32460 journal = {International Journal for Numerical Methods in Engineering}, 32461 volume = {37}, 32462 year = {1994}, 32463 pages = {217--228} 32464} 32465 32466@PhDThesis{ lee:military, 32467 author = {D. K. Lee}, 32468 title = {Military Force Planning Problems Under Uncertainty}, 32469 school = {University of Wisconsin -- Madison}, 32470 year = {1996}, 32471 address = {Madison, Wisconsin} 32472} 32473 32474@Article{ leibel.kutcher.ea:improved, 32475 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 32476 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 32477 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 32478 the Nasopharynx}, 32479 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32480 year = {1991}, 32481 volume = {20}, 32482 pages = {823--833} 32483} 32484 32485@Article{ lee.gallagher.ea:treatment, 32486 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 32487 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 32488 Computational Approaches and Experiments with Permanent Prostate Implant 32489 Planning}, 32490 journal = {Physics in Medicine and Biology}, 32491 year = {1999}, 32492 volume = {44}, 32493 pages = {145--165} 32494} 32495 32496@Article{ lemarechal.nemirovskii.ea:variants, 32497 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 32498 title = {New Variants of Bundle Methods}, 32499 year = {1995}, 32500 journal = {Mathematical Programming}, 32501 volume = {69}, 32502 pages = {111--147} 32503} 32504 32505@InCollection{ lemarechal.strodiot.ea:bundle, 32506 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 32507 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 32508 booktitle = {Nonlinear Programming}, 32509 year = {1981}, 32510 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 32511 publisher = {Academic Press}, 32512 pages = {245--282}, 32513 volume = {4} 32514} 32515 32516@Article{ lemke.howson:equilibrium, 32517 author = {C. E. Lemke and J. T. Howson}, 32518 title = {Equilibrium Points of Bimatrix Games}, 32519 journal = {SIAM Journal on Applied Mathematics}, 32520 year = {1964}, 32521 volume = {12}, 32522 pages = {413--423} 32523} 32524 32525@Article{ lemke:bimatrix, 32526 author = {C. E. Lemke}, 32527 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 32528 journal = {Management Science}, 32529 year = {1965}, 32530 volume = {11}, 32531 pages = {681--689} 32532} 32533 32534@InCollection{ lemke:complementary, 32535 author = {C. E. Lemke}, 32536 title = {On Complementary Pivot Theory}, 32537 booktitle = {Mathematics of the Decision Sciences: Part 1}, 32538 publisher = {American Mathematical Society}, 32539 year = {1968}, 32540 editor = {G. B. Dantzig and A. F. Veinott}, 32541 volume = {11}, 32542 series = {Lectures in Applied Mathematics}, 32543 address = {Providence}, 32544 pages = {95--114} 32545} 32546 32547@Article{ levenberg:method, 32548 author = {K. Levenberg}, 32549 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 32550 journal = {Quarterly Applied Mathematics}, 32551 year = {1944}, 32552 volume = {2}, 32553 pages = {164--168} 32554} 32555 32556@Article{ levitin.polyak:constrained, 32557 author = {E. S. Levitin and B. T. Polyak}, 32558 title = {Constrained minimization methods}, 32559 journal = {Computational Mathematics and Mathematical Physics}, 32560 year = {1968}, 32561 volume = {6}, 32562 pages = {1--50}, 32563 note = {Translated from Russian} 32564} 32565 32566@Article{ li.swetis:linear, 32567 author = {W. Li and J. J. Swetits}, 32568 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 32569 journal = {SIAM Journal on Optimization}, 32570 volume = {8}, 32571 pages = {457-475}, 32572 year = {1998} 32573} 32574 32575@TechReport{ li:error, 32576 author = {W. Li}, 32577 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 32578 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32579 year = {1993}, 32580 address = {Norfolk, VA 23529}, 32581 number = {TR93-1}, 32582 note = {SIAM Journal on Control and Optimization, to appear} 32583} 32584 32585@TechReport{ li:linearly, 32586 author = {W. Li}, 32587 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 32588 Quadratic Splines}, 32589 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32590 year = {1993}, 32591 address = {Norfolk, VA 23529}, 32592 number = {TR93-3}, 32593 note = {Journal of Optimization Theory and Applications, to appear} 32594} 32595 32596@InProceedings{ li:merit, 32597 author = {W. Li}, 32598 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 32599 Problems}, 32600 crossref = {ferris.pang:complementarity} 32601} 32602 32603@Article{ li:remarks, 32604 author = {W. Li}, 32605 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 32606 Complementarity Problem}, 32607 journal = {SIAM Journal on Optimization}, 32608 year = {1993}, 32609 volume = {3}, 32610 pages = {155--163} 32611} 32612 32613@TechReport{ li:sharp, 32614 author = {W. Li}, 32615 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 32616 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32617 year = {1991}, 32618 address = {Norfolk, VA 23529}, 32619 number = {TR91-13}, 32620 note = {SIAM Journal on Control and Optimization, to appear} 32621} 32622 32623@Article{ lin.kernighan:efficient, 32624 author = {S. Lin and B. W. Kernighan}, 32625 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 32626 journal = {Operations Research}, 32627 year = {1973}, 32628 volume = {21}, 32629 pages = {498--516} 32630} 32631 32632@Article{ lin.pang:iterative, 32633 author = {Y. Y. Lin and J. S. Pang}, 32634 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 32635 journal = {SIAM Journal on Control and Optimization}, 32636 year = {1987}, 32637 volume = {25}, 32638 pages = {383--411} 32639} 32640 32641@Unpublished{ linderoth:branch, 32642 author = {J. Linderoth}, 32643 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 32644 institution = {Argonne National Laboratories}, 32645 year = {2000}, 32646 note = {Working Paper} 32647} 32648 32649@Article{ lions.stampacchia:variational, 32650 author = {J. L. Lions and G. Stampacchia}, 32651 title = {Variational Inequalities}, 32652 journal = {Communications on Pure and Applied Math}, 32653 year = {1967}, 32654 volume = {20}, 32655 pages = {493--19} 32656} 32657 32658@Article{ lions.mercier:splitting, 32659 author = {P.--L. Lions and B. Mercier}, 32660 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 32661 journal = {SIAM Journal on Numerical Analysis}, 32662 year = {1979}, 32663 volume = {16}, 32664 pages = {964--979} 32665} 32666 32667@Article{ lions:methode, 32668 author = {P.--L. Lions}, 32669 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 32670 journal = {Israel Journal of Mathematics}, 32671 year = {1978}, 32672 volume = {31}, 32673 number = {2}, 32674 pages = {204--208} 32675} 32676 32677@InProceedings{ litzkow.livny.ea:condor, 32678 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 32679 title = {Condor: {A} Hunter of Idle Workstations}, 32680 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 32681 Systems}, 32682 year = {1988}, 32683 pages = {104--111}, 32684 month = jun 32685} 32686 32687@Article{ liu.nocedal:limited, 32688 author = {D. C. Liu and J. Nocedal}, 32689 title = {On the Limited Memory Method for Large Scale Optimization}, 32690 journal = {Mathematical Programming}, 32691 year = {1989}, 32692 volume = {45}, 32693 pages = {503--528} 32694} 32695 32696@InBook{ livny.raman:high, 32697 author = {M. Livny and R. Raman}, 32698 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 32699 chapter = {High Throughput Resource Management}, 32700 publisher = {Morgan Kaufmann Publishers}, 32701 year = {1999}, 32702 pages = {311--337} 32703} 32704 32705@Article{ llacer:inverse, 32706 author = {J. Llacer}, 32707 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 32708 Method}, 32709 journal = {Medical Physics}, 32710 year = {1997}, 32711 volume = {24}, 32712 number = {11}, 32713 pages = {1751--1764} 32714} 32715 32716@Book{ lojasiewicz:ensembles, 32717 author = {M. S. Lojasiewicz}, 32718 title = {Ensembles semi-analytiques}, 32719 publisher = {Institut des Hautes Etudes Scientifiques}, 32720 year = {1964}, 32721 address = {Bures-sur-Yvette} 32722} 32723 32724@Article{ lootsma:logarithmic, 32725 author = {F. A. Lootsma}, 32726 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 32727 journal = {Phillips Research Reports}, 32728 year = {1967}, 32729 volume = {22}, 32730 pages = {329--344} 32731} 32732 32733@InCollection{ lootsma:survey, 32734 author = {F. A. Lootsma}, 32735 title = {A Survey of Methods for Solving Constrained Minimization Problems via 32736 Unconstrained Minimization}, 32737 booktitle = {Numerical Methods for Nonlinear Optimization}, 32738 year = {1972}, 32739 editor = {F. A. Lootsma}, 32740 publisher = {Academic Press}, 32741 address = {London} 32742} 32743 32744@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 32745 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32746 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 32747 Regional Trade Blocks}, 32748 institution = {National Bureau of Economic Research, Inc.}, 32749 year = {1993}, 32750 number = {4512}, 32751 address = {Cambridge, Massechusetts} 32752} 32753 32754@InCollection{ lopezdesilanes.markusen.ea:auto, 32755 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32756 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 32757 year = {1994}, 32758 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 32759 publisher = {Cambridge University Press}, 32760 editor = {C. Shields and J. Francois} 32761} 32762 32763@Article{ lopezdesilanes.markusen.ea:complementarity, 32764 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32765 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 32766 journal = {Journal of Development Economics}, 32767 year = {1994}, 32768 volume = {45}, 32769 pages = {133--151} 32770} 32771 32772@Article{ lopezdesilanes.markusen.ea:trade, 32773 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32774 title = {Trade Policy Subtleties with Multinational Firms}, 32775 journal = {European Economic Review}, 32776 year = {1996} 32777} 32778 32779@Article{ lotstedt:coulomb, 32780 author = {P. L{\"{o}}tstedt}, 32781 title = {Coulomb friction in two-dimensional rigid body systems}, 32782 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 32783 volume = {61}, 32784 year = {1981}, 32785 pages = {605--615} 32786} 32787 32788@Article{ lotstedt:mechanical, 32789 author = {P. L{\"{o}}tstedt}, 32790 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 32791 journal = {SIAM Journal on Applied Mathematics}, 32792 volume = {42}, 32793 year = {1982}, 32794 pages = {281--296} 32795} 32796 32797@Book{ luenberger:linear, 32798 author = {D. G. Luenberger}, 32799 title = {Linear and Nonlinear Programming}, 32800 year = {1984}, 32801 publisher = {Addison-Wesley}, 32802 edition = {Second} 32803} 32804 32805@Book{ luenberger:optimization, 32806 author = {D. G. Luenberger}, 32807 title = {Optimization by Vector Space Methods}, 32808 year = {1969}, 32809 publisher = {John Wiley \& Sons}, 32810 address = {New York} 32811} 32812 32813@Article{ lundy.mees:convergence, 32814 author = {M. Lundy and A. Mees}, 32815 title = {Convergence of an Annealing Algorithm}, 32816 journal = {Mathematical Programming}, 32817 year = {1986}, 32818 volume = {34}, 32819 pages = {111--124} 32820} 32821 32822@Article{ luo.luo:extension, 32823 author = {X.-D. Luo and Z.-Q. Luo}, 32824 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 32825 journal = {SIAM Journal on Optimization}, 32826 year = {1994}, 32827 volume = {4}, 32828 pages = {383--392} 32829} 32830 32831@Article{ luo.mangasarian.ea:error, 32832 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 32833 title = {New Error Bounds for the Linear Complementarity Problem}, 32834 journal = {Mathematics of Operations Research}, 32835 year = {1994}, 32836 pages = {880--892}, 32837 volume = {19} 32838} 32839 32840@Article{ luo.pang.ea:exact, 32841 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 32842 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 32843 Equilibrium Constraints}, 32844 journal = {Mathematical Programming}, 32845 volume = {75}, 32846 pages = {19--76}, 32847 year = {1996} 32848} 32849 32850@Book{ luo.pang.ea:mathematical, 32851 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 32852 title = {Mathematical Programs with Equilibrium Constraints}, 32853 publisher = {Cambridge University Press}, 32854 year = {1996} 32855} 32856 32857@Article{ luo.pang:error, 32858 author = {Z.-Q. Luo and J. S. Pang}, 32859 title = {Error Bounds for Analytic Systems and their Applications}, 32860 journal = {Mathematical Programming}, 32861 year = {1994}, 32862 volume = {67}, 32863 pages = {1--28} 32864} 32865 32866@Article{ luo.shu.ea:optimizing, 32867 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 32868 title = {Optimizing computerized treatment planning for the Gamma Knife by source 32869 culling}, 32870 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32871 year = {1999}, 32872 volume = {45}, 32873 number = {5}, 32874 pages = {1339--1346} 32875} 32876 32877@InProceedings{ luo.tseng:class, 32878 author = {Z.-Q. Luo and P. Tseng}, 32879 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 32880 crossref = {ferris.pang:complementarity}, 32881 pages = {204--225} 32882} 32883 32884@Article{ luo.tseng:convergence, 32885 author = {Z.-Q. Luo and P. Tseng}, 32886 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 32887 Minimization}, 32888 journal = {Journal of Optimization Theory and Applications}, 32889 year = {1992}, 32890 volume = {72}, 32891 pages = {7--35} 32892} 32893 32894@Article{ luo.tseng:convergence*1, 32895 author = {Z.-Q. Luo and P. Tseng}, 32896 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 32897 Linear Complementarity Problem}, 32898 journal = {SIAM Journal on Control and Optimization}, 32899 year = {1991}, 32900 volume = {29}, 32901 pages = {1037--1060} 32902} 32903 32904@Article{ luo.tseng:convergence*2, 32905 author = {Z.-Q. Luo and P. Tseng}, 32906 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 32907 journal = {Mathematics of Operations Research}, 32908 year = {1993}, 32909 volume = {18}, 32910 pages = {846--867} 32911} 32912 32913@Article{ luo.tseng:error, 32914 author = {Z.--Q. Luo and P. Tseng}, 32915 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 32916 Affine Variational Inequality Problem}, 32917 journal = {SIAM Journal on Optimization}, 32918 year = {1992}, 32919 volume = {2}, 32920 pages = {43--54} 32921} 32922 32923@Article{ luo.tseng:error*1, 32924 author = {Z.-Q. Luo and P. Tseng}, 32925 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 32926 Over a Polyhedral Set}, 32927 journal = {SIAM Journal on Optimization}, 32928 year = {1993}, 32929 volume = {3}, 32930 pages = {43--59} 32931} 32932 32933@Article{ luo.tseng:error*2, 32934 author = {Z.-Q. Luo and P. Tseng}, 32935 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 32936 Approach}, 32937 journal = {Annals of Operations Research}, 32938 year = {1993}, 32939 volume = {46}, 32940 pages = {157--178} 32941} 32942 32943@Article{ luo.tseng:global, 32944 author = {Z.-Q. Luo and P. Tseng}, 32945 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 32946 Problems}, 32947 journal = {Operations Research Letters}, 32948 year = {1992}, 32949 volume = {11}, 32950 pages = {159--165} 32951} 32952 32953@Article{ luo.tseng:linear, 32954 author = {Z.-Q. Luo and P. Tseng}, 32955 title = {On the linear convergence of descent methods for convex essentially smooth 32956 minimization}, 32957 journal = {SIAM Journal on Control and Optimization}, 32958 year = {1992}, 32959 volume = {30}, 32960 pages = {408--425} 32961} 32962 32963@TechReport{ luo:convergence, 32964 author = {Z.-Q. Luo}, 32965 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 32966 Quadratic Programs}, 32967 institution = {Communications Research Laboratory, McMaster University}, 32968 year = {1992}, 32969 address = {Hamilton, Ontario} 32970} 32971 32972@Article{ lustig.marsten.ea:computational, 32973 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32974 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 32975 Programming}, 32976 journal = {Linear Algebra and Its Applications}, 32977 year = {1991}, 32978 volume = {152}, 32979 pages = {191--222} 32980} 32981 32982@Article{ lustig.marsten.ea:implementing, 32983 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32984 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 32985 programming}, 32986 journal = {SIAM Journal on Optimization}, 32987 year = {1992}, 32988 volume = {2}, 32989 pages = {435--449} 32990} 32991 32992@Article{ lustig.marsten.ea:interior-point, 32993 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32994 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 32995 journal = {ORSA Journal on Computing}, 32996 year = {1994}, 32997 volume = {6}, 32998 number = {1}, 32999 pages = {1--38} 33000} 33001 33002@Article{ lyman.wolbarst:optimization, 33003 author = {J. T. Lyman and A. B. Wolbarst}, 33004 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 33005 Algorithm}, 33006 journal = {International Journal of Radiation Oncology, Biology and Physics}, 33007 year = {1989}, 33008 volume = {17}, 33009 pages = {433--436} 33010} 33011 33012@Article{ mackie.holmes.ea:tomotherapy*1, 33013 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 33014 J. Yang and B. Paliwal and T. Kinsella}, 33015 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 33016 journal = {Medical Physics}, 33017 year = {1993}, 33018 volume = {20}, 33019 number = {6}, 33020 pages = {1709--1719} 33021} 33022 33023@Article{ mackie.holmes.ea:tomotherapy*2, 33024 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 33025 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 33026 journal = {Int. J. of Imaging Systems and Technology}, 33027 year = {1995}, 33028 volume = {6}, 33029 pages = {43--55} 33030} 33031 33032@Article{ mackie.scrimger.ea:convolution, 33033 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 33034 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 33035 journal = {Medical Physics}, 33036 year = {1985}, 33037 volume = {12}, 33038 pages = {188--196} 33039} 33040 33041@Article{ mackinnon:technique, 33042 author = {James G. Mac{K}innon}, 33043 title = {A Technique for the Solution of Spatial Equilibrium Models}, 33044 journal = {Journal of Regional Science}, 33045 year = {1976}, 33046 volume = {16}, 33047 pages = {293--307} 33048} 33049 33050@PhDThesis{ madsen:minimization, 33051 author = {K. Madsen}, 33052 title = {Minimization of Nonlinear Approximation Functions}, 33053 year = {1985}, 33054 address = {Lyngby, Denmark}, 33055 school = {Institute of Numerical Analysis, Technical University of Denmark}, 33056 annote = {Dissertation} 33057} 33058 33059@Book{ magill.quinzii:theory, 33060 author = {M. Magill and M. Quinzii}, 33061 title = {Theory of Incomplete Markets}, 33062 publisher = {MIT Press}, 33063 year = {1996} 33064} 33065 33066@InCollection{ magnanti:models, 33067 author = {T. L. Magnanti}, 33068 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 33069 booktitle = {Transportation Planning Models}, 33070 year = {1984}, 33071 editor = {M. Florian}, 33072 publisher = {North Holland}, 33073 pages = {153--186} 33074} 33075 33076@InCollection{ maguregui:modified, 33077 author = {J. Maguregui}, 33078 title = {A modified {N}ewton algorithm for functions over convex sets}, 33079 crossref = {mangasarian.meyer.ea:nonlinear*3}, 33080 pages = {461--473} 33081} 33082 33083@PhDThesis{ maguregui:regular, 33084 author = {J. Maguregui}, 33085 title = {Regular Multivalued Functions and Algorithmic Applications}, 33086 year = {1977}, 33087 address = {Madison, Wisconsin}, 33088 school = {Computer Sciences Department, University of Wisconsin} 33089} 33090 33091@Article{ mahey.oualibouch.ea:proximal, 33092 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 33093 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 33094 journal = {SIAM Journal on Optimization}, 33095 year = {1995}, 33096 volume = {5}, 33097 pages = {454--466} 33098} 33099 33100@Article{ mahey.pham:partial, 33101 author = {P. Mahey and D. T. Pham}, 33102 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 33103 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 33104 year = {1993}, 33105 volume = {27}, 33106 pages = {375--392} 33107} 33108 33109@InCollection{ maier.novati:shakedown, 33110 author = {G. Maier and G. Novati}, 33111 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 33112 geometric effects with reference to discrete structural models}, 33113 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 33114 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 33115 publisher = {Pineridge Press}, 33116 address = {Swansea}, 33117 year = {1990}, 33118 pages = {451--471} 33119} 33120 33121@Article{ maier:incremental, 33122 author = {G. Maier}, 33123 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 33124 Instabilizing Effects}, 33125 journal = {International Journal of Solids and Structures}, 33126 volume = {7}, 33127 year = {1971}, 33128 pages = {345--372} 33129} 33130 33131@InCollection{ maier:inverse, 33132 author = {G. Maier}, 33133 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 33134 booktitle = {Serie VIII}, 33135 publisher = {Academia Nazionale dei Lincei}, 33136 year = {1981}, 33137 volume = {LXX}, 33138 pages = {203--209} 33139} 33140 33141@Article{ maier:matrix, 33142 author = {G. Maier}, 33143 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 33144 yield planes}, 33145 journal = {Meccanica}, 33146 volume = {5}, 33147 year = {1970}, 33148 pages = {54--66} 33149} 33150 33151@Article{ maier:quadratic, 33152 author = {G. Maier}, 33153 title = {A quadratic programming approach for certain classes of nonlinear structural 33154 problems}, 33155 journal = {Meccanica}, 33156 volume = {3}, 33157 year = {1968}, 33158 pages = {121--130} 33159} 33160 33161@Book{ manber:introduction, 33162 author = {U. Manber}, 33163 title = {Introduction to Algorithms: {A} Creative Approach}, 33164 year = {1989}, 33165 publisher = {Addison-Wesley} 33166} 33167 33168@Article{ mangasarian.deleone:error, 33169 author = {O. L. Mangasarian and R. {De~Leone}}, 33170 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 33171 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 33172 journal = {Applied Mathematics and Optimization}, 33173 year = {1988}, 33174 volume = {17}, 33175 pages = {1--14} 33176} 33177 33178@Article{ mangasarian.deleone:parallel, 33179 author = {O. L. Mangasarian and R. {De~Leone}}, 33180 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 33181 Problems and Linear Programs}, 33182 journal = {Journal of Optimization Theory and Applications}, 33183 year = {1987}, 33184 volume = {54}, 33185 pages = {437--446} 33186} 33187 33188@Article{ mangasarian.fromovitz:fritz, 33189 author = {O. L. Mangasarian and S. Fromovitz}, 33190 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 33191 and inequality constraints}, 33192 journal = {Journal of Mathematical Analysis and its Applications}, 33193 year = {1967}, 33194 volume = {17}, 33195 pages = {37--47} 33196} 33197 33198@Article{ mangasarian.mclinden:simple, 33199 author = {O. L. Mangasarian and L. McLinden}, 33200 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 33201 Programs}, 33202 journal = {Mathematical Programming}, 33203 year = {1985}, 33204 volume = {32}, 33205 pages = {32--40} 33206} 33207 33208@Article{ mangasarian.meyer:nonlinear, 33209 author = {O. L. Mangasarian and R. R. Meyer}, 33210 title = {Nonlinear Perturbation of Linear Programs}, 33211 journal = {SIAM Journal on Control and Optimization}, 33212 year = {1979}, 33213 volume = {17}, 33214 pages = {745--752} 33215} 33216 33217@TechReport{ mangasarian.musicant:active, 33218 author = {O. L. Mangasarian and David R. Musicant}, 33219 title = {Active Set Support Vector Machine Classification}, 33220 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33221 year = {2000}, 33222 number = {00-04}, 33223 address = {Madison, Wisconsin} 33224} 33225 33226@TechReport{ mangasarian.musicant:lagrangian, 33227 author = {O. L. Mangasarian and D. R. Musicant}, 33228 title = {Lagrangian Support Vector Machines}, 33229 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33230 year = {2000}, 33231 number = {00-06}, 33232 address = {Madison, Wisconsin} 33233} 33234 33235@TechReport{ mangasarian.musicant:robust, 33236 author = {O. L. Mangasarian and David R. Musicant}, 33237 title = {Robust Linear and Support Vector Regression}, 33238 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33239 year = {1999}, 33240 number = {99-09}, 33241 address = {Madison, Wisconsin} 33242} 33243 33244@Article{ mangasarian.musicant:successive, 33245 author = {O. L. Mangasarian and David R. Musicant}, 33246 title = {Successive Overrelaxation for Support Vector Machines}, 33247 journal = {IEEE Transactions on Neural Networks}, 33248 volume = {10}, 33249 year = {1999}, 33250 pages = {1032-1037} 33251} 33252 33253@Article{ mangasarian.pang:exact, 33254 author = {O. L. Mangasarian and J. S. Pang}, 33255 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 33256 Constraints}, 33257 journal = {Optimization}, 33258 year = {1997}, 33259 volume = {42}, 33260 pages = {1--8} 33261} 33262 33263@Article{ mangasarian.pang:extended, 33264 author = {O. L. Mangasarian and J. S. Pang}, 33265 title = {The Extended Linear Complementarity Problem}, 33266 journal = {SIAM Journal on Matrix Analysis and Applications}, 33267 year = {1994}, 33268 volume = {16} 33269} 33270 33271@Article{ mangasarian.ren:error, 33272 author = {O. L. Mangasarian and J. Ren}, 33273 title = {New error bounds for the nonlinear complementarity problem}, 33274 year = {1994}, 33275 volume = {1}, 33276 pages = {49--56}, 33277 journal = {Communications on Applied Nonlinear Analysis} 33278} 33279 33280@Article{ mangasarian.ren:improved, 33281 author = {O. L. Mangasarian and J. Ren}, 33282 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 33283 year = {1994}, 33284 volume = {66}, 33285 journal = {Mathematical Programming}, 33286 pages = {241--255} 33287} 33288 33289@InProceedings{ mangasarian.setiono.ea:pattern, 33290 crossref = {coleman.li:large-scale}, 33291 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 33292 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 33293 Diagnosis}, 33294 pages = {22--31} 33295} 33296 33297@Article{ mangasarian.shiau:error, 33298 author = {O. L. Mangasarian and T.--H. Shiau}, 33299 title = {Error Bounds for Monotone Linear Complementarity Problems}, 33300 journal = {Mathematical Programming}, 33301 year = {1986}, 33302 volume = {36}, 33303 pages = {81--89} 33304} 33305 33306@Article{ mangasarian.shiau:lipschitz, 33307 author = {O. L. Mangasarian and T.--H. Shiau}, 33308 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 33309 Complementarity Problems}, 33310 journal = {SIAM Journal on Control and Optimization}, 33311 year = {1987}, 33312 volume = {25}, 33313 pages = {583--595} 33314} 33315 33316@Article{ mangasarian.solodov:nonlinear, 33317 author = {O. L. Mangasarian and M. V. Solodov}, 33318 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 33319 journal = {Mathematical Programming}, 33320 year = {1993}, 33321 volume = {62}, 33322 pages = {277--298} 33323} 33324 33325@Article{ mangasarian.solodov:serial, 33326 author = {O. L. Mangasarian and M. V. Solodov}, 33327 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 33328 Minimization}, 33329 year = {1994}, 33330 journal = {Optimization Methods and Software}, 33331 volume = {4}, 33332 pages = {103--116} 33333} 33334 33335@Article{ mangasarian.street.ea:breast, 33336 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 33337 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 33338 journal = {Operations Research}, 33339 year = {1995}, 33340 volume = {43}, 33341 pages = {570--577} 33342} 33343 33344@Article{ mangasarian.wolberg:cancer, 33345 author = {O. L. Mangasarian and W. H. Wolberg}, 33346 title = {Cancer Diagnosis via Linear Programming}, 33347 journal = {SIAM News}, 33348 year = {1990}, 33349 volume = {23}, 33350 pages = {1 \& 18} 33351} 33352 33353@InCollection{ mangasarian:applications, 33354 author = {O. L. Mangasarian}, 33355 title = {Some Applications of Penalty Functions in Mathematical Programming}, 33356 booktitle = {Optimization and Related Fields}, 33357 year = {1986}, 33358 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 33359 publisher = {Springer-Verlag}, 33360 address = {Heidelberg}, 33361 pages = {307--329}, 33362 note = {Lecture Notes in Mathematics 1190} 33363} 33364 33365@Article{ mangasarian:characterization, 33366 author = {O. L. Mangasarian}, 33367 title = {Characterization of linear complementarity problems as linear programs}, 33368 journal = {Mathematical Programming Study}, 33369 year = {1978}, 33370 volume = {7}, 33371 pages = {74--87} 33372} 33373 33374@InProceedings{ mangasarian:condition, 33375 author = {O. L. Mangasarian}, 33376 title = {A condition number for linear inequalities and linear programs}, 33377 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 33378 1981}, 33379 year = {1981}, 33380 editor = {G. Bamberg and O. Opitz}, 33381 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 33382 address = {Konigstein}, 33383 pages = {3--15} 33384} 33385 33386@Article{ mangasarian:convergence, 33387 author = {O. L. Mangasarian}, 33388 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 33389 Symmetric Monotone Linear Complementarity Problem}, 33390 journal = {SIAM Journal on Optimization}, 33391 volume = {1}, 33392 pages = {114--122}, 33393 year = {1991} 33394} 33395 33396@Article{ mangasarian:equivalence, 33397 author = {O. L. Mangasarian}, 33398 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 33399 journal = {SIAM Journal on Applied Mathematics}, 33400 year = {1976}, 33401 volume = {31}, 33402 pages = {89--92} 33403} 33404 33405@Article{ mangasarian:error, 33406 author = {O. L. Mangasarian}, 33407 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 33408 journal = {ORSA Journal on Computing}, 33409 volume = {15}, 33410 pages = {187--192}, 33411 year = {1994} 33412} 33413 33414@Article{ mangasarian:error*1, 33415 author = {O. L. Mangasarian}, 33416 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 33417 journal = {Mathematical Programming}, 33418 year = {1990}, 33419 volume = {48}, 33420 pages = {437--445} 33421} 33422 33423@Article{ mangasarian:generalized, 33424 author = {O. L. Mangasarian}, 33425 title = {Generalized Linear Complementarity Problems as Linear Programs}, 33426 journal = {Methods of Operations Research}, 33427 year = {1979}, 33428 editor = {W. Oettli and F. Steffens}, 33429 volume = {31}, 33430 pages = {393--402} 33431} 33432 33433@InCollection{ mangasarian:generalized*1, 33434 author = {O. L. Mangasarian}, 33435 title = {Generalized Support Vector Machines}, 33436 year = {2000}, 33437 pages = {135-146}, 33438 booktitle = {Advances in Large Margin Classifiers}, 33439 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 33440 publisher = {MIT Press}, 33441 address = {Cambridge, MA} 33442} 33443 33444@Article{ mangasarian:global, 33445 author = {O. L. Mangasarian}, 33446 title = {Global error bounds for monotone affine variational inequality problems}, 33447 journal = {Linear Algebra and Its Applications}, 33448 year = {1992}, 33449 pages = {153--164} 33450} 33451 33452@InCollection{ mangasarian:least, 33453 author = {O. L. Mangasarian}, 33454 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 33455 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 33456 year = {1990}, 33457 publisher = {Oxford University Press}, 33458 address = {New York}, 33459 pages = {217--221} 33460} 33461 33462@Article{ mangasarian:least-norm, 33463 author = {O. L. Mangasarian}, 33464 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 33465 Problem}, 33466 journal = {Journal of Mathematical Analysis and Applications}, 33467 year = {1983}, 33468 volume = {92}, 33469 pages = {240--251} 33470} 33471 33472@Article{ mangasarian:linear, 33473 author = {O. L. Mangasarian}, 33474 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 33475 journal = {Mathematical Programming}, 33476 year = {1976}, 33477 volume = {10}, 33478 pages = {263--270} 33479} 33480 33481@Article{ mangasarian:linear*1, 33482 author = {O. L. Mangasarian}, 33483 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 33484 journal = {Operations Research}, 33485 year = {1965}, 33486 volume = {13}, 33487 pages = {444--452} 33488} 33489 33490@Article{ mangasarian:locally, 33491 author = {O. L. Mangasarian}, 33492 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 33493 Complementarity Problems}, 33494 journal = {Mathematical Programming}, 33495 year = {1980}, 33496 volume = {19}, 33497 pages = {200--212} 33498} 33499 33500@InCollection{ mangasarian:machine, 33501 author = {O. L. Mangasarian}, 33502 title = {Machine Learning via Polyhedral Concave Minimization}, 33503 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 33504 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 33505 pages = {175-188}, 33506 year = {1996}, 33507 address = {Heidelberg}, 33508 publisher = {Physica-Verlag A Springer-Verlag Company} 33509} 33510 33511@Article{ mangasarian:mathematical, 33512 author = {O. L. Mangasarian}, 33513 title = {Mathematical Programming in Neural Networks}, 33514 journal = {ORSA Journal on Computing}, 33515 volume = {5}, 33516 pages = {349--360}, 33517 year = {1993} 33518} 33519 33520@InProceedings{ mangasarian:mathematical*1, 33521 author = {O. L. Mangasarian}, 33522 title = {Mathematical Programming in Machine Learning}, 33523 booktitle = {Nonlinear Optimization and Applications}, 33524 editor = {G. Di Pillo and F. Giannessi}, 33525 publisher = {Plenum Publishing}, 33526 address = {New York}, 33527 pages = {283--295}, 33528 year = {1996} 33529} 33530 33531@Article{ mangasarian:mathematical*2, 33532 author = {O. L. Mangasarian}, 33533 title = {Mathematical Programming in Data Mining}, 33534 journal = {Data Mining and Knowledge Discovery}, 33535 volume = {1}, 33536 year = {1997}, 33537 pages = {183-201} 33538} 33539 33540@Article{ mangasarian:multi-surface, 33541 author = {O. L. Mangasarian}, 33542 title = {Multi-surface Method of Pattern Separation}, 33543 journal = {IEEE Transactions on Information Theory}, 33544 year = {1968}, 33545 volume = {IT-14}, 33546 pages = {801--807} 33547} 33548 33549@Book{ mangasarian:nonlinear, 33550 author = {O. L. Mangasarian}, 33551 title = {Nonlinear Programming}, 33552 year = {1969}, 33553 publisher = {McGraw--Hill}, 33554 address = {New York}, 33555 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 33556} 33557 33558@Article{ mangasarian:normal, 33559 author = {O. L. Mangasarian}, 33560 title = {Normal Solutions of Linear Programs}, 33561 journal = {Mathematical Programming Study}, 33562 year = {1984}, 33563 volume = {22}, 33564 pages = {206--216} 33565} 33566 33567@Article{ mangasarian:optimal, 33568 author = {O. L. Mangasarian}, 33569 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 33570 Linear Programs}, 33571 journal = {Journal of Optimization Theory and Applications}, 33572 year = {1981}, 33573 volume = {35}, 33574 pages = {123--128} 33575} 33576 33577@Article{ mangasarian:parallel, 33578 author = {O. L. Mangasarian}, 33579 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 33580 journal = {SIAM Journal on Control and Optimization}, 33581 volume = {33}, 33582 pages = {1916--1925}, 33583 year = {1995} 33584} 33585 33586@TechReport{ mangasarian:regularized, 33587 author = {O. L. Mangasarian}, 33588 title = {Regularized Linear Programs with Equilibrium Constraints}, 33589 institution = {Computer Sciences Department, University of Wisconsin}, 33590 year = {1997}, 33591 address = {Madison, Wisconsin}, 33592 type = {Mathematical Programming Technical Report}, 33593 number = {97--13}, 33594 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 33595} 33596 33597@Article{ mangasarian:simple, 33598 author = {O. L. Mangasarian}, 33599 title = {A Simple Characterization of Solution Sets of Convex Programs}, 33600 journal = {Operations Research Letters}, 33601 year = {1988}, 33602 volume = {7}, 33603 pages = {21--26} 33604} 33605 33606@Article{ mangasarian:solution, 33607 author = {O. L. Mangasarian}, 33608 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 33609 journal = {Journal of Optimization Theory and Applications}, 33610 year = {1977}, 33611 month = aug, 33612 volume = {22}, 33613 pages = {465--485} 33614} 33615 33616@Article{ mangasarian:stable, 33617 author = {O. L. Mangasarian}, 33618 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 33619 journal = {Linear Algebra and Its Applications}, 33620 year = {1981}, 33621 volume = {41}, 33622 pages = {209--223} 33623} 33624 33625@Article{ mangasarian:sufficiency, 33626 author = {O. L. Mangasarian}, 33627 title = {Sufficiency of Exact Penalty Minimization}, 33628 journal = {SIAM Journal on Control and Optimization}, 33629 year = {1985}, 33630 month = jan, 33631 volume = {23}, 33632 pages = {30--37} 33633} 33634 33635@Article{ mangasarian:unconstrained, 33636 author = {O. L. Mangasarian}, 33637 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 33638 journal = {SIAM Journal on Control and Optimization}, 33639 year = {1975}, 33640 volume = {13}, 33641 pages = {772--791} 33642} 33643 33644@Book{ manne.richels:buying, 33645 author = {A. S. Manne and R. G. Richels}, 33646 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 33647 publisher = {MIT Press}, 33648 year = {1992}, 33649 address = {Cambridge MA} 33650} 33651 33652@Article{ manne.richels:global, 33653 author = {A. S. Manne and R. G. Richels}, 33654 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 33655 journal = {The Energy Journal}, 33656 year = {1991}, 33657 volume = {12}, 33658 pages = {87--107} 33659} 33660 33661@Article{ manne.richels:international, 33662 author = {A. S. Manne and R. G. Richels}, 33663 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 33664 journal = {Economic Review}, 33665 year = {1991}, 33666 volume = {81}, 33667 pages = {135--139} 33668} 33669 33670@Article{ manne.rutherford:international, 33671 author = {A. S. Manne and T. F. Rutherford}, 33672 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 33673 General Equilibrium Model}, 33674 journal = {The Energy Journal}, 33675 year = {1993}, 33676 volume = {14}, 33677 pages = {1--20} 33678} 33679 33680@InCollection{ manne:eta-macro, 33681 author = {A. S. Manne}, 33682 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 33683 booktitle = {Modeling Energy-Economy Interactions}, 33684 year = {1977}, 33685 editor = {C. J. Hitch}, 33686 publisher = {Resources for the Future}, 33687 address = {Washington DC} 33688} 33689 33690@PhDThesis{ maratos:exact, 33691 author = {N. Maratos}, 33692 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 33693 Problems}, 33694 year = {1978}, 33695 school = {Imperial College, University of London} 33696} 33697 33698@Article{ marcotte.dussault:note, 33699 author = {P. Marcotte and J.--P. Dussault}, 33700 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 33701 Inequalities}, 33702 journal = {Operations Research Letters}, 33703 year = {1987}, 33704 volume = {6}, 33705 pages = {35--42} 33706} 33707 33708@Article{ marcotte.zhu:exact, 33709 author = {P. Marcotte and D. L. Zhu}, 33710 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 33711 Problem}, 33712 journal = {Mathematical Programming}, 33713 year = {1996}, 33714 volume = {74}, 33715 pages = {141--158} 33716} 33717 33718@Article{ marcotte:algorithm, 33719 author = {P. Marcotte}, 33720 title = {A New Algorithm for Solving Variational Inequalities with Application to the 33721 Traffic Assignment Problem}, 33722 journal = {Mathematical Programming}, 33723 year = {1985}, 33724 volume = {33}, 33725 pages = {339--351} 33726} 33727 33728@Article{ marcotte:application, 33729 author = {P. Marcotte}, 33730 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 33731 Equilibrium Problems}, 33732 journal = {Information Systems and Operational Research}, 33733 year = {1991}, 33734 volume = {29}, 33735 pages = {258--270} 33736} 33737 33738@Article{ marcotte:network, 33739 author = {P. Marcotte}, 33740 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 33741 journal = {Mathematical Programming}, 33742 year = {1986}, 33743 volume = {34}, 33744 pages = {142--162} 33745} 33746 33747@Article{ markusen.rutherford.ea:el, 33748 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33749 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 33750 journal = {Cuadernos Economicos de Ice}, 33751 year = {1995}, 33752 volume = {59}, 33753 pages = {57--68} 33754} 33755 33756@Article{ markusen.rutherford.ea:trade, 33757 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33758 title = {Trade liberalization in a multinational-dominated industry}, 33759 journal = {Journal of International Economics}, 33760 year = {1995}, 33761 volume = {38}, 33762 pages = {95--118} 33763} 33764 33765@Article{ markusen.rutherford:discrete, 33766 author = {J. R. Markusen and T. F. Rutherford}, 33767 title = {Discrete plant-location decisions in an applied general equilibrium model of 33768 trade liberalization}, 33769 journal = {Weltwirtshchaftliches Archiv}, 33770 year = {1994} 33771} 33772 33773@Article{ markusen.wigle:nash, 33774 author = {J. Markusen and R. Wigle}, 33775 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 33776 Country Size, Scale Economies and Capital Mobility}, 33777 journal = {Journal of Political Mobility}, 33778 year = {1989}, 33779 volume = {97}, 33780 pages = {368--386} 33781} 33782 33783@Article{ marquardt:algorithm, 33784 author = {D. W. Marquardt}, 33785 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 33786 journal = {SIAM Journal on Applied Mathematics}, 33787 year = {1963}, 33788 volume = {11}, 33789 pages = {431--441} 33790} 33791 33792@Article{ martello.toth:algorithm, 33793 author = {S. Martello and P. Toth}, 33794 title = {A New Algorithm for the 0--1 Knapsack Problem}, 33795 journal = {Management Science}, 33796 year = {1988}, 33797 volume = {34}, 33798 pages = {633--644} 33799} 33800 33801@InCollection{ martello.toth:algorithms, 33802 author = {S. Martello and P. Toth}, 33803 title = {Algorithms for Knapsack Problems}, 33804 booktitle = {Surveys in Combinatorial Optimization}, 33805 year = {1987}, 33806 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 33807 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 33808 address = {Amsterdam} 33809} 33810 33811@Article{ martello.toth:mixture, 33812 author = {S. Martello and P. Toth}, 33813 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 33814 Problem}, 33815 journal = {Management Science}, 33816 year = {1984}, 33817 volume = {30}, 33818 pages = {765--771} 33819} 33820 33821@Article{ martello.toth:worst-case, 33822 author = {S. Martello and P. Toth}, 33823 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 33824 journal = {Mathematical Programming}, 33825 year = {1984}, 33826 volume = {28}, 33827 pages = {198--205} 33828} 33829 33830@Article{ martinet:regularisation, 33831 author = {Bernard Martinet}, 33832 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 33833 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 33834 year = {1970}, 33835 volume = {4}, 33836 pages = {154--159} 33837} 33838 33839@Article{ maskin.tirole:theory, 33840 author = {E. Maskin and J. Tirole}, 33841 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 33842 fixed costs}, 33843 journal = {Econometrica}, 33844 volume = {56}, 33845 year = {1988}, 33846 pages = {549--569} 33847} 33848 33849@Article{ maskin.tirole:theory*1, 33850 author = {E. Maskin and J. Tirole}, 33851 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 33852 Edgeworth cycles}, 33853 journal = {Econometrica}, 33854 volume = {56}, 33855 year = {1988}, 33856 pages = {571--579} 33857} 33858 33859@Article{ maskus.rutherford.ea:economic, 33860 author = {K. Maskus and T. F. Rutherford and S. Selby}, 33861 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 33862 {M}exico}, 33863 journal = {North American Journal of Economics and Finance}, 33864 year = {1996} 33865} 33866 33867@Article{ mastor:experimental, 33868 author = {A. A. Mastor}, 33869 title = {An Experimental Investigation and Comparative Evaluation of Production Line 33870 Balancing Techniques}, 33871 journal = {Management Science}, 33872 year = {1970}, 33873 volume = {16}, 33874 pages = {728--746} 33875} 33876 33877@Article{ mathias.pang:error, 33878 author = {R. Mathias and J. S. Pang}, 33879 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 33880 journal = {Linear Algebra and Its Applications}, 33881 year = {1990}, 33882 volume = {132}, 33883 pages = {123--136} 33884} 33885 33886@Article{ mathiesen:algorithm, 33887 author = {L. Mathiesen}, 33888 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 33889 {W}alrasian Equilibrium Model: An Example}, 33890 journal = {Mathematical Programming}, 33891 year = {1987}, 33892 volume = {37}, 33893 pages = {1--18} 33894} 33895 33896@Article{ mathiesen:computation, 33897 author = {L. Mathiesen}, 33898 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 33899 Problems}, 33900 journal = {Mathematical Programming Study}, 33901 year = {1985}, 33902 volume = {23}, 33903 pages = {144--162} 33904} 33905 33906@Article{ mathiesen:computational, 33907 author = {L. Mathiesen}, 33908 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 33909 Complementarity Problems}, 33910 journal = {Operations Research}, 33911 year = {1985}, 33912 volume = {33}, 33913 pages = {1225--1250} 33914} 33915 33916@Book{ matlab:users, 33917 author = {{MATLAB}}, 33918 title = {User's Guide}, 33919 year = {1992}, 33920 publisher = {The MathWorks, Inc.} 33921} 33922 33923@Book{ mcclelland.rummelhart:explorations, 33924 author = {J. L. McClelland and D. E. Rummelhart}, 33925 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 33926 Programs, and Exercises}, 33927 year = {1987}, 33928 publisher = {MIT Press}, 33929 address = {Cambridge, Massachusetts} 33930} 33931 33932@Article{ mccormick:modification, 33933 author = {G. P. McCormick}, 33934 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 33935 journal = {Mathematical Programming}, 33936 year = {1977}, 33937 volume = {13}, 33938 pages = {111--115} 33939} 33940 33941@Book{ mccormick:nonlinear, 33942 author = {G. P. McCormick}, 33943 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 33944 year = {1983}, 33945 publisher = {John Wiley \& Sons}, 33946 address = {New York} 33947} 33948 33949@Article{ mcculloch.pitts:logical, 33950 author = {W. McCulloch and W. Pitts}, 33951 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 33952 journal = {Bulletin of Mathematical Biophysics}, 33953 year = {1943}, 33954 volume = {7}, 33955 pages = {115--133} 33956} 33957 33958@TechReport{ mckenna.zenios:optimal, 33959 author = {M. McKenna and S. A. Zenios}, 33960 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 33961 institution = {Thinking Machines Corporation}, 33962 year = {1990}, 33963 type = {Working Paper}, 33964 address = {Cambridge, MA} 33965} 33966 33967@Article{ mckinnon:convergence, 33968 author = {K. I. M. McKinnon}, 33969 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 33970 journal = {SIAM Journal on Optimization}, 33971 year = {1998}, 33972 volume = {9}, 33973 pages = {148--158} 33974} 33975 33976@Article{ mcshane.monma.ea:implementation, 33977 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 33978 title = {An implementation of a primal-dual interior point method for linear programming}, 33979 journal = {ORSA Journal of Computing}, 33980 year = {1989}, 33981 volume = {1}, 33982 pages = {70--83} 33983} 33984 33985@PhDThesis{ medhi:decomposition, 33986 author = {D. Medhi}, 33987 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 33988 Optimization}, 33989 school = {Computer Sciences Department, University of Wisconsin}, 33990 year = {1987}, 33991 address = {Madison, Wisconsin}, 33992 note = {Technical Report 718} 33993} 33994 33995@Article{ medhi:parallel, 33996 author = {D. Medhi}, 33997 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 33998 Programming Problems}, 33999 journal = {Annals of Operations Research}, 34000 year = {1990}, 34001 volume = {22}, 34002 pages = {101--127} 34003} 34004 34005@Article{ megiddo:complexity, 34006 author = {N. Megiddo}, 34007 title = {On the complexity of polyhedral separability}, 34008 journal = {Discrete and Computational Geometry}, 34009 year = {1988}, 34010 volume = {3}, 34011 pages = {325--337} 34012} 34013 34014@Article{ megiddo:finding, 34015 author = {N. Megiddo}, 34016 title = {On Finding Primal-- and Dual--Optimal Bases}, 34017 journal = {ORSA Journal on Computing}, 34018 year = {1991}, 34019 volume = {3}, 34020 pages = {63--65} 34021} 34022 34023@Article{ mehrotra:implementation, 34024 author = {S. Mehrotra}, 34025 title = {On the implementation of a primal-dual interior point method}, 34026 journal = {SIAM Journal on Optimization}, 34027 year = {1992}, 34028 volume = {2}, 34029 pages = {575--601} 34030} 34031 34032@PhDThesis{ merrill:applications, 34033 author = {O. H. Merrill}, 34034 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 34035 Semicontinuous Point to Set Mappings}, 34036 year = {1972}, 34037 school = {University of Michigan} 34038} 34039 34040@Article{ merten.muller:variance, 34041 author = {A. G. Merten and M. E. Muller}, 34042 title = {Variance Minimization in Single Machine Sequencing Problems}, 34043 journal = {Management Science}, 34044 year = {1972}, 34045 volume = {18}, 34046 pages = {518--528} 34047} 34048 34049@TechReport{ meyer:continuity, 34050 author = {R. R. Meyer}, 34051 title = {Continuity Properties of Linear Programs}, 34052 institution = {Computer Sciences Department, University of Wisconsin}, 34053 year = {1979}, 34054 address = {Madison, Wisconsin}, 34055 number = {373} 34056} 34057 34058@Article{ miersemann.mittelmann:continuation, 34059 author = {E. Miersemann and H. D. Mittelmann}, 34060 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 34061 journal = {Journal of Computational and Applied Mathematics}, 34062 year = {1989}, 34063 volume = {26}, 34064 pages = {23--34} 34065} 34066 34067@Article{ mifflin:semismooth, 34068 author = {R. Mifflin}, 34069 title = {Semismooth and semiconvex functions in constrained optimization}, 34070 journal = {SIAM Journal on Control and Optimization}, 34071 year = {1977}, 34072 volume = {15}, 34073 pages = {957--972} 34074} 34075 34076@Article{ mifflin:stable, 34077 author = {R. Mifflin}, 34078 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 34079 journal = {Mathematical Programming}, 34080 vol = {16}, 34081 pages = {141--158}, 34082 year = {1979} 34083} 34084 34085@Book{ miller:survival, 34086 author = {Jr. R. G. Miller}, 34087 title = {Survival Analysis}, 34088 year = {1981}, 34089 publisher = {John Wiley \& Sons}, 34090 address = {New York} 34091} 34092 34093@Book{ minsky.papert:perceptrons, 34094 author = {M. Minsky and S. Papert}, 34095 title = {Perceptrons: An Introduction to Computational Geometry}, 34096 year = {1969}, 34097 publisher = {MIT Press}, 34098 address = {Cambridge, Massachusetts} 34099} 34100 34101@Article{ minty:monotone, 34102 author = {G. J. Minty}, 34103 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 34104 journal = {Duke Mathematics Journal}, 34105 year = {1962}, 34106 volume = {29}, 34107 pages = {341--346} 34108} 34109 34110@Article{ minty:monotonicity, 34111 author = {G. J. Minty}, 34112 title = {On the Monotonicity of the Gradient of a Convex Function}, 34113 journal = {Pacific Journal of Mathematics}, 34114 year = {1964}, 34115 volume = {14}, 34116 pages = {243--247} 34117} 34118 34119@TechReport{ mizuno.jarre.ea:unified, 34120 author = {S. Mizuno and F. Jarre and J. Stoer}, 34121 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 34122 linear complementarity problems}, 34123 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 34124 address = {W{\"{u}}rzburg, Germany}, 34125 year = {1994}, 34126 number = {Nr. 213}, 34127 type = {Preprint} 34128} 34129 34130@TechReport{ mizuno:polynomiality, 34131 author = {S. Mizuno}, 34132 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 34133 for linear programming}, 34134 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 34135 year = {1993}, 34136 number = {1006}, 34137 address = {Ithaca, New York}, 34138 month = jan 34139} 34140 34141@Article{ mohan.mageras.ea:clinically, 34142 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 34143 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 34144 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 34145 journal = {Medical Physics}, 34146 year = {1992}, 34147 volume = {19}, 34148 number = {4}, 34149 pages = {933--944} 34150} 34151 34152@Article{ mohan:field, 34153 author = {R. Mohan}, 34154 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 34155 Collimation}, 34156 journal = {Seminars in Radiation Oncology}, 34157 year = {1995}, 34158 volume = {5}, 34159 number = {2}, 34160 pages = {86--99} 34161} 34162 34163@Article{ monteiro.pang.ea:positive, 34164 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 34165 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 34166 journal = {SIAM Journal on Optimization}, 34167 year = {1995}, 34168 volume = {5}, 34169 pages = {129--148} 34170} 34171 34172@Article{ monteiro.tsuchiya:limiting, 34173 author = {R. D. C. Monteiro and T. Tsuchiya}, 34174 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 34175 Monotone Horizontal Linear Complementarity Problem}, 34176 year = {1996}, 34177 journal = {Mathematics of Operations Research}, 34178 pages = {793--814}, 34179 volume = {21} 34180} 34181 34182@Article{ monteiro.wright:local, 34183 author = {R. D. C. Monteiro and S. J. Wright}, 34184 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 34185 journal = {Computational Optimization and Applications}, 34186 year = {1994}, 34187 volume = {3}, 34188 pages = {131--155} 34189} 34190 34191@Article{ monteiro.wright:superlinear, 34192 author = {R. D. C. Monteiro and S. J. Wright}, 34193 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 34194 year = {1996}, 34195 journal = {SIAM Journal on Optimization}, 34196 volume = {6}, 34197 pages = {1--18} 34198} 34199 34200@Article{ monteiro.wright:superlinear*1, 34201 author = {R. D. C. Monteiro and S. J. Wright}, 34202 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 34203 journal = {Mathematical Programming}, 34204 year = {1995}, 34205 volume = {69}, 34206 pages = {311--333} 34207} 34208 34209@Article{ more.garbow.ea:testing, 34210 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 34211 title = {Testing Unconstrained Optimization Software}, 34212 journal = {ACM Transactions on Mathematical Software}, 34213 year = {1981}, 34214 volume = {7}, 34215 pages = {17--41} 34216} 34217 34218@Article{ more.rheinboldt:p, 34219 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 34220 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 34221 Mappings}, 34222 journal = {Linear Algebra and Its Applications}, 34223 year = {1973}, 34224 volume = {6}, 34225 pages = {45--68} 34226} 34227 34228@Article{ more.sorensen:use, 34229 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34230 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 34231 journal = {Mathematical Programming}, 34232 year = {1979}, 34233 volume = {16}, 34234 pages = {1--20} 34235} 34236 34237@Article{ more.sorensen:computing, 34238 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34239 title = {Computing a Trust Region Step}, 34240 journal = {SIAM Journal on Scientific and Statistical Computing}, 34241 year = {1983}, 34242 volume = {4}, 34243 pages = {553--572} 34244} 34245 34246@Article{ more.toraldo:solution, 34247 author = {J. J. Mor\'e and G. Toraldo}, 34248 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 34249 journal = {SIAM Journal on Optimization}, 34250 year = {1991}, 34251 volume = {1}, 34252 pages = {93--113} 34253} 34254 34255@TechReport{ more.vavasis:solution, 34256 author = {J. J. Mor\'{e} and S. A. Vavasis}, 34257 title = {On the Solution of Concave Knapsack Problems}, 34258 institution = {Argonne National Laboratory}, 34259 year = {1988}, 34260 address = {Argonne, Illinois}, 34261 number = {ANL/MCS--P40--1288}, 34262 type = {Mathematics and Computer Science Division Report} 34263} 34264 34265@Book{ more.wright:optimization, 34266 author = {J. J. Mor\'{e} and S. J. Wright}, 34267 title = {Optimization Software Guide}, 34268 publisher = {SIAM}, 34269 address = {Philadelphia, Pennsylvania}, 34270 series = {Frontiers in Applied Mathematics}, 34271 number = {14}, 34272 year = {1993} 34273} 34274 34275@TechReport{ more.wu:global, 34276 author = {J. J. Mor\'{e} and Z. Wu}, 34277 title = {Global Continuation for Distance Geometry Problems}, 34278 institution = {Argonne National Laboratory}, 34279 year = {1995}, 34280 type = {Preprint}, 34281 number = {MCS-P505-0395}, 34282 address = {Argonne, Illinois} 34283} 34284 34285@TechReport{ more.wu:issues, 34286 author = {J. J. Mor\'{e} and Z. Wu}, 34287 title = {Issues in Large-Scale Global Molecular Optimization}, 34288 institution = {Argonne National Laboratory}, 34289 year = {1995}, 34290 type = {Preprint}, 34291 number = {MCS-P539-1095}, 34292 address = {Argonne, Illinois} 34293} 34294 34295@TechReport{ more:collection, 34296 author = {J. J. Mor\'e}, 34297 title = {A Collection of Nonlinear Model Problems}, 34298 institution = {Argonne National Laboratory}, 34299 year = {1989}, 34300 type = {Preprint}, 34301 address = {Argonne, Illinois}, 34302 number = {MCS-P60-0289} 34303} 34304 34305@Article{ more:global, 34306 author = {J. J. Mor\'e}, 34307 title = {Global Methods for Nonlinear Complementarity Problems}, 34308 year = {1996}, 34309 journal = {Mathematics of Operations Research}, 34310 pages = {589--614}, 34311 volume = {21} 34312} 34313 34314@Article{ moreau:proximite, 34315 author = {J.--J. Moreau}, 34316 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 34317 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 34318 year = {1965}, 34319 volume = {93}, 34320 pages = {273--299} 34321} 34322 34323@Article{ morrill.lane.ea:dose-volume, 34324 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 34325 title = {Dose-volume considerations with linear programming}, 34326 journal = {Medical Physics}, 34327 year = {1991}, 34328 volume = {18}, 34329 number = {6}, 34330 pages = {1201--1210} 34331} 34332 34333@Article{ morrill:very, 34334 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 34335 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 34336 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34337 year = {1995}, 34338 volume = {31}, 34339 pages = {179--188} 34340} 34341 34342@TechReport{ morshedi.tapia:karmarkar, 34343 author = {A. M. Morshedi and R. A. Tapia}, 34344 title = {Karmarkar as a Classical Method}, 34345 institution = {Department of Mathematical Sciences, Rice University}, 34346 year = {1987}, 34347 number = {87--7}, 34348 type = {Technical Report} 34349} 34350 34351@Article{ mosco:dual, 34352 author = {U. Mosco}, 34353 title = {Dual Variational Inequalities}, 34354 journal = {Journal of Mathematical Analysis and its Applications}, 34355 year = {1972}, 34356 volume = {40}, 34357 pages = {202--206} 34358} 34359 34360@Article{ motzkin.schoenberg:relaxation, 34361 author = {T. S. Motzkin and I. J. Schoenberg}, 34362 title = {The relaxation method for linear inequalities}, 34363 journal = {Canadian Journal of Mathematics}, 34364 year = {1954}, 34365 volume = {6}, 34366 pages = {393--404} 34367} 34368 34369@InProceedings{ muhlenbein:parallel, 34370 crossref = {schaeffer:third}, 34371 author = {H. M{\"{}u}hlenbein}, 34372 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 34373 pages = {416--421} 34374} 34375 34376@Article{ mukhopadhyay.roy.ea:polynomial, 34377 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 34378 title = {A polynomial time algorithm for generating neural networks for pattern 34379 classification: Its stability properties and some test results}, 34380 journal = {Neural Computation}, 34381 year = {1993}, 34382 volume = {5}, 34383 pages = {317--330} 34384} 34385 34386@Article{ mulvey.ruszczynski:diagonal, 34387 author = {J. M. Mulvey and A. Ruszczynski}, 34388 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 34389 journal = {Operations Research Letters}, 34390 year = {1992}, 34391 volume = {12}, 34392 pages = {205--215} 34393} 34394 34395@TechReport{ mulvey.ruszczynski:scenario, 34396 author = {J. M. Mulvey and A. Ruszczynski}, 34397 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 34398 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 34399 year = {1991}, 34400 address = {Princeton, New Jersey}, 34401 number = {SOR 91-19}, 34402 type = {Technical Report} 34403} 34404 34405@PhDThesis{ munson:algorithms, 34406 author = {T. S. Munson}, 34407 title = {Algorithms and Environments for Complementarity}, 34408 school = {University of Wisconsin--Madison}, 34409 year = {2000}, 34410 address = {Madison, Wisconsin}, 34411 month = aug, 34412 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 34413} 34414 34415@Article{ munson.facchinei.ea:semismooth, 34416 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 34417 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 34418 journal = {INFORMS Journal on Computing}, 34419 year = {2001}, 34420 volume = {forthcoming} 34421} 34422 34423@Article{ murchland:braess, 34424 author = {J. D. Murchland}, 34425 title = {Braess' Paradox of Traffic Flow}, 34426 journal = {Transportation Research}, 34427 year = {1970}, 34428 volume = {4}, 34429 pages = {391--394} 34430} 34431 34432@Unpublished{ murphy.aha:uci, 34433 author = {P. M. Murphy and D. W. Aha}, 34434 title = {{UCI} Repository of Machine Learning Databases}, 34435 year = {1992}, 34436 note = {Department of Information and Computer Science, University of California, Irvine, 34437 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 34438} 34439 34440@Book{ murphy.lawrence.ea:american, 34441 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 34442 title = {American Cancer Society Textbook of Clinical Oncology}, 34443 publisher = {The American Cancer Society, Inc.}, 34444 address = {Atlanta, Georgia}, 34445 year = {1995} 34446} 34447 34448@Article{ murphy.sherali.ea:mathematical, 34449 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 34450 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 34451 Equilibrium}, 34452 journal = {Mathematical Programming}, 34453 year = {1982}, 34454 volume = {24}, 34455 pages = {92--106} 34456} 34457 34458@TechReport{ murtagh.saunders:minos, 34459 author = {B. A. Murtagh and M. A. Saunders}, 34460 title = {{MINOS} 5.0 User's Guide}, 34461 institution = {Stanford University}, 34462 address = {Stanford, California}, 34463 year = {1983}, 34464 number = {{SOL} 83.20}, 34465 type = {Technical Report} 34466} 34467 34468@InProceedings{ murthy.kasif.ea:oc1, 34469 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 34470 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 34471 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 34472 year = {1993}, 34473 publisher = {The AAAI Press/The MIT Press}, 34474 address = {Cambridge, MA 02142}, 34475 pages = {322--327} 34476} 34477 34478@Book{ murty:linear, 34479 author = {K. G. Murty}, 34480 title = {Linear Complementarity, Linear and Nonlinear Programming}, 34481 year = {1988}, 34482 publisher = {Helderman-Verlag}, 34483 address = {Berlin} 34484} 34485 34486@Book{ murty:linear*1, 34487 author = {K. G. Murty}, 34488 title = {Linear Programming}, 34489 year = {1983}, 34490 publisher = {John Wiley \& Sons}, 34491 address = {New York} 34492} 34493 34494@Article{ murty:number, 34495 author = {K. G. Murty}, 34496 title = {On the number of solutions of the complementarity problem and spanning properties 34497 of cones}, 34498 journal = {Linear Algebra and Its Applications}, 34499 year = {1972}, 34500 volume = {5}, 34501 pages = {65--108} 34502} 34503 34504@Book{ murty:linear*2, 34505 author = {K. G. Murty}, 34506 title = {Linear and Combinatorial Programming}, 34507 year = {1976}, 34508 publisher = {John Wiley \& Sons}, 34509 address = {New York} 34510} 34511 34512@Book{ nagurney:network, 34513 author = {A. Nagurney}, 34514 title = {Network Economics -- {A} Variational Inequality Approach}, 34515 publisher = {Kluwer Academic Publishers}, 34516 year = {1993}, 34517 address = {Dordrecht, The Netherlands} 34518} 34519 34520@Article{ nash.nocedal:numerical, 34521 author = {S. G. Nash and J. Nocedal}, 34522 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 34523 Method for Large Scale Optimization}, 34524 journal = {SIAM Journal on Optimization}, 34525 year = {1991}, 34526 volume = {3}, 34527 pages = {358--372} 34528} 34529 34530@Article{ nash:equilibrium, 34531 author = {J. F. Nash}, 34532 title = {Equilibrium Points in {N}--Person Games}, 34533 journal = {Proceedings of the National Academy of Sciences}, 34534 year = {1950}, 34535 volume = {36}, 34536 pages = {48--49} 34537} 34538 34539@Article{ nash:non-cooperative, 34540 author = {J. F. Nash}, 34541 title = {Non-cooperative games}, 34542 journal = {Annals of Mathematics}, 34543 year = {1951}, 34544 volume = {54}, 34545 pages = {286--295} 34546} 34547 34548@Article{ nash:newton-type, 34549 author = {S. G. Nash}, 34550 title = {{N}ewton--Type Minimization via {L}anczos Method}, 34551 journal = {SIAM Journal on Numerical Analysis}, 34552 year = {1984}, 34553 volume = {21}, 34554 pages = {770--788} 34555} 34556 34557@Article{ nauss:efficient, 34558 author = {R. M. Nauss}, 34559 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 34560 journal = {Management Science}, 34561 year = {1976}, 34562 volume = {23}, 34563 pages = {27--31} 34564} 34565 34566@Book{ nazareth:computer, 34567 author = {J. L. Nazareth}, 34568 title = {Computer Solution of Linear Programs}, 34569 year = {1987}, 34570 publisher = {Oxford University Press}, 34571 address = {Oxford} 34572} 34573 34574@Article{ nelder.mead:simplex, 34575 title = {A Simplex Method for Function Minimization}, 34576 author = {J. A. Nelder and R. Mead}, 34577 journal = {Computer Journal}, 34578 volume = {7}, 34579 pages = {308--313}, 34580 year = {1965} 34581} 34582 34583@Article{ nemhauser.savelsbergh.ea:minto, 34584 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 34585 title = {{MINTO}, {A} Mixed Integer Optimizer}, 34586 journal = {Operations Research Letters}, 34587 year = {1994}, 34588 optkey = {}, 34589 optvolume = {15}, 34590 optnumber = {}, 34591 optpages = {47--58}, 34592 optmonth = {}, 34593 optnote = {}, 34594 optannote = {} 34595} 34596 34597@Book{ nemhauser.wolsey:integer, 34598 author = {G. L. Nemhauser and L. A. Wolsey}, 34599 title = {Integer and Combinatorial Optimization}, 34600 publisher = {John Wiley \& Sons}, 34601 year = {1988}, 34602 address = {New York, NY} 34603} 34604 34605@Article{ nestor.pasurka:alternative, 34606 author = {D. Vaughn Nestor and C. Pasurka}, 34607 title = {Alternative Specifications for Environmental Control Costs in a General 34608 Equilibrium Framework}, 34609 journal = {Economics Letters}, 34610 year = {1995}, 34611 volume = {48}, 34612 pages = {273--280} 34613} 34614 34615@Article{ nestor.pasurka:cge, 34616 author = {D. Vaughn Nestor and C. Pasurka}, 34617 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 34618 of Environmental Policy}, 34619 journal = {Economic Modelling}, 34620 year = {1995}, 34621 volume = {12}, 34622 pages = {53--59} 34623} 34624 34625@Article{ newman.shapiro:theorems, 34626 author = {D. J. Newman and H. S. Shapiro}, 34627 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 34628 journal = {Duke Mathematical Journal}, 34629 year = {1963}, 34630 volume = {30}, 34631 pages = {673--682} 34632} 34633 34634@Article{ ng.peyton:block, 34635 author = {E. Ng and B. Peyton}, 34636 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 34637 journal = {SIAM Journal on Scientific and Statistical Computing}, 34638 year = {1993}, 34639 volume = {14}, 34640 pages = {1034--1056} 34641} 34642 34643@TechReport{ nielsen.zenios:solving, 34644 author = {S. S. Nielsen and S. A. Zenios}, 34645 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 34646 Algorithms}, 34647 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 34648 year = {1992}, 34649 address = {Philadelphia}, 34650 number = {92-01-05} 34651} 34652 34653@Article{ niemierko:optimization, 34654 author = {A. Niemierko}, 34655 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 34656 Points and Constraints}, 34657 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34658 year = {1992}, 34659 volume = {23}, 34660 pages = {99--108} 34661} 34662 34663@InCollection{ niemierko:treatment, 34664 author = {A. Niemierko}, 34665 title = {Treatment Plan Optimization}, 34666 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 34667 editor = {J. A. Purdy and B. Emami}, 34668 publisher = {Medical Physics Publishing}, 34669 year = {1993}, 34670 pages = {49--55}, 34671 address = {St. Louis, Missouri} 34672} 34673 34674@Article{ niemireko:optimization, 34675 author = {A. Niemierko}, 34676 title = {Optimization of intensity modulated beams: Local or global optimum?}, 34677 journal = {Medical Physics}, 34678 year = {1996}, 34679 optvolume = {23}, 34680 optpages = {1072} 34681} 34682 34683@Manual{ nih:radiation, 34684 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 34685 author = {N. C. I. National Institutes of Health}, 34686 organization = {NIH Publication}, 34687 address = {Bethesda, Maryland}, 34688 edition = {97-2227}, 34689 year = {1997} 34690} 34691 34692@Book{ nilsson:learning, 34693 author = {N. J. Nilsson}, 34694 title = {Learning Machines}, 34695 year = {1966}, 34696 publisher = {MIT Press}, 34697 address = {Cambridge, Massachusetts} 34698} 34699 34700@Article{ nocedal:theory, 34701 author = {J. Nocedal}, 34702 title = {Theory of Algorithms for Unconstrained Optimization}, 34703 journal = {Acta Numerica}, 34704 year = {1992}, 34705 pages = {199--242} 34706} 34707 34708@InProceedings{ noyes:neural, 34709 author = {J. L. Noyes}, 34710 title = {Neural Network Optimization Methods}, 34711 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 34712 Processing}, 34713 year = {1991}, 34714 publisher = {Indiana-Purdue University}, 34715 address = {Fort Wayne, Indiana}, 34716 pages = {1--12} 34717} 34718 34719@Article{ nygard.juell.ea:neural, 34720 author = {K. E. Nygard and P. Juell and N. Kadaba}, 34721 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 34722 journal = {ORSA Journal on Computing}, 34723 year = {1990}, 34724 volume = {4}, 34725 pages = {353--364} 34726} 34727 34728@Article{ oh.goenka:elastohydrodynamic, 34729 author = {K. P. Oh and P. K. Goenka}, 34730 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 34731 journal = {Transactions of the {ASME}, Journal of Tribology}, 34732 volume = {107}, 34733 year = {1985}, 34734 pages = {389--395} 34735} 34736 34737@Article{ oh.li.ea:elastohydrodynamic, 34738 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 34739 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 34740 journal = {Transactions of the {ASME}, Journal of Tribology}, 34741 volume = {109}, 34742 pages = {356--362}, 34743 year = {1987} 34744} 34745 34746@Article{ oh:analysis, 34747 author = {K. P. Oh}, 34748 title = {Analysis of a Needle Bearing}, 34749 journal = {Transactions of the {ASME}, Journal of Tribology}, 34750 volume = {106}, 34751 pages = {78--87}, 34752 year = {1984} 34753} 34754 34755@Article{ oh:formulation, 34756 author = {K. P. Oh}, 34757 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 34758 Complementarity Problem}, 34759 journal = {Transactions of the {ASME}, Journal of Tribology}, 34760 volume = {108}, 34761 year = {1986}, 34762 pages = {598--604} 34763} 34764 34765@Article{ oh:numerical, 34766 author = {K. P. Oh}, 34767 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 34768 Nonlinear Complementarity Problem}, 34769 journal = {Transactions of the {ASME}, Journal of Tribology}, 34770 volume = {106}, 34771 year = {1984}, 34772 pages = {88--95} 34773} 34774 34775@Article{ olivera.shepard.ea:maximum, 34776 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 34777 and E. E. Fitchard and T. R. Mackie}, 34778 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 34779 journal = {Physics in Medicine and Biology}, 34780 year = {1998}, 34781 pages = {3277--3294} 34782} 34783 34784@Article{ opial:weak, 34785 author = {Z. Opial}, 34786 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 34787 Mappings}, 34788 journal = {Bulletin of the American Mathematical Society}, 34789 year = {1967}, 34790 volume = {73}, 34791 pages = {591--597} 34792} 34793 34794@Book{ orchard-hays:advanced, 34795 author = {W. Orchard--Hays}, 34796 title = {Advanced Linear Programming Computing Techniques}, 34797 year = {1968}, 34798 publisher = {McGraw--Hill}, 34799 address = {New York} 34800} 34801 34802@Article{ orourke.taylor.ea:factor, 34803 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 34804 title = {Factor price convergence in the late nineteenth century}, 34805 journal = {International Economic Review}, 34806 year = {1996} 34807} 34808 34809@Article{ orourke.williamson:open, 34810 author = {K. O'Rourke and J. G. Williamson}, 34811 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 34812 accounting}, 34813 journal = {Scandinavian Economic and Social History}, 34814 year = {1995}, 34815 volume = {XLIII}, 34816 pages = {171--203} 34817} 34818 34819@Article{ orourke:costs, 34820 author = {K. O'Rourke}, 34821 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 34822 journal = {Research in Economic History}, 34823 year = {1995}, 34824 volume = {15}, 34825 pages = {215--259} 34826} 34827 34828@Article{ orourke:industrial, 34829 author = {K. O'Rourke}, 34830 title = {Industrial policy, employment policy and the non-traded sector}, 34831 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 34832 year = {1996} 34833} 34834 34835@Article{ orourke:measuring, 34836 author = {K. O'Rourke}, 34837 title = {Measuring protection: a cautionary tale}, 34838 journal = {Journal of Development Economics}, 34839 year = {1996} 34840} 34841 34842@Book{ ortega.rheinboldt:iterative, 34843 author = {J. M. Ortega and W. C. Rheinboldt}, 34844 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 34845 year = {1970}, 34846 publisher = {Academic Press}, 34847 address = {San Diego, California} 34848} 34849 34850@Book{ ortega:introduction, 34851 author = {J. M. Ortega}, 34852 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 34853 year = {1988}, 34854 publisher = {Plenum Press}, 34855 address = {New York} 34856} 34857 34858@Book{ ortega:numerical, 34859 author = {J. M. Ortega}, 34860 title = {Numerical Analysis, {A} Second Course}, 34861 year = {1972}, 34862 publisher = {Academic Press} 34863} 34864 34865@Article{ osborne.womersley:strong, 34866 author = {M. R. Osborne and R. S. Womersley}, 34867 title = {Strong uniqueness in sequential linear programming}, 34868 journal = {Journal of the Australian Mathematical Society, Series B}, 34869 year = {1990}, 34870 volume = {31}, 34871 pages = {379--384} 34872} 34873 34874@InCollection{ osborne:strong, 34875 author = {M. R. Osborne}, 34876 title = {Strong uniqueness in nonlinear approximation}, 34877 booktitle = {The numerical solution of nonlinear problems}, 34878 year = {1981}, 34879 editor = {C. T. H. Baker and C. Phillips}, 34880 publisher = {Clarendon Press}, 34881 address = {Oxford} 34882} 34883 34884@Book{ outrata.kocvara.ea:nonsmooth, 34885 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 34886 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 34887 publisher = {Kluwer Academic Publishers}, 34888 year = {1998}, 34889 address = {Dordrecht, The Netherlands} 34890} 34891 34892@Article{ outrata.zowe:numerical, 34893 author = {J. V. Outrata and J. Zowe}, 34894 title = {A Numerical Approach to Optimization Problems with Variational Inequality 34895 Constraints}, 34896 journal = {Mathematical Programming}, 34897 year = {1995}, 34898 volume = {68}, 34899 pages = {105--130} 34900} 34901 34902@Article{ outrata:necessary, 34903 author = {J. V. Outrata}, 34904 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 34905 journal = {Journal of Optimization Theory and Applications}, 34906 volume = {76}, 34907 year = {1993}, 34908 pages = {305--320} 34909} 34910 34911@Article{ outrata:numerical, 34912 author = {J. V. Outrata}, 34913 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 34914 journal = {Zeitschrift f{\"{u}}r Operations Research}, 34915 volume = {4}, 34916 year = {1990}, 34917 pages = {255--278} 34918} 34919 34920@Article{ outrata:optimization, 34921 author = {J. V. Outrata}, 34922 title = {On Optimization Problems with Variational Inequality Constraints}, 34923 journal = {SIAM Journal on Optimization}, 34924 volume = {4}, 34925 year = {1994}, 34926 pages = {340--357} 34927} 34928 34929@Article{ paige.saunders:lsqr, 34930 author = {C. C. Paige and M. A. Saunders}, 34931 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 34932 journal = {{ACM} Transactions on Mathematical Software}, 34933 year = {1982}, 34934 volume = {8}, 34935 pages = {43--71} 34936} 34937 34938@Article{ paige.saunders:solution, 34939 author = {C. C. Paige and M. A. Saunders}, 34940 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 34941 journal = {SIAM Journal on Numerical Analysis}, 34942 year = {1975}, 34943 volume = {12}, 34944 pages = {617--629} 34945} 34946 34947@Article{ palacios-gomez.lasdon.ea:nonlinear, 34948 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 34949 title = {Nonlinear Optimization by Successive Linear Programming}, 34950 journal = {Management Science}, 34951 year = {1982}, 34952 volume = {28}, 34953 pages = {1106--1120} 34954} 34955 34956@Article{ palomares.mangasarian:superlinearly, 34957 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 34958 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 34959 Optimization Problems}, 34960 journal = {Mathematical Programming}, 34961 year = {1976}, 34962 volume = {11}, 34963 pages = {1--13} 34964} 34965 34966@Article{ panagiotopoulos.al-fahed:robot, 34967 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 34968 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 34969 journal = {The International Journal of Robotics Research}, 34970 year = {1994}, 34971 volume = {13}, 34972 pages = {127--136} 34973} 34974 34975@Book{ panagiotopoulos:hemivariational, 34976 author = {P. D. Panagiotopoulos}, 34977 title = {Hemivariational Inequalities}, 34978 publisher = {Springer-Verlag}, 34979 address = {Berlin}, 34980 year = {1993} 34981} 34982 34983@Book{ panagiotopoulos:inequality, 34984 author = {P. D. Panagiotopoulos}, 34985 title = {Inequality Problems in Mechanics and Applications}, 34986 publisher = {Birkh{\"{a}}user}, 34987 address = {Boston}, 34988 year = {1985} 34989} 34990 34991@Article{ pang.chan:iterative, 34992 author = {J. S. Pang and D. Chan}, 34993 title = {Iterative Methods for Variational and Complementarity Problems}, 34994 journal = {Mathematical Programming}, 34995 year = {1982}, 34996 volume = {24}, 34997 pages = {284--313} 34998} 34999 35000@Article{ pang.gabriel:nesqp, 35001 author = {J. S. Pang and S. A. Gabriel}, 35002 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 35003 journal = {Mathematical Programming}, 35004 year = {1993}, 35005 volume = {60}, 35006 pages = {295--338} 35007} 35008 35009@Article{ pang.han.ea:minimization, 35010 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 35011 title = {Minimization of Locally {L}ipschitzian Functions}, 35012 journal = {SIAM Journal on Optimization}, 35013 year = {1991}, 35014 volume = {1}, 35015 pages = {57--82} 35016} 35017 35018@Article{ pang.qi:nonsmooth, 35019 author = {J. S. Pang and L. Qi}, 35020 title = {Nonsmooth Equations: Motivation and Algorithms}, 35021 journal = {SIAM Journal on Optimization}, 35022 year = {1993}, 35023 volume = {3}, 35024 pages = {443--465} 35025} 35026 35027@Article{ pang.trinkle.ea:complementarity, 35028 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 35029 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 35030 journal = {Computational Optimization and Applications}, 35031 volume = {5}, 35032 pages = {97--138}, 35033 year = {1996} 35034} 35035 35036@Article{ pang.trinkle:complementarity, 35037 author = {J. S. Pang and J. C. Trinkle}, 35038 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 35039 Contact Problems with {C}oulomb Friction}, 35040 year = {1996}, 35041 journal = {Mathematical Programming}, 35042 volume = {73}, 35043 pages = {199--226} 35044} 35045 35046@TechReport{ pang.wang:embedding, 35047 author = {J. S. Pang and Z. P. Wang}, 35048 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 35049 Problems}, 35050 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35051 year = {1990}, 35052 address = {Baltimore, Maryland} 35053} 35054 35055@TechReport{ pang.yang:parallel, 35056 author = {J. S. Pang and J. M. Yang}, 35057 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 35058 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35059 year = {1987}, 35060 address = {Baltimore, Maryland}, 35061 type = {Manuscript} 35062} 35063 35064@Article{ pang.yu:linearized, 35065 author = {J. S. Pang and C. S. Yu}, 35066 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 35067 Networks}, 35068 journal = {Networks}, 35069 volume = {14}, 35070 pages = {427--438}, 35071 year = {1984} 35072} 35073 35074@Article{ pang:b-differentiable, 35075 author = {J. S. Pang}, 35076 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 35077 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 35078 Inequality Problems}, 35079 journal = {Mathematical Programming}, 35080 year = {1991}, 35081 volume = {51}, 35082 pages = {101--132} 35083} 35084 35085@InCollection{ pang:complementarity, 35086 author = {J. S. Pang}, 35087 title = {Complementarity Problems}, 35088 booktitle = {Handbook in Global Optimization}, 35089 publisher = {Kluwer Academic Publishers}, 35090 year = {1994}, 35091 editor = {R. Horst and P. Pardalos}, 35092 address = {Boston} 35093} 35094 35095@Article{ pang:convergence, 35096 author = {J. S. Pang}, 35097 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 35098 Problem}, 35099 journal = {Journal of Optimization Theory and Applications}, 35100 year = {1982}, 35101 volume = {37}, 35102 pages = {149--162} 35103} 35104 35105@Article{ pang:convergence*1, 35106 author = {J. S. Pang}, 35107 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 35108 Application of some Sensitivity Results}, 35109 journal = {Mathematical Programming}, 35110 year = {1993}, 35111 volume = {58}, 35112 pages = {149--160} 35113} 35114 35115@Article{ pang:inexact, 35116 author = {J. S. Pang}, 35117 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 35118 journal = {Mathematical Programming}, 35119 year = {1986}, 35120 volume = {36}, 35121 pages = {54--71} 35122} 35123 35124@Article{ pang:more, 35125 author = {J. S. Pang}, 35126 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 35127 Complementarity Problem}, 35128 journal = {Journal of Optimization Theory and Applications}, 35129 year = {1986}, 35130 volume = {49}, 35131 pages = {107--134} 35132} 35133 35134@Article{ pang:more*1, 35135 author = {J. S. Pang}, 35136 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 35137 Complementarity Problems}, 35138 journal = {Journal of Optimization Theory and Applications}, 35139 year = {1986}, 35140 volume = {49}, 35141 pages = {107--134} 35142} 35143 35144@Article{ pang:necessary, 35145 author = {J. S. Pang}, 35146 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 35147 the Linear Complementarity Problem}, 35148 journal = {Journal of Optimization Theory and Applications}, 35149 year = {1984}, 35150 volume = {42}, 35151 pages = {1--17} 35152} 35153 35154@Article{ pang:newtons, 35155 author = {J. S. Pang}, 35156 title = {{N}ewton's Method for {B}--Differentiable Equations}, 35157 journal = {Mathematics of Operations Research}, 35158 year = {1990}, 35159 volume = {15}, 35160 pages = {311--341} 35161} 35162 35163@Article{ pang:posteriori, 35164 author = {J. S. Pang}, 35165 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 35166 Problem}, 35167 journal = {Mathematics of Operations Research}, 35168 year = {1987}, 35169 volume = {12}, 35170 pages = {474--484} 35171} 35172 35173@Article{ pantoja.mayne:sequential, 35174 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 35175 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 35176 with Control Inequality Constraints}, 35177 journal = {International Journal on Control}, 35178 year = {1991}, 35179 volume = {53}, 35180 pages = {823--836} 35181} 35182 35183@Book{ papadimitriou.steiglitz:combinatorial, 35184 author = {C. H. Papadimitriou and K. Steiglitz}, 35185 title = {Combinatorial Optimization: Algorithms and Complexity}, 35186 year = {1982}, 35187 publisher = {Prentice-Hall, Inc}, 35188 address = {Englewood Cliffs, New Jersey} 35189} 35190 35191@Article{ papanikolau.mackie.ea:investigation, 35192 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 35193 Reckwerdt}, 35194 title = {Investigation of the convolution method for polyenergetic spectra}, 35195 journal = {Medical Physics}, 35196 year = {1993}, 35197 volume = {20}, 35198 number = {5}, 35199 pages = {1327--1336} 35200} 35201 35202@Article{ parisot:resolution, 35203 author = {G. R. Parisot}, 35204 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 35205 Lin\'{e}aire par Application de la Programmation Logarithmique}, 35206 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 35207 year = {1961}, 35208 volume = {20}, 35209 pages = {227--259} 35210} 35211 35212@Article{ parker.cave.ea:comparison, 35213 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 35214 title = {Comparison of Simplex Algorithms}, 35215 journal = {Analytica Chimica Acta}, 35216 year = {1985}, 35217 volume = {175}, 35218 pages = {231--237} 35219} 35220 35221@InProceedings{ parker:optimal, 35222 author = {D. Parker}, 35223 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 35224 Second Order Hebbian Learning}, 35225 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 35226 II}, 35227 year = {1987}, 35228 address = {San Diego:IEEE}, 35229 pages = {593--600} 35230} 35231 35232@Book{ pascali.sburlan:nonlinear, 35233 author = {D. Pascali and S. Sburlan}, 35234 title = {Nonlinear Mappings of Monotone Type}, 35235 publisher = {Editura Academeie}, 35236 year = {1978} 35237} 35238 35239@Article{ passty:ergodic, 35240 author = {G. B. Passty}, 35241 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 35242 space}, 35243 journal = {Journal of Mathematical Analysis and Applications}, 35244 year = {1979}, 35245 volume = {72}, 35246 pages = {383--390} 35247} 35248 35249@Article{ peaceman.rachford:numerical, 35250 author = {D. W. Peaceman and H. H. Rachford}, 35251 title = {The numerical solution of parabolic and elliptic differential equations}, 35252 journal = {SIAM Journal}, 35253 year = {1955}, 35254 volume = {3}, 35255 pages = {28--41} 35256} 35257 35258@Book{ peck.tiesberg:global, 35259 author = {S. Peck and T. Tiesberg}, 35260 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 35261 {CETA}}, 35262 publisher = {The Electric Power Institute}, 35263 year = {1992}, 35264 address = {Paolo Alto CA} 35265} 35266 35267@TechReport{ peng:convexity, 35268 author = {J. -M. Peng}, 35269 title = {The Convexity of the Implicit {L}agrangian}, 35270 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35271 year = {1995}, 35272 type = {Technical Report}, 35273 address = {Beijing} 35274} 35275 35276@Article{ peng:equivalence, 35277 author = {J. -M. Peng}, 35278 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 35279 journal = {Mathematical Programming}, 35280 year = {1997}, 35281 volume = {78}, 35282 pages = {347--356} 35283} 35284 35285@Article{ pennisi:taking, 35286 author = {E. Pennisi}, 35287 title = {Taking a structured approach to understanding proteins}, 35288 journal = {Science}, 35289 year = {1998}, 35290 volume = {279}, 35291 pages = {978--979} 35292} 35293 35294@Article{ penot:regularity, 35295 author = {J. P. Penot}, 35296 title = {On regularity conditions in mathematical programming}, 35297 journal = {Mathematical Programming Study}, 35298 year = {1982}, 35299 volume = {17}, 35300 pages = {28--66} 35301} 35302 35303@Book{ perez:principles, 35304 author = {C. A. Perez and L. W. Brady}, 35305 title = {Principles and practice of radiotherapy}, 35306 publisher = {Lippincott-Raven}, 35307 year = {1998}, 35308 address = {Philadelphia}, 35309 edition = {3rd} 35310} 35311 35312@Article{ perroni.rutherford:international, 35313 author = {C. Perroni and T. Rutherford}, 35314 title = {International Trade in Carbon Emission Rights and Basic Materials: General 35315 Equilibrium Calculations for 2020}, 35316 journal = {Scandinavian Journal of Economics}, 35317 year = {1993} 35318} 35319 35320@Article{ perroni.rutherford:regular, 35321 author = {C. Perroni and T. Rutherford}, 35322 title = {Regular Flexibility of Nested {CES} Functions}, 35323 journal = {European Economic Review}, 35324 year = {1995}, 35325 volume = {39}, 35326 pages = {335--343} 35327} 35328 35329@InCollection{ perroni.wigle:environmental, 35330 author = {C. Perroni and R. M. Wigle}, 35331 title = {Environmental Policy Modeling}, 35332 booktitle = {Global Trade Analysis: Modeling and Applications}, 35333 publisher = {Cambridge University Press}, 35334 year = {1996}, 35335 editor = {T. Hertel} 35336} 35337 35338@Article{ peterson:review, 35339 author = {D. W. Peterson}, 35340 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 35341 journal = {SIAM Review}, 35342 year = {1973}, 35343 volume = {15}, 35344 pages = {639--654} 35345} 35346 35347@PhDThesis{ petersson:optimization, 35348 author = {J. Petersson}, 35349 title = {Optimization of Structures in Unilateral Contact}, 35350 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 35351 number = {397}, 35352 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 35353 University}, 35354 address = {Link{\"o}ping, Sweden}, 35355 year = {1995} 35356} 35357 35358@Book{ petri:modelling, 35359 author = {P. Petri}, 35360 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 35361 publisher = {Harvard University Press}, 35362 year = {1984} 35363} 35364 35365@InProceedings{ petrzykowski:application, 35366 author = {T. Petrzykowski}, 35367 title = {Application of the Steepest Ascent Method to Concave Programming}, 35368 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 35369 year = {1962}, 35370 publisher = {North--Holland}, 35371 address = {Amsterdam}, 35372 pages = {185--189} 35373} 35374 35375@InProceedings{ pettey.leuze.ea:parallel, 35376 crossref = {grefenstette:genetic}, 35377 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 35378 title = {A Parallel Genetic Algorithm}, 35379 pages = {155--161} 35380} 35381 35382@InProceedings{ pettey.leuze:theoretical, 35383 crossref = {schaeffer:third}, 35384 author = {C. C. Pettey and M. R. Leuze}, 35385 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 35386 pages = {398--405} 35387} 35388 35389@Book{ pfeiffer.glocker:multibody, 35390 author = {F. Pfeiffer and C. Glocker}, 35391 title = {Multibody Dynamics with Unilateral Contact}, 35392 year = {1996}, 35393 publisher = {John Wiley \& Sons} 35394} 35395 35396@TechReport{ pierro.iusem:convergence, 35397 author = {A. R. de Pierro and A. N. Iusem}, 35398 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 35399 Linear Complementarity Problems}, 35400 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 35401 year = {1990}, 35402 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 35403} 35404 35405@InCollection{ pillo.grippo.ea:class, 35406 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 35407 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 35408 booktitle = {System Modelling and Optimization}, 35409 year = {1981}, 35410 editor = {R. F. Drenick and F. Kozin}, 35411 publisher = {Springer-Verlag}, 35412 address = {Berlin} 35413} 35414 35415@Article{ pillo.grippo:augmented, 35416 author = {G. Di Pillo and L. Grippo}, 35417 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 35418 Problems}, 35419 journal = {Journal of Optimization Theory and Applications}, 35420 year = {1982}, 35421 volume = {36}, 35422 pages = {495--519} 35423} 35424 35425@Article{ pillo.grippo:class, 35426 author = {G. Di Pillo and L. Grippo}, 35427 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 35428 journal = {SIAM Journal on Control and Optimization}, 35429 year = {1979}, 35430 volume = {17}, 35431 pages = {618--628} 35432} 35433 35434@Article{ pillo.grippo:continuously, 35435 author = {G. Di Pillo and L. Grippo}, 35436 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 35437 Problems with Inequality Constraints}, 35438 journal = {SIAM Journal on Control and Optimization}, 35439 year = {1985}, 35440 volume = {23}, 35441 pages = {72--84} 35442} 35443 35444@Article{ pillo.grippo:exact, 35445 author = {G. Di Pillo and L. Grippo}, 35446 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 35447 Programming Problems}, 35448 journal = {Mathematical Programming}, 35449 year = {1986}, 35450 volume = {36}, 35451 pages = {1--18} 35452} 35453 35454@InProceedings{ plambeck.fu.ea:throughput, 35455 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35456 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 35457 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 35458 editor = {J. Schoen}, 35459 year = {1993}, 35460 publisher = {Society for Computer Simulation}, 35461 address = {San Diego, CA}, 35462 pages = {70--75} 35463} 35464 35465@Article{ plambeck.fu.ea:sample-path, 35466 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35467 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 35468 journal = {Mathematical Programming}, 35469 year = {1996}, 35470 volume = {75}, 35471 pages = {137--176} 35472} 35473 35474@InProceedings{ platt:sequential, 35475 author = {J. Platt}, 35476 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 35477 Machines}, 35478 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 35479 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 35480 publisher = {MIT Press}, 35481 pages = {185-208}, 35482 year = {1999} 35483} 35484 35485@Book{ poincare:sur, 35486 author = {H. Poincar\'{e}}, 35487 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 35488 year = {1881}, 35489 publisher = {Oeuvres I}, 35490 address = {Gauthier--Villars, Paris} 35491} 35492 35493@Article{ polak.ribiere:note, 35494 author = {E. Polak and G. Ribi\`{e}re}, 35495 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 35496 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 35497 year = {1969}, 35498 volume = {16-R1}, 35499 pages = {35--43} 35500} 35501 35502@Book{ polak:computational, 35503 author = {E. Polak}, 35504 title = {Computational Methods in Optimization; {A} Unified Approach}, 35505 year = {1971}, 35506 publisher = {Academic Press}, 35507 address = {New York} 35508} 35509 35510@Article{ polak:global, 35511 author = {E. Polak}, 35512 title = {On the Global Stabilization of Locally Convergent Algorithms}, 35513 journal = {Automatica}, 35514 year = {1976}, 35515 volume = {12}, 35516 pages = {337--349} 35517} 35518 35519@Article{ polyak.tretiyakov:concerning, 35520 author = {B. T. Polyak and N. V. Tretiyakov}, 35521 title = {Concerning an Iterative Method for Linear Programming and its Economic 35522 Interpretation}, 35523 journal = {Economics and Mathematical Methods}, 35524 year = {1972}, 35525 volume = {8}, 35526 pages = {740--751}, 35527 note = {(Russian)} 35528} 35529 35530@Article{ polyak.tretiyakov:method, 35531 author = {B. T. Polyak and N. V. Tretiyakov}, 35532 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 35533 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 35534 year = {1973}, 35535 volume = {13}, 35536 pages = {42--58} 35537} 35538 35539@Article{ polyak:conjugate, 35540 author = {B. T. Polyak}, 35541 title = {The conjugate gradient method in extremal problems}, 35542 journal = {USSR Computational Mathematics and Mathematical Physics}, 35543 year = {1969}, 35544 volume = {9}, 35545 pages = {94--112}, 35546 note = {Translated from Russian} 35547} 35548 35549@Book{ polyak:introduction, 35550 author = {B. T. Polyak}, 35551 title = {Introduction to Optimization}, 35552 year = {1987}, 35553 publisher = {Optimization Software, Inc.}, 35554 address = {Publications Division, New York} 35555} 35556 35557@Unpublished{ polyak:methods, 35558 author = {R. A. Polyak}, 35559 title = {On the Methods of Centers}, 35560 year = {1988}, 35561 note = {Unpublished manuscript} 35562} 35563 35564@Unpublished{ polyak:sharp, 35565 author = {B. T. Polyak}, 35566 title = {Sharp Minima}, 35567 year = {1979}, 35568 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 35569 Applications, {IIASA}, Laxenburg, Austria} 35570} 35571 35572@InProceedings{ polyak:smooth, 35573 author = {R. A. Polyak}, 35574 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 35575 Problems with Constraints}, 35576 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 35577 Programming}, 35578 year = {1982}, 35579 address = {Bonn} 35580} 35581 35582@Article{ polychronopoulos.tsitsiklis:analysis, 35583 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 35584 title = {Stochastic Shortest Path Problems with Recourse}, 35585 journal = {Networks}, 35586 year = {1996}, 35587 volume = {27}, 35588 pages = {133--143} 35589} 35590 35591@TechReport{ potra.bonnans:infeasible, 35592 author = {F. A. Potra and J. F. Bonnans}, 35593 title = {Infeasible path following algorithms for linear complementarity problems}, 35594 institution = {INRIA}, 35595 year = {1994}, 35596 month = dec, 35597 number = {RR--2445}, 35598 type = {Research Report} 35599} 35600 35601@Article{ potra.sheng:large-step, 35602 author = {F. A. Potra and R. Sheng}, 35603 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 35604 year = {1997}, 35605 journal = {SIAM Journal on Optimization}, 35606 volume = {7}, 35607 pages = {318--335} 35608} 35609 35610@Article{ potra:infeasible, 35611 author = {F. A. Potra}, 35612 title = {An infeasible interior-point predictor-corrector algorithm for linear 35613 programming}, 35614 journal = {SIAM Journal on Optimization}, 35615 year = {1996}, 35616 volume = {6}, 35617 pages = {19--32} 35618} 35619 35620@TechReport{ potra:onl, 35621 author = {F. A. Potra}, 35622 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 35623 convergence.}, 35624 institution = {Department of Mathematics, The University of Iowa}, 35625 address = {Iowa City, Iowa}, 35626 year = {1994}, 35627 number = {50}, 35628 type = {Reports on Computational Mathematics} 35629} 35630 35631@TechReport{ potra:predictor-corrector, 35632 author = {F. A. Potra}, 35633 title = {On a predictor-corrector method for solving linear programs from infeasible 35634 starting points}, 35635 institution = {Department of Mathematics, University of Iowa}, 35636 address = {Iowa City, Iowa}, 35637 year = {1992}, 35638 number = {34}, 35639 type = {Reports on Computational Mathematics} 35640} 35641 35642@TechReport{ potra:quadratically, 35643 author = {F. A. Potra}, 35644 title = {A quadratically convergent infeasible interior-point algorithm for linear 35645 programming}, 35646 institution = {Department of Mathematics, University of Iowa}, 35647 year = {1992}, 35648 number = {28}, 35649 address = {Iowa City, Iowa}, 35650 month = jul 35651} 35652 35653@InCollection{ powell:convergence, 35654 author = {M. J. D. Powell}, 35655 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 35656 Optimization Calculations}, 35657 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35658 pages = {27--63} 35659} 35660 35661@InProceedings{ powell:direct, 35662 author = {M. J. D. Powell}, 35663 title = {A Direct Search Optimization Method that Models the Objective and Constraint 35664 Functions by Linear Interpolation}, 35665 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 35666 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 35667 volume = {275}, 35668 year = {1994}, 35669 publisher = {Kluwer Academic Publishers}, 35670 pages = {51--67}, 35671 address = {Dordrecht, The Netherlands} 35672} 35673 35674@Article{ powell:efficient, 35675 author = {M. J. D. Powell}, 35676 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 35677 without Calculating Derivatives}, 35678 journal = {Computer Journal}, 35679 year = {1964}, 35680 volume = {17}, 35681 pages = {155--162} 35682} 35683 35684@InCollection{ powell:general, 35685 author = {M. J. D. Powell}, 35686 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 35687 booktitle = {Approximation Theory IV}, 35688 year = {1983}, 35689 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 35690 publisher = {Academic Press}, 35691 address = {New York}, 35692 pages = {187--218} 35693} 35694 35695@InCollection{ powell:hybrid, 35696 author = {M. J. D. Powell}, 35697 title = {A hybrid method for nonlinear equations}, 35698 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 35699 publisher = {Gordon and Breach}, 35700 year = {1970}, 35701 editor = {P. Rabinowitz} 35702} 35703 35704@TechReport{ powell:karmarkars, 35705 author = {M. J. D. Powell}, 35706 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 35707 institution = {Department of Applied Mathematics and Theoretical Physics, University of 35708 Cambridge}, 35709 year = {1989}, 35710 month = nov, 35711 address = {Cambridge, CB3 9EW, England} 35712} 35713 35714@InCollection{ powell:method, 35715 author = {M. J. D. Powell}, 35716 title = {A Method for Nonlinear Constraints in Minimization Problems}, 35717 booktitle = {Optimization}, 35718 year = {1969}, 35719 editor = {R. Fletcher}, 35720 publisher = {Academic Press}, 35721 address = {London}, 35722 pages = {283--298} 35723} 35724 35725@Book{ prekopa:stochastic, 35726 author = {A. Pr{\'{e}}kopa}, 35727 title = {Stochastic Programming}, 35728 publisher = {Kluwer Academic Publishers}, 35729 year = {1995}, 35730 address = {Dordrecht, The Netherlands} 35731} 35732 35733@Book{ press.flannery.ea:numerical, 35734 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 35735 Vetterling}, 35736 title = {Numerical Recipes : the Art of Scientific Computing}, 35737 publisher = {Cambridge University Press}, 35738 year = {1988} 35739} 35740 35741@Article{ pruyne.livny:interfacing, 35742 author = {J. Pruyne and M. Livny}, 35743 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 35744 journal = {Journal on Future Generations of Computer Systems}, 35745 volume = {12}, 35746 year = {1996}, 35747 pages = {67--85} 35748} 35749 35750@InCollection{ pruyne.livny:parallel, 35751 author = {J. Pruyne and M. Livny}, 35752 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 35753 booktitle = {Job Scheduling Strategies for Parallel Processing}, 35754 publisher = {Springer-Verlag}, 35755 year = {1995}, 35756 editor = {D. G. Feitelson and L. Rudolph}, 35757 volume = {949}, 35758 series = {Lecture Notes in Computer Science} 35759} 35760 35761@PhDThesis{ pruyne:resource, 35762 author = {J. C. Pruyne}, 35763 title = {Resource Management Services for Parallel Applications}, 35764 school = {University of Wisconsin--Madison}, 35765 year = {1996}, 35766 address = {Madison, Wisconsin} 35767} 35768 35769@Book{ pshenichny.danilin:numerical, 35770 author = {B. N. Pshenichny and Yu. M. Danilin}, 35771 title = {Numerical Methods in Extremal Problems}, 35772 year = {1978}, 35773 publisher = {MIR Publishers}, 35774 address = {Moscow} 35775} 35776 35777@TechReport{ qi.chen:globally, 35778 author = {L. Qi and X. Chen}, 35779 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 35780 institution = {School of Mathematics, University of New South Wales}, 35781 year = {1993}, 35782 annote = {revised}, 35783 address = {Sydney} 35784} 35785 35786@Article{ qi.jiang:semismooth, 35787 author = {L. Qi and H. Jiang}, 35788 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 35789 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 35790 journal = {Mathematics of Operations Research}, 35791 volume = {22}, 35792 pages = {301--325}, 35793 year = {1997} 35794} 35795 35796@TechReport{ qi.peng:unconstrained, 35797 author = {H. -D. Qi and J. -M. Peng}, 35798 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 35799 Problems}, 35800 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35801 year = {1996}, 35802 type = {Technical Report}, 35803 address = {Beijing} 35804} 35805 35806@InCollection{ qi.sun:survey, 35807 author = {L. Qi and D. Sun}, 35808 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 35809 year = {1999}, 35810 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 35811 booktitle = {Progress in Optimization}, 35812 pages = {121--146}, 35813 series = {Applied Optimization}, 35814 volume = {30}, 35815 publisher = {Kluwer Academic Publishers}, 35816 address = {Dordrecht} 35817} 35818 35819@Article{ qi.sun:nonsmooth, 35820 author = {L. Qi and J. Sun}, 35821 title = {A Nonsmooth Version of {N}ewton's Method}, 35822 journal = {Mathematical Programming}, 35823 year = {1993}, 35824 volume = {58}, 35825 pages = {353--368} 35826} 35827 35828@Article{ qi:convergence, 35829 author = {L. Qi}, 35830 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 35831 journal = {Mathematics of Operations Research}, 35832 year = {1993}, 35833 volume = {18}, 35834 pages = {227--244} 35835} 35836 35837@TechReport{ qi:regular, 35838 author = {L. Qi}, 35839 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 35840 convergent generalized {N}ewton methods for complementarity and variational 35841 inequality problems}, 35842 institution = {School of Mathematics, University of New South Wales}, 35843 year = {1997}, 35844 type = {Applied Mathematics Report}, 35845 number = {AMR 97/14}, 35846 address = {Sydney, Australia} 35847} 35848 35849@Article{ radner:competitive, 35850 author = {R. Radner}, 35851 title = {Competitive Equilibrium under Uncertainty}, 35852 journal = {Econometrica}, 35853 year = {1968}, 35854 volume = {36}, 35855 pages = {31--58} 35856} 35857 35858@Article{ radstrom:embedding, 35859 author = {H. R{\aa}dstr{\"{o}}m}, 35860 title = {An embedding theorem for spaces of convex sets}, 35861 journal = {Proc. Amer. Math. Soc.}, 35862 year = {1952}, 35863 volume = {3}, 35864 pages = {165--169} 35865} 35866 35867@Article{ raghavachari:connections, 35868 author = {M. Raghavachari}, 35869 title = {On Connections between Zero--One Integer Programming and Concave Programming 35870 Under Linear Constraints}, 35871 journal = {Operations Research}, 35872 year = {1969}, 35873 volume = {17}, 35874 pages = {680--684} 35875} 35876 35877@Article{ rajan.burridge.ea:dynamics, 35878 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 35879 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 35880 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 35881 month = mar, 35882 year = {1987}, 35883 pages = {671--677} 35884} 35885 35886@Article{ ralph:branching, 35887 author = {D. Ralph}, 35888 title = {On Branching Numbers of Normal Manifolds}, 35889 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 35890 volume = {22}, 35891 pages = {1041--1050}, 35892 year = {1994} 35893} 35894 35895@Article{ ralph:global, 35896 author = {D. Ralph}, 35897 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 35898 Path Search}, 35899 journal = {Mathematics of Operations Research}, 35900 year = {1994}, 35901 volume = {19}, 35902 pages = {352--389} 35903} 35904 35905@InProceedings{ ralph:piecewise, 35906 author = {D. Ralph}, 35907 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 35908 with Linear Complementarity Constraints}, 35909 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 35910 Applications (CTAC95)}, 35911 year = {1996} 35912} 35913 35914@PhDThesis{ raman:integration, 35915 author = {R. Raman}, 35916 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 35917 for process systems.}, 35918 address = {Pittsburgh, Pennsylvania}, 35919 year = {1993}, 35920 school = {Department of Chemical Engineering, Carnegie Mellon University} 35921} 35922 35923@PhDThesis{ rangaraj:nonsmooth, 35924 author = {Narayan Rangaraj}, 35925 title = {Nonsmooth Optimization: Algorithms and Applications}, 35926 year = {1990}, 35927 address = {Baltimore, MD}, 35928 school = {Department of Mathematical Sciences, The Johns Hopkins University} 35929} 35930 35931@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 35932 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 35933 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 35934 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35935 Radiation Therapy, Salt Lake City}, 35936 year = {1997}, 35937 editor = {D. D. Leavitt and G. Starkshall}, 35938 publisher = {Medical Physics Publishing}, 35939 address = {St. Louis, Missouri}, 35940 pages = {420--422} 35941} 35942 35943@Article{ reid:sparsity-exploiting, 35944 author = {J. K. Reid}, 35945 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear 35946 Programming Bases}, 35947 journal = {Mathematical Programming}, 35948 year = {1982}, 35949 volume = {24}, 35950 pages = {55--69} 35951} 35952 35953@Book{ reingold.nievergelt.ea:combinatorial, 35954 author = {E. Reingold and J. Nievergelt and N. Deo}, 35955 title = {Combinatorial Algorithms: Theory and Practice}, 35956 publisher = {Prentice-Hall, Inc}, 35957 address = {Englewood Cliffs, New Jersey} 35958} 35959 35960@PhDThesis{ reinoza:degree, 35961 author = {J. A. Reinoza}, 35962 title = {A Degree for Generalized Equations}, 35963 year = {1979}, 35964 address = {Madison, Wisconsin}, 35965 school = {University of Wisconsin} 35966} 35967 35968@Article{ reinoza:solving, 35969 author = {A. Reinoza}, 35970 title = {Solving Generalized Equations via Homotopies}, 35971 journal = {Mathematical Programming}, 35972 year = {1985}, 35973 volume = {31}, 35974 pages = {307--320} 35975} 35976 35977@PhDThesis{ ren:computable, 35978 author = {J. Ren}, 35979 title = {Computable Error Bounds in Mathematical Programming}, 35980 school = {Computer Sciences Department, University of Wisconsin}, 35981 year = {1993}, 35982 address = {Madison, Wisconsin}, 35983 note = {Technical Report 1173} 35984} 35985 35986@Article{ renegar:polynomial-time, 35987 author = {J. Renegar}, 35988 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 35989 Programming}, 35990 journal = {Mathematical Programming}, 35991 year = {1988}, 35992 volume = {40}, 35993 pages = {59--94} 35994} 35995 35996@Article{ robbins.monro:stochastic, 35997 author = {H. Robbins and S. Monro}, 35998 title = {A Stochastic Approximation Method}, 35999 journal = {Annals of Mathematical Statistics}, 36000 year = {1951}, 36001 volume = {22}, 36002 pages = {400--407} 36003} 36004 36005@Article{ robinson:analysis, 36006 author = {S. M. Robinson}, 36007 title = {Analysis of Sample-Path Optimization}, 36008 journal = {Mathematics of Operations Research}, 36009 year = {1996}, 36010 volume = {21}, 36011 pages = {513--528} 36012} 36013 36014@InCollection{ robinson:bundle-based, 36015 author = {S. M. Robinson}, 36016 title = {Bundle-Based Decomposition: Conditions for Convergence}, 36017 booktitle = {Analyse Non Lin\'{e}aire}, 36018 year = {1989}, 36019 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 36020 publisher = {Gauthier-Villaars}, 36021 address = {Paris}, 36022 pages = {435--447} 36023} 36024 36025@InCollection{ robinson:bundle-based*1, 36026 author = {S. M. Robinson}, 36027 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 36028 booktitle = {System Modeling and Optimization}, 36029 year = {1986}, 36030 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 36031 publisher = {Springer-Verlag}, 36032 address = {Berlin}, 36033 pages = {751--756}, 36034 volume = {84}, 36035 series = {Lecture Notes in Control and Information Sciences} 36036} 36037 36038@Article{ robinson:continuity, 36039 author = {S. M. Robinson}, 36040 title = {Some Continuity Properties of Polyhedral Multifunctions}, 36041 journal = {Mathematical Programming Study}, 36042 year = {1981}, 36043 volume = {14}, 36044 pages = {206--214} 36045} 36046 36047@Article{ robinson:extension, 36048 author = {S. M. Robinson}, 36049 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 36050 journal = {Numerische Mathematik}, 36051 year = {1972}, 36052 volume = {19}, 36053 pages = {341--347} 36054} 36055 36056@InCollection{ robinson:generalized, 36057 crossref = {bachem.grotschel.ea:mathematical}, 36058 author = {S. M. Robinson}, 36059 title = {Generalized Equations}, 36060 pages = {346--367} 36061} 36062 36063@Article{ robinson:generalized*1, 36064 author = {S. M. Robinson}, 36065 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 36066 journal = {Mathematical Programming Study}, 36067 year = {1979}, 36068 volume = {10}, 36069 pages = {128--141} 36070} 36071 36072@InCollection{ robinson:homeomorphism, 36073 author = {S. M. Robinson}, 36074 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 36075 booktitle = {Optimization and Nonlinear Analysis}, 36076 year = {1992}, 36077 editor = {A. Ioffe and M. Marcus and S. Reich}, 36078 publisher = {Longman}, 36079 address = {Harlow, Essex, England}, 36080 pages = {240--248}, 36081 series = {Pitman Research Notes in Mathematics Series No. 244} 36082} 36083 36084@Article{ robinson:implicit-function, 36085 author = {S. M. Robinson}, 36086 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 36087 journal = {Mathematics of Operations Research}, 36088 year = {1991}, 36089 volume = {16}, 36090 pages = {292--309} 36091} 36092 36093@Article{ robinson:local*1, 36094 author = {S. M. Robinson}, 36095 title = {Local Epi--Continuity and Local Optimization}, 36096 journal = {Mathematical Programming}, 36097 year = {1987}, 36098 volume = {37}, 36099 pages = {208--222} 36100} 36101 36102@Article{ robinson:local*2, 36103 author = {S. M. Robinson}, 36104 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 36105 Nondegeneracy}, 36106 journal = {Mathematical Programming Study}, 36107 year = {1984}, 36108 volume = {22}, 36109 pages = {217--230} 36110} 36111 36112@Article{ robinson:local*3, 36113 author = {S. M. Robinson}, 36114 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 36115 Stability and Sensitivity}, 36116 journal = {Mathematical Programming Study}, 36117 year = {1987}, 36118 volume = {30}, 36119 pages = {45--66} 36120} 36121 36122@Article{ robinson:mathematical, 36123 author = {S. M. Robinson}, 36124 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 36125 journal = {Mathematical Programming}, 36126 year = {1990}, 36127 volume = {48}, 36128 pages = {221--229} 36129} 36130 36131@Article{ robinson:newtons, 36132 author = {S. M. Robinson}, 36133 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 36134 journal = {Set Valued Analysis}, 36135 year = {1994}, 36136 volume = {2}, 36137 pages = {291--305} 36138} 36139 36140@Article{ robinson:nonsingularity, 36141 author = {S. M. Robinson}, 36142 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 36143 journal = {Mathematical Programming}, 36144 year = {1993}, 36145 volume = {62}, 36146 pages = {415--425} 36147} 36148 36149@InCollection{ robinson:nonsmooth, 36150 author = {S. M. Robinson}, 36151 title = {Nonsmooth Continuation for Generalized Equations}, 36152 year = {1997}, 36153 pages = {282--291}, 36154 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 36155 booktitle = {Recent Advances in Optimization}, 36156 series = {Lecture Notes in Economics and Mathematical Systems}, 36157 volume = {452}, 36158 publisher = {Springer-Verlag}, 36159 address = {Heidelberg} 36160} 36161 36162@Article{ robinson:normal, 36163 author = {S. M. Robinson}, 36164 title = {Normal Maps Induced by Linear Transformations}, 36165 journal = {Mathematics of Operations Research}, 36166 year = {1992}, 36167 volume = {17}, 36168 pages = {691--714} 36169} 36170 36171@Article{ robinson:normed, 36172 author = {S. M. Robinson}, 36173 title = {Normed Convex Processes}, 36174 journal = {Transactions of the American Mathematical Society}, 36175 year = {1972}, 36176 volume = {174}, 36177 pages = {127--140} 36178} 36179 36180@Article{ robinson:reduction, 36181 author = {S. M. Robinson}, 36182 title = {A reduction method for variational inequalities}, 36183 journal = {Mathematical Programming}, 36184 year = {1998}, 36185 volume = {80}, 36186 pages = {161--169} 36187} 36188 36189@Article{ robinson:regularity, 36190 author = {S. M. Robinson}, 36191 title = {Regularity and stability for convex multivalued functions}, 36192 journal = {Mathematics of Operations Research}, 36193 year = {1976}, 36194 volume = {1}, 36195 pages = {130--143} 36196} 36197 36198@Unpublished{ robinson:shadow, 36199 author = {S. M. Robinson}, 36200 title = {Shadow {JUNK} for biblio file}, 36201 year = {1800} 36202} 36203 36204@Article{ robinson:shadow*1, 36205 author = {S. M. Robinson}, 36206 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 36207 journal = {Operations Research}, 36208 year = {1993}, 36209 volume = {41}, 36210 pages = {518--535} 36211} 36212 36213@Article{ robinson:shadow*2, 36214 author = {S. M. Robinson}, 36215 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 36216 journal = {Operations Research}, 36217 year = {1993}, 36218 volume = {41}, 36219 pages = {536--548} 36220} 36221 36222@Unpublished{ robinson:stability, 36223 author = {S. M. Robinson}, 36224 title = {Stability {JUNK} for biblio file}, 36225 year = {1800} 36226} 36227 36228@Article{ robinson:stability*1, 36229 author = {S. M. Robinson}, 36230 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 36231 journal = {SIAM Journal on Numerical Analysis}, 36232 year = {1975}, 36233 volume = {12}, 36234 pages = {754--769} 36235} 36236 36237@Article{ robinson:stability*2, 36238 author = {S. M. Robinson}, 36239 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 36240 Nonlinear Systems}, 36241 journal = {SIAM Journal on Numerical Analysis}, 36242 year = {1976}, 36243 volume = {13}, 36244 pages = {497--513} 36245} 36246 36247@Article{ robinson:strongly, 36248 author = {S. M. Robinson}, 36249 title = {Strongly Regular Generalized Equations}, 36250 journal = {Mathematics of Operations Research}, 36251 year = {1980}, 36252 volume = {5}, 36253 pages = {43--62} 36254} 36255 36256@Article{ rockafellar.wets:generalized, 36257 author = {R. T. Rockafellar and R. J.--B. Wets}, 36258 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 36259 Control in Discrete Time}, 36260 journal = {SIAM Journal on Control and Optimization}, 36261 year = {1990}, 36262 volume = {28}, 36263 pages = {810--822} 36264} 36265 36266@Article{ rockafellar.wets:lagrangian, 36267 author = {R. T. Rockafellar and R. J.--B. Wets}, 36268 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 36269 in Stochastic Programming}, 36270 journal = {Mathematical Programming Study}, 36271 year = {1986}, 36272 volume = {28}, 36273 pages = {63--93} 36274} 36275 36276@InCollection{ rockafellar.wets:linear-quadratic, 36277 author = {R. T. Rockafellar and R. J.--B. Wets}, 36278 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 36279 Generation Algorithm}, 36280 booktitle = {Stochastic Optimization}, 36281 publisher = {Springer-Verlag}, 36282 year = {1987}, 36283 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 36284 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 36285 pages = {545--560}, 36286 address = {New York, Berlin} 36287} 36288 36289@Article{ rockafellar.wets:scenarios, 36290 author = {R. T. Rockafellar and R. J.--B. Wets}, 36291 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 36292 journal = {Mathematics of Operations Research}, 36293 year = {1991}, 36294 volume = {10}, 36295 pages = {119--147} 36296} 36297 36298@InProceedings{ rockafellar:applications, 36299 author = {R. T. Rockafellar}, 36300 title = {New Applications of Duality in Convex Programming}, 36301 booktitle = {Proceedings of the Fourth Conference on Probability}, 36302 year = {1971}, 36303 address = {Brasov, Romania} 36304} 36305 36306@Article{ rockafellar:augmented, 36307 author = {R. T. Rockafellar}, 36308 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 36309 journal = {SIAM Journal on Control and Optimization}, 36310 year = {1974}, 36311 volume = {12}, 36312 pages = {268--285} 36313} 36314 36315@Article{ rockafellar:augmented*1, 36316 author = {R. T. Rockafellar}, 36317 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 36318 Convex Programming}, 36319 journal = {Mathematics of Operations Research}, 36320 year = {1976}, 36321 volume = {1}, 36322 pages = {97--116} 36323} 36324 36325@Article{ rockafellar:characterization, 36326 author = {R. T. Rockafellar}, 36327 title = {Characterization of the subdifferentials of convex functions}, 36328 journal = {Pacific Journal of Mathematics}, 36329 year = {1966}, 36330 volume = {17}, 36331 number = {3}, 36332 pages = {497--510} 36333} 36334 36335@Article{ rockafellar:computational, 36336 author = {R. T. Rockafellar}, 36337 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 36338 Programming}, 36339 journal = {Mathematical Programming}, 36340 year = {1990}, 36341 volume = {48}, 36342 pages = {447--474} 36343} 36344 36345@Book{ rockafellar:conjugate, 36346 author = {R. T. Rockafellar}, 36347 title = {Conjugate Duality and Optimization}, 36348 year = {1974}, 36349 publisher = {SIAM}, 36350 address = {Philadelphia, Pennsylvania}, 36351 volume = {16}, 36352 series = {Conference Board of the Mathematical Sciences} 36353} 36354 36355@Book{ rockafellar:convex, 36356 author = {R. T. Rockafellar}, 36357 title = {Convex Analysis}, 36358 year = {1970}, 36359 publisher = {Princeton University Press}, 36360 address = {Princeton, New Jersey} 36361} 36362 36363@Article{ rockafellar:first-, 36364 author = {R. T. Rockafellar}, 36365 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 36366 journal = {Transactions of the American Mathematical Society}, 36367 year = {1988}, 36368 volume = {307}, 36369 pages = {75--108} 36370} 36371 36372@InProceedings{ rockafellar:generalized, 36373 author = {R. T. Rockafellar}, 36374 title = {A Generalized Approach to Linear-Quadratic Programming}, 36375 booktitle = {Proceedings of the International Conference on Numerical Optimization and 36376 Applications}, 36377 year = {1986}, 36378 pages = {58--66}, 36379 note = {(Xi'an, China)} 36380} 36381 36382@InProceedings{ rockafellar:generalized*1, 36383 crossref = {bachem.grotschel.ea:mathematical}, 36384 author = {R. T. Rockafellar}, 36385 title = {Generalized Subgradients in Mathematical Programming}, 36386 pages = {368--390} 36387} 36388 36389@InCollection{ rockafellar:large-scale, 36390 author = {R. T. Rockafellar}, 36391 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 36392 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 36393 chapter = {15}, 36394 year = {1991}, 36395 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 36396 publisher = {SIAM Publications}, 36397 pages = {247--261} 36398} 36399 36400@Article{ rockafellar:linear-quadratic, 36401 author = {R. T. Rockafellar}, 36402 title = {Linear-Quadratic Programming and Optimal Control}, 36403 journal = {SIAM Journal on Control and Optimization}, 36404 year = {1987}, 36405 volume = {25}, 36406 pages = {781--814} 36407} 36408 36409@Article{ rockafellar:maximality, 36410 author = {R. T. Rockafellar}, 36411 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 36412 journal = {Transactions of the American Mathematical Society}, 36413 year = {1970}, 36414 volume = {149}, 36415 pages = {75--88} 36416} 36417 36418@InCollection{ rockafellar:monotone, 36419 author = {R. T. Rockafellar}, 36420 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 36421 crossref = {mangasarian.meyer.ea:nonlinear*3}, 36422 pages = {1--26} 36423} 36424 36425@Article{ rockafellar:monotone*1, 36426 author = {R. T. Rockafellar}, 36427 title = {Monotone Operators and the Proximal Point Algorithm}, 36428 journal = {SIAM Journal on Control and Optimization}, 36429 year = {1976}, 36430 volume = {14}, 36431 pages = {877--898} 36432} 36433 36434@Article{ rockafellar:multiplier, 36435 author = {R. T. Rockafellar}, 36436 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 36437 journal = {Journal of Optimization Theory and Applications}, 36438 year = {1973}, 36439 volume = {12}, 36440 pages = {555--562} 36441} 36442 36443@Article{ rockafellar:multistage, 36444 author = {R. T. Rockafellar}, 36445 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 36446 journal = {Control and Cybernetics}, 36447 year = {1988}, 36448 volume = {17}, 36449 number = {2-3}, 36450 pages = {225--245} 36451} 36452 36453@Book{ rockafellar:network, 36454 author = {R. T. Rockafellar}, 36455 title = {Network Flows and Monotropic Optimization}, 36456 publisher = {John Wiley}, 36457 year = {1984}, 36458 address = {New York} 36459} 36460 36461@Article{ rodrigues:mixed, 36462 author = {H. C. Rodrigues}, 36463 title = {A mixed variational formulation for shape optimization of solids with contact 36464 conditions}, 36465 journal = {Structural Optimization}, 36466 volume = {6}, 36467 year = {1993}, 36468 pages = {19--28} 36469} 36470 36471@Book{ rodrigues:obstacle, 36472 author = {J. F. Rodrigues}, 36473 title = {Obstacle Problems in Mathematical Physics}, 36474 publisher = {Elsevier Publishing Company}, 36475 address = {Amsterdam}, 36476 year = {1987} 36477} 36478 36479@Book{ roos.terlaky.ea:theory, 36480 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 36481 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 36482 publisher = {John Wiley \& Sons}, 36483 year = {1997}, 36484 address = {Chichester} 36485} 36486 36487@TechReport{ rosa:decomposition, 36488 author = {C. H. Rosa}, 36489 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 36490 institution = {IIASA}, 36491 year = {1996}, 36492 number = {WP-96-013}, 36493 address = {A-2361 Laxenburg, Austria} 36494} 36495 36496@Article{ rosen.lane.ea:treatment, 36497 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 36498 title = {Treatment Plan Optimization Using Linear Programming}, 36499 journal = {Medical Physics}, 36500 year = {1990}, 36501 volume = {18}, 36502 number = {2}, 36503 pages = {141--152} 36504} 36505 36506@TechReport{ rosenblatt:perceptron-a, 36507 author = {F. Rosenblatt}, 36508 title = {The perceptron--a perceiving and recognizing automaton}, 36509 institution = {Cornell Aeronautical Laboratory}, 36510 year = {1957}, 36511 month = jan, 36512 address = {Ithaca, New York}, 36513 number = {85-460-1} 36514} 36515 36516@Book{ rosenblatt:principles, 36517 author = {F. Rosenblatt}, 36518 title = {Principles of Neurodynamics}, 36519 year = {1962}, 36520 publisher = {Spartan Books}, 36521 address = {New York} 36522} 36523 36524@InProceedings{ rosenblatt:two, 36525 author = {F. Rosenblatt}, 36526 title = {Two theorems of statistical separability in the perceptron}, 36527 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 36528 year = {1959}, 36529 publisher = {{HMS} Stationery Office}, 36530 address = {London}, 36531 volume = {1} 36532} 36533 36534@Article{ rosenbrock:automatic, 36535 author = {H. H. Rosenbrock}, 36536 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 36537 journal = {Computer Journal}, 36538 year = {1960}, 36539 volume = {3}, 36540 pages = {175--184} 36541} 36542 36543@Article{ roy.mukhopadhyay:pattern, 36544 author = {A. Roy and S. Mukhopadhyay}, 36545 title = {Pattern Classification Using Linear Programming}, 36546 journal = {ORSA Journal on Computing}, 36547 year = {1990}, 36548 volume = {3}, 36549 pages = {66--80} 36550} 36551 36552@Book{ rubinstein:monte, 36553 author = {R. Rubinstein}, 36554 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 36555 Networks}, 36556 publisher = {Wiley}, 36557 address = {New York, NY}, 36558 year = {1986} 36559} 36560 36561@Article{ ruchala.olivera.ea:comparison, 36562 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 36563 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 36564 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 36565 journal = {Physics in Medicine and Biology, forthcoming}, 36566 year = {1999} 36567} 36568 36569@Book{ rudin:principles, 36570 author = {W. Rudin}, 36571 title = {Principles of Mathematical Analysis}, 36572 year = {1976}, 36573 publisher = {McGraw--Hill}, 36574 address = {Tokyo, Japan}, 36575 edition = {Third} 36576} 36577 36578@Book{ rudin:real, 36579 author = {W. Rudin}, 36580 title = {Real and Complex Analysis}, 36581 year = {1974}, 36582 publisher = {McGraw--Hill}, 36583 address = {Tokyo, Japan}, 36584 edition = {Second} 36585} 36586 36587@InProceedings{ rumelhart.hinton.ea:learning, 36588 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 36589 title = {Learning Internal Representations by Error Propagation}, 36590 booktitle = {Parallel Distributed Processing}, 36591 year = {1986}, 36592 editor = {D. E. Rumelhart and J. L. McClelland}, 36593 publisher = {MIT Press}, 36594 address = {Cambridge, Massachusetts}, 36595 pages = {318--362} 36596} 36597 36598@Book{ rumelhart.mcclelland:parallel, 36599 author = {D. E. Rumelhart and J. L. McClelland}, 36600 title = {Parallel Distributed Processing}, 36601 year = {1986}, 36602 publisher = {MIT Press}, 36603 address = {Cambridge, Massachusetts} 36604} 36605 36606@InCollection{ ruszczynski:regularized, 36607 author = {A. Ruszczynski}, 36608 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 36609 year = {1995}, 36610 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 36611 editor = {K. Marti and P. Kall}, 36612 publisher = {Springer-Verlag}, 36613 address = {Berlin}, 36614 volume = {425}, 36615 series = {Lecture Notes in Control and Information Sciences}, 36616 pages = {93--108} 36617} 36618 36619@Article{ rutherford.rutstrom.ea:lacord, 36620 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 36621 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 36622 quantitative}, 36623 journal = {Revue d' Economie du developpement}, 36624 year = {1994} 36625} 36626 36627@InCollection{ rutherford.tarr:blueprints, 36628 author = {T. Rutherford and D. Tarr}, 36629 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 36630 Open Economy}, 36631 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 36632 publisher = {Cambridge University Press}, 36633 year = {1997}, 36634 editor = {R. Baldwin and J. Francois}, 36635 address = {New York} 36636} 36637 36638@Article{ rutherford:applied, 36639 author = {T. F. Rutherford}, 36640 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 36641 Overview of the Modeling Framework and Syntax}, 36642 year = {1999}, 36643 volume = {14}, 36644 pages = {1--46}, 36645 journal = {Computational Economics} 36646} 36647 36648@PhDThesis{ rutherford:applied*1, 36649 author = {T. F. Rutherford}, 36650 title = {Applied General Equilibrium Modeling}, 36651 school = {Stanford University}, 36652 year = {1987} 36653} 36654 36655@Article{ rutherford:extensions, 36656 author = {T. F. Rutherford}, 36657 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 36658 Analysis}, 36659 journal = {Journal of Economic Dynamics and Control}, 36660 volume = {19}, 36661 pages = {1299--1324}, 36662 year = {1995} 36663} 36664 36665@Misc{ rutherford:gnuplot, 36666 author = {T. F. Rutherford}, 36667 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 36668 organization = {Department of Economics, University of Colorado}, 36669 address = {Boulder, Colorado}, 36670 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 36671} 36672 36673@Unpublished{ rutherford:miles, 36674 author = {T. F. Rutherford}, 36675 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 36676 year = {1993}, 36677 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 36678} 36679 36680@TechReport{ rutherford:modeling, 36681 author = {T. F. Rutherford}, 36682 title = {A Modeling System for Applied General Equilibrium Analysis}, 36683 type = {Cowles Foundation Discussion Paper}, 36684 number = {836}, 36685 institution = {Yale University}, 36686 year = {1987} 36687} 36688 36689@TechReport{ rutherford:mpsge, 36690 author = {T. F. Rutherford}, 36691 title = {{MPSGE}}, 36692 institution = {University of Western Ontario}, 36693 year = {1988}, 36694 address = {London, Ontario} 36695} 36696 36697@Article{ rykov:simplex, 36698 author = {A. S. Rykov}, 36699 title = {Simplex Direct Search Algorithms}, 36700 journal = {Automation and Remote Control}, 36701 year = {1980}, 36702 volume = {41}, 36703 pages = {784--793} 36704} 36705 36706@Article{ saad.schultz:gmres, 36707 author = {Y. Saad and M. Schultz}, 36708 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 36709 Linear Systems}, 36710 journal = {SIAM Journal on Scientific and Statistical Computing}, 36711 year = {1986}, 36712 volume = {44}, 36713 pages = {856--869} 36714} 36715 36716@Book{ saad:iterative, 36717 author = {Y. Saad}, 36718 title = {Iterative Methods for Sparse Linear Systems}, 36719 year = {1996}, 36720 publisher = {PWS Publishing Company}, 36721 address = {Boston, Massachusetts} 36722} 36723 36724@Article{ sahni:approximate, 36725 author = {S. Sahni}, 36726 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 36727 journal = {jacm}, 36728 year = {1975}, 36729 volume = {22}, 36730 pages = {115--124} 36731} 36732 36733@InProceedings{ sauer.shepard.ea:comparison, 36734 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 36735 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 36736 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36737 Radiation Therapy, Salt Lake City}, 36738 year = {1997}, 36739 editor = {D. D. Leavitt and G. Starkshall}, 36740 publisher = {Medical Physics Publishing}, 36741 address = {St. Louis, Missouri} 36742} 36743 36744@Article{ sauer.xu:multivariate, 36745 author = {Th. Sauer and Y. Xu}, 36746 title = {On Multivariate {L}agrange Interpolation}, 36747 journal = {Mathematics of Computation}, 36748 year = {1995}, 36749 volume = {64}, 36750 pages = {1147--1170} 36751} 36752 36753@Article{ savelsbergh:preprocessing, 36754 author = {M. W. P. Savelsbergh}, 36755 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 36756 journal = {ORSA Journal on Computing}, 36757 year = {1994}, 36758 volume = {6}, 36759 pages = {445--454} 36760} 36761 36762@Article{ scarf:approximation, 36763 author = {H. E. Scarf}, 36764 title = {The Approximation of Fixed Points of a Continuous Mapping}, 36765 journal = {SIAM Journal on Applied Mathematics}, 36766 year = {1967}, 36767 volume = {15}, 36768 pages = {1328--1343} 36769} 36770 36771@Book{ scarf:computation, 36772 author = {H. E. Scarf}, 36773 title = {The Computation of Economic Equilibria}, 36774 year = {1973}, 36775 publisher = {Yale University Press}, 36776 address = {New Haven, Connecticut} 36777} 36778 36779@TechReport{ scheel.scholtes:mathematical, 36780 author = {H. Scheel and S. Scholtes}, 36781 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 36782 and Sensitivity}, 36783 institution = {Judge Institute of Management Studies, University of Cambridge}, 36784 year = {1998}, 36785 type = {Technical Report}, 36786 address = {Cambridge, England} 36787} 36788 36789@Article{ schlick:modified, 36790 author = {T. Schlick}, 36791 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 36792 journal = {SIAM Journal on Scientific Computing}, 36793 year = {1993}, 36794 volume = {14}, 36795 pages = {424--445} 36796} 36797 36798@Article{ schnabel.eskow:modified, 36799 author = {R. B. Schnabel and E. Eskow}, 36800 title = {A New Modified {C}holesky Factorization}, 36801 journal = {SIAM Journal on Scientific and Statistical Computing}, 36802 year = {1991}, 36803 volume = {11}, 36804 pages = {1136--1158} 36805} 36806 36807@Article{ schneider.zenios:comparative, 36808 author = {M. H. Schneider and S. A. Zenios}, 36809 title = {A Comparative Study of Algorithms for Matrix Balancing}, 36810 journal = {Operations Research}, 36811 year = {1990}, 36812 volume = {38}, 36813 pages = {439--455} 36814} 36815 36816@Book{ scholkopf.burges.ea:advances, 36817 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 36818 title = {Advances in Kernel Methods: Support Vector Machines}, 36819 publisher = {MIT Press}, 36820 address = {Cambridge, MA }, 36821 year = {1998}, 36822 isbn = {0-262-19416-3} 36823} 36824 36825@Article{ scholtes.stohr:exact, 36826 author = {S. Scholtes and M. St{\"{o}}hr}, 36827 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 36828 journal = {SIAM Journal on Control and Optimization}, 36829 volume = {37}, 36830 pages = {617--652}, 36831 year = {1999} 36832} 36833 36834@TechReport{ scholtes:introduction, 36835 author = {S. Scholtes}, 36836 title = {Introduction to piecewise differentiable equations}, 36837 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 36838 Universit{\"{a}}t Karlsruhe}, 36839 year = {1994}, 36840 type = {Preprint}, 36841 number = {No. 53/1994}, 36842 address = {Karlsruhe, Germany} 36843} 36844 36845@Article{ schramm.zowe:version, 36846 author = {H. Schramm and J. Zowe}, 36847 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 36848 Idea, Convergence Analysis, Numerical Results}, 36849 journal = {SIAM Journal on Optimization}, 36850 year = {1992}, 36851 volume = {2}, 36852 pages = {121--152} 36853} 36854 36855@Article{ schultz.meyer:interior, 36856 author = {G. L. Schultz and R. R. Meyer}, 36857 title = {An Interior Point Method for Block Angular Optimization}, 36858 journal = {SIAM Journal on Optimization}, 36859 year = {1991}, 36860 volume = {1}, 36861 pages = {583--602} 36862} 36863 36864@InProceedings{ sekiguchi.sato.ea:ninf, 36865 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 36866 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 36867 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 36868 year = {1996}, 36869 address = {Santa Fe} 36870} 36871 36872@InCollection{ sellami.robinson:homotopies, 36873 author = {H. Sellami and S. M. Robinson}, 36874 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 36875 Inequalities}, 36876 booktitle = {Nonlinear Optimization and Applications}, 36877 editor = {G. Di Pillo and F. Giannessi}, 36878 year = {1996}, 36879 pages = {327--343}, 36880 publisher = {Plenum Press}, 36881 address = {New York} 36882} 36883 36884@Article{ sellami.robinson:implementation, 36885 author = {H. Sellami and S. M. Robinson}, 36886 title = {Implementation of a Continuation Method for Normal Maps}, 36887 journal = {Mathematical Programming}, 36888 year = {1997}, 36889 volume = {76}, 36890 pages = {563--578} 36891} 36892 36893@PhDThesis{ sellami:continuation, 36894 author = {H. Sellami}, 36895 title = {A Continuation Method for Normal Maps}, 36896 school = {University of Wisconsin -- Madison}, 36897 year = {1994}, 36898 address = {Madison, Wisconsin} 36899} 36900 36901@Article{ sellami:homotopy, 36902 author = {H. Sellami}, 36903 title = {A Homotopy Continuation Method for Normal Maps}, 36904 journal = {Mathematical Programming}, 36905 vol = {82}, 36906 year = {1998}, 36907 pages = {317--337} 36908} 36909 36910@Book{ seuss:one, 36911 author = {{Dr.} A. Seuss}, 36912 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 36913 year = {1960}, 36914 publisher = {Beginner Books}, 36915 address = {New York}, 36916 series = {Beginner Books, B13}, 36917 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 36918 Yink, Yop, Gack, and the Zeds} 36919} 36920 36921@Article{ seyfferth.pfeiffer:dynamics, 36922 author = {W. Seyfferth and F. Pfeiffer}, 36923 title = {Dynamics of Assembly Processes With a Manipulator}, 36924 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 36925 and Systems}, 36926 year = {1992}, 36927 pages = {1303--1310} 36928} 36929 36930@Article{ shanno.simantiraki:infeasible, 36931 author = {D. Shanno and E. Simantiraki}, 36932 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 36933 year = {1997}, 36934 journal = {SIAM Journal on Optimization}, 36935 volume = {7}, 36936 pages = {620--640} 36937} 36938 36939@InProceedings{ shanno.simantiraki:interior, 36940 author = {D. Shanno and E. Simantiraki}, 36941 title = {Interior Point Methods for Linear and Nonlinear Programming}, 36942 booktitle = {State of the Art in Numerical Analysis}, 36943 year = {1997}, 36944 editor = {I. S. Duff and G. A. Watson}, 36945 publisher = {Oxford University Press}, 36946 address = {Oxford} 36947} 36948 36949@Article{ shannon:introduction, 36950 author = {R. E. Shannon}, 36951 title = {Introduction to the Art and Science of simulation}, 36952 journal = {WSC98 1998 Winter simulation conference proceedings}, 36953 year = {1998}, 36954 volume = {1}, 36955 pages = {7--14} 36956} 36957 36958@TechReport{ shapiro:concepts, 36959 author = {A. Shapiro}, 36960 title = {On Concepts of Directional Differentiability}, 36961 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 36962 year = {1988}, 36963 address = {Pretoria, South Africa}, 36964 number = {73/88(18)}, 36965 type = {Research Report} 36966} 36967 36968@Book{ shavlik.editors:readings, 36969 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 36970 title = {Readings in Machine Learning}, 36971 year = {1990}, 36972 publisher = {Morgan Kaufman}, 36973 address = {San Mateo, California} 36974} 36975 36976@Article{ shavlik.mooney.ea:symbolic, 36977 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 36978 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 36979 journal = {Machine Learning}, 36980 year = {1991}, 36981 volume = {6}, 36982 pages = {111--143} 36983} 36984 36985@Book{ sheffi:urban, 36986 author = {Y. Sheffi}, 36987 title = {Urban Transportation Networks}, 36988 publisher = {Prentice-Hall, Inc}, 36989 year = {1985}, 36990 address = {Englewood Cliffs, New Jersey} 36991} 36992 36993@Article{ sheng.potra:quadratically, 36994 author = {R. Sheng and F. A. Potra}, 36995 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 36996 Polynomial {CO}mplexity}, 36997 journal = {SIAM Journal on Optimization}, 36998 year = {1997}, 36999 volume = {7}, 37000 pages = {304--317} 37001} 37002 37003@InProceedings{ shepard.angelos.ea:simple, 37004 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 37005 title = {A Simple Model for Examining Radiotherapy Optimization}, 37006 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 37007 Radiation Therapy, Salt Lake City}, 37008 year = {1997}, 37009 editor = {D. D. Leavitt and G. Starkshall}, 37010 publisher = {Medical Physics Publishing}, 37011 address = {St. Louis, Missouri} 37012} 37013 37014@Article{ shepard.ferris.ea:inverse, 37015 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 37016 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 37017 journal = {Medical Physics}, 37018 volume = {27}, 37019 pages = {12}, 37020 year = {2000}, 37021 key = {93} 37022} 37023 37024@Article{ shepard.ferris.ea:optimizing, 37025 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 37026 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 37027 journal = {SIAM Review}, 37028 volume = {41}, 37029 pages = {721--744}, 37030 year = {1999}, 37031 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 37032 key = {68}, 37033 institution = {Computer Sciences Department, University of Wisconsin}, 37034 address = {Madison, Wisconsin}, 37035 number = {98-07}, 37036 type = {Mathematical Programming Technical Report} 37037} 37038 37039@Article{ sherali.shetty:finitely, 37040 author = {H. D. Sherali and C. M. Shetty}, 37041 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 37042 Cuts and Disjunctive Face Cuts}, 37043 journal = {Mathematical Programming}, 37044 year = {1980}, 37045 volume = {19}, 37046 pages = {14--31} 37047} 37048 37049@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 37050 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 37051 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 37052 journal = {Operations Research}, 37053 year = {1983}, 37054 volume = {31}, 37055 pages = {253--276} 37056} 37057 37058@Article{ shi.olafsson.ea:hybrid, 37059 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 37060 title = {A New Hybrid Optimization Algorithm}, 37061 journal = {Computers and Industrial Engineering}, 37062 year = {1999}, 37063 volume = {36}, 37064 pages = {409--426} 37065} 37066 37067@PhDThesis{ shiau:iterative, 37068 author = {T.--H. Shiau}, 37069 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 37070 school = {Computer Sciences Department, University of Wisconsin}, 37071 year = {1983}, 37072 address = {Madison, Wisconsin}, 37073 note = {Technical Report 507} 37074} 37075 37076@InProceedings{ shor:generalized, 37077 crossref = {bachem.grotschel.ea:mathematical}, 37078 author = {N. Z. Shor}, 37079 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 37080 Dilation Operations}, 37081 pages = {501--529} 37082} 37083 37084@Book{ shor:minimization, 37085 author = {N. Z. Shor}, 37086 title = {Minimization Methods for Nondifferentiable Functions}, 37087 year = {1985}, 37088 publisher = {Springer-Verlag}, 37089 address = {Berlin} 37090} 37091 37092@Article{ shoven.whalley:applied, 37093 author = {J. Shoven and J. Whalley}, 37094 title = {Applied General Equilibrium Models of Taxation and International Trade: 37095 Introduction and Survey}, 37096 journal = {Journal of Economic Literature}, 37097 year = {1984}, 37098 volume = {22}, 37099 pages = {1007--1051} 37100} 37101 37102@Article{ shultz.meyer:interior, 37103 author = {G. L. Shultz and R. R. Meyer}, 37104 title = {An Interior Point Method for Block Angular Optimization}, 37105 journal = {SIAM Journal on Optimization}, 37106 year = {1991}, 37107 volume = {1}, 37108 pages = {583--602} 37109} 37110 37111@Article{ shultz.schnabel.ea:family, 37112 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 37113 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 37114 journal = {SIAM Journal on Numerical Analysis}, 37115 year = {1985}, 37116 volume = {22}, 37117 pages = {44--67} 37118} 37119 37120@Article{ sibony:methodes, 37121 author = {M. Sibony}, 37122 title = {Methodes iteratives pur les equations et inequations aux derives partielles 37123 nonlineaires de type monotone}, 37124 journal = {Calcolo}, 37125 year = {1970}, 37126 volume = {7}, 37127 pages = {65--183} 37128} 37129 37130@Article{ sidney:optimal, 37131 author = {J. B. Sidney}, 37132 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 37133 journal = {Operations Research}, 37134 year = {1977}, 37135 volume = {25}, 37136 pages = {62--69} 37137} 37138 37139@Book{ siegel:corba, 37140 author = {J. Siegel}, 37141 title = {{CORBA} - Fundamentals and Programming}, 37142 publisher = {John Wiley \& Sons}, 37143 year = {1996}, 37144 address = {New York, New York} 37145} 37146 37147@TechReport{ simantiraki.shanno:infeasible-interior-point, 37148 author = {E. Simantiraki and D. F. Shanno}, 37149 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 37150 type = {Research Report}, 37151 number = {7-95}, 37152 institution = {Rutgers Center for Operations Research, Rutgers University}, 37153 address = {New Brunswick, New Jersey}, 37154 year = {1995} 37155} 37156 37157@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 37158 author = {E. Simantiraki and D. F. Shanno}, 37159 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 37160 Problems}, 37161 crossref = {ferris.pang:complementarity}, 37162 pages = {386--404} 37163} 37164 37165@Book{ simpson:artificial, 37166 author = {P. K. Simpson}, 37167 title = {Artificial Neural Systems}, 37168 year = {1990}, 37169 publisher = {Pergamon Press}, 37170 address = {New York} 37171} 37172 37173@Article{ smeers:computable, 37174 author = {Y. Smeers}, 37175 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 37176 and Gas Markets}, 37177 journal = {The Energy Journal}, 37178 year = {1997}, 37179 optkey = {}, 37180 optvolume = {18}, 37181 optnumber = {}, 37182 optmonth = {}, 37183 optpages = {1--32}, 37184 optnote = {}, 37185 optannote = {} 37186} 37187 37188@Article{ smith:design, 37189 author = {F. W. Smith}, 37190 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 37191 Procedures}, 37192 journal = {IEEE Transactions on Computers}, 37193 year = {1969}, 37194 volume = {18}, 37195 pages = {367--372} 37196} 37197 37198@Article{ smith:existence, 37199 author = {M. J. Smith}, 37200 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 37201 journal = {Transportation Research}, 37202 year = {1979}, 37203 volume = {13B}, 37204 pages = {295--304} 37205} 37206 37207@Article{ smith:existence*1, 37208 author = {M. J. Smith}, 37209 title = {The existence and calculation of traffic equilibria}, 37210 journal = {Transportation Research}, 37211 volume = {17B}, 37212 year = {1983}, 37213 pages = {291--303} 37214} 37215 37216@Article{ smith:pattern, 37217 author = {F. W. Smith}, 37218 title = {Pattern Classifier Design by Linear Programming}, 37219 journal = {IEEE Transactions on Computers}, 37220 year = {1968}, 37221 volume = {C-17}, 37222 pages = {367--372} 37223} 37224 37225@Article{ solodov.svaiter:projection, 37226 author = {M. V. Solodov and B. F. Svaiter}, 37227 title = {A New Projection Method for Variational Inequality Problems}, 37228 journal = {SIAM Journal on Control and Optimization}, 37229 volume = {37}, 37230 pages = {765--776}, 37231 year = {1999} 37232} 37233 37234@Article{ solodov.tseng:modified, 37235 author = {M. V. Solodov and P. Tseng}, 37236 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 37237 year = {1996}, 37238 journal = {SIAM Journal on Control and Optimization}, 37239 pages = {1814--1830}, 37240 volume = {34} 37241} 37242 37243@Article{ solodov:stationary, 37244 author = {M. V. Solodov}, 37245 title = {Stationary Points of Bound Constrained Minimization Reformulations of 37246 Complementarity Problems}, 37247 journal = {Journal of Optimization Theory and Applications, forthcoming}, 37248 year = {1997} 37249} 37250 37251@Article{ spendley.hext.ea:sequential, 37252 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 37253 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 37254 Operation}, 37255 journal = {Technometrics}, 37256 year = {1962}, 37257 pages = {441--461}, 37258 volume = {4} 37259} 37260 37261@Article{ spingarn:applications, 37262 author = {J. E. Spingarn}, 37263 title = {Applications of the Method of Partial Inverses to Convex Programming}, 37264 journal = {Mathematical Programming}, 37265 year = {1985}, 37266 volume = {32}, 37267 pages = {199--223} 37268} 37269 37270@Book{ srinivasan.whalley:general, 37271 author = {T. Srinivasan and J. Whalley}, 37272 title = {General Equilibrium Trade Policy Modelling}, 37273 publisher = {MIT Press}, 37274 year = {1986}, 37275 address = {Boston} 37276} 37277 37278@Book{ stackelberg:theory, 37279 author = {H. Van Stackelberg}, 37280 title = {The Theory of Market Economy}, 37281 publisher = {Oxford University Press}, 37282 year = {1952} 37283} 37284 37285@Article{ stavroulakis.panagiotopoulos.ea:rigid, 37286 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 37287 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 37288 Applications}, 37289 journal = {Computers \& Structures}, 37290 volume = {40}, 37291 year = {1991}, 37292 pages = {599--614} 37293} 37294 37295@Article{ stavroulakis:optimal, 37296 author = {G. E. Stavroulakis}, 37297 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 37298 optimal control problem for variational inequalities}, 37299 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 37300 year = {1996} 37301} 37302 37303@Article{ stavroulakis:optimal*1, 37304 author = {G. E. Stavroulakis}, 37305 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 37306 journal = {Archives of Applied Mechanics, forthcoming}, 37307 year = {1996} 37308} 37309 37310@Book{ steenbrink:optimization, 37311 author = {P. A. Steenbrink}, 37312 title = {Optimization of Transport Networks}, 37313 publisher = {John Wiley \& Sons}, 37314 address = {London, England}, 37315 year = {1974} 37316} 37317 37318@Article{ stephens:asymptotic, 37319 author = {M. A. Stephens}, 37320 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 37321 journal = {Annals of Statistics}, 37322 year = {1976}, 37323 volume = {4}, 37324 pages = {357--369} 37325} 37326 37327@Article{ stephens:edf, 37328 author = {M. A. Stephens}, 37329 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 37330 journal = {Journal of the American Statistical Association}, 37331 year = {1974}, 37332 volume = {69}, 37333 pages = {730--737} 37334} 37335 37336@Article{ stevens:location, 37337 author = {B. H. Stevens}, 37338 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 37339 journal = {Papers of the Regional Science Association}, 37340 year = {1968}, 37341 volume = {21}, 37342 pages = {19--34} 37343} 37344 37345@Article{ stewart.trinkle:implicit, 37346 author = {D. E. Stewart and J. C. Trinkle}, 37347 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 37348 Collisions and {C}oulomb Friction}, 37349 journal = {International Journal for Numerical Methods in Engineering}, 37350 year = {1996}, 37351 volume = {39}, 37352 pages = {2673--2691} 37353} 37354 37355@Book{ stoer.bulirsch:introduction, 37356 author = {J. Stoer and R. Bulirsch}, 37357 title = {Introduction to Numerical Analysis}, 37358 year = {1980}, 37359 publisher = {Springer-Verlag}, 37360 address = {New York} 37361} 37362 37363@Article{ stoer:complexity, 37364 author = {J. Stoer}, 37365 title = {The complexity of an infeasible interior--point path--following method for the 37366 solution of linear programs}, 37367 journal = {Optimization Methods and Software}, 37368 year = {1994}, 37369 volume = {3}, 37370 pages = {1--12} 37371} 37372 37373@Article{ stone:cross-validatory, 37374 author = {M. Stone}, 37375 title = {Cross-validatory choice and assessment of statistical predictions}, 37376 journal = {Journal of the Royal Statistical Society}, 37377 year = {1974}, 37378 volume = {36}, 37379 pages = {111--147} 37380} 37381 37382@Article{ stone.smith.ea:inverse, 37383 author = {R. A. Stone and V. Smith and L. Verhey}, 37384 title = {Inverse Planning for the {G}amma {K}nife}, 37385 journal = {Medical Physics}, 37386 year = {1993}, 37387 volume = {20}, 37388 pages = {865} 37389} 37390 37391@Book{ strang:linear, 37392 author = {G. Strang}, 37393 title = {Linear Algebra and its Applications}, 37394 year = {1980}, 37395 publisher = {Academic Press}, 37396 address = {New York}, 37397 edition = {Second} 37398} 37399 37400@InProceedings{ street.wolberg.ea:nuclear, 37401 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 37402 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 37403 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 37404 year = {1993}, 37405 publisher = {SPIE--The International Society for Optical Engineering}, 37406 address = {San Jose, California}, 37407 pages = {861--870}, 37408 volume = {1905} 37409} 37410 37411@Article{ subramanian:gauss-newton, 37412 author = {P. K. Subramanian}, 37413 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 37414 journal = {Journal of Optimization Theory and Applications}, 37415 year = {1993}, 37416 volume = {77}, 37417 pages = {467--482} 37418} 37419 37420@PhDThesis{ subramanian:iterative, 37421 author = {P. K. Subramanian}, 37422 title = {Iterative Methods of Solution for Complementarity Problems}, 37423 year = {1985}, 37424 address = {Madison, Wisconsin}, 37425 school = {Computer Sciences Department, University of Wisconsin} 37426} 37427 37428@TechReport{ subramanian:note, 37429 author = {P. K. Subramanian}, 37430 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 37431 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 37432 year = {1985}, 37433 address = {Madison, Wisconsin}, 37434 number = {2844}, 37435 type = {Technical Summary Report} 37436} 37437 37438@TechReport{ suh.gucht:distributed, 37439 author = {J. Y. Suh and D. Van Gucht}, 37440 title = {Distributed Genetic Algorithms}, 37441 institution = {Computer Science Department, Indiana University}, 37442 year = {1987}, 37443 address = {Bloomington}, 37444 number = {225} 37445} 37446 37447@Article{ sun.natori.ea:computational, 37448 author = {S. M. Sun and M. C. Natori and K. C. Park}, 37449 title = {A Computational Procedure for Flexible Beams with Frictional Contact 37450 Constraints}, 37451 journal = {International Journal for Numerical Methods in Engineering}, 37452 volume = {36}, 37453 pages = {3781--3800}, 37454 year = {1993} 37455} 37456 37457@Article{ sun.qi:ncp-functions, 37458 author = {D. Sun and L. Qi}, 37459 title = {On {NCP}-Functions}, 37460 journal = {Computational Optimization and Applications, forthcoming}, 37461 year = {1998} 37462} 37463 37464@Article{ sun.womersley:unconstrained, 37465 author = {D. Sun and R. S. Womersley}, 37466 title = {A new unconstrained differentiable merit function for box constrained variational 37467 inequality problems and a damped {G}auss-{N}ewton method}, 37468 journal = {SIAM Journal on Optimization}, 37469 year = {1999}, 37470 volume = {9}, 37471 pages = {388--413} 37472} 37473 37474@Article{ sun:class, 37475 author = {D. Sun}, 37476 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 37477 journal = {Journal of Optimization Theory and Applications}, 37478 year = {1996}, 37479 volume = {91}, 37480 pages = {123--140} 37481} 37482 37483@PhDThesis{ sun:monotropic, 37484 author = {J. Sun}, 37485 title = {On Monotropic Piecewise Quadratic Programming}, 37486 school = {University of Washington}, 37487 year = {1986}, 37488 address = {Seattle, Washington} 37489} 37490 37491@Article{ sun:thermal, 37492 author = {D. C. Sun}, 37493 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 37494 journal = {Journal of Applied Mechanics}, 37495 volume = {58}, 37496 pages = {141--153}, 37497 year = {1991} 37498} 37499 37500@Article{ sundararaghavan.ahmed:minimizing, 37501 author = {P. S. Sundararaghavan and M. U. Ahmed}, 37502 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 37503 Scheduling}, 37504 journal = {Naval Research Logistics Quarterly}, 37505 year = {1984}, 37506 volume = {31}, 37507 pages = {325--333} 37508} 37509 37510@TechReport{ sznajder.gowda:generalizations, 37511 author = {R. Sznajder and M. S. Gowda}, 37512 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 37513 horizontal {LCP}s}, 37514 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 37515 year = {1992}, 37516 address = {Catonsville, Maryland}, 37517 number = {92--16}, 37518 type = {Research Report} 37519} 37520 37521@Article{ sznajder.gowda:nondegeneracy, 37522 author = {R. Sznajder and M. S. Gowda}, 37523 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 37524 journal = {Mathematics of Operations Research}, 37525 year = {1998}, 37526 volume = {23}, 37527 pages = {221--238} 37528} 37529 37530@Article{ taji.fukushima.ea:globally, 37531 author = {K. Taji and M. Fukushima and T. Ibaraki}, 37532 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 37533 Inequalities}, 37534 journal = {Mathematical Programming}, 37535 year = {1993}, 37536 volume = {58}, 37537 pages = {369--383} 37538} 37539 37540@Article{ taji.fukushima:optimization, 37541 author = {K. Taji and M. Fukushima}, 37542 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 37543 Problem}, 37544 journal = {Journal of the Operations Research Society of Japan}, 37545 year = {1994}, 37546 volume = {37}, 37547 pages = {310--331} 37548} 37549 37550@Article{ talbot.patterson.ea:comparative, 37551 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 37552 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 37553 journal = {Management Science}, 37554 year = {1986}, 37555 volume = {32}, 37556 pages = {430--454} 37557} 37558 37559@Article{ talman.yamamoto:simplicial, 37560 author = {A. J. J. Talman and Y. Yamamoto}, 37561 title = {A {S}implicial Algorithm for Stationary Point Problems}, 37562 journal = {Mathematics of Operations Research}, 37563 year = {1989}, 37564 volume = {14}, 37565 pages = {383--399} 37566} 37567 37568@InProceedings{ tanese:distributed, 37569 crossref = {schaeffer:third}, 37570 author = {R. Tanese}, 37571 title = {Distributed Genetic Algorithms}, 37572 pages = {434--439} 37573} 37574 37575@InProceedings{ tanese:parallel, 37576 crossref = {grefenstette:genetic}, 37577 author = {R. Tanese}, 37578 title = {Parallel Genetic Algorithms for a Hypercube}, 37579 pages = {177--183} 37580} 37581 37582@Article{ teboulle:entropic, 37583 author = {M. Teboulle}, 37584 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 37585 year = {1992}, 37586 journal = {Mathematics of Operations Research}, 37587 volume = {17}, 37588 pages = {670--690} 37589} 37590 37591@Article{ thuente:duality, 37592 author = {D. J. Thuente}, 37593 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 37594 journal = {Operations Research}, 37595 year = {1980}, 37596 volume = {28}, 37597 pages = {1005--1011} 37598} 37599 37600@Book{ tikhonov.arsenin:solutions, 37601 author = {A. N. Tikhonov and V. Y. Arsenin}, 37602 title = {Solutions of Ill--Posed Problems}, 37603 year = {1977}, 37604 publisher = {John Wiley \& Sons}, 37605 address = {New York} 37606} 37607 37608@InProceedings{ tin-loi.ferris:complementarity, 37609 author = {F. Tin-Loi and M. C. Ferris}, 37610 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 37611 booktitle = {Computational Mechanics for the Next Millenium}, 37612 key = {79}, 37613 pages = {1029--1036}, 37614 year = {1999}, 37615 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 37616 volume = {2}, 37617 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 37618 Mechanics}, 37619 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 37620 publisher = {Elsevier Science Ltd}, 37621 type = {Mathematical Programming Technical Report}, 37622 institution = {Computer Sciences Department, University of Wisconsin}, 37623 address = {Madison, Wisconsin}, 37624 number = {99-02} 37625} 37626 37627@InProceedings{ tin-loi.ferris:holonomic, 37628 author = {F. Tin-Loi and M. C. Ferris}, 37629 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 37630 booktitle = {Advances in Fracture Research}, 37631 year = {1997}, 37632 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 37633 volume = {2}, 37634 publisher = {Pergamon Press}, 37635 pages = {2183--2190}, 37636 key = {53} 37637} 37638 37639@InProceedings{ tin-loi.ferris:simple, 37640 author = {F. Tin-Loi and M. C. Ferris}, 37641 title = {A Simple Mathematical Programming Method for a Structural Identification 37642 Problem}, 37643 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 37644 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 37645 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 37646 publisher = {Techno-Press}, 37647 address = {Korea}, 37648 year = {1997}, 37649 pages = {511--518}, 37650 key = {59} 37651} 37652 37653@Article{ tin-loi.misa:large, 37654 author = {F. Tin-Loi and J. S. Misa}, 37655 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 37656 journal = {International Journal for Numerical Methods in Engineering}, 37657 volume = {39}, 37658 pages = {741--762}, 37659 year = {1996} 37660} 37661 37662@Article{ tin-loi.pang:elastoplastic, 37663 author = {F. Tin-Loi and J. S. Pang}, 37664 title = {Elastoplastic analysis of structures with nonlinear hardening}, 37665 journal = {Computer Methods in Applied Mechanics and Engineering}, 37666 volume = {107}, 37667 year = {1993}, 37668 pages = {299--312} 37669} 37670 37671@Article{ tin-loi.vimonsatit:nonlinear, 37672 author = {F. Tin-Loi and V. Vimonsatit}, 37673 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 37674 journal = {Engineering Structures}, 37675 volume = {18}, 37676 year = {1996}, 37677 pages = {115--124} 37678} 37679 37680@Article{ tobin:uniqueness, 37681 author = {R. L. Tobin}, 37682 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 37683 journal = {Annals of Operations Research}, 37684 volume = {34}, 37685 year = {1992}, 37686 pages = {21--36} 37687} 37688 37689@Article{ tobin:variable, 37690 author = {R. L. Tobin}, 37691 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 37692 Problem}, 37693 journal = {Mathematical Programming}, 37694 year = {1988}, 37695 volume = {40}, 37696 pages = {33--51} 37697} 37698 37699@Article{ todd.burrell:extension, 37700 author = {M. J. Todd and B. P. Burrell}, 37701 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 37702 Variables}, 37703 journal = {Algorithmica}, 37704 year = {1986}, 37705 volume = {1}, 37706 pages = {409--424} 37707} 37708 37709@Book{ todd:computation, 37710 author = {M. J. Todd}, 37711 title = {Computation of Fixed Points and Applications}, 37712 publisher = {Springer-Verlag}, 37713 year = {1976}, 37714 volume = {124}, 37715 series = {Lecture Notes in Economics and Mathematical Systems}, 37716 address = {Heidelberg} 37717} 37718 37719@Article{ todd:note, 37720 author = {M. J. Todd}, 37721 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 37722 Production}, 37723 journal = {Journal of Mathematical Economics}, 37724 year = {1976}, 37725 volume = {6}, 37726 pages = {135--144} 37727} 37728 37729@Article{ toint:assesment, 37730 author = {Ph. L. Toint}, 37731 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37732 Optimization}, 37733 year = {1996}, 37734 journal = {SIAM Journal on Scientific Computing}, 37735 volume = {17}, 37736 pages = {725=-739} 37737} 37738 37739@TechReport{ toint:assesment*1, 37740 author = {Ph. L. Toint}, 37741 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37742 Optimization: The Complete Numerical Results}, 37743 institution = {Department of Mathematics, FUNDP}, 37744 year = {1994}, 37745 number = {94/15}, 37746 address = {Namur, Belgium} 37747} 37748 37749@Article{ toint:global, 37750 author = {Ph. L. Toint}, 37751 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 37752 in a {H}ilbert Space}, 37753 journal = {IMA Journal of Numerical Analysis}, 37754 year = {1988}, 37755 volume = {8}, 37756 pages = {231--252} 37757} 37758 37759@Article{ toint:non-monotone, 37760 author = {Ph. L. Toint}, 37761 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 37762 Convex Constraints}, 37763 year = {1997}, 37764 journal = {Mathematical Programming}, 37765 volume = {77}, 37766 pages = {69--94} 37767} 37768 37769@InCollection{ toint:transportation, 37770 author = {Ph. L. Toint}, 37771 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 37772 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 37773 Management}, 37774 publisher = {Springer-Verlag}, 37775 series = {NATO ASI Series F}, 37776 year = {1997}, 37777 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 37778} 37779 37780@Article{ tomlin.welch:finding, 37781 author = {J. Tomlin and J. Welch}, 37782 title = {Finding Duplicate Rows in a Linear Programming Model}, 37783 journal = {Operations Research Letters}, 37784 year = {1986}, 37785 volume = {5}, 37786 number = {1}, 37787 pages = {7--11} 37788} 37789 37790@Article{ torczon:convergence, 37791 author = {V. Torczon}, 37792 title = {On the Convergence of the Multidirectional Search Algorithm}, 37793 journal = {SIAM Journal on Optimization}, 37794 year = {1991}, 37795 volume = {1}, 37796 pages = {123--145} 37797} 37798 37799@Article{ torczon:convergence*1, 37800 author = {V. Torczon}, 37801 title = {On the Convergence of Pattern Search Algorithms}, 37802 journal = {SIAM Journal on Optimization}, 37803 year = {1997}, 37804 volume = {7}, 37805 pages = {1--25} 37806} 37807 37808@Misc{ torma.rutherford:general, 37809 author = {H. Torma and T. Rutherford}, 37810 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 37811 year = {1992}, 37812 howpublished = {Working Paper 15/1992}, 37813 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 37814} 37815 37816@Article{ trinkle.pang.ea:dynamic, 37817 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 37818 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 37819 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 37820 year = {1997}, 37821 pages = {267--279}, 37822 volume = {77} 37823} 37824 37825@InProceedings{ trinkle.pang:dynamic, 37826 author = {J. C. Trinkle and J. S. Pang}, 37827 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 37828 book = {{IEEE} International Conference on Robotics and Automation}, 37829 pages = {2276--2281}, 37830 year = {1997} 37831} 37832 37833@TechReport{ tseng.bertsekas:convergence, 37834 author = {P. Tseng and D. P. Bertsekas}, 37835 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 37836 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 37837 Technology}, 37838 year = {1990}, 37839 type = {technical report}, 37840 number = {LIDS-P-1995}, 37841 address = {Cambridge, MA} 37842} 37843 37844@Article{ tseng.yamashita.ea:equivalence, 37845 author = {P. Tseng and N. Yamashita and M. Fukushima}, 37846 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 37847 Approach}, 37848 year = {1996}, 37849 journal = {SIAM Journal on Optimization}, 37850 volume = {6}, 37851 pages = {446--460} 37852} 37853 37854@Article{ tseng:applications, 37855 author = {P. Tseng}, 37856 title = {Applications of a splitting algorithm to decomposition in convex programming and 37857 variational inequalities}, 37858 journal = {SIAM Journal on Control and Optimization}, 37859 year = {1991}, 37860 volume = {29}, 37861 pages = {119--138} 37862} 37863 37864@Article{ tseng:dual, 37865 author = {P. Tseng}, 37866 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 37867 Constraints: a Unified Approach}, 37868 journal = {SIAM Journal on Control and Optimization}, 37869 year = {1990}, 37870 volume = {28}, 37871 pages = {214--242} 37872} 37873 37874@Article{ tseng:dual*1, 37875 author = {P. Tseng}, 37876 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 37877 Unified Approach}, 37878 journal = {SIAM Journal on Control and Optimization}, 37879 year = {1990}, 37880 volume = {28}, 37881 pages = {214--242} 37882} 37883 37884@Article{ tseng:dual*2, 37885 author = {P. Tseng}, 37886 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 37887 journal = {Mathematical Programming}, 37888 year = {1993}, 37889 volume = {59}, 37890 pages = {231--248} 37891} 37892 37893@Article{ tseng:fortified-descent, 37894 author = {P. Tseng}, 37895 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 37896 journal = {SIAM Journal on Optimization}, 37897 volume = {10}, 37898 pages = {269--288}, 37899 year = {2000} 37900} 37901 37902@Article{ tseng:growth, 37903 author = {P. Tseng}, 37904 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 37905 Problem}, 37906 journal = {Journal of Optimization Theory and Applications}, 37907 volume = {89}, 37908 year = {1996}, 37909 pages = {17--37} 37910} 37911 37912@Unpublished{ tseng:matlab, 37913 author = {P. Tseng}, 37914 title = {Matlab Implementations of Complementarity Codes}, 37915 year = {1995}, 37916 note = {Private Communication} 37917} 37918 37919@Article{ ursescu:multifunctions, 37920 author = {C. Ursescu}, 37921 title = {Multifunctions with closed convex graph}, 37922 journal = {Czech. Math. J.}, 37923 year = {1975}, 37924 volume = {35}, 37925 pages = {438--441} 37926} 37927 37928@TechReport{ vaidya:algorithm, 37929 author = {P. M. Vaidya}, 37930 title = {An Algorithm for Linear Programming which Requires 37931 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 37932 institution = {AT\&T Bell Laboratories}, 37933 year = {1987}, 37934 address = {Murray Hill, New Jersey} 37935} 37936 37937@Article{ val:unloading, 37938 author = {P. Du Val}, 37939 title = {The Unloading Problem for Plane Curves}, 37940 journal = {American Journal of Mathematics}, 37941 year = {1940}, 37942 volume = {62}, 37943 pages = {307--311} 37944} 37945 37946@InCollection{ valentine:problem, 37947 author = {F. A. Valentine}, 37948 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 37949 Conditions}, 37950 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 37951 year = {1937}, 37952 publisher = {University of Chicago Press}, 37953 address = {Chicago}, 37954 pages = {407--448} 37955} 37956 37957@Article{ valle.poch.ea:comparison, 37958 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 37959 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 37960 Flow-Injection Systems}, 37961 journal = {Analytica Chimica Acta}, 37962 year = {1990}, 37963 volume = {241}, 37964 pages = {31--42} 37965} 37966 37967@Article{ vandenberghe.demoor.ea:generalized, 37968 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 37969 title = {The generalized linear complementarity problem applied to the complete analysis 37970 of resistive piecewise-linear circuits}, 37971 journal = {IEEE Transactions on Circuits and Systems}, 37972 volume = {36}, 37973 year = {1989}, 37974 pages = {1382--1391} 37975} 37976 37977@Article{ vanderbei.meketon.ea:modification, 37978 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 37979 title = {A Modification of {K}armarkar's Algorithm}, 37980 journal = {Algorithmica}, 37981 year = {1986}, 37982 volume = {1}, 37983 pages = {395--407} 37984} 37985 37986@Article{ vanderbei:affine-scaling, 37987 author = {R. J. Vanderbei}, 37988 title = {Affine--Scaling for Linear Programs with Free Variables}, 37989 journal = {Mathematical Programming}, 37990 year = {1989}, 37991 volume = {43}, 37992 pages = {31--44} 37993} 37994 37995@Article{ vanroy.wolsey:solving, 37996 author = {T. J. Van~Roy and L. A. Wolsey}, 37997 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 37998 journal = {Operations Research}, 37999 volume = {35}, 38000 pages = {45--57}, 38001 year = {1987} 38002} 38003 38004@Book{ vapnik:nature, 38005 author = {V. N. Vapnik}, 38006 title = {The Nature of Statistical Learning Theory}, 38007 publisher = {John Wiley \& Sons}, 38008 address = {New York}, 38009 year = {1996} 38010} 38011 38012@Book{ varian:microeconomic, 38013 author = {Hal R. Varian}, 38014 title = {Microeconomic Analysis}, 38015 year = {1978}, 38016 publisher = {W.W. Norton \& Company}, 38017 address = {New York, New York} 38018} 38019 38020@Article{ verhey:immobilizing, 38021 author = {L. J. Verhey}, 38022 title = {Immobilizing and Positioning Patients for Radiotherapy}, 38023 journal = {Seminars in Radiation Oncology}, 38024 year = {1995}, 38025 volume = {5}, 38026 number = {2}, 38027 pages = {100--113} 38028} 38029 38030@Article{ vinante.pintos:differentiable, 38031 author = {C. Vinante and S. Pintos}, 38032 title = {On Differentiable Exact Penalty Functions}, 38033 journal = {Journal of Optimization Theory and Applications}, 38034 year = {1986}, 38035 volume = {50}, 38036 pages = {479--493} 38037} 38038 38039@Article{ vlach:scheduling, 38040 author = {M. Vlach}, 38041 title = {On Scheduling with Earliness and Tardiness Penalties}, 38042 journal = {Methods of Operations Research}, 38043 year = {1983}, 38044 volume = {45}, 38045 pages = {367--375} 38046} 38047 38048@InCollection{ wacker:summary, 38049 author = {H.--J. Wacker}, 38050 title = {A Summary of the Developments on Imbedding Methods}, 38051 booktitle = {Continuation Methods}, 38052 year = {1978}, 38053 editor = {H.--J. Wacker}, 38054 publisher = {Academic Press}, 38055 address = {New York}, 38056 pages = {1--35} 38057} 38058 38059@Article{ wakefield.tin-loi:large, 38060 author = {R. R. Wakefield and F. Tin-Loi}, 38061 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 38062 Formulation}, 38063 journal = {Computer Methods in Applied Mechanics and Engineering}, 38064 volume = {84}, 38065 year = {1990}, 38066 pages = {229--242} 38067} 38068 38069@Article{ wakefield.tin-loi:large*1, 38070 author = {R. R. Wakefield and F. Tin-Loi}, 38071 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 38072 Approach}, 38073 journal = {International Journal Mechanical Science}, 38074 volume = {33}, 38075 year = {1991}, 38076 pages = {379--391} 38077} 38078 38079@Article{ walker:implementation, 38080 author = {H. F. Walker}, 38081 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 38082 journal = {SIAM Journal on Scientific Computing}, 38083 volume = {9}, 38084 year = {1988}, 38085 pages = {152--163} 38086} 38087 38088@Book{ wall.schwartz:programming, 38089 author = {L. Wall and R. L. Schwartz}, 38090 title = {Programming Perl}, 38091 publisher = {O'Reilly and Associates, Inc.}, 38092 address = {Sebastopol, CA}, 38093 year = {1991} 38094} 38095 38096@Book{ walras:elements, 38097 author = {L. Walras}, 38098 title = {Elements of Pure Economics}, 38099 publisher = {Allen and Unwin}, 38100 year = {1954}, 38101 address = {London} 38102} 38103 38104@Article{ wang.monteiro.ea:interior, 38105 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 38106 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 38107 journal = {Mathematical Programming}, 38108 volume = {74}, 38109 pages = {159--196}, 38110 year = {1996} 38111} 38112 38113@Article{ wardi:stochastic, 38114 author = {Y. Wardi}, 38115 title = {A Stochastic Steepest-Descent Algorithm}, 38116 journal = {Journal of Optimization Theory and Applications}, 38117 year = {1988}, 38118 volume = {59}, 38119 pages = {307--323} 38120} 38121 38122@Article{ wardi:stochastic*1, 38123 author = {Y. Wardi}, 38124 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 38125 journal = {Journal of Optimization Theory and Applications}, 38126 year = {1990}, 38127 volume = {64}, 38128 pages = {399--417} 38129} 38130 38131@Article{ wardrop:theoretical, 38132 author = {J. G. Wardrop}, 38133 title = {Some Theoretical Aspects of Road Traffic Research}, 38134 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 38135 year = {1952}, 38136 pages = {325--378} 38137} 38138 38139@Article{ warga:minimizing, 38140 author = {J. Warga}, 38141 title = {Minimizing certain convex functions}, 38142 journal = {Journal of SIAM on Applied Mathematics}, 38143 year = {1963}, 38144 volume = {11}, 38145 pages = {588--593} 38146} 38147 38148@Article{ watson.billups.ea:hompack, 38149 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 38150 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 38151 Algorithms}, 38152 journal = {{ACM} Transactions on Mathematical Software}, 38153 year = {1987}, 38154 volume = {13}, 38155 pages = {281--310} 38156} 38157 38158@Article{ watson.billups.ea:slow, 38159 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 38160 title = {Slow Viscous Flow in a Syringe}, 38161 journal = {Journal of Biomechanical Engineering}, 38162 year = {1986}, 38163 volume = {108}, 38164 pages = {317--323} 38165} 38166 38167@Article{ watson:discrete, 38168 author = {G. A. Watson}, 38169 title = {Discrete $\ell_1$ approximation by rational functions}, 38170 journal = {IMA Journal of Numerical Analysis}, 38171 year = {1984}, 38172 volume = {4}, 38173 pages = {275--288} 38174} 38175 38176@Article{ watson:solving, 38177 author = {L. T. Watson}, 38178 title = {Solving the nonlinear complementarity problem by a homotopy method}, 38179 journal = {SIAM Journal on Control and Optimization}, 38180 year = {1979}, 38181 volume = {17}, 38182 pages = {36--46} 38183} 38184 38185@Article{ webb:optimum, 38186 author = {S. Webb}, 38187 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 38188 Heterogeneity}, 38189 journal = {Physics in Medicine and Biology}, 38190 year = {1994}, 38191 volume = {39}, 38192 pages = {1895--1914} 38193} 38194 38195@Book{ webb:physics, 38196 author = {S. Webb}, 38197 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 38198 publisher = {Institute of Physics Publishing Ltd.}, 38199 year = {1997}, 38200 optaddress = {Philadelphia} 38201} 38202 38203@InBook{ webb:theory, 38204 author = {S. Webb}, 38205 editor = {E. Sternick}, 38206 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 38207 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 38208 publisher = {Advanced Medical Publishing}, 38209 year = {1997} 38210} 38211 38212@Book{ weiss.kulikowski:computer, 38213 author = {S. M. Weiss and C. A. Kulikowski}, 38214 title = {Computer Systems that Learn}, 38215 year = {1991}, 38216 publisher = {Morgan Kaufmann Publishers, Inc}, 38217 address = {San Mateo, California} 38218} 38219 38220@PhDThesis{ werbos:beyond, 38221 author = {P. J. Werbos}, 38222 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 38223 Sciences}, 38224 year = {1974}, 38225 school = {Harvard University} 38226} 38227 38228@InCollection{ wets:convergence, 38229 author = {R. J.-B. Wets}, 38230 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 38231 Problems}, 38232 booktitle = {Variational Inequalites and Complementarity Problems}, 38233 year = {1980}, 38234 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 38235 publisher = {John Wiley \& Sons}, 38236 address = {New York}, 38237 pages = {375--403} 38238} 38239 38240@InCollection{ wets:large, 38241 author = {R. J.-B. Wets}, 38242 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 38243 booktitle = {Numerical Techniques for Stochastic Optimization}, 38244 publisher = {Springer-Verlag}, 38245 year = {1988}, 38246 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 38247 address = {Berlin}, 38248 pages = {65--93} 38249} 38250 38251@Article{ white:asymptotic, 38252 author = {H. White}, 38253 title = {Some asymptotic results for learning in single hidden-layer feedforward network 38254 models}, 38255 journal = {Journal of the American Stattistical Association}, 38256 year = {1989}, 38257 volume = {84}, 38258 number = {408}, 38259 pages = {1003--1013} 38260} 38261 38262@Article{ white:learning, 38263 author = {H. White}, 38264 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 38265 journal = {Neural Computation}, 38266 year = {1989}, 38267 volume = {1}, 38268 pages = {425--461} 38269} 38270 38271@InProceedings{ whitley.starkweather.ea:scheduling, 38272 crossref = {schaeffer:third}, 38273 author = {D. Whitley and T. Starkweather and D. Fuquay}, 38274 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 38275 Operator}, 38276 pages = {133--140} 38277} 38278 38279@Book{ williams:model, 38280 author = {H. P. Williams}, 38281 title = {Model Building in Mathematical Programming}, 38282 publisher = {John Wiley \& Sons}, 38283 year = {1990}, 38284 edition = {Third} 38285} 38286 38287@Book{ wilmott.dewynne.ea:option, 38288 author = {P. Wilmott and J. Dewynne and S. Howison}, 38289 title = {Option Pricing}, 38290 publisher = {Oxford Financial Press}, 38291 year = {1993}, 38292 address = {Oxford, England} 38293} 38294 38295@PhDThesis{ wilson:simplicial, 38296 author = {R. B. Wilson}, 38297 title = {A Simplicial Algorithm for Concave Programming}, 38298 year = {1963}, 38299 address = {Boston, MA}, 38300 school = {Graduate School of Business Administration, Harvard University} 38301} 38302 38303@TechReport{ wolberg.bennett.ea:breast, 38304 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 38305 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 38306 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 38307 Wisconsin}, 38308 year = {1992}, 38309 address = {Madison, WI 53706}, 38310 type = {Manuscript} 38311} 38312 38313@Article{ wolberg.mangasarian:multisurface, 38314 author = {W. H. Wolberg and O. L. Mangasarian}, 38315 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 38316 Cytology}, 38317 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 38318 year = {1990}, 38319 volume = {87}, 38320 pages = {9193--9196} 38321} 38322 38323@Unpublished{ wolberg.mangasarian:wbcd, 38324 author = {W. H. Wolberg and O. L. Mangasarian}, 38325 title = {{WBCD: Wisconsin Breast Cancer Database}}, 38326 year = {1991}, 38327 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 38328 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 38329} 38330 38331@Article{ wolberg.street.ea:breast, 38332 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38333 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 38334 journal = {Analytical and Quantitative Cytology and Histology}, 38335 year = {1993}, 38336 volume = {15}, 38337 number = {6}, 38338 pages = {396--404} 38339} 38340 38341@Unpublished{ wolberg.street.ea:wdbc, 38342 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38343 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 38344 year = {1995}, 38345 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38346 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 38347} 38348 38349@Unpublished{ wolberg.street.ea:wpbc, 38350 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38351 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 38352 year = {1995}, 38353 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38354 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 38355} 38356 38357@Book{ wolsey:integer, 38358 author = {L. A. Wolsey}, 38359 title = {Integer Programming}, 38360 publisher = {John Wiley \& Sons}, 38361 year = {1998}, 38362 address = {New York, NY} 38363} 38364 38365@Article{ womersley:local, 38366 author = {R. S. Womersley}, 38367 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 38368 journal = {Mathematical Programming}, 38369 year = {1985}, 38370 volume = {32}, 38371 pages = {69--89} 38372} 38373 38374@Article{ woo.sanders.ea:peacock, 38375 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 38376 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 38377 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38378 year = {1994}, 38379 volume = {29}, 38380 number = {1}, 38381 pages = {213--214} 38382} 38383 38384@Article{ wright.ralph:superlinear, 38385 author = {S. J. Wright and D. Ralph}, 38386 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 38387 Problems}, 38388 year = {1996}, 38389 journal = {Mathematics of Operations Research}, 38390 volume = {21}, 38391 pages = {815--838} 38392} 38393 38394@TechReport{ wright.zhang:superquadratic, 38395 author = {S. J. Wright and Y. Zhang}, 38396 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 38397 problems}, 38398 institution = {Argonne National Laboratory}, 38399 year = {1994}, 38400 annote = {revised}, 38401 number = {MCS--P418--0294}, 38402 address = {Argonne, Illinois}, 38403 type = {Preprint} 38404} 38405 38406@TechReport{ wright:dynfgm, 38407 author = {S. E. Wright}, 38408 title = {{DYNFGM}: Dynamic Finite Generation Method}, 38409 institution = {Department of Mathematics, University of Washington}, 38410 year = {1989}, 38411 address = {Seattle, Washington} 38412} 38413 38414@Article{ wright:infeasible-interior-point, 38415 author = {S. J. Wright}, 38416 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 38417 journal = {Mathematical Programming}, 38418 volume = {67}, 38419 pages = {29--51}, 38420 year = {1994} 38421} 38422 38423@Article{ wright:path-following, 38424 author = {S. J. Wright}, 38425 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 38426 Complementarity Problems}, 38427 journal = {Optimization Methods and Software}, 38428 year = {1993}, 38429 volume = {2}, 38430 pages = {79--106} 38431} 38432 38433@TechReport{ wright:path-following*1, 38434 author = {S. J. Wright}, 38435 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 38436 Problems}, 38437 institution = {Argonne National Laboratory}, 38438 year = {1993}, 38439 number = {MCS--P401--1293}, 38440 address = {Argonne, Illinois} 38441} 38442 38443@Book{ wright:primal-dual, 38444 author = {S. J. Wright}, 38445 title = {Primal--Dual Interior--Point Methods}, 38446 year = {1997}, 38447 publisher = {SIAM}, 38448 address = {Philadelphia, Pennsylvania} 38449} 38450 38451@TechReport{ wright:reduced, 38452 author = {S. J. Wright}, 38453 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 38454 institution = {Argonne National Laboratory}, 38455 year = {2000}, 38456 number = {MCS--P808--0400}, 38457 address = {Argonne, Illinois} 38458} 38459 38460@Article{ wright:solution, 38461 author = {S. J. Wright}, 38462 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 38463 journal = {Parallel Computing}, 38464 year = {1990}, 38465 volume = {16}, 38466 pages = {221--238} 38467} 38468 38469@Article{ wu.bourland:morphology, 38470 author = {Q. J. Wu and J. D. Bourland}, 38471 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 38472 isocenters}, 38473 journal = {Medical Physics}, 38474 year = {1999}, 38475 volume = {26}, 38476 number = {10}, 38477 pages = {2151--2160} 38478} 38479 38480@Misc{ wunderling:soplex, 38481 author = {R. Wunderling}, 38482 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 38483 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 38484} 38485 38486@Article{ xiao.harker:nonsmooth, 38487 author = {B. Xiao and P. T. Harker}, 38488 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 38489 journal = {Mathematical Programming}, 38490 year = {1994}, 38491 volume = {65}, 38492 pages = {151--194} 38493} 38494 38495@Article{ xiao.harker:nonsmooth*1, 38496 author = {B. Xiao and P. T. Harker}, 38497 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 38498 Results}, 38499 journal = {Mathematical Programming}, 38500 year = {1994}, 38501 volume = {65}, 38502 pages = {195--216} 38503} 38504 38505@Article{ xiao.zhou:nonmonotone, 38506 author = {Y. Xiao and F. J. Zhou}, 38507 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 38508 Minimization}, 38509 journal = {Computing}, 38510 year = {1992}, 38511 volume = {48}, 38512 pages = {303--317} 38513} 38514 38515@TechReport{ xiao:global, 38516 author = {B. Xiao}, 38517 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 38518 {B}-differentiable equation approach}, 38519 type = {{Ph.D. Thesis}}, 38520 year = {1990}, 38521 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 38522 address = {Philadelphia, PA} 38523} 38524 38525@Article{ xu.burke:polynomial, 38526 author = {S. Xu and J. V. Burke}, 38527 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 38528 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 38529 year = {1999}, 38530 journal = {Mathematical Programming}, 38531 volume = {86}, 38532 pages = {91--104} 38533} 38534 38535@TechReport{ xu:global, 38536 author = {S. Xu}, 38537 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 38538 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 38539 institution = {Department of Mathematics, University of Washington}, 38540 year = {1996}, 38541 type = {Technical Report}, 38542 address = {Seattle, WA} 38543} 38544 38545@Article{ yajima.konno:efficient, 38546 author = {Y. Yajima and H. Konno}, 38547 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 38548 Problems}, 38549 journal = {Journal of Global Optimization}, 38550 year = {1991}, 38551 volume = {1:1}, 38552 pages = {155--171} 38553} 38554 38555@Article{ yamamoto:path-following, 38556 author = {Y. Yamamoto}, 38557 title = {A Path--Following Algorithm for Stationary Point Problems}, 38558 journal = {Journal of Operations Society of Japan}, 38559 year = {1987}, 38560 volume = {30}, 38561 pages = {181--198} 38562} 38563 38564@Article{ yamashita.fukushima:modified, 38565 author = {N. Yamashita and M. Fukushima}, 38566 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 38567 Complementarity Problems}, 38568 journal = {Mathematical Programming}, 38569 year = {1997}, 38570 volume = {76}, 38571 pages = {469--492} 38572} 38573 38574@Article{ yamashita.fukushima:stationary, 38575 author = {N. Yamashita and M. Fukushima}, 38576 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 38577 Problems}, 38578 journal = {Journal of Optimization Theory and Applications}, 38579 volume = {84}, 38580 pages = {653--663}, 38581 year = {1995} 38582} 38583 38584@Article{ yamashita.taji.ea:unconstrained, 38585 author = {N. Yamashita and K. Taji and M. Fukushima}, 38586 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 38587 journal = {Journal of Optimization Theory and Applications}, 38588 year = {1997}, 38589 volume = {92}, 38590 pages = {439--456} 38591} 38592 38593@TechReport{ yamashita:properties, 38594 author = {N. Yamashita}, 38595 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 38596 Complementarity Problem}, 38597 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 38598 year = {1996}, 38599 type = {Technical Report}, 38600 address = {Kyoto, Japan} 38601} 38602 38603@Article{ yang.mackie.ea:investigation, 38604 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 38605 Thomadsen}, 38606 title = {An investigation of tomotherapy beam delivery}, 38607 journal = {Medical Physics}, 38608 year = {1997}, 38609 volume = {24}, 38610 number = {3}, 38611 pages = {425--436} 38612} 38613 38614@Article{ yan.shu.ea:clinical, 38615 author = {Y. Yan and H. Shu and X. Bao}, 38616 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 38617 Treatmen System}, 38618 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38619 year = {1997}, 38620 volume = {39}, 38621 pages = {247--254} 38622} 38623 38624@Article{ yau.gao:obstacle, 38625 author = {S. T. Yau and Y. Gao}, 38626 title = {Obstacle problem for von {K}arm\'an equations}, 38627 journal = {Advances in Applied Mathematics}, 38628 volume = {13}, 38629 year = {1992}, 38630 pages = {123--141} 38631} 38632 38633@Article{ ye.tse:extension, 38634 author = {Y. Ye and E. Tse}, 38635 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 38636 Programming}, 38637 journal = {Mathematical Programming}, 38638 year = {1989}, 38639 volume = {44} 38640} 38641 38642@Article{ ye:affine, 38643 author = {Y. Ye}, 38644 title = {On affine scaling algorithms for nonconvex quadratic programming}, 38645 journal = {Mathematical Programming}, 38646 year = {1992}, 38647 volume = {56}, 38648 pages = {285--300} 38649} 38650 38651@PhDThesis{ ye:interior, 38652 author = {Y. Ye}, 38653 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 38654 Programming}, 38655 year = {1987}, 38656 address = {Stanford, California}, 38657 school = {Department of Engineering--Economic Systems, Stanford University} 38658} 38659 38660@Book{ ye:interior*1, 38661 author = {Y. Ye}, 38662 title = {Interior-Point Algorithms: Theory and Analysis}, 38663 publisher = {John Wiley \& Sons}, 38664 year = {1997}, 38665 address = {New York, NY} 38666} 38667 38668@Article{ yu:convergence, 38669 author = {W. --C. Yu}, 38670 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 38671 journal = {Scientia Sinica, Special issue of Mathematics}, 38672 year = {1979}, 38673 volume = {1}, 38674 pages = {68--77} 38675} 38676 38677@Article{ yu.schell:genetic, 38678 author = {Y. Yu and M. C. Schell}, 38679 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 38680 journal = {Medical Physics}, 38681 year = {1996}, 38682 volume = {23}, 38683 pages = {2085--2091} 38684} 38685 38686@Article{ yuan:superlinear, 38687 author = {Y. Yuan}, 38688 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 38689 Optimization}, 38690 journal = {Mathematical Programming}, 38691 year = {1985}, 38692 volume = {31}, 38693 pages = {269--285} 38694} 38695 38696@Book{ zangwill:nonlinear, 38697 author = {W. I. Zangwill}, 38698 title = {Nonlinear Programming: {A} Unified Approach}, 38699 year = {1969}, 38700 publisher = {Prentice-Hall, Inc}, 38701 address = {Englewood Cliffs, New Jersey} 38702} 38703 38704@TechReport{ zangwill:nonlinear*1, 38705 author = {W. I. Zangwill}, 38706 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 38707 institution = {Center for Research in Management Science, University of California}, 38708 year = {1965}, 38709 address = {Berkeley}, 38710 number = {131}, 38711 type = {Working Paper} 38712} 38713 38714@Article{ zangwill:nonlinear*2, 38715 author = {W. I. Zangwill}, 38716 title = {Nonlinear Programming via Penalty Functions}, 38717 journal = {Management Science}, 38718 year = {1967}, 38719 volume = {13}, 38720 pages = {344--358} 38721} 38722 38723@TechReport{ zenios.censor:massively, 38724 author = {S. A. Zenios and Y. Censor}, 38725 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 38726 Problems}, 38727 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 38728 year = {1990}, 38729 type = {report}, 38730 number = {89-09-10}, 38731 address = {Philadelphia, PA} 38732} 38733 38734@Article{ zenios.lasken:nonlinear, 38735 author = {S. A. Zenios and R. A. Lasken}, 38736 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 38737 journal = {Annals of Operations Research}, 38738 year = {1988}, 38739 volume = {14}, 38740 pages = {147--163} 38741} 38742 38743@Article{ zenios.mulvey:distributed, 38744 author = {S. A. Zenios and J. M. Mulvey}, 38745 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 38746 journal = {Parallel Computing}, 38747 year = {1988}, 38748 volume = {6}, 38749 pages = {43--56} 38750} 38751 38752@TechReport{ zenios.neilsen:massively, 38753 author = {S. A. Zenios and S. Neilsen}, 38754 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 38755 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38756 year = {1990}, 38757 type = {report}, 38758 number = {90-03-01}, 38759 address = {Philadelphia, PA} 38760} 38761 38762@TechReport{ zenios.qi.ea:comparative, 38763 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 38764 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 38765 Nonlinear Network Optimization}, 38766 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38767 year = {1990}, 38768 type = {report}, 38769 number = {89-10-02}, 38770 address = {Philadelphia, PA} 38771} 38772 38773@Article{ zhang.kim.ea:improved, 38774 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 38775 title = {An Improved Successive Linear Programming Algorithm}, 38776 year = {1985}, 38777 journal = {Management Science}, 38778 volume = {31}, 38779 pages = {1312--1331} 38780} 38781 38782@Article{ zhang.tapia.ea:superlinear, 38783 author = {Y. Zhang and R. A. Tapia and F. Potra}, 38784 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 38785 of problems}, 38786 journal = {SIAM Journal on Optimization}, 38787 year = {1993}, 38788 volume = {3}, 38789 number = {?}, 38790 pages = {413--422}, 38791} 38792 38793@Article{ zhang.tapia:superlinearly, 38794 author = {Y. Zhang and R. A. Tapia}, 38795 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 38796 linear programming}, 38797 journal = {SIAM Journal on Optimization}, 38798 year = {1993}, 38799 volume = {3}, 38800 pages = {118--133} 38801} 38802 38803@TechReport{ zhang.zhang:superlinear, 38804 author = {Y. Zhang and D. Zhang}, 38805 title = {Superlinear convergence of infeasible interior-point methods for linear 38806 programming}, 38807 institution = {Department of Mathematics and Statistics, University of Maryland}, 38808 year = {1992}, 38809 number = {92-15}, 38810 address = {Baltimore County, Maryland} 38811} 38812 38813@Article{ zhang:convergence, 38814 author = {Yin Zhang}, 38815 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 38816 Horizontal Linear Complementarity Problem}, 38817 journal = {SIAM Journal on Optimization}, 38818 year = {1994}, 38819 volume = {4}, 38820 pages = {208--227} 38821} 38822 38823@Article{ zhang:convergence*1, 38824 author = {Y. Zhang}, 38825 title = {On the convergence of a class of infeasible interior-point methods for the 38826 horizontal linear complementarity problem}, 38827 journal = {SIAM Journal on Optimization}, 38828 year = {1994}, 38829 volume = {4}, 38830 pages = {208--227} 38831} 38832 38833@Article{ zhu.rockafellar:primal-dual, 38834 author = {C. Y. Zhu and R. T. Rockafellar}, 38835 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 38836 Programming}, 38837 journal = {SIAM Journal on Optimization}, 38838 year = {1993}, 38839 volume = {3}, 38840 pages = {751--783} 38841} 38842 38843@Article{ zhu:modified, 38844 author = {C. Y. Zhu}, 38845 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 38846 journal = {Computational Optimization and Applications}, 38847 year = {1992}, 38848 volume = {2}, 38849 pages = {182--205} 38850} 38851 38852@Article{ zhu:primal-dual, 38853 author = {C. Y. Zhu}, 38854 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 38855 Programming}, 38856 journal = {SIAM Journal on Optimization}, 38857 year = {1995}, 38858 volume = {5}, 38859 pages = {114--128} 38860} 38861 38862@Book{ zoutendijk:methods, 38863 author = {G. Zoutendijk}, 38864 title = {Methods of Feasible Directions}, 38865 year = {1960}, 38866 publisher = {Elsevier Publishing Company}, 38867 address = {Amsterdam} 38868} 38869 38870@Article{ zowe.kurcyusz:regularity, 38871 author = {J. Zowe and S. Kurcyusz}, 38872 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 38873 journal = {Applied Mathematics and Optimization}, 38874 year = {1979}, 38875 volume = {5}, 38876 pages = {49--62} 38877} 38878 38879@InProceedings{ zowe:nondifferentiable, 38880 author = {J. Zowe}, 38881 title = {Nondifferentiable Optimization}, 38882 booktitle = {Computational Mathematical Programming}, 38883 year = {1985}, 38884 editor = {K. Schittkowski}, 38885 publisher = {Springer-Verlag}, 38886 address = {Berlin} 38887} 38888 38889@Proceedings{ bachem.grotschel.ea:mathematical, 38890 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 38891 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 38892 year = {1983}, 38893 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 38894 publisher = {Springer Verlag}, 38895 address = {Berlin} 38896} 38897 38898@Proceedings{ belew.booker:fourth, 38899 year = {1991}, 38900 editor = {R. K. Belew and L. B. Booker}, 38901 publisher = {Morgan Kaufmann Publishers, Inc}, 38902 address = {San Mateo, California}, 38903 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 38904} 38905 38906@Proceedings{ coleman.li:large-scale, 38907 year = {1990}, 38908 editor = {T. F. Coleman and Y. Li}, 38909 publisher = {SIAM}, 38910 address = {Philadelphia, Pennsylvania}, 38911 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 38912 University, Ithaca, New York, October 19-20, 1989}, 38913 booktitle = {Large-Scale Numerical Optimization} 38914} 38915 38916@Book{ davis:genetic, 38917 title = {Genetic Algorithms and Simulated Annealing}, 38918 year = {1987}, 38919 editor = {L. D. Davis}, 38920 publisher = {Pitman}, 38921 address = {London}, 38922 booktitle = {Genetic Algorithms and Simulated Annealing} 38923} 38924 38925@Proceedings{ ferris.pang:complementarity, 38926 title = {Complementarity and Variational Problems: State of the Art}, 38927 booktitle = {Complementarity and Variational Problems: State of the Art}, 38928 year = {1997}, 38929 key = {57}, 38930 editor = {M. C. Ferris and J. S. Pang}, 38931 publisher = {SIAM Publications}, 38932 address = {Philadelphia, Pennsylvania} 38933} 38934 38935@Proceedings{ ferris.mangasarian.ea:complementarity, 38936 title = {Complementarity: Applications, Algorithms and Extensions}, 38937 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 38938 year = {2001}, 38939 key = {95}, 38940 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 38941 publisher = {Kluwer Academic Publishers}, 38942 address = {Dordrecht, The Netherlands} 38943} 38944 38945@Proceedings{ florian:traffic, 38946 title = {Traffic Equilibrium Methods}, 38947 year = {1976}, 38948 editor = {M. Florian}, 38949 publisher = {Springer-Verlag}, 38950 address = {Berlin} 38951} 38952 38953@Proceedings{ grefenstette:genetic, 38954 title = {Genetic Algorithms and their Applications: Proceedings of the Second 38955 International Conference on Genetic Algorithms}, 38956 year = {1987}, 38957 editor = {J. J. Grefenstette}, 38958 publisher = {Lawrence Erlbaum Associates}, 38959 address = {Hillsdale, New Jersey}, 38960 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 38961 International Conference on Genetic Algorithms} 38962} 38963 38964@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 38965 booktitle = {Nonlinear Programming}, 38966 volume = {2}, 38967 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38968 publisher = {Academic Press}, 38969 address = {New York}, 38970 year = {1975} 38971} 38972 38973@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 38974 booktitle = {Nonlinear Programming}, 38975 volume = {3}, 38976 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38977 publisher = {Academic Press}, 38978 address = {London}, 38979 year = {1978} 38980} 38981 38982@Proceedings{ robinson:local, 38983 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 38984 Regularity}, 38985 year = {1983}, 38986 editor = {V. Pereyra and A. Reinoza}, 38987 publisher = {Springer-Verlag}, 38988 address = {Berlin}, 38989 author = {S. M. Robinson}, 38990 pages = {240--251}, 38991 series = {Numerical Methods: Proceedings, Caracas 1982} 38992} 38993 38994@Proceedings{ schaeffer:third, 38995 year = {1989}, 38996 editor = {J. D. Schaeffer}, 38997 publisher = {Morgan Kaufmann Publishers, Inc}, 38998 address = {San Mateo, California}, 38999 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 39000} 39001 39002@Book{ vanderbei:linear, 39003 author = {R. J. Vanderbei}, 39004 title = {Linear Programming: Foundations and Extensions}, 39005 year = {1997}, 39006 publisher = {Kluwer Academic Publishers}, 39007 address = {Boston, Massachusetts} 39008} 39009 39010@Book{ dfobook, 39011 title = {Introduction to Derivative-Free Optimization}, 39012 publisher = {Society for Industrial and Applied Mathematics}, 39013 year = {2009}, 39014 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 39015 series = {MPS/SIAM Series on Optimization}, 39016 address = {Philadelphia, PA, USA}, 39017 isbn = {0-89871-460-5} 39018} 39019 39020@Article{ unedf0, 39021 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 39022 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 39023 title = {Nuclear Energy Density Optimization}, 39024 journal = {Physical Review C}, 39025 year = {2010}, 39026 volume = {82}, 39027 number = {2}, 39028 pages = {024313}, 39029 doi = {10.1103/PhysRevC.82.024313} 39030} 39031 39032@Article{ hestenes1969multiplier, 39033 title = {Multiplier and gradient methods}, 39034 author = {Hestenes, Magnus R}, 39035 journal = {Journal of optimization theory and applications}, 39036 volume = {4}, 39037 number = {5}, 39038 pages = {303--320}, 39039 year = {1969}, 39040 publisher = {Springer} 39041} 39042 39043@Article{ powell1969method, 39044 title = {A method for nonlinear constraints in minimization problems}, 39045 author = {Powell, Michael JD}, 39046 journal = {Optimization}, 39047 pages = {283--298}, 39048 year = {1969}, 39049 publisher = {Academic Press} 39050} 39051 39052@Book{ nocedal2006numerical, 39053 title = {Numerical optimization}, 39054 author = {Jorge Nocedal and Stephen Wright}, 39055 year = {2006}, 39056 publisher = {Springer Science \& Business Media} 39057} 39058 39059@Article{ rockafellar1974augmented, 39060 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 39061 author = {Rockafellar, R Tyrrell}, 39062 journal = {SIAM Journal on Control}, 39063 volume = {12}, 39064 number = {2}, 39065 pages = {268--285}, 39066 year = {1974}, 39067 publisher = {SIAM} 39068} 39069 39070@Article{ bacuta2006, 39071 title = {A unified approach for Uzawa algorithms}, 39072 author = {Constantin Bacuta}, 39073 journal = {SIAM Journal on Numerical Analysis}, 39074 volume = {44}, 39075 number = {6}, 39076 pages = {2633--2649}, 39077 year = {2006} 39078} 39079 39080@Article{ manteuffelrugesouthworth2018, 39081 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 39082 (AIR)}, 39083 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 39084 journal = {SIAM Journal on Scientific Computing}, 39085 volume = {40}, 39086 number = {6}, 39087 pages = {A4105--A4130}, 39088 year = {2018} 39089} 39090 39091@Article{ manteuffelmunzenmaierrugesouthworth2019, 39092 title = {Nonsymmetric reduction-based algebraic multigrid}, 39093 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 39094 journal = {SIAM Journal on Scientific Computing}, 39095 volume = {41}, 39096 number = {5}, 39097 pages = {S242--S268}, 39098 year = {2019} 39099} 39100 39101@PhDThesis{ sivas2021, 39102 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 39103 author = {Abdullah Ali Sivas}, 39104 department = {Applied Mathematics}, 39105 institution = {University of Waterloo}, 39106 year = {2021} 39107} 39108 39109@Article{ brookshughes1982, 39110 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 39111 with particular emphasis on the incompressible {Navier-Stokes} equations}, 39112 author = {Alexander N Brooks and Thomas JR Hughes}, 39113 journal = {Computer methods in applied mechanics and engineering}, 39114 volume = {32}, 39115 number = {1-3}, 39116 pages = {199--259}, 39117 year = {1982}, 39118 publisher = {Elsevier} 39119} 39120 39121@InProceedings{ suhisaac2020, 39122 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 39123 author = {Hansol Suh and Tobin Isaac}, 39124 booktitle = {SC20: International Conference for High Performance Computing, Networking, 39125 Storage and Analysis}, 39126 pages = {1--12}, 39127 year = {2020}, 39128 organization = {IEEE} 39129} 39130 39131@Misc{ alauzet2010, 39132 title = {Metric-Based Anisotropic Mesh Adaptation}, 39133 author = {Fr\'{e}d\'{e}ric Alauzet}, 39134 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 39135 year = {2010} 39136} 39137 39138@Article{ chan1994qmrcgs, 39139 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 39140 systems}, 39141 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 39142 and Tong, Charles H}, 39143 journal = {SIAM Journal on Scientific Computing}, 39144 volume = {15}, 39145 number = {2}, 39146 pages = {338--347}, 39147 year = {1994}, 39148 publisher = {SIAM} 39149} 39150 39151@Article{ ghai2019comparison, 39152 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 39153 nonsymmetric linear systems}, 39154 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 39155 journal = {Numerical Linear Algebra with Applications}, 39156 volume = {26}, 39157 number = {1}, 39158 pages = {e2215}, 39159 year = {2019}, 39160 publisher = {Wiley Online Library} 39161} 39162 39163@Article{ mishrasalacknepley2022, 39164 title = {On the order of accuracy for finite difference approximations of partial 39165 differential equations using stencil composition}, 39166 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 39167 journal = {International Journal on Numerical Methods in Engineering}, 39168 note = {Submitted}, 39169 year = {2022} 39170} 39171 39172@Article{ nathawaniknepley2022, 39173 title = {Droplet formation simulation using mixed finite elements}, 39174 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39175 journal = {Physics of Fluids}, 39176 volume = {34}, 39177 pages = {064105}, 39178 doi = {10.1063/5.0089752}, 39179 year = {2022} 39180} 39181 39182@InProceedings{ nathawaniknepley2022b, 39183 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 39184 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39185 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 39186 (ICCFD11)}, 39187 editor = {Christoph Brehm and Shishir Pandya}, 39188 number = {4103}, 39189 year = {2022} 39190} 39191 39192@Article{ nathawaniknepley2023, 39193 title = {One-dimensional model to simulate shear-induced droplet formation}, 39194 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39195 journal = {International Journal of Multiphase Flow}, 39196 note = {Submitted}, 39197 year = {2023} 39198} 39199 39200@InProceedings{ georgalisnathawaniknepleypatra2023, 39201 title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, 39202 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 39203 Patra}, 39204 booktitle = {AIAA SciTech 2024}, 39205 note = {Accepted}, 39206 year = {2023} 39207} 39208 39209@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 39210 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 39211 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 39212 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 39213 Thompson and Junchao Zhang}, 39214 doi = {10.48550/ARXIV.2204.01722}, 39215 url = {https://arxiv.org/abs/2204.01722}, 39216 publisher = {arXiv}, 39217 note = {Submitted}, 39218 year = {2022} 39219} 39220 39221@InCollection{ mayknepley2023, 39222 title = {Numerical Modeling of Subduction}, 39223 author = {Dave A. May and Matthew G. Knepley}, 39224 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 39225 editor = {João C. Duarte}, 39226 pages = {539-571}, 39227 isbn = {978-0-323-85733-8}, 39228 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 39229 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 39230 year = {2023} 39231} 39232 39233@Article{ adamsknepley2023, 39234 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 39235 plasmas in {PETSc}}, 39236 author = {Mark F. Adams and Matthew G. Knepley}, 39237 url = {https://arxiv.org/abs/2302.10242}, 39238 note = {In preparation}, 39239 year = {2023}, 39240 petsc_uses = {DMPlex} 39241} 39242 39243@Article{ finnknepleypusztayadams2023, 39244 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 39245 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 39246 url = {https://arxiv.org/abs/2303.12620}, 39247 journal = {Communications in Applied Mathematics and Computational Science}, 39248 volume = {18}, 39249 number = {1}, 39250 pages = {135--152}, 39251 doi = {10.2140/camcos.2023.18.135}, 39252 year = {2023} 39253} 39254 39255@Article{ eggersdupont1994, 39256 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 39257 equation}, 39258 author = {Jens Eggers and Todd F. Dupont}, 39259 journal = {Journal of fluid mechanics}, 39260 volume = {262}, 39261 pages = {205--221}, 39262 year = {1994}, 39263 publisher = {Cambridge University Press} 39264} 39265 39266@PhDThesis{ pusztaythesis2023, 39267 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 39268 author = {Joseph V. Pusztay}, 39269 type = {{PhD} thesis}, 39270 school = {University at Buffalo, Department of Computer Science and Engineering}, 39271 address = {Buffalo, NY}, 39272 month = may, 39273 year = {2022} 39274} 39275 39276@PhDThesis{ finnthesis2023, 39277 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 39278 System}, 39279 author = {Daniel S. Finn}, 39280 type = {{PhD} thesis}, 39281 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39282 Engineering}, 39283 address = {Buffalo, NY}, 39284 month = may, 39285 year = {2023} 39286} 39287 39288@PhDThesis{ nathawanithesis2023, 39289 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 39290 author = {Darsh Kiritbhai Nathawani}, 39291 type = {{PhD} thesis}, 39292 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39293 Engineering}, 39294 address = {Buffalo, NY}, 39295 month = may, 39296 year = {2023} 39297} 39298 39299@article{MckayEriksonKozdon2019, 39300 title = {A computational method for earthquake cycles within anisotropic media}, 39301 author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, 39302 journal = {Geophysical Journal International}, 39303 volume = {219}, 39304 number = {2}, 39305 pages = {816--833}, 39306 year = {2019}, 39307} 39308 39309@article{EricksonOReillyNordstrom2019, 39310 title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, 39311 author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, 39312 journal = {Journal of Scientific Computing}, 39313 volume = {81}, 39314 pages = {2356--2387}, 39315 year = {2019}, 39316} 39317 39318@article{KozdonEricksonWilcox2021, 39319 title = {Hybridized summation-by-parts finite difference methods}, 39320 author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, 39321 journal = {Journal of Scientific Computing}, 39322 volume = {87}, 39323 number = {3}, 39324 pages = {85}, 39325 year = {2021}, 39326} 39327 39328@article{SEAS2022, 39329 title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, 39330 author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, 39331 journal = {Journal of Geophysical Research: Solid Earth}, 39332 volume = {127}, 39333 number = {3}, 39334 pages = {e2021JB023519}, 39335 year = {2022}, 39336} 39337 39338@article{EricksonKozdonHarvey2022, 39339 title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, 39340 author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, 39341 journal = {Journal of Scientific Computing}, 39342 volume = {93}, 39343 number = {1}, 39344 pages = {17}, 39345 year = {2022}, 39346} 39347 39348@article{RuckerEriksonKarlstromLeeGopalakrishnan2022, 39349 title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, 39350 author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, 39351 journal = {Journal of Geophysical Research: Solid Earth}, 39352 volume = {127}, 39353 number = {9}, 39354 pages = {e2022JB024506}, 39355 year = {2022}, 39356} 39357 39358@article{HarveyEriksonKozdon2023, 39359 title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, 39360 author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, 39361 journal = {Journal of Geophysical Research: Solid Earth}, 39362 pages = {e2022JB025357}, 39363 year = {2023}, 39364} 39365 39366@article{SEAS2023, 39367 title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, 39368 author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, 39369 journal = {Bulletin of the Seismological Society of America}, 39370 volume = {113}, 39371 number = {2}, 39372 pages = {499--523}, 39373 year = {2023}, 39374} 39375