1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@article{veldhuizen1984d, 20 title = {{D}-stability and {K}aps-{R}entrop-methods}, 21 author = {Veldhuizen, M van}, 22 journal = {Computing}, 23 volume = {32}, 24 number = {3}, 25 pages = {229--237}, 26 year = {1984}, 27 publisher = {Springer} 28} 29 30@article{shampine1982implementation, 31 title = {Implementation of {R}osenbrock methods}, 32 author = {Shampine, Lawrence F}, 33 journal = {ACM Transactions on Mathematical Software (TOMS)}, 34 volume = {8}, 35 number = {2}, 36 pages = {93--113}, 37 year = {1982}, 38 publisher = {ACM New York, NY, USA} 39} 40 41@book{wanner1996solving, 42 title = {Solving ordinary differential equations {II}}, 43 author = {Wanner, Gerhard and Hairer, Ernst}, 44 volume = {375}, 45 year = {1996}, 46 publisher = {Springer Berlin Heidelberg New York} 47} 48 49@article{kaps1979generalized, 50 title = {Generalized {R}unge--{K}utta methods of order four with stepsize control for stiff ordinary differential equations}, 51 author = {Kaps, Peter and Rentrop, Peter}, 52 journal = {Numerische Mathematik}, 53 volume = {33}, 54 pages = {55--68}, 55 year = {1979}, 56 publisher = {Springer} 57} 58 59@book{butcher2016numerical, 60 title = {Numerical methods for ordinary differential equations}, 61 author = {Butcher, John Charles}, 62 year = {2016}, 63 publisher = {John Wiley \& Sons} 64} 65 66@article{chung1993, 67 author = {Chung, J. and Hulbert, G. M.}, 68 title = {A Time Integration Algorithm for Structural Dynamics With Improved Numerical Dissipation: The Generalized-alpha Method}, 69 journal = {Journal of Applied Mechanics}, 70 volume = {60}, 71 number = {2}, 72 pages = {371-375}, 73 year = {1993}, 74 month = {06}, 75 issn = {0021-8936}, 76 doi = {10.1115/1.2900803}, 77 url = {https://doi.org/10.1115/1.2900803}, 78 eprint = {https://asmedigitalcollection.asme.org/appliedmechanics/article-pdf/60/2/371/5463014/371\_1.pdf}, 79} 80 81@article{hosea1996analysis, 82 title = {Analysis and implementation of {TR-BDF2}}, 83 author = {Hosea, ME and Shampine, LF}, 84 journal = {Applied Numerical Mathematics}, 85 volume = {20}, 86 number = {1-2}, 87 pages = {21--37}, 88 year = {1996}, 89 publisher = {Elsevier} 90} 91 92@article{kennedy2019diagonally, 93 title = {Diagonally implicit {R}unge--{K}utta methods for stiff {ODE}s}, 94 author = {Kennedy, Christopher A and Carpenter, Mark H}, 95 journal = {Applied Numerical Mathematics}, 96 volume = {146}, 97 pages = {221--244}, 98 year = {2019}, 99 publisher = {Elsevier} 100} 101 102@inproceedings{xu2017adaptive, 103 title = {Adaptive relaxed {ADMM}: Convergence theory and practical implementation}, 104 author = {Xu, Zheng and Figueiredo, Mario AT and Yuan, Xiaoming and Studer, Christoph and Goldstein, Tom}, 105 booktitle = {Proceedings of the IEEE conference on computer vision and pattern recognition}, 106 pages = {7389--7398}, 107 year = {2017} 108} 109 110@article{hindmarsh1996time, 111 title = {Time-step limits for stable solutions of the ice-sheet equation}, 112 author = {Hindmarsh, Richard CA and Payne, Antony J}, 113 journal = {Annals of Glaciology}, 114 volume = {23}, 115 pages = {74--85}, 116 year = {1996}, 117 publisher = {Cambridge University Press} 118} 119 120@article{benson2006flexible, 121 title = {Flexible complementarity solvers for large-scale applications}, 122 author = {Benson, Steven J and Munson, Todd S}, 123 journal = {Optimization Methods and Software}, 124 volume = {21}, 125 number = {1}, 126 pages = {155--168}, 127 year = {2006}, 128 publisher ={Taylor \& Francis} 129} 130 131@article{byrd1994representations, 132 title = {Representations of quasi-{N}ewton matrices and their use in limited memory methods}, 133 author = {Byrd, Richard H and Nocedal, Jorge and Schnabel, Robert B}, 134 journal = {Mathematical Programming}, 135 volume = {63}, 136 number = {1-3}, 137 pages = {129--156}, 138 year = {1994}, 139 publisher = {Springer} 140} 141 142@article{gilbert1989some, 143 title = {Some numerical experiments with variable-storage quasi-{N}ewton algorithms}, 144 author = {Gilbert, Jean Charles and Lemar{\'e}chal, Claude}, 145 journal = {Mathematical programming}, 146 volume = {45}, 147 number = {1-3}, 148 pages = {407--435}, 149 year = {1989}, 150 publisher = {Springer} 151} 152 153@inproceedings{dener2019accelerating, 154 title = {Accelerating limited-memory quasi-{N}ewton convergence for large-scale optimization}, 155 author = {Dener, Alp and Munson, Todd}, 156 booktitle = {Computational Science--ICCS 2019: 19th International Conference, Faro, Portugal, June 12--14, 2019, Proceedings, Part III 19}, 157 pages = {495--507}, 158 year = {2019}, 159 organization = {Springer} 160} 161 162@article{park2021linear, 163 title = {Linear and nonlinear solvers for simulating multiphase flow within large-scale engineered subsurface systems}, 164 author = {Park, Heeho D and Hammond, Glenn E and Valocchi, Albert J and LaForce, Tara}, 165 journal = {Advances in Water Resources}, 166 volume = {156}, 167 pages = {104029}, 168 year = {2021}, 169 publisher = {Elsevier} 170} 171 172@inproceedings{va1981design, 173 title = {Design of optimally smoothing multi-stage schemes for the {E}uler equations}, 174 author = {Van Leer, Bram and Tai, Chang-Hsien and Powell, Kenneth}, 175 booktitle = {9th Computational Fluid Dynamics Conference}, 176 pages = {1933}, 177 year = {1981} 178} 179 180@article{pierce1997preconditioned, 181 title = {Preconditioned multigrid methods for compressible flow calculations on stretched meshes}, 182 author = {Pierce, Niles A and Giles, Michael B}, 183 journal = {Journal of Computational Physics}, 184 volume = {136}, 185 number = {2}, 186 pages = {425--445}, 187 year = {1997}, 188 publisher = {Elsevier} 189} 190 191@article{kong2016highly, 192 title = {A highly scalable multilevel {S}chwarz method with boundary geometry preserving coarse spaces for {3D} elasticity problems on domains with complex geometry}, 193 author = {Kong, Fande and Cai, Xiao-Chuan}, 194 journal = {SIAM Journal on Scientific Computing}, 195 volume = {38}, 196 number = {2}, 197 pages = {C73--C95}, 198 year = {2016}, 199 publisher = {SIAM} 200} 201 202@inproceedings{gutierrez2017accommodating, 203 title = {Accommodating thread-level heterogeneity in coupled parallel applications}, 204 author = {Guti{\'e}rrez, Samuel K and Davis, Kei and Arnold, Dorian C and Baker, Randal S and Robey, Robert W and McCormick, Patrick and 205 Holladay, Daniel and Dahl, Jon A and Zerr, R Joe and Weik, Florian and others}, 206 booktitle = {2017 {IEEE} International Parallel and Distributed Processing Symposium ({IPDPS})}, 207 pages = {469--478}, 208 year = {2017}, 209 organization = {IEEE} 210} 211 212@article{heroux2011bi, 213 title = {Bi-modal MPI and MPI+ threads computing on scalable multicore systems}, 214 author = {Heroux, Michael A and Brightwell, R and Wolf, Michael M}, 215 journal = {IJHPCA (Submitted)}, 216 year = {2011} 217} 218 219@inproceedings{bozdaug2005parallel, 220 title = {A parallel distance-2 graph coloring algorithm for distributed memory computers}, 221 author = {Bozda{\u{g}}, Doruk and Catalyurek, Umit and Gebremedhin, Assefaw H and Manne, Fredrik and Boman, Erik G and {\"O}zg{\"u}ner, F{\"u}sun}, 222 booktitle = {International conference on high performance computing and communications}, 223 pages = {796--806}, 224 year = {2005}, 225 organization = {Springer} 226} 227 228@article{dohrmann2009overlapping, 229 title = {An overlapping {S}chwarz algorithm for almost incompressible elasticity}, 230 author = {Dohrmann, Clark R and Widlund, Olof B}, 231 journal = {SIAM journal on numerical analysis}, 232 volume = {47}, 233 number = {4}, 234 pages = {2897--2923}, 235 year = {2009}, 236 publisher = {SIAM} 237} 238 239@article{dohrmann2008domain, 240 title = {Domain decomposition for less regular subdomains: Overlapping {S}chwarz in two dimensions}, 241 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 242 journal = {SIAM journal on numerical analysis}, 243 volume = {46}, 244 number = {4}, 245 pages = {2153--2168}, 246 year = {2008}, 247 publisher = {SIAM} 248} 249 250@incollection{dohrmann2008family, 251 title = {A family of energy minimizing coarse spaces for overlapping {S}chwarz preconditioners}, 252 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 253 booktitle = {Domain decomposition methods in science and engineering XVII}, 254 pages = {247--254}, 255 year = {2008}, 256 publisher = {Springer} 257} 258 259@book{dohrmann2008extending, 260 title = {Extending theory for domain decomposition algorithms to irregular subdomains}, 261 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 262 year = {2008}, 263 publisher = {Springer} 264} 265 266@article{dryja1994schwarz, 267 title = {{S}chwarz analysis of iterative substructuring algorithms for elliptic problems in three dimensions}, 268 author = {Dryja, Maksymilian and Smith, Barry F and Widlund, Olof B}, 269 journal = {SIAM journal on numerical analysis}, 270 volume = {31}, 271 number = {6}, 272 pages = {1662--1694}, 273 year = {1994}, 274 publisher = {SIAM} 275} 276 277@book{smith1990domain, 278 title = {Domain decomposition algorithms for the partial differential equations of linear elasticity}, 279 author = {Smith, Barry F}, 280 year = {1990}, 281 publisher = {New York University} 282} 283 284@article{bramble1989construction, 285 title = {The construction of preconditioners for elliptic problems by substructuring. {IV}}, 286 author = {Bramble, James H and Pasciak, Joseph E and Schatz, Alfred H}, 287 journal = {Mathematics of Computation}, 288 volume = {53}, 289 number = {187}, 290 pages = {1--24}, 291 year = {1989} 292} 293 294@article{kaczmarz1937angenaherte, 295 title = {Angenaherte auflosung von systemen linearer gleichungen}, 296 author = {Kaczmarz, Stefan}, 297 journal = {Bull. Int. Acad. Pol. Sic. Let., Cl. Sci. Math. Nat.}, 298 pages = {355--357}, 299 year = {1937} 300} 301 302@article{nataf2022recent, 303 title = {Recent advances in domain decomposition methods for large-scale saddle point problems}, 304 author = {Nataf, Fr{\'e}d{\'e}ric and Tournier, Pierre-Henri}, 305 journal = {Comptes Rendus. M{\'e}canique}, 306 volume = {350}, 307 number = {S1}, 308 pages = {1--15}, 309 year = {2022} 310} 311 312@article{al2022robustpd, 313 title = {A robust algebraic multilevel domain decomposition preconditioner for sparse symmetric positive definite matrices}, 314 author = {Al Daas, Hussam and Jolivet, Pierre}, 315 journal = {SIAM Journal on Scientific Computing}, 316 volume = {44}, 317 number = {4}, 318 pages = {A2582--A2598}, 319 year = {2022}, 320 publisher = {SIAM} 321} 322 323@article{al2022robust, 324 title = {A robust algebraic domain decomposition preconditioner for sparse normal equations}, 325 author = {Al Daas, Hussam and Jolivet, Pierre and Scott, Jennifer A}, 326 journal = {SIAM Journal on Scientific Computing}, 327 volume = {44}, 328 number = {3}, 329 pages = {A1047--A1068}, 330 year = {2022}, 331 publisher = {SIAM} 332} 333 334@article{al2021multilevel, 335 title = {A multilevel {S}chwarz preconditioner based on a hierarchy of robust coarse spaces}, 336 author = {Al Daas, Hussam and Grigori, Laura and Jolivet, Pierre and Tournier, Pierre-Henri}, 337 journal = {SIAM Journal on Scientific Computing}, 338 volume = {43}, 339 number = {3}, 340 pages = {A1907--A1928}, 341 year = {2021}, 342 publisher = {SIAM} 343} 344 345@book{dolean2015introduction, 346 title = {An introduction to domain decomposition methods: algorithms, theory, and parallel implementation}, 347 author = {Dolean, Victorita and Jolivet, Pierre and Nataf, Fr{\'e}d{\'e}ric}, 348 year = {2015}, 349 publisher = {SIAM} 350} 351 352@article{spillane2011robust, 353 title = {A robust two-level domain decomposition preconditioner for systems of {PDE}s}, 354 author = {Spillane, Nicole and Dolean, Victorita and Hauret, Patrice and Nataf, Fr{\'e}d{\'e}ric and Pechstein, Clemens and Scheichl, Robert}, 355 journal = {Comptes Rendus Mathematique}, 356 volume = {349}, 357 number = {23-24}, 358 pages = {1255--1259}, 359 year = {2011}, 360 publisher = {Elsevier} 361} 362 363@article{kong2020highly, 364 title = {A Highly Parallel Multilevel {N}ewton--{K}rylov--{S}chwarz Method with Subspace-Based Coarsening and 365 Partition-Based Balancing for the Multigroup Neutron Transport Equation on Three-Dimensional Unstructured Meshes}, 366 author = {Kong, Fande and Wang, Yaqi and Gaston, Derek R and Permann, Cody J and Slaughter, Andrew E and Lindsay, 367 Alexander D and DeHart, Mark D and Martineau, Richard C}, 368 journal = {SIAM Journal on Scientific Computing}, 369 volume = {42}, 370 number = {5}, 371 pages = {C193--C220}, 372 year = {2020}, 373 publisher = {SIAM} 374} 375 376@article{ipsen2001note, 377 title = {A note on preconditioning nonsymmetric matrices}, 378 author = {Ipsen, Ilse CF}, 379 journal = {SIAM Journal on Scientific Computing}, 380 volume = {23}, 381 number = {3}, 382 pages = {1050--1051}, 383 year = {2001}, 384 publisher = {SIAM} 385} 386 387@article{murphy2000note, 388 title = {A note on preconditioning for indefinite linear systems}, 389 author = {Murphy, Malcolm F and Golub, Gene H and Wathen, Andrew J}, 390 journal = {SIAM Journal on Scientific Computing}, 391 volume = {21}, 392 number = {6}, 393 pages = {1969--1972}, 394 year = {2000}, 395 publisher = {SIAM} 396} 397 398@article{oliphant1961implicit, 399 title = {An implicit, numerical method for solving two-dimensional time-dependent diffusion problems}, 400 author = {Oliphant, Thomas A}, 401 journal = {Quarterly of Applied mathematics}, 402 volume = {19}, 403 number = {3}, 404 pages = {221--229}, 405 year = {1961} 406} 407 408@article{dupont1968approximate, 409 title = {An approximate factorization procedure for solving self-adjoint elliptic difference equations}, 410 author = {Dupont, Todd and Kendall, Richard P and Rachford, Jr, HH}, 411 journal = {SIAM Journal on Numerical Analysis}, 412 volume = {5}, 413 number = {3}, 414 pages = {559--573}, 415 year = {1968}, 416 publisher = {SIAM} 417} 418 419@inproceedings{manteuffel1979shifted, 420 title = {Shifted incomplete {C}holesky factorization}, 421 author = {Manteuffel, Thomas A}, 422 booktitle = {Sparse Matrix Proceedings 1978}, 423 pages = {41--61}, 424 year = {1979}, 425 organization = {SIAM, Philadelphia, PA} 426} 427 428@incollection{chan1997approximate, 429 title = {Approximate and incomplete factorizations}, 430 author = {Chan, Tony F and Van Der Vorst, Henk A}, 431 booktitle = {Parallel numerical algorithms}, 432 pages = {167--202}, 433 year = {1997}, 434 publisher = {Springer} 435} 436 437@article{mandel2008multispace, 438 title = {Multispace and multilevel {BDDC}}, 439 author = {Mandel, Jan and Soused{\'\i}k, Bed{\v{r}}ich and Dohrmann, Clark R}, 440 journal = {Computing}, 441 volume = {83}, 442 number = {2-3}, 443 pages = {55--85}, 444 year = {2008}, 445 publisher = {Springer} 446} 447 448@article{klawonn2006dual, 449 title = {Dual-primal {FETI} methods for linear elasticity}, 450 author = {Klawonn, Axel and Widlund, Olof B}, 451 journal = {Communications on Pure and Applied Mathematics: A Journal Issued by the Courant Institute of Mathematical Sciences}, 452 volume = {59}, 453 number = {11}, 454 pages = {1523--1572}, 455 year = {2006}, 456 publisher = {Wiley Online Library} 457} 458 459@article{dohrmann2007approximate, 460 title = {An approximate {BDDC} preconditioner}, 461 author = {Dohrmann, Clark R}, 462 journal = {Numerical Linear Algebra with Applications}, 463 volume = {14}, 464 number = {2}, 465 pages = {149--168}, 466 year = {2007}, 467 publisher = {Wiley Online Library} 468} 469 470@book{dryja1987additive, 471 title = {An additive variant of the {S}chwarz alternating method for the case of many subregions}, 472 author = {Dryja, Maksymilian and Widlund, Olof}, 473 year = {1987}, 474 publisher = {Ultracomputer Research Laboratory, Univ., Courant Inst. of Mathematical~…} 475} 476 477@article{couturier2016tsirm, 478 title = {{TSIRM}: A two-stage iteration with least-squares residual minimization algorithm to solve large sparse linear and nonlinear systems}, 479 author = {Couturier, Rapha{\"e}l and Khodja, Lilia Ziane and Guyeux, Christophe}, 480 journal = {Journal of Computational Science}, 481 volume = {17}, 482 pages = {535--546}, 483 year = {2016}, 484 publisher = {Elsevier} 485} 486 487@article{chan1998transpose, 488 title = {Transpose-free formulations of Lanczos-type methods for nonsymmetric linear systems}, 489 author = {Chan, Tony F and De Pillis, Lisette and Van Der Vorst, Henk}, 490 journal = {Numerical Algorithms}, 491 volume = {17}, 492 pages = {51--66}, 493 year = {1998}, 494 publisher = {Springer} 495} 496 497@article{catabriga2006performance, 498 title = {Performance of {LCD} iterative method in the finite element and finite difference solution of convection--diffusion equations}, 499 author = {Catabriga, L and Valli, AMP and Melotti, BZ and Pessoa, LM and Coutinho, ALGA}, 500 journal = {Communications in numerical methods in engineering}, 501 volume = {22}, 502 number = {6}, 503 pages = {643--656}, 504 year = {2006}, 505 publisher = {Wiley Online Library} 506} 507 508@article{catabriga2004evaluating, 509 title = {Evaluating the {LCD} algorithm for solving linear systems of equations arising from implicit {SUPG} formulation of compressible flows}, 510 author = {Catabriga, Lucia and Coutinho, Alvaro LGA and Franca, Leopoldo P}, 511 journal = {International Journal for Numerical Methods in Engineering}, 512 volume = {60}, 513 number = {9}, 514 pages = {1513--1534}, 515 year = {2004}, 516 publisher = {Wiley Online Library} 517} 518 519@article{dai2004study, 520 title = {Study on semi-conjugate direction methods for non-symmetric systems}, 521 author = {Dai, Yu-Hong and Yuan, Jinyun}, 522 journal = {International journal for numerical methods in engineering}, 523 volume = {60}, 524 number = {8}, 525 pages = {1383--1399}, 526 year = {2004}, 527 publisher = {Wiley Online Library} 528} 529 530@article{yuan2004semi, 531 title = {Semi-conjugate direction methods for real positive definite systems}, 532 author = {Yuan, JY and Golub, Gene H and Plemmons, Robert J and Cecilio, WAG}, 533 journal = {BIT Numerical Mathematics}, 534 volume = {44}, 535 pages = {189--207}, 536 year = {2004}, 537 publisher = {Springer} 538} 539 540@article{ji2017breakdown, 541 title = {A breakdown-free block conjugate gradient method}, 542 author = {Ji, Hao and Li, Yaohang}, 543 journal = {BIT Numerical Mathematics}, 544 volume = {57}, 545 pages = {379--403}, 546 year = {2017}, 547 publisher = {Springer} 548} 549 550@inproceedings{jolivet2016block, 551 title = {Block iterative methods and recycling for improved scalability of linear solvers}, 552 author = {Jolivet, Pierre and Tournier, Pierre-Henri}, 553 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 554 pages = {190--203}, 555 year = {2016}, 556 organization = {IEEE} 557} 558 559@article{calandra2013modified, 560 title = {A modified block flexible {GMRES} method with deflation at each iteration for the solution of non-{H}ermitian linear systems with multiple right-hand sides}, 561 author = {Calandra, Henri and Gratton, Serge and Lago, Rafael and Vasseur, Xavier and Carvalho, Luiz Mariano}, 562 journal = {SIAM Journal on Scientific Computing}, 563 volume = {35}, 564 number = {5}, 565 pages = {S345--S367}, 566 year = {2013}, 567 publisher = {SIAM} 568} 569 570@article{o1980block, 571 title = {The block conjugate gradient algorithm and related methods}, 572 author = {O'Leary, Dianne P}, 573 journal = {Linear algebra and its applications}, 574 volume = {29}, 575 pages = {293--322}, 576 year = {1980}, 577 publisher = {Elsevier} 578} 579 580@article{erhel1996restarted, 581 title = {Restarted {GMRES} preconditioned by deflation}, 582 author = {Erhel, Jocelyne and Burrage, Kevin and Pohl, Bert}, 583 journal = {Journal of computational and applied mathematics}, 584 volume = {69}, 585 number = {2}, 586 pages = {303--318}, 587 year = {1996}, 588 publisher = {Elsevier} 589} 590 591@article{bai1994newton, 592 title = {A {N}ewton basis {GMRES} implementation}, 593 author = {Bai, Zhaojun and Hu, Dan and Reichel, Lothar}, 594 journal = {IMA Journal of Numerical Analysis}, 595 volume = {14}, 596 number = {4}, 597 pages = {563--581}, 598 year = {1994}, 599 publisher = {Oxford University Press} 600} 601 602@article{sidje1997alternatives, 603 title = {Alternatives for parallel Krylov subspace basis computation}, 604 author = {Sidje, Roger B}, 605 journal = {Numerical linear algebra with applications}, 606 volume = {4}, 607 number = {4}, 608 pages = {305--331}, 609 year = {1997}, 610 publisher = {Wiley Online Library} 611} 612 613@inproceedings{mohiyuddin2009minimizing, 614 title = {Minimizing communication in sparse matrix solvers}, 615 author = {Mohiyuddin, Marghoob and Hoemmen, Mark and Demmel, James and Yelick, Katherine}, 616 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage and Analysis}, 617 pages = {1--12}, 618 year = {2009} 619} 620 621@article{demmel2012communication, 622 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 623 author = {Demmel, James and Grigori, Laura and Hoemmen, Mark and Langou, Julien}, 624 journal = {SIAM Journal on Scientific Computing}, 625 volume = {34}, 626 number = {1}, 627 pages = {A206--A239}, 628 year = {2012}, 629 publisher = {SIAM} 630} 631 632@article{philippe2012generation, 633 title = {On the generation of {K}rylov subspace bases}, 634 author = {Philippe, Bernard and Reichel, Lothar}, 635 journal = {Applied Numerical Mathematics}, 636 volume = {62}, 637 number = {9}, 638 pages = {1171--1186}, 639 year = {2012}, 640 publisher = {Elsevier} 641} 642 643@article{wakam2013memory, 644 title = {Memory efficient hybrid algebraic solvers for linear systems arising from compressible flows}, 645 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Pacull, Fran{\c{c}}ois}, 646 journal = {Computers \& Fluids}, 647 volume = {80}, 648 pages = {158--167}, 649 year = {2013}, 650 publisher = {Elsevier} 651} 652 653@misc{wakam2011parallelism, 654 title = {Parallelism and robustness in {GMRES} with the {N}ewton basis and the deflated restarting}, 655 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Erhel, Jocelyne}, 656 year = {2011}, 657 url = {https://hal.inria.fr/inria-00638247/en} 658} 659 660@article{tu2015feti, 661 title = {A {FETI-DP} type domain decomposition algorithm for three-dimensional incompressible {S}tokes equations}, 662 author = {Tu, Xuemin and Li, Jing}, 663 journal = {SIAM Journal on Numerical Analysis}, 664 volume = {53}, 665 number = {2}, 666 pages = {720--742}, 667 year = {2015}, 668 publisher = {SIAM} 669} 670 671@article{farhat2001feti, 672 title = {{FETI-DP}: a dual--primal unified {FETI} method—part {I}: A faster alternative to the two-level {FETI} method}, 673 author = {Farhat, Charbel and Lesoinne, Michel and LeTallec, Patrick and Pierson, Kendall and Rixen, Daniel}, 674 journal = {International journal for numerical methods in engineering}, 675 volume = {50}, 676 number = {7}, 677 pages = {1523--1544}, 678 year = {2001}, 679 publisher = {Wiley Online Library} 680} 681 682@article{lottes2023optimal, 683 title = {Optimal polynomial smoothers for multigrid {V}-cycles}, 684 author = {Lottes, James}, 685 journal = {Numerical Linear Algebra with Applications}, 686 volume = {30}, 687 number = {6}, 688 pages = {e2518}, 689 year = {2023}, 690 publisher = {Wiley Online Library} 691} 692 693@article{phillips2022optimal, 694 title = {Optimal {C}hebyshev Smoothers and One-sided {V}-cycles}, 695 author = {Phillips, Malachi and Fischer, Paul}, 696 journal = {arXiv preprint arXiv:2210.03179}, 697 year = {2022} 698} 699 700@incollection{toint1981towards, 701 title = {Towards an efficient sparsity exploiting {N}ewton method for minimization}, 702 author = {Toint, Philippe}, 703 booktitle = {Sparse matrices and their uses}, 704 pages = {57--88}, 705 year = {1981}, 706 publisher = {Academic press} 707} 708 709@article{cools2019numerically, 710 title = {Numerically stable recurrence relations for the communication hiding pipelined conjugate gradient method}, 711 author = {Cools, Siegfried and Cornelis, Jeffrey and Vanroose, Wim}, 712 journal = {IEEE Transactions on Parallel and Distributed Systems}, 713 volume = {30}, 714 number = {11}, 715 pages = {2507--2522}, 716 year = {2019}, 717 publisher = {IEEE} 718} 719 720@article{cornelis2018communication, 721 title = {The communication-hiding conjugate gradient method with deep pipelines}, 722 author = {Cornelis, Jeffrey and Cools, Siegfried and Vanroose, Wim}, 723 journal = {arXiv preprint arXiv:1801.04728}, 724 year = {2018} 725} 726 727@article{d1993conjugate, 728 title = {Conjugate gradient algorithms with reduced synchronization overhead on distributed memory multiprocessors}, 729 author = {D’Azevedo, EF and Eijkhout, VL and Romine, CH}, 730 journal = {Computer Science Technical Report CS-93-185, University of Tennessee, Knoxville}, 731 year = {1993} 732} 733 734@book{malek2014preconditioning, 735 title = {Preconditioning and the conjugate gradient method in the context of solving {PDEs}}, 736 author = {M{\'a}lek, Josef and Strako{\v{s}}, Zden{\v{e}}k}, 737 year = {2014}, 738 publisher = {SIAM} 739} 740 741@book{fokkema1996enhanced, 742 title = {Enhanced implementation of {BiCGstab}(l) for solving linear systems of equations}, 743 author = {Fokkema, Diederik R}, 744 year = {1996}, 745 publisher = {Citeseer} 746} 747 748@article{sleijpen1994bicgstab, 749 title = {{BiCGstab}(l) and other hybrid {Bi-CG} methods}, 750 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A and Fokkema, Diederik R}, 751 journal = {Numerical Algorithms}, 752 volume = {7}, 753 pages = {75--109}, 754 year = {1994}, 755 publisher = {Springer} 756} 757 758@article{sleijpen1995overview, 759 title = {An overview of approaches for the stable computation of hybrid {BiCG} methods}, 760 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A}, 761 journal = {Applied numerical mathematics}, 762 volume = {19}, 763 number = {3}, 764 pages = {235--254}, 765 year = {1995}, 766 publisher = {Elsevier} 767} 768 769@article{fischer1998projection, 770 title = {Projection techniques for iterative solution of Ax= b with successive right-hand sides}, 771 author = {Fischer, Paul F}, 772 journal = {Computer methods in applied mechanics and engineering}, 773 volume = {163}, 774 number = {1-4}, 775 pages = {193--204}, 776 year = {1998}, 777 publisher = {Elsevier} 778} 779 780@article{maskery2018insights, 781 title = {Insights into the mechanical properties of several triply periodic minimal surface lattice structures 782 made by polymer additive manufacturing}, 783 author = {Maskery, Ian and Sturm, Logan and Aremu, Adedeji O and Panesar, Ajit and Williams, 784 Christopher B and Tuck, Christopher J and Wildman, Ricky D and Ashcroft, Ian A and Hague, Richard JM}, 785 journal = {Polymer}, 786 volume = {152}, 787 pages = {62--71}, 788 year = {2018}, 789 publisher = {Elsevier} 790} 791 792@book{karniadakis2005spectral, 793 title = {Spectral/hp element methods for computational fluid dynamics}, 794 author = {Karniadakis, George and Sherwin, Spencer J}, 795 year = {2005}, 796 publisher = {Oxford University Press, USA} 797} 798 799@article{golub1969calculation, 800 title = {Calculation of {G}auss quadrature rules}, 801 author = {Golub, Gene H and Welsch, John H}, 802 journal = {Mathematics of computation}, 803 volume = {23}, 804 number = {106}, 805 pages = {221--230}, 806 year = {1969} 807} 808 809@article{soderlind2006adaptive, 810 title = {Adaptive time-stepping and computational stability}, 811 author = {S{\"o}derlind, Gustaf and Wang, Lina}, 812 journal = {Journal of Computational and Applied Mathematics}, 813 volume = {185}, 814 number = {2}, 815 pages = {225--243}, 816 year = {2006}, 817 publisher = {Elsevier} 818} 819 820@article{soderlind2003digital, 821 title = {Digital filters in adaptive time-stepping}, 822 author = {S{\"o}derlind, Gustaf}, 823 journal = {{ACM} Transactions on Mathematical Software ({TOMS})}, 824 volume = {29}, 825 number = {1}, 826 pages = {1--26}, 827 year = {2003}, 828 publisher = {ACM New York, NY, USA} 829} 830 831@article{volkwein2013proper, 832 title = {Proper orthogonal decomposition: Theory and reduced-order modelling}, 833 author = {Volkwein, Stefan}, 834 journal = {Lecture Notes, University of Konstanz}, 835 volume = {4}, 836 number = {4}, 837 pages = {1--29}, 838 year = {2013}, 839 url = {http://www.math.uni-konstanz.de/numerik/personen/volkwein/teaching/POD-Book.pdf} 840} 841 842@article{frisvad2012building, 843 title = {Building an orthonormal basis from a {3D} unit vector without normalization}, 844 author = {Frisvad, Jeppe Revall}, 845 journal = {Journal of Graphics Tools}, 846 volume = {16}, 847 number = {3}, 848 pages = {151--159}, 849 year = {2012}, 850 publisher = {Taylor \& Francis} 851} 852 853@article{constantinescu2007multirate, 854 title = {Multirate timestepping methods for hyperbolic conservation laws}, 855 author = {Constantinescu, Emil M and Sandu, Adrian}, 856 journal = {Journal of Scientific Computing}, 857 volume = {33}, 858 number = {3}, 859 pages = {239--278}, 860 year = {2007}, 861 publisher = {Springer} 862} 863 864@article{liu2022newton, 865 title = {A {N}ewton-{MR} algorithm with complexity guarantees for nonconvex smooth unconstrained optimization}, 866 author = {Liu, Yang and Roosta, Fred}, 867 journal = {arXiv preprint arXiv:2208.07095}, 868 year = {2022} 869} 870 871@article{choi2011minres, 872 title = {{MINRES-QLP}: A {K}rylov subspace method for indefinite or singular symmetric systems}, 873 author = {Choi, Sou-Cheng T and Paige, Christopher C and Saunders, Michael A}, 874 journal = {SIAM Journal on Scientific Computing}, 875 volume = {33}, 876 number = {4}, 877 pages = {1810--1836}, 878 year = {2011}, 879 publisher = {SIAM} 880} 881 882@article{chen2020predict, 883 title = {Predict-and-recompute conjugate gradient variants}, 884 author = {Chen, Tyler and Carson, Erin}, 885 journal = {SIAM Journal on Scientific Computing}, 886 volume = {42}, 887 number = {5}, 888 pages = {A3084--A3108}, 889 year = {2020}, 890 publisher = {SIAM} 891} 892 893@article{cools2018analyzing, 894 title = {Analyzing the effect of local rounding error propagation on the maximal attainable accuracy of the pipelined conjugate gradient method}, 895 author = {Cools, Siegfried and Yetkin, Emrullah Fatih and Agullo, Emmanuel and Giraud, Luc and Vanroose, Wim}, 896 journal = {SIAM Journal on Matrix Analysis and Applications}, 897 volume = {39}, 898 number = {1}, 899 pages = {426--450}, 900 year = {2018}, 901 publisher = {SIAM} 902} 903 904@inproceedings{tiwari2020pipelined, 905 title = {Pipelined preconditioned conjugate gradient methods for distributed memory systems}, 906 author = {Tiwari, Manasi and Vadhiyar, Sathish}, 907 booktitle = {2020 IEEE 27th International Conference on High Performance Computing, Data, and Analytics (HiPC)}, 908 pages = {151--160}, 909 year = {2020}, 910 organization = {IEEE} 911} 912 913@article{nash1984newton, 914 title = {Newton-type minimization via the {L}anczos method}, 915 author = {Nash, Stephen G}, 916 journal = {SIAM Journal on Numerical Analysis}, 917 volume = {21}, 918 number = {4}, 919 pages = {770--788}, 920 year = {1984}, 921 publisher = {SIAM} 922} 923 924@inproceedings{eller2016scalable, 925 title = {Scalable non-blocking preconditioned conjugate gradient methods}, 926 author = {Eller, Paul R and Gropp, William}, 927 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 928 pages = {204--215}, 929 year = {2016}, 930 organization = {IEEE} 931} 932 933@article{gould1999solving, 934 title = {Solving the trust-region subproblem using the Lanczos method}, 935 author = {Gould, Nicholas IM and Lucidi, Stefano and Roma, Massimo and Toint, Philippe L}, 936 journal = {SIAM Journal on Optimization}, 937 volume = {9}, 938 number = {2}, 939 pages = {504--525}, 940 year = {1999}, 941 publisher = {SIAM} 942} 943 944@article{cools2017communication, 945 title = {The communication-hiding pipelined {BiCGstab} method for the parallel solution of large unsymmetric linear systems}, 946 author = {Cools, Siegfried and Vanroose, Wim}, 947 journal = {Parallel Computing}, 948 volume = {65}, 949 pages = {1--20}, 950 year = {2017}, 951 publisher = {Elsevier} 952} 953 954@Misc{moabwebsite, 955 key = {MOAB}, 956 title = {{MOAB} Website}, 957 howpublished = {\url{https://www.mcs.anl.gov/~fathom/moab-docs/html/contents.html}}, 958 year = {2023} 959} 960 961@book{deuflhard2011, 962 title = {{N}ewton Methods for Nonlinear Problems}, 963 author = {Peter Deuflhard}, 964 volume = {35}, 965 year = {2011}, 966 isbn = {978-3-642-23898-7}, 967 doi = {10.1007/978-3-642-23899-4}, 968 publisher = {Springer-Verlag}, 969 address = {Berlin, Heidelberg} 970} 971 972@article{ketcheson2010runge, 973 title = {{R}unge--{K}utta methods with minimum storage implementations}, 974 author = {Ketcheson, David I}, 975 journal = {Journal of Computational Physics}, 976 volume = {229}, 977 number = {5}, 978 pages = {1763--1773}, 979 year = {2010}, 980 publisher = {Elsevier} 981} 982 983@article{WalkerNi2011, 984 title = {{A}nderson acceleration for fixed-point iterations}, 985 author = {Homer F Walker and Peng Ni}, 986 journal = {SIAM Journal on Numerical Analysis}, 987 volume = {49}, 988 number = {4}, 989 pages = {1715--1735}, 990 year = {2011}, 991 publisher = {SIAM} 992} 993 994@article{Hua2007, 995 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 996 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 997 journal = {AIChE Journal}, 998 volume = {53}, 999 number = {10}, 1000 pages = {2534--2548}, 1001 year = {2007}, 1002 publisher = {Wiley Online Library} 1003} 1004 1005@Article{ openblas, 1006 title = {{OpenBLAS}: A High Performance {BLAS} Library on {L}oongson {3A} {CPU}}, 1007 journal = {Journal of Software}, 1008 volume = {22}, 1009 pages = {208--216}, 1010 year = {2011}, 1011 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 1012 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 1013} 1014 1015@Misc{ openblas-website, 1016 title = {{OpenBLAS}}, 1017 key = {OpenBLAS}, 1018 howpublished = {\url{https://www.openblas.net}} 1019} 1020 1021@Misc{ openacc-website, 1022 title = {{OpenACC}}, 1023 key = {OpenACC}, 1024 howpublished = {\url{https://www.openacc.org}} 1025} 1026 1027@Misc{ bueler2020petsc, 1028 title = {{PETSc} for Partial Differential Equations: Numerical Solutions in {C} and {P}ython}, 1029 author = {Bueler, Ed}, 1030 year = {2020}, 1031 publisher = {SIAM}, 1032 petsc_uses = {KSP} 1033} 1034 1035@TechReport{ petscforgpuexascale, 1036 title = {Toward Performance-Portable {PETSc} for {GPU}-based Exascale Systems}, 1037 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1038 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 1039 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1040 institution = {Argonne National Laboratory}, 1041 number = {ANL/MCS-P9401-1020}, 1042 note = {\url{https://arxiv.org/abs/2011.00715}}, 1043 year = {2020}, 1044 petsc_uses = {KSP} 1045} 1046 1047@Article{ mills2021, 1048 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 1049 journal = {Parallel Computing}, 1050 volume = {108}, 1051 pages = {102831}, 1052 year = {2021}, 1053 issn = {0167-8191}, 1054 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 1055 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 1056 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1057 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 1058 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 1059} 1060 1061@Article{ rupp:2016:pis:2988256.2907944, 1062 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 1063 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 1064 journal = {ACM Trans. Math. Softw.}, 1065 issue_date = {September 2016}, 1066 volume = {43}, 1067 number = {2}, 1068 month = aug, 1069 year = {2016}, 1070 issn = {0098-3500}, 1071 pages = {11:1--11:27}, 1072 articleno = {11}, 1073 numpages = {27}, 1074 doi = {10.1145/2907944}, 1075 acmid = {2907944}, 1076 publisher = {ACM}, 1077 address = {New York, NY, USA}, 1078 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 1079 gradient method}, 1080 petsc_uses = {KSP} 1081} 1082 1083@Article{ dalcin2011parallel, 1084 title = {Parallel distributed computing using python}, 1085 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 1086 journal = {Advances in Water Resources}, 1087 volume = {34}, 1088 number = {9}, 1089 pages = {1124--1139}, 1090 year = {2011}, 1091 publisher = {Elsevier}, 1092 petsc_uses = {KSP} 1093} 1094 1095@Article{ mendezpongaortiz2018, 1096 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 1097 author = {JP Mendez and M Ponga and M Ortiz}, 1098 journal = {Journal of the Mechanics and Physics of Solids}, 1099 year = {2018}, 1100 petsc_uses = {KSP} 1101} 1102 1103@TechReport{ morgan2020evaluation, 1104 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 1105 System: Part 1: Vector Node Performance}, 1106 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 1107 year = {2020}, 1108 institution = {Argonne National Laboratory}, 1109 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 1110 petsc_uses = {KSP} 1111} 1112 1113@TechReport{ pdeconstrainedspectraladjoints, 1114 title = {PDE constrained optimization, error estimation and control with spectral elements 1115 using PETSc and TAO}, 1116 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 1117 type = {Preprint}, 1118 number = {ANL/MCS-P9031-1117}, 1119 institution = {ANL}, 1120 month = nov, 1121 year = {2017}, 1122 petsc_uses = {KSP} 1123} 1124 1125@InProceedings{ asc2013, 1126 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 1127 title = {Evaluation of overlapping restricted additive {S}chwarz preconditioning for 1128 parallel solution of very large power flow problems}, 1129 booktitle = {HiPCNA-PG’13}, 1130 year = {2013}, 1131 petsc_uses = {KSP} 1132} 1133 1134@InProceedings{ as2013, 1135 author = {S. Abhyankar and B. F. Smith}, 1136 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 1137 Smart Grid Applications}, 1138 booktitle = {Proceedings of the IEEE PES General Meeting}, 1139 year = {2013}, 1140 petsc_uses = {KSP} 1141} 1142 1143@TechReport{ tspaper, 1144 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 1145 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 1146 Barry F. Smith}, 1147 type = {Preprint}, 1148 number = {ANL/MCS-P5061-0114}, 1149 institution = {ANL}, 1150 month = jan, 1151 year = {2014}, 1152 petsc_uses = {KSP} 1153} 1154 1155@TechReport{ abhyankaretal2018, 1156 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 1157 and Barry F. Smith and Hong Zhang}, 1158 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 1159 journal = {arXiv e-preprints}, 1160 eprint = {1806.01437}, 1161 archiveprefix = {arXiv}, 1162 year = {2018}, 1163 petsc_uses = {KSP} 1164} 1165 1166@Article{ zhang2021cams, 1167 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 1168 author = {Hong Zhang and Emil M. Constantinescu}, 1169 journal = {arXiv e-preprints}, 1170 eprint = {2202.11890}, 1171 archiveprefix = {arXiv}, 1172 year = {2022}, 1173 petsc_uses = {KSP} 1174} 1175 1176@InProceedings{ zhangconstantinescu2021b, 1177 title = {Revolve-based adjoint checkpointing for multistage time integration}, 1178 author = {Hong Zhang and Emil M. Constantinescu}, 1179 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 1180 month = jun, 1181 year = {2021}, 1182 petsc_uses = {KSP} 1183} 1184 1185@Article{ zhang2022tsadjoint, 1186 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 1187 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 1188 Sensitivity Analysis}}, 1189 journal = {SIAM Journal on Scientific Computing}, 1190 volume = {44}, 1191 number = {1}, 1192 pages = {C1-C24}, 1193 year = {2022}, 1194 doi = {10.1137/21M140078X}, 1195 petsc_uses = {KSP} 1196} 1197 1198@TechReport{ bb2008, 1199 author = {Tomasz Blachowicz and Bartlomiej Baron}, 1200 title = {A graphical extension for the Windows version of the Parallel Finite Element 1201 Micromagnetics Package (MagParExt)}, 1202 url = {http://arxiv.org/abs/0807.2655}, 1203 year = {2008}, 1204 petsc_uses = {KSP} 1205} 1206 1207@Article{ jacvgv2008, 1208 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 1209 and J L Vicent}, 1210 title = {Field induced vortex dynamics in magnetic {Ni} nanotriangles}, 1211 journal = {Nanotechnology}, 1212 volume = {19}, 1213 year = {2008}, 1214 doi = {10.1088/0957-4484/19/28/285717}, 1215 petsc_uses = {KSP} 1216} 1217 1218@Article{ yjdwh2008, 1219 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1220 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1221 journal = {Journal of the Magnetics Society of Japan}, 1222 volume = {32}, 1223 year = {2008}, 1224 pages = {50-53}, 1225 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 1226 petsc_uses = {KSP} 1227} 1228 1229@Article{ mtrtrsa2008, 1230 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 1231 Schrefl and M. Albrecht}, 1232 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 1233 journal = {J. Appl. Phys.}, 1234 volume = {103}, 1235 year = {2008}, 1236 doi = {10.1063/1.2894587}, 1237 petsc_uses = {KSP} 1238} 1239 1240@InProceedings{ tmrttsa2008, 1241 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 1242 Schrefl and M. Albrecht}, 1243 title = {Patterning of magnetic films by focused ion beam irradiation}, 1244 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 1245 year = {2008}, 1246 petsc_uses = {KSP} 1247} 1248 1249@Article{ yjdbh2007, 1250 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 1251 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 1252 factor for the single-phase soft magnetic films}, 1253 journal = {J. Magn. Magn. Mater.}, 1254 volume = {320}, 1255 number = {7}, 1256 pages = {1393-1397}, 1257 doi = {10.1016/j.jmmm.2007.11.025}, 1258 petsc_uses = {KSP} 1259} 1260 1261@Article{ lxky2007, 1262 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 1263 title = {Micromagnetic simulation and experimental study on microwave permeability of 1264 nano-magnetic films}, 1265 journal = {Transactions of Nonferrous Metals Society of China}, 1266 year = {2007}, 1267 pages = {756-759}, 1268 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 1269 petsc_uses = {KSP} 1270} 1271 1272@Article{ yjdwh2008a, 1273 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1274 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1275 journal = {Journal of the Magnetics Society of Japan}, 1276 volume = {32}, 1277 year = {2008}, 1278 pages = {50-53}, 1279 doi = {10.3379/msjmag.32.50}, 1280 petsc_uses = {KSP} 1281} 1282 1283@Article{ lylw2007, 1284 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 1285 title = {Micromagnetic study of magnetization reversal in patterned {DyFeCo} thin films}, 1286 journal = {Phys. Stat. Sol.}, 1287 volume = {204}, 1288 number = {12}, 1289 pages = {4049-4052}, 1290 year = {2007}, 1291 doi = {10.1002/pssa.200777359}, 1292 petsc_uses = {KSP} 1293} 1294 1295@InProceedings{ sg2007, 1296 author = {Simon Greaves}, 1297 title = {Micromagnetic Simulations of Magnetic Recording Media}, 1298 booktitle = {High Performance Computing on Vector Systems 2007}, 1299 doi = {10.1007/978-3-540-74384-2_17}, 1300 petsc_uses = {KSP} 1301} 1302 1303@Article{ bsc2007, 1304 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 1305 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm {NiFe} Nanorings}, 1306 journal = {IEEE Trans. Magn.}, 1307 volume = {43}, 1308 year = {2007}, 1309 pages = {2884-2886}, 1310 doi = {10.1109/TMAG.2007.892867}, 1311 petsc_uses = {KSP} 1312} 1313 1314@Article{ ffbf, 1315 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 1316 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 1317 Micromagnetic Simulations: Nmag.}, 1318 journal = {IEEE Trans. Magn. Volume}, 1319 volume = {43}, 1320 pages = {2896-2898}, 1321 doi = {10.1109/TMAG.2007.893843}, 1322 petsc_uses = {KSP} 1323} 1324 1325@InBook{ dfssfs2006, 1326 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 1327 chapter = {Computational Aspects of Micromagnetics}, 1328 title = {The Science of Hysteresis}, 1329 editor = { G. Bertotti and I. Mayergoyz}, 1330 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 1331 petsc_uses = {KSP} 1332} 1333 1334@InBook{ fss, 1335 author = {J. Fidler and T. Schrefl and W. Scholz}, 1336 chapter = {Computational Micromagnetics}, 1337 title = {Handbook of Theoretical and Computational Nanotechnology}, 1338 editor = {M. Rieth and W. Schommers}, 1339 url = {http://www.amazon.com/gp/product/158883042X}, 1340 petsc_uses = {KSP} 1341} 1342 1343@InBook{ shbsef, 1344 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 1345 Josef Fidler}, 1346 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 1347 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 1348 editor = {Helmut Kronmueller and Stuart Parkin}, 1349 doi = {10.1002/9780470022184.hmm203}, 1350 petsc_uses = {KSP} 1351} 1352 1353@InBook{ sfs, 1354 author = {D. Suess and J. Fidler and T. Schrefl}, 1355 chapter = {Micromagnetic Simulation of magnetic materials}, 1356 title = {Handbook of Magnetic Materials}, 1357 editor = {K. H. J. Buschow}, 1358 url = {http://www.amazon.com/gp/product/0444518509}, 1359 petsc_uses = {KSP} 1360} 1361 1362@Article{ fsxzs, 1363 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 1364 Sharma}, 1365 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 1366 Recording.}, 1367 journal = {IEEE Trans. Magn. Volume}, 1368 volume = {43}, 1369 pages = {2175-2177}, 1370 doi = {10.1109/TMAG.2007.893122}, 1371 petsc_uses = {KSP} 1372} 1373 1374@Article{ sb2006, 1375 author = {W. Scholz and S. Batra}, 1376 title = {Effect of write current waveform on magnetization and head field dynamics of 1377 perpendicular recording heads}, 1378 journal = {IEEE Trans. Magn.}, 1379 volume = {42}, 1380 year = {2006}, 1381 pages = {2264--2266}, 1382 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 1383 petsc_uses = {KSP} 1384} 1385 1386@Article{ bsr2006, 1387 author = {S. Batra and W. Scholz and T. Roscamp}, 1388 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 1389 recording system}, 1390 journal = {J. Appl. Phys.}, 1391 volume = {99}, 1392 year = {2006}, 1393 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 1394 petsc_uses = {KSP} 1395} 1396 1397@InProceedings{ japios2006, 1398 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 1399 Subramanian}, 1400 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 1401 in systems with cubic and uniaxial anisotropy.}, 1402 booktitle = {Intermag 2006 Conference}, 1403 petsc_uses = {KSP} 1404} 1405 1406@Article{ kbmb2006, 1407 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 1408 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 1409 Perpendicular Recording Heads}, 1410 journal = {IEEE Trans. Magn.}, 1411 volume = {42}, 1412 year = {2006}, 1413 pages = {2428--2430}, 1414 doi = {10.1109/TMAG.2006.879430}, 1415 petsc_uses = {KSP} 1416} 1417 1418@Article{ cclcw2006, 1419 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 1420 title = {Control of Domain Wall Motion in Permalloy Ring}, 1421 journal = {IEEE Trans. Magn.}, 1422 volume = {42}, 1423 year = {2006}, 1424 pages = {2960--2962}, 1425 doi = {10.1109/TMAG.2006.878414}, 1426 petsc_uses = {KSP} 1427} 1428 1429@Article{ bfmfzczg2007, 1430 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 1431 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 1432 title = {Micromagnetic modelling of ferromagnetic cones}, 1433 journal = {J. Magn. Magn. Mater.}, 1434 volume = {312}, 1435 year = {2007}, 1436 pages = {234-238}, 1437 url = {http://eprints.soton.ac.uk/45900/}, 1438 petsc_uses = {KSP} 1439} 1440 1441@PhDThesis{ rb2005, 1442 author = {Richard Boardman}, 1443 title = {Computer simulation studies of magnetic nanostructures}, 1444 school = {Computational Engineering and Design Group, School of Engineering Sciences, 1445 University of Southampton, United Kingdom}, 1446 year = {2005}, 1447 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 1448 petsc_uses = {KSP} 1449} 1450 1451@InProceedings{ cwwy2006, 1452 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 1453 title = {MPI Performance Analysis Tools on Blue Gene/L}, 1454 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 1455 year = {2006}, 1456 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 1457 petsc_uses = {KSP} 1458} 1459 1460@InProceedings{ ch2006, 1461 author = {I.-H. Chung and J.K. Hollingsworth}, 1462 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 1463 Programs}, 1464 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 1465 pages = {45--56}, 1466 doi = {10.1109/HPDC.2006.1652135}, 1467 petsc_uses = {KSP} 1468} 1469 1470@Article{ lkpl2005, 1471 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1472 title = {Multibit {MRAM} using a pair of memory cells}, 1473 journal = {IEEE Trans. Magn.}, 1474 volume = {41}, 1475 year = {2005}, 1476 pages = {2670-2672}, 1477 doi = {10.1109/TMAG.2005.855288}, 1478 petsc_uses = {KSP} 1479} 1480 1481@Article{ gscn2005, 1482 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 1483 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 1484 journal = {Phys. Rev. B}, 1485 volume = {71}, 1486 year = {2005}, 1487 doi = {10.1103/PhysRevB.71.144407}, 1488 petsc_uses = {KSP} 1489} 1490 1491@PhDThesis{ mda, 1492 author = {Massimiliano d'Aquino}, 1493 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 1494 school = { Universita di Napoli Federico II.}, 1495 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 1496 petsc_uses = {KSP} 1497} 1498 1499@TechReport{ ssdfssf2003, 1500 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 1501 Stehno and J. Fidler}, 1502 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 1503 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 1504 petsc_uses = {KSP} 1505} 1506 1507@InProceedings{ sb2006a, 1508 author = {W. Scholz and S. Batra}, 1509 title = {Effect of write current waveform on magnetization and head field dynamics of 1510 perpendicular recording heads}, 1511 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 1512 petsc_uses = {KSP} 1513} 1514 1515@Article{ scholz-batra1, 1516 author = {W. Scholz and S. Batra}, 1517 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 1518 Recording}, 1519 journal = {IEEE Trans. Magn.}, 1520 note = {submitted}, 1521 year = {2005}, 1522 petsc_uses = {KSP} 1523} 1524 1525@Article{ scholz-batra2, 1526 author = {W. Scholz and S. Batra}, 1527 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 1528 journal = {IEEE Trans. Magn.}, 1529 volume = {41}, 1530 year = {2005}, 1531 pages = {702-706}, 1532 petsc_uses = {KSP} 1533} 1534 1535@Article{ daquino-scholz1, 1536 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1537 title = {Micromagnetic Analysis of Fast Precessional Switching}, 1538 journal = {J. Magn. Magn. Mater.}, 1539 volume = {290-291}, 1540 year = {2005}, 1541 pages = {510-513}, 1542 petsc_uses = {KSP} 1543} 1544 1545@Article{ aq-scholz-fid, 1546 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1547 title = {Numerical and analytical study of fast precessional switching}, 1548 journal = {J. Appl. Phys.}, 1549 volume = {95}, 1550 year = {2004}, 1551 pages = {7055-7057}, 1552 petsc_uses = {KSP} 1553} 1554 1555@InProceedings{ gar-tabik-gar, 1556 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 1557 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 1558 Scatterers}, 1559 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 1560 (PDP'04)}, 1561 year = {2004}, 1562 pages = {80--}, 1563 petsc_uses = {KSP} 1564} 1565 1566@InProceedings{ aq-scholz-mia, 1567 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 1568 title = {Analysis of fast precessional switching in magnetic thin films}, 1569 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 1570 year = {2004}, 1571 pages = {257-260}, 1572 petsc_uses = {KSP} 1573} 1574 1575@Article{ scholz-fid-seus, 1576 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 1577 Dittrich and V. Tsiantos}, 1578 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 1579 Axes}, 1580 journal = {J. Magn. Magn. Mater.}, 1581 year = {2004}, 1582 pages = {1524-1525}, 1583 petsc_uses = {KSP} 1584} 1585 1586@Article{ boardman-zimmerman, 1587 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 1588 Peter de Groot}, 1589 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 1590 journal = {Journal of Applied Physics}, 1591 year = {2005}, 1592 petsc_uses = {KSP} 1593} 1594 1595@Article{ lim-kim-park, 1596 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1597 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 1598 journal = {IEEE Trans. Magn.}, 1599 note = {submitted}, 1600 petsc_uses = {KSP} 1601} 1602 1603@Article{ scholz-suess2, 1604 author = {W. Scholz and D. Suess and T. Schrefl and J. Fidler}, 1605 title = {Micromagnetic simulation of magnetization reversal in small particles with 1606 surface anisotropy}, 1607 journal = {J. Appl. Phys.}, 1608 volume = {95}, 1609 year = {2004}, 1610 pages = {6807-6809}, 1611 petsc_uses = {KSP} 1612} 1613 1614@Article{ scholz-schrefl1, 1615 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 1616 Tsiantos}, 1617 title = {Micromagnetic simulation of the pinning and depinning process in permanent 1618 magnets}, 1619 journal = {IEEE Trans. Magn.}, 1620 volume = {39}, 1621 year = {2003}, 1622 pages = {2920-2922}, 1623 petsc_uses = {KSP} 1624} 1625 1626@Article{ scholz-guslienko, 1627 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 1628 W. Chantrell and J. Fidler}, 1629 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 1630 nanodots}, 1631 journal = {J. Magn. Magn. Mater.}, 1632 volume = {266}, 1633 year = {2003}, 1634 pages = {155-163}, 1635 petsc_uses = {KSP} 1636} 1637 1638@Article{ scholz1, 1639 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 1640 Forster and V. Tsiantos}, 1641 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1642 journal = {Comp. Mat. Sci}, 1643 year = {2003}, 1644 pages = {366--383}, 1645 volume = {28}, 1646 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 1647 petsc_uses = {KSP} 1648} 1649 1650@PhDThesis{ scholz2, 1651 author = {W. Scholz}, 1652 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1653 school = {Vienna University of Technology, Vienna, Austria}, 1654 year = {2003}, 1655 petsc_uses = {KSP} 1656} 1657 1658@Article{ scholz3, 1659 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 1660 Forster and J. Fidler}, 1661 title = {Implementation of a high performance parallel finite element micromagnetics 1662 package}, 1663 journal = {J. Magn. Magn. Mater.}, 1664 year = {2004}, 1665 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 1666 petsc_uses = {KSP} 1667} 1668 1669% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1670@InBook{ zhanggladwell1, 1671 author = {W. Zhang and I. Gladwell}, 1672 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 1673 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 1674 year = {2000}, 1675 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 1676 Physics, vol. 552}, 1677 publisher = {Springer}, 1678 pages = {4190-}, 1679 petsc_uses = {KSP} 1680} 1681 1682@Article{ wolf1, 1683 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 1684 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 1685 thin films}, 1686 journal = {Phil. Mag. A}, 1687 year = {2003}, 1688 lab = {ANL}, 1689 petsc_uses = {KSP} 1690} 1691 1692@Article{ wolf2, 1693 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 1694 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 1695 grain-boundary properties}, 1696 journal = {Computational Materials Science}, 1697 year = {2001}, 1698 volume = {23}, 1699 pages = {15--32}, 1700 lab = {ANL}, 1701 petsc_uses = {KSP} 1702} 1703 1704@Article{ wolf3, 1705 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 1706 title = {Role of grain rotation in grain growth by mesoscale simulation}, 1707 journal = {Phil. Mag. A}, 1708 year = {2002}, 1709 volume = {82}, 1710 pages = {1271--1297}, 1711 lab = {ANL}, 1712 petsc_uses = {KSP} 1713} 1714 1715% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1716@Article{ saut, 1717 author = { Olivier Saut}, 1718 title = {Bidimensional Study of the {M}axwell-{B}loch Model in a Nonlinear Crystal}, 1719 journal = {SIAM Journal on Scientific Computing}, 1720 year = {2004}, 1721 note = {submitted}, 1722 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 1723 petsc_uses = {KSP} 1724} 1725 1726% LiteralHTML: 1727% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 1728% LiteralHTML: 1729@InBook{ khanallorenziayachepennec2016, 1730 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 1731 of Brain Deformation in {Alzheimer's} Disease}, 1732 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 1733 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 1734 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 1735 Miller}, 1736 pages = {167--176}, 1737 isbn = {978-3-319-28329-6}, 1738 doi = {10.1007/978-3-319-28329-6_15}, 1739 publisher = {Springer International Publishing}, 1740 year = {2016}, 1741 petsc_uses = {KSP} 1742} 1743 1744@Article{ ataseven, 1745 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 1746 title = {Parallel implementation of the accelerated {BEM} approach for {EMSI} of the human 1747 brain}, 1748 journal = {Medical and Biological Engineering and Computing}, 1749 month = feb, 1750 year = {2008}, 1751 doi = {10.1007/s11517-008-0316-0}, 1752 petsc_uses = {KSP} 1753} 1754 1755@Article{ dennis-eberhart-03, 1756 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 1757 pages = {832-840}, 1758 volume = {125}, 1759 number = {6}, 1760 title = {Finite-element simulation of cooling of realistic {3-D} human head and neck}, 1761 journal = {J Biomech Eng}, 1762 year = {2003}, 1763 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 1764 petsc_uses = {KSP} 1765} 1766 1767@Conference{ gu7174parallel, 1768 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 1769 frequency-domain small animal optical tomography}}, 1770 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 1771 booktitle = {Proc. of SPIE Vol}, 1772 volume = {7174}, 1773 number = {717406}, 1774 pages = {1}, 1775 petsc_uses = {KSP} 1776} 1777 1778@Article{ barchanski2005using, 1779 title = {{Using domain decomposition techniques for the calculation of low-frequency 1780 electric current densities in high-resolution 3D human anatomy models}}, 1781 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 1782 T.}, 1783 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 1784 and Electronic Engineering}, 1785 volume = {24}, 1786 number = {2}, 1787 pages = {458--467}, 1788 issn = {0332-1649}, 1789 year = {2005}, 1790 publisher = {Emerald Group Publishing Limited}, 1791 petsc_uses = {KSP} 1792} 1793 1794@Article{ motrescurienen05, 1795 author = {V. C. Motrescu and U. van Rienen}, 1796 pages = {227--231}, 1797 volume = {3}, 1798 title = {Computation of currents induced by {ELF} electric fields in anisotropic human 1799 tissues using the Finite Integration Technique}, 1800 journal = {Advances in Radio Science}, 1801 year = {2005}, 1802 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 1803 petsc_uses = {KSP} 1804} 1805 1806@Article{ motrescurienen04, 1807 author = {V. C. Motrescu and U. van Rienen}, 1808 pages = {309--313}, 1809 volume = {2}, 1810 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 1811 Integration Technique (FIT)}, 1812 journal = {Advances in Radio Science}, 1813 year = {2004}, 1814 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 1815 petsc_uses = {KSP} 1816} 1817 1818@InProceedings{ dbl2, 1819 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 1820 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 1821 booktitle = {ECCOMAS2000}, 1822 year = {2000}, 1823 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 1824 petsc_uses = {KSP} 1825} 1826 1827@Unpublished{ cell, 1828 title = {Parallel Simulation Engines for Whole-Cell Models}, 1829 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 1830 Weber}, 1831 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 1832 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 1833 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 1834 year = {2001}, 1835 petsc_uses = {KSP} 1836} 1837 1838@Article{ barker2010two, 1839 title = {Two-level {N}ewton and hybrid {S}chwarz preconditioners for fluid-structure 1840 interaction}, 1841 author = {Barker, A.T. and Cai, X.C.}, 1842 journal = {SIAM Journal on Scientific Computing}, 1843 volume = {32}, 1844 number = {4}, 1845 pages = {2395--2417}, 1846 year = {2010}, 1847 publisher = {Society for Industrial and Applied Mathematics}, 1848 petsc_uses = {KSP} 1849} 1850 1851@Article{ barker2010scalable, 1852 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 1853 with application to blood flow modeling}, 1854 author = {Barker, A.T. and Cai, X.C.}, 1855 journal = {Journal of Computational Physics}, 1856 volume = {229}, 1857 number = {3}, 1858 pages = {642--659}, 1859 year = {2010}, 1860 publisher = {Elsevier}, 1861 petsc_uses = {KSP} 1862} 1863 1864@Article{ barker2009nks, 1865 title = {{NKS} for fully coupled fluid-structure interaction with application}, 1866 author = {Barker, A.T. and Cai, X.C.}, 1867 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 1868 pages = {275--282}, 1869 year = {2009}, 1870 publisher = {Springer}, 1871 petsc_uses = {KSP} 1872} 1873 1874@Article{ mirams2013, 1875 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 1876 and Yi Cui and Gary R Mirams}, 1877 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 1878 to predict {QT} interval changes in the rabbit ventricular wedge}, 1879 journal = {Journal of pharmacological and toxicological methods}, 1880 volume = {68}, 1881 number = {1}, 1882 pages = {88--96}, 1883 year = {2013}, 1884 doi = {10.1016/j.vascn.2013.04.004}, 1885 petsc_uses = {KSP} 1886} 1887 1888% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1889% LiteralHTML: <center><img alt="" 1890% LiteralHTML: src="images/spine0l.jpg"></center></p> 1891% LiteralHTML: <center><img alt="" 1892% LiteralHTML: src="images/vertebra.jpg"></center></p> 1893% LiteralHTML:<font color="#FF0000"> 1894% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 1895% LiteralHTML:Understanding bone mechanical properties and how they may lead to 1896% LiteralHTML:fractures is thus an important medical research activity. PETSc and 1897% LiteralHTML:Prometheus have been used for extremely large scale finite element 1898% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 1899% LiteralHTML:team of doctors and computational scientists. This computation was 1900% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 1901% LiteralHTML:with over 4000 processors.</p> 1902% LiteralHTML: </font> 1903@Article{ arbenz2008scalable, 1904 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 1905 analysis of human bone structures}, 1906 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 1907 journal = {International Journal for Numerical Methods in Engineering}, 1908 volume = {73}, 1909 number = {7}, 1910 pages = {927--947}, 1911 year = {2008}, 1912 publisher = {Wiley Online Library}, 1913 petsc_uses = {KSP} 1914} 1915 1916@InProceedings{ adams-04, 1917 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1918 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 1919 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 1920 half a billion degrees of freedom}, 1921 note = {Gordon Bell Award}, 1922 year = {2004}, 1923 petsc_uses = {KSP} 1924} 1925 1926@InProceedings{ adams-03b, 1927 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1928 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 1929 Whole Bone Micro-Mechanics on the {IBM SP}}, 1930 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 1931 year = {2003}, 1932 petsc_uses = {KSP} 1933} 1934 1935@InProceedings{ oghattas2002, 1936 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 1937 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 1938 booktitle = {Procceedings of SC2002}, 1939 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 1940 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 1941 by time-dependent PDEs, and scalability results for an inverse wave propagation 1942 problem of determining the material field of an acoustic medium. Using the 1943 algorithm, they solved a synthetic inverse wave propagation problem though a 1944 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 1945 processors.}, 1946 year = {2002}, 1947 petsc_uses = {KSP} 1948} 1949 1950% LiteralHTML: <a name="biology:cardiology"> 1951% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1952% LiteralHTML: <center><img alt="" 1953% LiteralHTML: src="images/heart.jpg"> 1954% LiteralHTML: <img alt="" 1955% LiteralHTML: src="images/pump.jpg"></center></p> 1956% LiteralHTML: 1957% LiteralHTML:<font color="#FF0000"> 1958% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 1959% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 1960% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 1961% LiteralHTML: through the heart. PETSc has been used by several research groups to 1962% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 1963% LiteralHTML: fully understand the developments of arrhthmias.</p> 1964% LiteralHTML:</font> 1965@InProceedings{ oghattas2000, 1966 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1967 Walkington}, 1968 title = {A Parallel Dynamic-Mesh {L}agrangian Method for Simulation of Flows with Dynamic 1969 Interfaces}, 1970 booktitle = {Procceedings of SC2000}, 1971 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1972 note = {Blood flow modeling at the microscale including effects on individual blood 1973 cells, for designing heart assist pumps, etc.}, 1974 year = {2000}, 1975 petsc_uses = {KSP} 1976} 1977 1978@InBook{ cfps2006, 1979 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1980 editor = {A. Quarteroni et al.}, 1981 title = {Complex Systems in Biomedicine}, 1982 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1983 publisher = {Springer-Verlag}, 1984 pages = {187--241}, 1985 year = {2006}, 1986 petsc_uses = {KSP} 1987} 1988 1989@InProceedings{ cfpst2007, 1990 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 1991 title = {Determining recovery times from transmembrane action potentials and unipolar 1992 electrograms in normal heart tissue}, 1993 booktitle = {FIMH07}, 1994 publisher = {Springer-Verlag}, 1995 volume = {4466}, 1996 pages = {139--149}, 1997 year = {2007}, 1998 petsc_uses = {KSP} 1999} 2000 2001@Article{ seemann2010framework, 2002 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 2003 Equations Using PETSc}}, 2004 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 2005 D{\\"o}ssel, O.}, 2006 journal = {Progress in Industrial Mathematics at ECMI 2008}, 2007 pages = {363--369}, 2008 year = {2010}, 2009 publisher = {Springer}, 2010 petsc_uses = {KSP} 2011} 2012 2013@InProceedings{ pft2005, 2014 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 2015 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 2016 Intramural Heterogeneity}, 2017 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 2018 pages = {267--277}, 2019 editors = {A. Frangi et al.}, 2020 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 2021 year = {2005}, 2022 petsc_uses = {KSP} 2023} 2024 2025@Article{ bgcp2005, 2026 author = {Boyce E. Griffith and Charles S. Peskin}, 2027 title = {On the order of accuracy of the immersed boundary method: Higher order 2028 convergence rates for sufficiently smooth problems}, 2029 journal = {Journal of Computational Physics}, 2030 year = {2005}, 2031 volume = {208}, 2032 pages = {75--105}, 2033 petsc_uses = {KSP} 2034} 2035 2036@Article{ griffith2007adaptive, 2037 title = {An adaptive, formally second order accurate version of the immersed boundary 2038 method}, 2039 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 2040 journal = {Journal of Computational Physics}, 2041 volume = {223}, 2042 number = {1}, 2043 pages = {10--49}, 2044 year = {2007}, 2045 publisher = {Elsevier}, 2046 petsc_uses = {KSP} 2047} 2048 2049@PhDThesis{ griffith05, 2050 author = {Boyce Griffith}, 2051 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 2052 parallel version of the immersed boundary method}, 2053 school = {New York University}, 2054 year = {2005}, 2055 petsc_uses = {KSP} 2056} 2057 2058@PhDThesis{ murillo, 2059 author = {Maria S. Murillo}, 2060 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 2061 Differential Equations with an Application in Computational Biology}, 2062 school = {University of Colorado at Boulder}, 2063 year = {2002}, 2064 petsc_uses = {KSP} 2065} 2066 2067@Article{ spv2004, 2068 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 2069 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 2070 journal = {IEEE Trans. Biomed. Eng}, 2071 year = {2004}, 2072 volume = {51}, 2073 pages = {1960--1968}, 2074 petsc_uses = {KSP} 2075} 2076 2077@Article{ vphl2003, 2078 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 2079 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 2080 journal = {J. Electrocardiol.}, 2081 year = {2003}, 2082 volume = {36}, 2083 pages = {69--74}, 2084 petsc_uses = {KSP} 2085} 2086 2087@InProceedings{ spbv2003, 2088 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and E.J. Vigmond}, 2089 title = {Preconditioning Techniques for the Bidomain Equations}, 2090 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2091 Methods}, 2092 pages = {571--580}, 2093 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2094 note = {}, 2095 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2096 year = {2003}, 2097 petsc_uses = {KSP} 2098} 2099 2100@Article{ franz-pavir-04, 2101 author = {P. Colli Franzone and L.~F. Pavarino}, 2102 title = {A parallel solver for reaction-diffusion systems in computational 2103 electrocardiology}, 2104 journal = {Mathematical Models and Methods in Applied Sciences}, 2105 year = {2004}, 2106 volume = {14}, 2107 number = {6}, 2108 pages = {883--912}, 2109 petsc_uses = {KSP} 2110} 2111 2112@Article{ franz-pavir-05, 2113 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2114 title = {Simulating patterns of excitation, repolarization and action potential 2115 durationwith cardiac Bidomain and Monodomain models}, 2116 journal = {Mathematical Biosciences}, 2117 year = {2005}, 2118 volume = {197}, 2119 number = {1}, 2120 pages = {35--66}, 2121 petsc_uses = {KSP} 2122} 2123 2124@Article{ franz-pavir-06, 2125 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2126 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 2127 the dispersion of cardiac repolarization and action potential duration: a 2128 simulation study}, 2129 journal = {Mathematical Biosciences}, 2130 year = {2006}, 2131 volume = {204}, 2132 number = {1}, 2133 pages = {132--165}, 2134 petsc_uses = {KSP} 2135} 2136 2137@InProceedings{ colli-franz-sim, 2138 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 2139 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 2140 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 2141 Mediterranean Conference on Medical and Biological Engineering}, 2142 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 2143 year = {2004}, 2144 petsc_uses = {KSP} 2145} 2146 2147@InProceedings{ pf2003, 2148 author = {Luca F. Pavarino and Piero Colli Franzone}, 2149 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 2150 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2151 Methods}, 2152 pages = {669--776}, 2153 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2154 note = {}, 2155 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2156 year = {2003}, 2157 petsc_uses = {KSP} 2158} 2159 2160@Article{ maria-is04, 2161 author = {Maria Murillo and Xiao-Chuan Cai}, 2162 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 2163 activity of the heart}, 2164 journal = {Numerical Linear Algebra with Applications}, 2165 year = {2004}, 2166 volume = {11}, 2167 pages = {261 - 277}, 2168 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 2169 petsc_uses = {KSP} 2170} 2171 2172@Article{ murli2007monitoring, 2173 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 2174 Imaging in a Grid computing PSE}}, 2175 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 2176 and Lapegna, M.}, 2177 journal = {Grid-Based Problem Solving Environments}, 2178 pages = {421--432}, 2179 year = {2007}, 2180 publisher = {Springer}, 2181 petsc_uses = {KSP} 2182} 2183 2184@Article{ carracciuolo:2006:tpc, 2185 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 2186 title = {Towards a parallel component for imaging in {PETSc} programming environment: a case 2187 study in {3-D} echocardiography}, 2188 journal = {Parallel Comput.}, 2189 volume = {32}, 2190 issue = {1}, 2191 month = jan, 2192 year = {2006}, 2193 issn = {0167-8191}, 2194 pages = {67--83}, 2195 numpages = {17}, 2196 doi = {10.1016/j.parco.2005.09.001}, 2197 acmid = {1141218}, 2198 publisher = {Elsevier Science Publishers B. V.}, 2199 address = {Amsterdam, The Netherlands, The Netherlands}, 2200 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 2201 component}, 2202 petsc_uses = {KSP} 2203} 2204 2205@Article{ damore2011integration, 2206 title = {Integration of emerging computer technologies for an efficient image sequences 2207 analysis}, 2208 journal = {Integrated Computer-Aided Engineering }, 2209 volume = {18}, 2210 number = {4}, 2211 pages = {365 - 378}, 2212 year = {2011}, 2213 note = {}, 2214 issn = {1875-8835}, 2215 doi = {10.3233/ICA-2011-0382}, 2216 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 2217 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 2218 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 2219 petsc_uses = {KSP} 2220} 2221 2222@InProceedings{ eth_biwi_00721, 2223 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and G. 2224 Székely}, 2225 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 2226 a {S}chur Complement Preconditioner}, 2227 booktitle = {Euro-Par 2009 Parallel Processing}, 2228 year = {2009}, 2229 month = aug, 2230 pages = {747-759}, 2231 volume = {5704}, 2232 editor = {H. Sips and D. Epema and H.-X. Lin}, 2233 series = {Lecture Notes in Computer Science}, 2234 publisher = {Springer}, 2235 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 2236 parallel Krylov solver}, 2237 petsc_uses = {KSP} 2238} 2239 2240% LiteralHTML: <a name="biology:imagingandsurgery"> 2241% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 2242% LiteralHTML: <center><img alt="" 2243% LiteralHTML: src="images/brain.jpg"></center> 2244@Article{ ganser2004deformable, 2245 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 2246 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 2247 journal = {Medical Image Analysis}, 2248 volume = {8}, 2249 number = {1}, 2250 pages = {3--22}, 2251 year = {2004}, 2252 publisher = {Elsevier}, 2253 petsc_uses = {KSP} 2254} 2255 2256@Unpublished{ taccsurgery, 2257 title = {{TACC} supercomputer performs laser cancer surgery on canine}, 2258 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 2259 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 2260 Austin performed laser surgery on a dog in Houston without the intervention of a 2261 surgeon. The treatment was developed collaboratively by computational experts from 2262 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 2263 leading technologists from the M.D. Anderson Cancer Center in Houston, and 2264 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 2265 state-of-the-art thermal imaging technology, and advanced computational methods, 2266 dynamic, data-driven treatments are being pursued as a minimally invasive 2267 alternative to the standard treatment of cancer.}, 2268 petsc_uses = {KSP} 2269} 2270 2271@Article{ ffhbresso2008, 2272 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 2273 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 2274 Tinsley Oden}, 2275 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 2276 journal = {Engineering with Computers}, 2277 note = {Special issue on Computational Bioengineering}, 2278 year = {2008}, 2279 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 2280 petsc_uses = {KSP} 2281} 2282 2283@TechReport{ dobbhbbbdeffghkkps2008, 2284 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 2285 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 2286 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 2287 and S. Prudhomme and R. J. Stafford}, 2288 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 2289 Cancer}, 2290 year = {2008}, 2291 institution = {University of Texas at Austin}, 2292 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 2293 petsc_uses = {KSP} 2294} 2295 2296@Article{ ogdb2004, 2297 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 2298 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 2299 journal = {Physics in Medicine and Biology}, 2300 year = {2004}, 2301 volume = {49}, 2302 pages = {2955--2947}, 2303 petsc_uses = {KSP} 2304} 2305 2306@InProceedings{ majumdar11, 2307 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 2308 Baldridge and P. Krysl}, 2309 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 2310 booktitle = {ICCS 2005}, 2311 pages = {672--679}, 2312 editor = {V.S. Sunderam et al.}, 2313 year = {2005}, 2314 petsc_uses = {KSP} 2315} 2316 2317@Conference{ sermesant-etal:03, 2318 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 2319 Ayache, H.}, 2320 title = {A parallel implementation of non-rigid registration using a volumetric 2321 biomechanical model}, 2322 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 2323 address = {Philadelphia, PA, USA}, 2324 publisher = {Springer-Verlag}, 2325 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2326 series = {Lecture Notes in Computer Science}, 2327 volume = {2717}, 2328 pages = {398-407}, 2329 date = {june 23-24}, 2330 year = {2003}, 2331 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 2332 petsc_uses = {KSP} 2333} 2334 2335@Conference{ sermesant-etal:04, 2336 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 2337 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 2338 title = {A Novel Nonrigid Registration Algorithm And Applications}, 2339 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 2340 address = {Philadelphia, PA, USA}, 2341 publisher = {Springer-Verlag}, 2342 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2343 series = {Lecture Notes in Computer Science}, 2344 volume = {2208}, 2345 pages = {923}, 2346 year = {2003}, 2347 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 2348 petsc_uses = {KSP} 2349} 2350 2351@Article{ warfield-haker-talos-05, 2352 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 2353 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 2354 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 2355 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 2356 title = {Capturing intraoperative deformations: research experience at {B}righam and {W}omen's 2357 hospital}, 2358 journal = {Medical Image Analysis}, 2359 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 2360 year = {2005}, 2361 petsc_uses = {KSP} 2362} 2363 2364@Article{ brain3, 2365 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 2366 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 2367 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 2368 Deformation during Image Guided Neurosurgery}, 2369 journal = {Computing and Visualization in Science}, 2370 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 2371 year = {2002}, 2372 petsc_uses = {KSP} 2373} 2374 2375@Article{ brain2, 2376 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 2377 Kikinis and Simon K. Warfield}, 2378 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 2379 Element Biomechanical Model}, 2380 journal = {IEEE Transactions on Medical Imaging}, 2381 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 2382 year = {2001}, 2383 petsc_uses = {KSP} 2384} 2385 2386@InProceedings{ brain1, 2387 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 2388 Ferenc A. Jolesz and Ron Kikinis}, 2389 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 2390 Guided Neurosurgery}, 2391 booktitle = {Proceedings of SC2000}, 2392 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 2393 year = {2000}, 2394 petsc_uses = {KSP} 2395} 2396 2397@Article{ vanne06, 2398 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 2399 M. Lassas and M. Kalke}, 2400 title = {Parallelized {B}ayesian inversion for three-dimensional dental {X}-ray imaging}, 2401 journal = {IEEE Transactions on Medical Imaging}, 2402 volume = {25}, 2403 number = {2}, 2404 month = feb, 2405 year = {2006}, 2406 pages = {218--228}, 2407 petsc_uses = {KSP} 2408} 2409 2410@InProceedings{ knepleybardhan2015, 2411 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 2412 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 2413 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 2414 Exposition}, 2415 volume = {9}, 2416 pages = {V009T12A04}, 2417 doi = {10.1115/IMECE2015-53579}, 2418 year = {2015}, 2419 petsc_uses = {KSP} 2420} 2421 2422@InProceedings{ bardhanknepley2015, 2423 title = {Multiscale models and approximation algorithms for protein electrostatics}, 2424 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 2425 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 2426 volume = {61}, 2427 pages = {163--174}, 2428 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 2429 doi = {10.2495/BEM380131}, 2430 publisher = {WIT Press}, 2431 year = {2015}, 2432 petsc_uses = {KSP} 2433} 2434 2435% LiteralHTML: 2436% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 2437% LiteralHTML: 2438@InProceedings{ adamsbrennanknepleywang2022, 2439 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 2440 quench plasmas}, 2441 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 2442 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 2443 (IPDPS '22)}, 2444 doi = {10.1109/IPDPS53621.2022.00020}, 2445 year = {2022}, 2446 petsc_uses = {DMPlex} 2447} 2448 2449@Misc{ adamsknepleybrennan2021, 2450 title = {Runaway Electron Generation with High-Performance, Structure Preserving 2451 Discretization of {F}okker--{P}lank--{L}andau}, 2452 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 2453 year = {2021}, 2454 petsc_uses = {KSP} 2455} 2456 2457@Article{ adamshirvijokiknepleybrownisaacmills2017, 2458 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 2459 Architectures}, 2460 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 2461 Isaac and Richard Mills}, 2462 journal = {SIAM Journal on Scientific Computing}, 2463 volume = {39}, 2464 number = {6}, 2465 pages = {C452--C465}, 2466 doi = {10.1137/17M1118828}, 2467 eprint = {1702.08880}, 2468 year = {2017}, 2469 petsc_uses = {KSP} 2470} 2471 2472@Article{ pusztayknepleyadams2022, 2473 title = {Conservative Projection Between {FEM} and Particle Bases}, 2474 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 2475 journal = {SIAM Journal on Scientific Computing}, 2476 volume = {44}, 2477 number = {4}, 2478 pages = {C310--C319}, 2479 doi = {10.1137/21M145407}, 2480 year = {2022} 2481} 2482 2483@Article{ hirvijoki2017, 2484 author = {Eero Hirvijoki and Mark F. Adams}, 2485 title = {Conservative discretization of the {Landau} collision integral}, 2486 journal = {Physics of Plasmas}, 2487 volume = {24}, 2488 number = {3}, 2489 pages = {032121}, 2490 doi = {10.1063/1.4979122}, 2491 year = {2017}, 2492 petsc_uses = {KSP} 2493} 2494 2495@Article{ mollenadamsknepleyhagerchang2021, 2496 title = {Implementation of higher-order velocity mapping between marker particles and grid 2497 in the particle-in-cell code {XGC}}, 2498 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 2499 S. Chang}, 2500 journal = {Journal of Plasma Physics}, 2501 volume = {87}, 2502 number = {2}, 2503 pages = {905870229}, 2504 eprint = {2012.11764}, 2505 doi = {10.1017/S0022377821000441}, 2506 year = {2021}, 2507 petsc_uses = {KSP} 2508} 2509 2510@Article{ lsmh2014, 2511 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 2512 title = {Comparison of particle trajectories and collision operators for collisional 2513 transport in nonaxisymmetric plasmas}, 2514 journal = { Physics of Plasmas}, 2515 volume = {21}, 2516 year = {2014}, 2517 petsc_uses = {KSP} 2518} 2519 2520@Article{ lpcep2014, 2521 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 2522 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 2523 pedestal}, 2524 journal = {Plasma Physics and Controlled Fusion}, 2525 volume = {56}, 2526 year = {2014}, 2527 petsc_uses = {KSP} 2528} 2529 2530@Article{ facets-scidac08, 2531 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 2532 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 2533 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 2534 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 2535 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 2536 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 2537 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 2538 Stotler and A. Pigarov}, 2539 journal = {J. Phys.: Conf. Ser.}, 2540 volume = {125}, 2541 year = {2008}, 2542 pages = {012040}, 2543 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 2544 petsc_uses = {KSP} 2545} 2546 2547@Article{ facets-scidac09, 2548 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 2549 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 2550 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 2551 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 2552 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 2553 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 2554 and A. Pigarov and H. Zhang}, 2555 journal = {J. Phys.: Conf. Ser.}, 2556 volume = {180}, 2557 year = {2009}, 2558 pages = {012056}, 2559 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 2560 petsc_uses = {KSP} 2561} 2562 2563@InProceedings{ facets-scidac10, 2564 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 2565 {FACETS} Code}, 2566 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 2567 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 2568 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 2569 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 2570 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 2571 Pigarov and H. Zhang}, 2572 booktitle = {Proceedings of SciDAC 2010 Conference}, 2573 year = {2010}, 2574 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 2575 petsc_uses = {KSP} 2576} 2577 2578@InProceedings{ facets-fec2010, 2579 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 2580 the {FACETS} Framework}, 2581 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 2582 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 2583 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 2584 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 2585 Republic of Korea}, 2586 year = {2010}, 2587 petsc_uses = {KSP} 2588} 2589 2590@InProceedings{ facets-epdp2010, 2591 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 2592 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 2593 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 2594 Groebner and S. Balay and L. McInnes and H. Zhang}, 2595 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 2596 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 2597 year = {2010}, 2598 petsc_uses = {KSP} 2599} 2600 2601@Article{ carlssoncary09, 2602 author = {Johan Carlsson, John R. Cary}, 2603 title = {The hypersecant {J}acobian approximation for quasi-{N}ewton solves of sparse 2604 nonlinear systems}, 2605 journal = {arXiv}, 2606 year = {2009}, 2607 note = {http://arxiv.org/abs/0905.1054}, 2608 url = {http://arxiv.org/pdf/0905.1054v1}, 2609 petsc_uses = {KSP} 2610} 2611 2612@InProceedings{ oshahjs2006, 2613 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 2614 S.J. Janhunen and T.P. Kiviniemi}, 2615 title = {Performance enhancements to {ELMFIRE} gyrokinetic code leading to new ranges of 2616 application}, 2617 booktitle = {33rd EPS Conference on Plasma Phys.}, 2618 year = {2006}, 2619 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 2620 note = {European fusion code}, 2621 petsc_uses = {KSP} 2622} 2623 2624@Article{ zhu2006, 2625 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 2626 title = {Intermediate nonlinear evolution of the {P}arker instability: Formation of 2627 convection-induced discontinuities and absence of finite-time singularities}, 2628 journal = {Phys. Rev. Lett.}, 2629 volume = {96}, 2630 number = {065001}, 2631 year = {2006}, 2632 doi = {10.1103/PhysRevLett.96.065001}, 2633 petsc_uses = {KSP} 2634} 2635 2636@InProceedings{ ppc2005, 2637 author = {B. Philip and M. Pernice and L.Chacon}, 2638 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 2639 Refinement}, 2640 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 2641 methods}, 2642 year = {2005}, 2643 lab = {LANL}, 2644 petsc_uses = {KSP} 2645} 2646 2647@Article{ pp2005, 2648 author = {M. Pernice and B. Philip}, 2649 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 2650 Refinement}, 2651 year = {2005}, 2652 journal = {SIAM J. of Sci. Comput.}, 2653 lab = {LANL}, 2654 petsc_uses = {KSP} 2655} 2656 2657@Article{ gt2004, 2658 author = {A. H. Glasser and X. Z. Tang}, 2659 title = {The {SEL} macroscopic modeling code}, 2660 year = {2004}, 2661 journal = {Computer Physics Communications}, 2662 pages = {237--243}, 2663 volume = {164}, 2664 lab = {LANL}, 2665 petsc_uses = {KSP} 2666} 2667 2668@Article{ nl2006, 2669 author = {Y. Nishimura and Z.Lin}, 2670 title = {A finite element mesh in a tokamak edge geometry}, 2671 year = {2006}, 2672 journal = {Contributions to Plasma Physics}, 2673 volume = {22}, 2674 lab = {PPPL}, 2675 petsc_uses = {KSP} 2676} 2677 2678@Article{ nlle2004, 2679 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 2680 title = {A finite element {P}oisson solver for gyrokinetic particle simulations in a global 2681 field aligned mesh}, 2682 year = {2006}, 2683 journal = {J. Comput. Phys.}, 2684 volume = {214}, 2685 pages = {657}, 2686 lab = {PPPL}, 2687 petsc_uses = {KSP} 2688} 2689 2690@InProceedings{ lnlle2004, 2691 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 2692 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 2693 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2694 year = {2004}, 2695 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 2696 lab = {PPPL}, 2697 petsc_uses = {KSP} 2698} 2699 2700@InProceedings{ nlclew2004, 2701 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 2702 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 2703 model}, 2704 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2705 year = {2004}, 2706 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 2707 lab = {PPPL}, 2708 petsc_uses = {KSP} 2709} 2710 2711@Article{ tb1, 2712 author = {X.~Z.~Tang and A.~H.~Boozer}, 2713 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 2714 plasma}, 2715 journal = {Physics of Plasmas}, 2716 year = {2004}, 2717 pages = {171--185}, 2718 volume = {11}, 2719 lab = {LANL}, 2720 petsc_uses = {KSP} 2721} 2722 2723@Unpublished{ nlcw, 2724 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 2725 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 2726 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 2727 Albuquerque, New Mexico, October 2003}, 2728 year = {2003}, 2729 petsc_uses = {KSP} 2730} 2731 2732@TechReport{ tang2001, 2733 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 2734 Strauss}, 2735 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 2736 year = {2001}, 2737 institution = {Princeton Plasma Physics Laboratory}, 2738 number = {PPPL-3532}, 2739 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 2740 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 2741 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 2742 March 12-14, 2001.}, 2743 lab = {PPPL}, 2744 petsc_uses = {KSP} 2745} 2746 2747% LiteralHTML: 2748% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 2749% LiteralHTML: 2750@Article{ valerathomasgarciacastillo2019, 2751 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 2752 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 2753 Coastal Ocean Model}, 2754 journal = {Journal of Marine Science and Engineering}, 2755 volume = {7}, 2756 number = {6}, 2757 article-number= {185}, 2758 url = {https://www.mdpi.com/2077-1312/7/6/185}, 2759 issn = {2077-1312}, 2760 doi = {10.3390/jmse7060185}, 2761 year = {2019}, 2762 petsc_uses = {KSP} 2763} 2764 2765@Article{ furuichimat2015, 2766 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 2767 thermal convection simulation surrounded by free surface}, 2768 author = {Mikito Furuichi and Dave A May}, 2769 journal = {Computer Physics Communications}, 2770 volume = {192}, 2771 pages = {1--11}, 2772 year = {2015}, 2773 petsc_uses = {KSP} 2774} 2775 2776@Article{ sharplesmoresivelicjadamecmay2016, 2777 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 2778 model}, 2779 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 2780 Dave A May}, 2781 journal = {Physics of the Earth and Planetary Interiors}, 2782 volume = {252}, 2783 pages = {77--90}, 2784 year = {2016}, 2785 petsc_uses = {KSP} 2786} 2787 2788@Article{ spiegelmanmaywilson2016, 2789 title = {On the solvability of incompressible {S}tokes with viscoplastic rheologies in 2790 geodynamics}, 2791 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 2792 journal = {Geochemistry, Geophysics, Geosystems}, 2793 volume = {17}, 2794 number = {6}, 2795 pages = {2213--2238}, 2796 year = {2016}, 2797 petsc_uses = {KSP} 2798} 2799 2800@Article{ buiteretal2016, 2801 title = {Benchmarking numerical models of brittle thrust wedges}, 2802 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 2803 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 2804 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 2805 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 2806 journal = {Journal of structural geology}, 2807 volume = {92}, 2808 pages = {140--177}, 2809 year = {2016}, 2810 petsc_uses = {KSP} 2811} 2812 2813@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 2814 title = {Modular and flexible spectral-element waveform modelling in two and three 2815 dimensions}, 2816 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 2817 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 2818 journal = {Geophysical Journal International}, 2819 volume = {216}, 2820 number = {3}, 2821 pages = {1675--1692}, 2822 doi = {10.1093/gji/ggy469}, 2823 year = {2019}, 2824 petsc_uses = {KSP} 2825} 2826 2827@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 2828 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 2829 Modeling}, 2830 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 2831 Martin van Driel and Lion Krischer and Andreas Fichtner}, 2832 journal = {SIAM Journal on Scientific Computing}, 2833 volume = {43}, 2834 number = {2}, 2835 pages = {C127--C153}, 2836 eprint = {http://arxiv.org/abs/2004.08729}, 2837 doi = {10.1137/20M1332748}, 2838 year = {2021}, 2839 petsc_uses = {KSP} 2840} 2841 2842@Article{ parsani2021, 2843 title = {High-order accurate entropy-stable discontinuous collocated {G}alerkin methods with 2844 the summation-by-parts property for compressible {CFD} frameworks: Scalable {SSDC} 2845 algorithms and flow solver}, 2846 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 2847 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 2848 journal = {Journal of Computational Physics}, 2849 volume = {424}, 2850 pages = {109844}, 2851 issn = {0021-9991}, 2852 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 2853 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 2854 year = {2021}, 2855 petsc_uses = {KSP} 2856} 2857 2858@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 2859 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 2860 governed by {PDEs}}, 2861 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 2862 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 2863 journal = {SIAM Journal of Scientific Computing}, 2864 volume = {42}, 2865 number = {5}, 2866 pages = {A3397--A3426}, 2867 year = {2020} 2868} 2869 2870@Article{ zampinibouakaramturkiyyahkniokeyes2022, 2871 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 2872 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 2873 Keyes}, 2874 journal = {Advances on Computational Mathematics}, 2875 note = {In press}, 2876 year = {2022} 2877} 2878 2879@Article{ dassizampiniscacchi2022, 2880 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 2881 discretizations of elliptic equations in mixed form}, 2882 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 2883 journal = {Computer Methods in Applied Mechanics and Engineering}, 2884 volume = {391}, 2885 pages = {114620}, 2886 year = {2022} 2887} 2888 2889@Article{ youngoppenheimdimant2017, 2890 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 2891 title = {Hybrid simulations of coupled {F}arley-{B}uneman/gradient drift instabilities in the 2892 equatorial E region ionosphere}, 2893 journal = {Journal of Geophysical Research: Space Physics}, 2894 volume = {122}, 2895 number = {5}, 2896 issn = {2169-9402}, 2897 doi = {10.1002/2017JA024161}, 2898 pages = {5768--5781}, 2899 year = {2017}, 2900 petsc_uses = {KSP} 2901} 2902 2903@Article{ rioussetpatylillisfillingimenglandwithershale2013, 2904 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in {M}ars' 2905 dynamo region}, 2906 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 2907 and Scott L England and Paul G Withers and John P M Hale}, 2908 journal = {Journal of Geophysical Research: Space Physics}, 2909 volume = {118}, 2910 number = {6}, 2911 pages = {3647--3659}, 2912 year = {2013}, 2913 publisher = {Wiley Online Library}, 2914 petsc_uses = {KSP} 2915} 2916 2917@Article{ chien2016representation, 2918 title = {Representation of topography by partial steps using the immersed boundary method 2919 in a vector vorticity equation model (VVM)}, 2920 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 2921 journal = {Journal of Advances in Modeling Earth Systems}, 2922 year = {2016}, 2923 publisher = {Wiley Online Library}, 2924 petsc_uses = {KSP} 2925} 2926 2927@Article{ berger2015parallel, 2928 title = {Parallel preconditioners for monolithic solution of shear bands}, 2929 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 2930 journal = {Journal of Computational Physics}, 2931 year = {2015}, 2932 publisher = {Elsevier}, 2933 petsc_uses = {KSP} 2934} 2935 2936@Article{ may2015496, 2937 title = {A scalable, matrix-free multigrid preconditioner for finite element 2938 discretizations of heterogeneous {S}tokes flow }, 2939 journal = {Computer Methods in Applied Mechanics and Engineering }, 2940 volume = {290}, 2941 number = {0}, 2942 pages = {496--523}, 2943 year = {2015}, 2944 issn = {0045-7825}, 2945 doi = {10.1016/j.cma.2015.03.014}, 2946 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 2947 petsc_uses = {KSP} 2948} 2949 2950@Article{ isaacknepley2017, 2951 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 2952 author = {Tobin Isaac and Matthew G. Knepley}, 2953 journal = {ArXiv e-prints}, 2954 eprint = {1508.02470}, 2955 year = {2017}, 2956 note = {\url{http://arxiv.org/abs/1508.02470}}, 2957 petsc_uses = {DMPlex} 2958} 2959 2960@Article{ knepleylangegorman2017, 2961 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 2962 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 2963 journal = {ArXiv e-prints}, 2964 eprint = {1506.06194}, 2965 year = {2017}, 2966 note = {\url{http://arxiv.org/abs/1506.06194}}, 2967 petsc_uses = {DMPlex} 2968} 2969 2970@Article{ langemitchellknepleygorman2015, 2971 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2972 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2973 journal = {SIAM Journal on Scientific Computing}, 2974 volume = {38}, 2975 number = {5}, 2976 pages = {S143--S155}, 2977 eprint = {http://arxiv.org/abs/1506.07749}, 2978 doi = {10.1137/15M1026092}, 2979 year = {2016}, 2980 petsc_uses = {DMPlex} 2981} 2982 2983@InProceedings{ langeknepleygorman2015, 2984 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 2985 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 2986 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 2987 month = apr, 2988 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 2989 year = {2015}, 2990 petsc_uses = {DMPlex} 2991} 2992 2993@InProceedings{ wallworkknepleybarralpiggott2022, 2994 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 2995 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 2996 Piggott}, 2997 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 2998 editor = {Trevor Robinson}, 2999 month = jan, 3000 address = {Seattle, WA}, 3001 pages = {1--5}, 3002 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 3003 year = {2022}, 3004 petsc_uses = {DMPlex} 3005} 3006 3007@InProceedings{ timalsinaknepley2023, 3008 title = {Tetrahedralization of a Hexahedral Mesh}, 3009 author = {Aman Timalsina and Matthew G. Knepley}, 3010 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 3011 year = {2023}, 3012 petsc_uses = {DMPlex} 3013} 3014 3015@Article{ farrellknepleywechsungmitchell2020, 3016 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 3017 methods}, 3018 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 3019 Wechsung}, 3020 journal = {ACM Transaction on Mathematical Software}, 3021 eprint = {http://arxiv.org/abs/1912.08516}, 3022 volume = {47}, 3023 number = {3}, 3024 pages = {1--22}, 3025 issn = {0098-3500}, 3026 doi = {10.1145/3445791}, 3027 publisher = {Association for Computing Machinery}, 3028 issue_date = {September 2021}, 3029 year = {2021}, 3030 petsc_uses = {KSP,DMPlex} 3031} 3032 3033@Article{ laakmann2022augmented, 3034 title = {An augmented Lagrangian preconditioner for the magnetohydrodynamics equations at high Reynolds and coupling numbers}, 3035 author = {Fabian Laakmann and Patrick E Farrell and Lawrence Mitchell}, 3036 journal = {SIAM Journal on Scientific Computing}, 3037 volume = {44}, 3038 number = {4}, 3039 pages = {B1018--B1044}, 3040 year = {2022} 3041} 3042 3043@Article{ papadopoulosfarrellsurowiec2021, 3044 title = {Computing multiple solutions of topology optimization problems}, 3045 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E and Surowiec, Thomas M}, 3046 journal = {SIAM Journal on Scientific Computing}, 3047 volume = {43}, 3048 number = {3}, 3049 pages = {A1555--A1582}, 3050 year = {2021} 3051} 3052 3053@Article{ jiangzhanghuschneiderzorinpanozzo2021, 3054 title = {Bijective and coarse high-order tetrahedral meshes}, 3055 author = {Jiang, Zhongshi and Zhang, Ziyi and Hu, Yixin and Schneider, Teseo and Zorin, Denis and Panozzo, Daniele}, 3056 journal = {ACM Transactions on Graphics (TOG)}, 3057 volume = {40}, 3058 number = {4}, 3059 pages = {1--16}, 3060 year = {2021} 3061} 3062 3063@Article{ abumaclachlanfarrell2023, 3064 title = {Monolithic multigrid for implicit {Runge--Kutta} discretizations of incompressible fluid flow}, 3065 author = {Abu-Labdeh, Razan and MacLachlan, Scott and Farrell, Patrick E}, 3066 journal = {Journal of Computational Physics}, 3067 volume = {478}, 3068 pages = {111961}, 3069 year = {2023} 3070} 3071 3072@Article{ farrellkirbymarchena2021, 3073 title = {{Irksome}: Automating {Runge--Kutta} time-stepping for finite element methods}, 3074 author = {Farrell, Patrick E and Kirby, Robert C and Marchena-Menendez, Jorge}, 3075 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3076 volume = {47}, 3077 number = {4}, 3078 pages = {1--26}, 3079 year = {2021} 3080} 3081 3082@Article{ farrellgazca2020, 3083 title = {An augmented Lagrangian preconditioner for implicitly constituted non-Newtonian incompressible flow}, 3084 author = {Farrell, Patrick E and Gazca-Orozco, Pablo Alexei}, 3085 journal = {SIAM Journal on Scientific Computing}, 3086 volume = {42}, 3087 number = {6}, 3088 pages = {B1329--B1349}, 3089 year = {2020} 3090} 3091 3092@Article{ farrellmitchellscottwechsung2022, 3093 title = {Robust multigrid methods for nearly incompressible elasticity using macro elements}, 3094 author = {Farrell, Patrick E and Mitchell, Lawrence and Scott, L Ridgway and Wechsung, Florian}, 3095 journal = {IMA Journal of Numerical Analysis}, 3096 volume = {42}, 3097 number = {4}, 3098 pages = {3306--3329}, 3099 year = {2022} 3100} 3101 3102@Article{ shihstadlerwechsung2022, 3103 title = {Robust multigrid techniques for augmented Lagrangian preconditioning of incompressible Stokes equations with extreme viscosity variations}, 3104 author = {Shih, Yu-hsuan and Stadler, Georg and Wechsung, Florian}, 3105 journal = {SIAM Journal on Scientific Computing}, 3106 volume = {45}, 3107 number = {3}, 3108 pages = {S27--S53}, 3109 year = {2022} 3110} 3111 3112@Article{ adlerhehumaclachlanohm2022, 3113 title = {Monolithic multigrid for a reduced-quadrature discretization of poroelasticity}, 3114 author = {Adler, James H and He, Yunhui and Hu, Xiaozhe and MacLachlan, Scott and Ohm, Peter}, 3115 journal = {SIAM Journal on Scientific Computing}, 3116 volume = {45}, 3117 number = {3}, 3118 pages = {S54--S81}, 3119 year = {2022} 3120} 3121 3122@Article{ xiafarrellwechsung2021, 3123 title = {Augmented Lagrangian preconditioners for the Oseen--Frank model of nematic and cholesteric liquid crystals}, 3124 author = {Xia, Jingmin and Farrell, Patrick E and Wechsung, Florian}, 3125 journal = {BIT Numerical Mathematics}, 3126 volume = {61}, 3127 pages = {607--644}, 3128 year = {2021} 3129} 3130 3131@Article{ budisahukuchtamardalzikatanov2023, 3132 title = {Algebraic multigrid methods for metric-perturbed coupled problems}, 3133 author = {Budisa, Ana and Hu, Xiaozhe and Kuchta, Miroslav and Mardal, Kent-Andre and Zikatanov, Ludmil Tomov}, 3134 journal = {arXiv preprint arXiv:2305.06073}, 3135 year = {2023} 3136} 3137 3138@Article{ laakmannhufarrell2023, 3139 title = {Structure-preserving and helicity-conserving finite element approximations and preconditioning for the Hall MHD equations}, 3140 author = {Laakmann, Fabian and Hu, Kaibo and Farrell, Patrick E}, 3141 journal = {Journal of Computational Physics}, 3142 volume = {492}, 3143 pages = {112410}, 3144 year = {2023} 3145} 3146 3147@Article{ hongkrauskuchtalymberymardalrognes2022, 3148 title = {Robust approximation of generalized Biot-Brinkman problems}, 3149 author = {Hong, Qingguo and Kraus, Johannes and Kuchta, Miroslav and Lymbery, Maria and Mardal, Kent-Andr{\'e} and Rognes, Marie E}, 3150 journal = {Journal of Scientific Computing}, 3151 volume = {93}, 3152 number = {3}, 3153 pages = {77}, 3154 year = {2022} 3155} 3156 3157@Article{ boonkuchtamardalruiz2021, 3158 title = {Robust preconditioners for perturbed saddle-point problems and conservative discretizations of {Biot's} equations utilizing total pressure}, 3159 author = {Boon, Wietse M and Kuchta, Miroslav and Mardal, Kent-Andre and Ruiz-Baier, Ricardo}, 3160 journal = {SIAM Journal on Scientific Computing}, 3161 volume = {43}, 3162 number = {4}, 3163 pages = {B961--B983}, 3164 year = {2021} 3165} 3166 3167@Article{ papadopoulosfarrell2023, 3168 title = {Preconditioners for computing multiple solutions in three-dimensional fluid topology optimization}, 3169 author = {Papadopoulos, Ioannis PA and Farrell, Patrick E}, 3170 journal = {SIAM Journal on Scientific Computing}, 3171 volume = {45}, 3172 number = {6}, 3173 pages = {B853--B883}, 3174 year = {2023} 3175} 3176 3177@Article{ farrellhamdanmaclachlan2022, 3178 title = {A new mixed finite-element method for H2 elliptic problems}, 3179 author = {Farrell, Patrick E and Hamdan, Abdalaziz and MacLachlan, Scott P}, 3180 journal = {Computers \& Mathematics with Applications}, 3181 volume = {128}, 3182 pages = {300--319}, 3183 year = {2022} 3184} 3185 3186@Article{ harpertuminaro2023, 3187 title = {Compression and Reduced Representation Techniques for Patch-Based Relaxation}, 3188 author = {Harper, Graham and Tuminaro, Ray}, 3189 journal = {arXiv preprint arXiv:2306.10025}, 3190 year = {2023} 3191} 3192 3193@Article{ kirbykernell2021, 3194 title = {Preconditioning mixed finite elements for tide models}, 3195 author = {Kirby, Robert C and Kernell, Tate}, 3196 journal = {Computers \& Mathematics with Applications}, 3197 volume = {82}, 3198 pages = {212--227}, 3199 year = {2021} 3200} 3201 3202@Book{ xia2023, 3203 title = {Computing and Analysing Energy Minimisation Problems in Liquid Crystals: Implementation Using Firedrake}, 3204 author = {Xia, Jingmin}, 3205 year = {2023}, 3206 publisher = {World Scientific} 3207} 3208 3209@PhDThesis{ leveque2022, 3210 title = {Preconditioned iterative methods for optimal control problems with time-dependent PDEs as constraints}, 3211 author = {Leveque, Santolo}, 3212 school = {The University of Edinburgh}, 3213 year = {2022} 3214} 3215 3216@PhDThesis{ brubeck2022, 3217 title = {Optimal-complexity and robust multigrid methods for high-order FEM}, 3218 author = {Pablo D. Brubeck}, 3219 school = {Oxford University}, 3220 year = {2022} 3221} 3222 3223@Misc{ firedrakeproject, 3224 title = {{The {F}iredrake project}}, 3225 author = {David A Ham and Firedrake Team}, 3226 url = {http://firedrakeproject.org}, 3227 year = {2022}, 3228 petsc_uses = {KSP} 3229} 3230 3231@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 3232 title = {Firedrake: automating the finite element method by composing abstractions}, 3233 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 3234 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 3235 and Paul HJ Kelly}, 3236 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3237 volume = {43}, 3238 number = {3}, 3239 pages = {24}, 3240 year = {2016}, 3241 petsc_uses = {KSP} 3242} 3243 3244@Article{ mitchellmuller2016, 3245 title = {High level implementation of geometric multigrid solvers for finite element 3246 problems: Applications in atmospheric modelling}, 3247 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 3248 journal = {Journal of Computational Physics}, 3249 volume = {327}, 3250 pages = {1--18}, 3251 year = {2016}, 3252 petsc_uses = {KSP} 3253} 3254 3255@Article{ mcraeberceamitchellhamcotter2016, 3256 title = {Automated generation and symbolic manipulation of tensor product finite 3257 elements}, 3258 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 3259 and Colin J Cotter}, 3260 journal = {SIAM Journal on Scientific Computing}, 3261 volume = {38}, 3262 number = {5}, 3263 pages = {S25--S47}, 3264 year = {2016}, 3265 petsc_uses = {KSP} 3266} 3267 3268@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 3269 title = {A structure-exploiting numbering algorithm for finite elements on extruded 3270 meshes, and its performance evaluation in {Firedrake}}, 3271 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 3272 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 3273 journal = {Geoscientific Model Development}, 3274 volume = {9}, 3275 number = {10}, 3276 pages = {3803--3815}, 3277 doi = {10.5194/gmd-9-3803-2016}, 3278 year = {2016}, 3279 petsc_uses = {KSP} 3280} 3281 3282@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 3283 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 3284 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 3285 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 3286 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 3287 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 3288 publisher = {Springer Berlin Heidelberg}, 3289 pages = {279--289}, 3290 isbn = {978-3-642-38750-0}, 3291 doi = {10.1007/978-3-642-38750-0_21}, 3292 year = {2013}, 3293 petsc_uses = {KSP} 3294} 3295 3296@Article{ kirbymitchell2017, 3297 title = {Solver composition across the {PDE}/linear algebra barrier}, 3298 author = {Robert C Kirby and Lawrence Mitchell}, 3299 journal = {arXiv preprint arXiv:1706.01346}, 3300 year = {2017}, 3301 petsc_uses = {KSP} 3302} 3303 3304@Article{ saibaba2012application, 3305 title = {Application of hierarchical matrices to linear inverse problems in 3306 geostatistics}, 3307 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 3308 Peter K and Darve, Eric F}, 3309 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 3310 volume = {67}, 3311 number = {5}, 3312 pages = {857}, 3313 year = {2012}, 3314 petsc_uses = {KSP} 3315} 3316 3317@Article{ collignonkausmayfernandez14, 3318 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 3319 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 3320 journal = {Geochem Geophy Geosy}, 3321 year = {2014}, 3322 petsc_uses = {KSP} 3323} 3324 3325@Article{ fernandezkaus14, 3326 author = {Fern\'andez, N. and Kaus, B.}, 3327 title = {Fold interaction and wavelength selection in {3D} models of multilayer detachment 3328 folding}, 3329 journal = {Tectonophysics}, 3330 year = {2014}, 3331 petsc_uses = {KSP} 3332} 3333 3334@Article{ baumannkauspopov14, 3335 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 3336 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 3337 journal = {Tectonophysics}, 3338 year = {2014}, 3339 petsc_uses = {KSP} 3340} 3341 3342@Article{ lechmannschmalholzhetenyimaykaus14, 3343 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 3344 J. P.}, 3345 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 3346 of the modern {India-Asia} collisional system with {3-D} numerical models}, 3347 journal = { Journal of Geophysical Research - Solid Earth}, 3348 year = {2014}, 3349 petsc_uses = {KSP} 3350} 3351 3352@InBook{ fernandezkaus14b, 3353 author = {Fern\'andez N. and Kaus B.J.P.}, 3354 title = {Analytical and numerical investigation of {3D} multilayer detachment}, 3355 booktitle = {Mathematics of Planet Earth}, 3356 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 3357 and Dur\'an J.J. and Vargas-Guzman J.A.}, 3358 publisher = {Springer}, 3359 year = {2014}, 3360 petsc_uses = {KSP} 3361} 3362 3363@Article{ hossein-hsueh-etal-2014a, 3364 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 3365 journal = {J. Mech. Phys. Solids}, 3366 pages = {320--348}, 3367 title = {Effective toughness of heterogeneous media}, 3368 volume = {71}, 3369 year = {2014}, 3370 petsc_uses = {KSP} 3371} 3372 3373@Unpublished{ leon-baldelli-bourdin-2014a, 3374 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 3375 month = aug, 3376 note = {Submitted.}, 3377 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 3378 year = {2014}, 3379 petsc_uses = {KSP} 3380} 3381 3382@Article{ leon-baldelli-babadjian-etal-2013a, 3383 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 3384 Maurini, C.}, 3385 journal = {J. Mech. Phys. Solids}, 3386 pages = {15-32}, 3387 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 3388 volume = {70}, 3389 year = {2014}, 3390 petsc_uses = {KSP} 3391} 3392 3393@Article{ mesgarnejad-bourdin-etal-2014a, 3394 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 3395 journal = {Comp. Methods Appl. Mech. Engng.}, 3396 title = {Validation simulations for the variational approach to fracture}, 3397 volume = {Submitted}, 3398 year = {2014}, 3399 petsc_uses = {KSP} 3400} 3401 3402@InProceedings{ bourdin-chukwudozie-etal-2013a, 3403 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3404 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 3405 University, Stanford, CA}, 3406 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 3407 Fracturing Under In-Situ Stresses}, 3408 year = {2013}, 3409 petsc_uses = {KSP} 3410} 3411 3412@Article{ maurini-bourdin-etal-2012a, 3413 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 3414 journal = {Int. J. Fracture}, 3415 number = {1-2}, 3416 pages = {75-91}, 3417 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 3418 capillary tube: experiments and numerical simulations using a two-dimensional 3419 variational approach}, 3420 volume = {184}, 3421 year = {2013}, 3422 petsc_uses = {KSP} 3423} 3424 3425@Article{ mesgarnejad-bourdin-etal-2013a, 3426 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 3427 journal = {J. Mech. Phys Solids}, 3428 number = {11}, 3429 pages = {2360--2379}, 3430 title = {A variational approach to the fracture of brittle thin films under out of plane 3431 loading}, 3432 volume = {61}, 3433 year = {2013}, 3434 petsc_uses = {KSP} 3435} 3436 3437@InProceedings{ bourdin-chukwudozie-etal-2012a, 3438 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3439 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 3440 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 3441 volume = {SPE 159154}, 3442 year = {2012}, 3443 petsc_uses = {KSP} 3444} 3445 3446@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 3447 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 3448 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 3449 Langtangen}, 3450 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 3451 journal = {Advances in Water Resources}, 3452 volume = {51}, 3453 number = {0}, 3454 pages = {405--437}, 3455 year = {2013}, 3456 note = {35th Year Anniversary Issue}, 3457 issn = {0309-1708}, 3458 doi = {10.1016/j.advwatres.2012.05.008}, 3459 petsc_uses = {KSP} 3460} 3461 3462@Article{ scheltingamyerspietrzak10, 3463 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 3464 title = {A finite element sea ice model of the {C}anadian Arctic Archipelago}, 3465 journal = {Ocean Dynamics}, 3466 volume = {60}, 3467 number = {6}, 3468 pages = {1539-1558}, 3469 year = {2010}, 3470 issn = {1616-7341}, 3471 doi = {10.1007/s10236-010-0356-5}, 3472 publisher = {Springer-Verlag}, 3473 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 3474 Archipelago; Freshwater flux}, 3475 language = {English}, 3476 petsc_uses = {KSP} 3477} 3478 3479@InBook{ destefanoandreasisecchi13, 3480 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 3481 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 3482 inversions}, 3483 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 3484 chapter = {626}, 3485 pages = {3226--3230}, 3486 doi = {10.1190/segam2013-0244.1}, 3487 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 3488 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 3489 petsc_uses = {KSP} 3490} 3491 3492@Article{ pourhiethuetmaylabroussejolivet12, 3493 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 3494 title = {Kinematic interpretation of the {3D} shapes of metamorphic core complexes}, 3495 journal = {Geochem. Geophys. Geosyst.}, 3496 volume = {13}, 3497 pages = {Q09002}, 3498 year = {2012}, 3499 doi = {10.1029/2012GC004271}, 3500 petsc_uses = {KSP} 3501} 3502 3503@Article{ lechmannmaykausschmalholz11, 3504 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 3505 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 3506 collision}, 3507 journal = {Geophysical Journal International}, 3508 volume = {187}, 3509 pages = {10--33}, 3510 year = {2011}, 3511 doi = {10.1111/j.1365-246X.2011.05164.x}, 3512 petsc_uses = {KSP} 3513} 3514 3515@Article{ stefano:r69, 3516 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 3517 Virgilio and Fred F. Snyder}, 3518 collaboration = {}, 3519 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 3520 application to subsalt imaging}, 3521 publisher = {SEG}, 3522 year = {2011}, 3523 journal = {Geophysics}, 3524 volume = {76}, 3525 number = {3}, 3526 pages = {R69-R80}, 3527 keywords = {geophysical image processing; inverse problems; seismology}, 3528 doi = {10.1190/1.3554652}, 3529 petsc_uses = {KSP} 3530} 3531 3532@Article{ stefano:806, 3533 author = {Michele De Stefano}, 3534 collaboration = {}, 3535 title = {Simultaneous joint inversion for susceptibility and velocity}, 3536 publisher = {SEG}, 3537 year = {2011}, 3538 journal = {SEG Technical Program Expanded Abstracts}, 3539 volume = {30}, 3540 number = {1}, 3541 pages = {806-810}, 3542 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 3543 doi = {10.1190/1.3628198}, 3544 petsc_uses = {KSP} 3545} 3546 3547@Article{ mayknepley2011, 3548 author = {Dave A. May and Matthew G. Knepley}, 3549 title = {Optimal, scalable forward models for computing gravity anomalies}, 3550 journal = {Geophysical Journal International}, 3551 volume = {187}, 3552 number = {1}, 3553 pages = {161--177}, 3554 url = {http://arxiv.org/abs/1107.5951}, 3555 note = {\url{http://arxiv.org/abs/1107.5951}}, 3556 year = {2011}, 3557 petsc_uses = {KSP} 3558} 3559 3560@InProceedings{ bourdinknepleymaurini2010, 3561 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3562 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 3563 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 3564 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 3565 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 3566 address = {Stanford, CA}, 3567 year = {2010}, 3568 petsc_uses = {KSP} 3569} 3570 3571@InProceedings{ bourdinknepleymaurini2010b, 3572 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3573 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 3574 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 3575 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 3576 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 3577 address = {Sacramento, CA}, 3578 year = {2010}, 3579 petsc_uses = {KSP} 3580} 3581 3582@Article{ chen2007full, 3583 title = {Full {3D} tomography for the crustal structure of the {Los Angeles} region}, 3584 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 3585 journal = {Bulletin of the Seismological Society of America}, 3586 volume = {97}, 3587 number = {4}, 3588 pages = {1094}, 3589 year = {2007}, 3590 publisher = {Seismol Soc America}, 3591 petsc_uses = {KSP} 3592} 3593 3594@Article{ brown2010ens, 3595 author = {Brown, Jed}, 3596 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 3597 Zürich, Switzerland}, 3598 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 3599 journal = {Journal of Scientific Computing}, 3600 publisher = {Springer Netherlands}, 3601 issn = {0885-7474}, 3602 keyword = {Mathematics and Statistics}, 3603 pages = {48-63}, 3604 volume = {45}, 3605 issue = {1}, 3606 doi = {10.1007/s10915-010-9396-8}, 3607 year = {2010}, 3608 petsc_uses = {KSP} 3609} 3610 3611@PhDThesis{ brown2011, 3612 title = {Computational methods for ice flow simulation}, 3613 author = {Jed Brown}, 3614 school = {ETH Z{\"u}rich}, 3615 year = {2011}, 3616 petsc_uses = {KSP} 3617} 3618 3619@Article{ brown2013tmeice, 3620 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 3621 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 3622 journal = {SIAM Journal on Scientific Computing}, 3623 volume = {35}, 3624 number = {2}, 3625 year = {2013}, 3626 pages = {359--375}, 3627 doi = {10.1137/110834512}, 3628 note = {Also preprint ANL/MCS-P743-1298}, 3629 petsc_uses = {KSP} 3630} 3631 3632@InProceedings{ brown2013quasinewton, 3633 author = {Jed Brown and Peter Brune}, 3634 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 3635 methods}, 3636 year = {2013}, 3637 booktitle = {International Conference on Mathematics and Computational Methods Applied to 3638 Nuclear Science and Engineering}, 3639 pages = {2554--2565}, 3640 petsc_uses = {KSP} 3641} 3642 3643@Misc{ spiegelman-siampp10, 3644 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 3645 Earth Geodynamics}, 3646 author = {Marc Spiegelman}, 3647 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 3648 Computing}, 3649 year = {2010}, 3650 petsc_uses = {KSP} 3651} 3652 3653@Article{ schauer2011a, 3654 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 3655 Quintana-Ort\'{\i}}, 3656 title = {Large scale simulation of wave propagation in soils interacting with structures 3657 using {FEM} and {SBFEM}}, 3658 journal = {Journal of Computational Acoustics}, 3659 volume = {19}, 3660 number = {1}, 3661 pages = {75--93}, 3662 year = {2011}, 3663 doi = {10.1142/S0218396X11004316}, 3664 petsc_uses = {KSP} 3665} 3666 3667@Misc{ bsa2010, 3668 author = {J. Brown and B. Smith and A. Ahmadia}, 3669 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 3670 note = {submitted to SIAM Journal on Scientific Computing}, 3671 year = {2012}, 3672 petsc_uses = {KSP} 3673} 3674 3675@Article{ kellerkatz2016, 3676 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 3677 author = {Tobias Keller and Richard F. Katz}, 3678 journal = {Journal of Petrology}, 3679 doi = {10.1093/petrology/egw030}, 3680 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 3681 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 3682 year = {2016}, 3683 petsc_uses = {KSP} 3684} 3685 3686@Article{ weatherley12, 3687 author = {S. Weatherley and R.F. Katz}, 3688 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 3689 mantle}, 3690 journal = {Geochem.\ Geophys.\ Geosys.}, 3691 year = {2012}, 3692 volume = {13}, 3693 number = {1}, 3694 pages = {Q0AC18}, 3695 doi = {10.1029/2011GC003989}, 3696 petsc_uses = {KSP} 3697} 3698 3699@Article{ katz12, 3700 author = {R.F. Katz and S. Weatherley}, 3701 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 3702 journal = {Earth\ Planet.\ Sci.\ Lett.}, 3703 year = {2012}, 3704 doi = {10.1016/j.epsl.2012.04.042}, 3705 volume = {335-336}, 3706 pages = {226-237}, 3707 petsc_uses = {KSP} 3708} 3709 3710@Article{ katz10b, 3711 author = {R.F. Katz}, 3712 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 3713 journal = {Geochem.\ Geophys.\ Geosys.}, 3714 volume = {10}, 3715 number = {Q0AC07}, 3716 year = {2010}, 3717 doi = {10.1029/2010GC003282}, 3718 petsc_uses = {KSP} 3719} 3720 3721@Article{ england10, 3722 author = {P.C. England and R.F. Katz}, 3723 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 3724 journal = {Nature}, 3725 year = {2010}, 3726 volume = {467}, 3727 pages = {700--703}, 3728 doi = {10.1038/nature09417}, 3729 petsc_uses = {KSP} 3730} 3731 3732@Article{ weatherley10, 3733 author = {S. Weatherley and R.F. Katz}, 3734 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 3735 journal = {Geochem.\ Geophys.\ Geosys.}, 3736 year = {2010}, 3737 volume = {11}, 3738 number = {10}, 3739 doi = {10.1029/2010GC003192}, 3740 petsc_uses = {KSP} 3741} 3742 3743@Article{ katz10, 3744 author = {R.F. Katz and M.G. Worster}, 3745 title = {The stability of ice-sheet grounding lines}, 3746 journal = {Proc.~Roy.~Soc.~A}, 3747 year = {2010}, 3748 volume = {466}, 3749 pages = {1597--1620}, 3750 doi = {10.1098/rspa.2009.0434}, 3751 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 3752 petsc_uses = {KSP} 3753} 3754 3755@Article{ kyrkesmith2013stress, 3756 title = {Stress balances of ice streams in a vertically integrated, higher-order 3757 formulation}, 3758 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 3759 journal = {Journal of Glaciology}, 3760 volume = {59}, 3761 number = {215}, 3762 pages = {449--466}, 3763 year = {2013}, 3764 doi = {10.3189/2013JoG12J140}, 3765 petsc_uses = {KSP} 3766} 3767 3768@Article{ takei2013anisotropy1, 3769 author = {Takei Y. and R.F. Katz}, 3770 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 3771 Governing equations and linearised analysis}}, 3772 journal = {J.\ Fluid\ Mech.}, 3773 year = {2013}, 3774 volume = {734}, 3775 pages = {424-455}, 3776 doi = {10.1017/jfm.2013.482}, 3777 petsc_uses = {KSP} 3778} 3779 3780@Article{ katz2013anisotropy2, 3781 author = {Katz R.F. and Y. Takei}, 3782 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 3783 Numerical solutions of the full equations}}, 3784 journal = {J.\ Fluid\ Mech.}, 3785 year = {2013}, 3786 volume = {734}, 3787 pages = {456-485}, 3788 doi = {10.1017/jfm.2013.483}, 3789 petsc_uses = {KSP} 3790} 3791 3792@Article{ kyrke-smith2014subglacial, 3793 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 3794 title = {Subglacial hydrology and the formation of ice streams}, 3795 journal = {Proc.\ Roy.\ Soc.\ A}, 3796 year = {2014}, 3797 volume = {470}, 3798 number = {2161}, 3799 doi = {10.1098/rspa.2013.0494}, 3800 petsc_uses = {KSP} 3801} 3802 3803@Article{ spiegelmanwilsonvankeken2013, 3804 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 3805 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 3806 multi-physics problems in the solid Earth sciences}}, 3807 journal = {AGU Fall Meeting Abstracts}, 3808 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 3809 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 3810 year = {2013}, 3811 month = dec, 3812 pages = {A2208}, 3813 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 3814 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 3815 petsc_uses = {KSP} 3816} 3817 3818@Article{ bueler2009shallow, 3819 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 3820 ice sheet model}}, 3821 author = {Ed Bueler and Jed Brown}, 3822 journal = {Journal of Geophysical Research-Earth Surface}, 3823 volume = {114}, 3824 number = {F3}, 3825 pages = {F03008}, 3826 year = {2009}, 3827 publisher = {American Geophysical Union}, 3828 petsc_uses = {KSP} 3829} 3830 3831@Article{ bueler2007est, 3832 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 3833 effective tools for verification}}, 3834 author = {Ed Bueler and Jed Brown and Craig Lingle}, 3835 journal = {J. Glaciol}, 3836 volume = {53}, 3837 pages = {499--516}, 3838 year = {2007}, 3839 petsc_uses = {KSP} 3840} 3841 3842@Article{ bueler2007fcv, 3843 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 3844 simulations}}, 3845 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 3846 journal = {Ann. Glaciol}, 3847 volume = {46}, 3848 pages = {97--105}, 3849 year = {2007}, 3850 petsc_uses = {KSP} 3851} 3852 3853@Article{ bueler2005iso, 3854 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 3855 Latrice N. Bowman}, 3856 title = {Exact solutions and numerical verification for isothermal ice sheets}, 3857 journal = {J. Glaciol.}, 3858 volume = {51}, 3859 number = {173}, 3860 pages = {291--306}, 3861 year = {2005}, 3862 petsc_uses = {KSP} 3863} 3864 3865@Article{ chao2008programming, 3866 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 3867 author = {Chao-fan, Z. and Yao-lin, S.}, 3868 journal = {Earthquake}, 3869 year = {2008}, 3870 petsc_uses = {KSP} 3871} 3872 3873@Article{ marti2014, 3874 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 3875 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 3876 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 3877 title = {Full sphere hydrodynamic and dynamo benchmarks}, 3878 journal = {Geophysical Journal International}, 3879 year = {2014}, 3880 doi = {10.1093/gji/ggt518}, 3881 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 3882 petsc_uses = {KSP} 3883} 3884 3885@InProceedings{ ganfulukyangxueyang2013, 3886 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 3887 Guangwen}, 3888 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 3889 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 3890 Field-Programmable Custom Computing Machines}, 3891 series = {FCCM '13}, 3892 pages = {230--}, 3893 year = {2013}, 3894 isbn = {978-0-7695-4969-9}, 3895 doi = {10.1109/FCCM.2013.26}, 3896 acmid = {2495688}, 3897 publisher = {IEEE Computer Society}, 3898 petsc_uses = {KSP} 3899} 3900 3901@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 3902 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 3903 Xiaomeng Huang and Guangwen Yang}, 3904 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 3905 Conference on}, 3906 title = {A highly-efficient and green data flow engine for solving {E}uler atmospheric 3907 equations}, 3908 year = {2014}, 3909 month = sep, 3910 pages = {1-6}, 3911 doi = {10.1109/FPL.2014.6927462}, 3912 petsc_uses = {KSP} 3913} 3914 3915%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 3916%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 3917%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 3918@Article{ aagaardknepleywilliams13, 3919 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 3920 Models of Quasi-static and Dynamic Crustal Deformation}, 3921 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 3922 journal = {Journal of Geophysical Research: Solid Earth}, 3923 volume = {118}, 3924 number = {6}, 3925 pages = {3059--3079}, 3926 issn = {2169-9356}, 3927 doi = {10.1002/jgrb.50217}, 3928 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 3929 year = {2013}, 3930 petsc_uses = {KSP} 3931} 3932 3933@InProceedings{ aagaardknepleywilliams11, 3934 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3935 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3936 Deformation}, 3937 booktitle = {Eos Transactions of the AGU}, 3938 organization = {American Geophysical Union}, 3939 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 3940 year = {2011}, 3941 petsc_uses = {KSP} 3942} 3943 3944@InProceedings{ knepley10b, 3945 author = {Matthew G. {Knepley}}, 3946 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 3947 booktitle = {Eos Transactions of the AGU}, 3948 organization = {American Geophysical Union}, 3949 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 3950 year = {2010}, 3951 petsc_uses = {KSP} 3952} 3953 3954@InProceedings{ mayknepleygurnis09, 3955 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 3956 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 3957 booktitle = {Eos Transactions of the AGU}, 3958 organization = {American Geophysical Union}, 3959 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 3960 year = {2009}, 3961 petsc_uses = {KSP} 3962} 3963 3964@InProceedings{ yuenknepleyerlebacherwright09, 3965 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 3966 title = {The Coming Role of {GPU} in Computational Geodynamics}, 3967 booktitle = {Eos Transactions of the AGU}, 3968 organization = {American Geophysical Union}, 3969 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 3970 year = {2009}, 3971 petsc_uses = {KSP} 3972} 3973 3974@InProceedings{ aagaardknepleywilliams08, 3975 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 3976 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3977 Deformation}, 3978 booktitle = {Eos Transactions of the AGU}, 3979 organization = {American Geophysical Union}, 3980 volume = {89}, 3981 number = {53}, 3982 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 3983 year = {2007}, 3984 petsc_uses = {KSP} 3985} 3986 3987@InProceedings{ aagaardknepleywilliams07, 3988 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3989 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3990 Deformation}, 3991 booktitle = {Eos Transactions of the AGU}, 3992 organization = {American Geophysical Union}, 3993 volume = {88}, 3994 number = {52}, 3995 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 3996 year = {2007}, 3997 petsc_uses = {KSP} 3998} 3999 4000@InProceedings{ aagaardknepleywilliams05, 4001 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 4002 title = {Development of software for studying earthquakes across multiple spatial and 4003 temporal scales by coupling quasi-static and dynamic simulations}, 4004 booktitle = {Eos Transactions of the AGU}, 4005 organization = {American Geophysical Union}, 4006 volume = {86}, 4007 number = {52}, 4008 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 4009 year = {2005}, 4010 petsc_uses = {KSP} 4011} 4012 4013@InProceedings{ williamsgablehagermeadeaagaardknepley08, 4014 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 4015 Brad Aagaard and Matthew G. Knepley}, 4016 title = {Modeling of Multiple Earthquake Cycles in {S}outhern {C}alifornia Using the {SCEC} 4017 Community Fault Model}, 4018 booktitle = {Proceedings of Geosciences '08}, 4019 address = {Wellington, NZ}, 4020 month = nov, 4021 year = {2008}, 4022 petsc_uses = {KSP} 4023} 4024 4025@TechReport{ zhang07, 4026 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 4027 Tsunamis}, 4028 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 4029 type = {Preprint}, 4030 number = {ANL/MCS-P1459-0907}, 4031 institution = {ANL}, 4032 month = sep, 4033 year = {2007}, 4034 petsc_uses = {KSP} 4035} 4036 4037@Article{ katz08b, 4038 author = {Richard F. Katz}, 4039 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 4040 focusing at mid-ocean ridges}, 4041 journal = {J. Petrology}, 4042 year = {2008}, 4043 volume = {49}, 4044 pages = {2099--2121}, 4045 doi = {10.1093/petrology/egn058}, 4046 petsc_uses = {KSP} 4047} 4048 4049@Article{ hgrhkjvv2008, 4050 title = {On preconditioning for a parallel solution of the {R}ichards equation}, 4051 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 4052 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 4053 journal = {Computers and Geosciences}, 4054 volume = {34}, 4055 pages = {1958--1963}, 4056 year = {2008}, 4057 petsc_uses = {KSP} 4058} 4059 4060@Article{ maymoresi2008, 4061 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 4062 computational geodynamics}, 4063 journal = {Physics of the Earth and Planetary Interiors}, 4064 volume = {171}, 4065 number = {1-4}, 4066 pages = {33--47}, 4067 year = {2008}, 4068 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 4069 Applications}, 4070 issn = {0031-9201}, 4071 doi = {10.1016/j.pepi.2008.07.036}, 4072 author = {Dave A. May and Louis Moresi}, 4073 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 4074 petsc_uses = {KSP} 4075} 4076 4077@Article{ kausmuhlhausmay2010, 4078 title = {A stabilization algorithm for geodynamic numerical simulations with a free 4079 surface}, 4080 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 4081 journal = {Physics of the Earth and Planetary Interiors}, 4082 volume = {181}, 4083 number = {1}, 4084 pages = {12--20}, 4085 year = {2010}, 4086 petsc_uses = {KSP} 4087} 4088 4089@Article{ duretzmaygeryatackley2011, 4090 title = {Discretization errors and free surface stabilization in the finite difference and 4091 marker-in-cell method for applied geodynamics: A numerical study}, 4092 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 4093 journal = {Geochemistry, Geophysics, Geosystems}, 4094 volume = {12}, 4095 number = {7}, 4096 year = {2011}, 4097 petsc_uses = {KSP} 4098} 4099 4100@Article{ furuichimaytackley2011, 4101 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 4102 {Schur} complement approach with mixed precision arithmetic}, 4103 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 4104 journal = {Journal of Computational Physics}, 4105 volume = {230}, 4106 number = {24}, 4107 pages = {8835--8851}, 4108 year = {2011}, 4109 petsc_uses = {KSP} 4110} 4111 4112@Article{ kellermaykaus2013, 4113 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 4114 lithosphere and crust}, 4115 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 4116 journal = {Geophysical Journal International}, 4117 volume = {195}, 4118 number = {3}, 4119 pages = {1406--1442}, 4120 year = {2013}, 4121 petsc_uses = {KSP} 4122} 4123 4124@Article{ schellartfreemanstegmanmoresimay2007, 4125 title = {Evolution and diversity of subduction zones controlled by slab width}, 4126 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 4127 May}, 4128 journal = {Nature}, 4129 volume = {446}, 4130 number = {7133}, 4131 pages = {308--311}, 4132 year = {2007}, 4133 petsc_uses = {KSP} 4134} 4135 4136@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 4137 title = {A comparison of numerical surface topography calculations in geodynamic 4138 modelling: an evaluation of the sticky air method}, 4139 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 4140 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 4141 journal = {Geophysical Journal International}, 4142 volume = {189}, 4143 number = {1}, 4144 pages = {38--54}, 4145 year = {2012}, 4146 petsc_uses = {KSP} 4147} 4148 4149@Article{ stegmanfreemanschellartmoresimay2006, 4150 title = {Influence of trench width on subduction hinge retreat rates in {3-D} models of slab 4151 rollback}, 4152 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 4153 May}, 4154 journal = {Geochemistry, Geophysics, Geosystems}, 4155 volume = {7}, 4156 number = {3}, 4157 year = {2006}, 4158 petsc_uses = {KSP} 4159} 4160 4161@InProceedings{ may2014ptatin, 4162 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 4163 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 4164 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 4165 Computing, Networking, Storage and Analysis}}, 4166 organization = {ACM}, 4167 pages = {274--284}, 4168 year = {2014}, 4169 doi = {10.1109/SC.2014.28}, 4170 petsc_uses = {KSP} 4171} 4172 4173@Article{ maybrownpourhiet2015, 4174 title = {A scalable, matrix-free multigrid preconditioner for finite element 4175 discretizations of heterogeneous {Stokes} flow}, 4176 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 4177 journal = {Computer Methods in Applied Mechanics and Engineering}, 4178 volume = {290}, 4179 pages = {496--523}, 4180 year = {2015}, 4181 doi = {10.1016/j.cma.2015.03.014}, 4182 petsc_uses = {KSP} 4183} 4184 4185@Article{ duretzmayyamato2016, 4186 title = {A free surface capturing discretization for the staggered grid finite difference 4187 scheme}, 4188 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 4189 journal = {Geophysical Journal International}, 4190 volume = {204}, 4191 number = {3}, 4192 pages = {1518--1530}, 4193 year = {2016}, 4194 petsc_uses = {KSP} 4195} 4196 4197@Article{ rhebergenwellskatzwathen2014, 4198 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 4199 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 4200 journal = {SIAM J. Sci. Comput.}, 4201 volume = {36}, 4202 pages = {A1960--A1977}, 4203 year = {2014}, 4204 petsc_uses = {KSP} 4205} 4206 4207@Article{ katz08a, 4208 author = {R.F. Katz and M.G. Worster}, 4209 title = {Simulation of directional solidification, thermochemical convection, and chimney 4210 formation in a {H}ele-{S}haw cell}, 4211 journal = {J. Comp. Phys.}, 4212 volume = {227}, 4213 pages = {9823-9840}, 4214 year = {2008}, 4215 doi = {10.1016/j.jcp.2008.06.039}, 4216 petsc_uses = {KSP} 4217} 4218 4219@Article{ aabg2007, 4220 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 4221 title = {Full waveform inversion for seismic velocity and anelastic losses in 4222 heterogeneous structures}, 4223 journal = {Bulletin of Seismological Society of America}, 4224 year = {2007}, 4225 volume = {97}, 4226 pages = {1990--2008}, 4227 petsc_uses = {KSP} 4228} 4229 4230@Article{ katz2006, 4231 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 4232 title = {The dynamics of melt and shear localization in partially molten aggregates}, 4233 journal = {Nature}, 4234 year = {2006}, 4235 volume = {442}, 4236 pages = {676--679}, 4237 month = aug, 4238 day = {10}, 4239 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 4240 petsc_uses = {KSP} 4241} 4242 4243@InProceedings{ mqrs2003, 4244 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 4245 year = {2003}, 4246 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 4247 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 4248 Sozopol, Bulgaria, June 4-8, 2003}, 4249 petsc_uses = {KSP} 4250} 4251 4252@InProceedings{ lichtner1, 4253 author = {Chuan Lu and Peter C. Lichtner}, 4254 year = {2005}, 4255 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 4256 Geologic Media}, 4257 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 4258 lab = {LANL}, 4259 petsc_uses = {KSP} 4260} 4261 4262@Article{ hammondlichtnermills2014, 4263 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 4264 Example with {PFLOTRAN}}, 4265 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 4266 journal = {Water Resources Research}, 4267 volume = {50}, 4268 number = {1}, 4269 pages = {208--228}, 4270 doi = {10.1002/2012WR013483}, 4271 year = {2014}, 4272 petsc_uses = {KSP} 4273} 4274 4275@Article{ smw2003, 4276 author = {R. Scheichl and R. Masson and J. Wendebourg}, 4277 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 4278 journal = {Computational Geosciences}, 4279 year = {2003}, 4280 volume = {7}, 4281 pages = {295--318}, 4282 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 4283 petsc_uses = {KSP} 4284} 4285 4286@Article{ kees-miller-03, 4287 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 4288 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 4289 journal = {Computational Geosciences}, 4290 year = {2003}, 4291 volume = {7}, 4292 pages = {91--114}, 4293 petsc_uses = {KSP} 4294} 4295 4296@Article{ bk2003, 4297 author = {JN Buur and T Kuehnel}, 4298 title = {Improving depth imaging by automated model updating}, 4299 journal = {The Leading Edge}, 4300 year = {2003}, 4301 volume = {22}, 4302 pages = {310-318}, 4303 petsc_uses = {KSP} 4304} 4305 4306@Article{ frederickbuffett2016, 4307 title = {Submarine groundwater discharge as a possible formation mechanism for 4308 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 4309 author = {Jennifer M. Frederick and Bruce A. Buffett}, 4310 journal = {Journal of Geophysical Research: Solid Earth}, 4311 volume = {121}, 4312 number = {3}, 4313 pages = {1383--1404}, 4314 issn = {2169-9356}, 4315 doi = {10.1002/2015JB012627}, 4316 year = {2016}, 4317 petsc_uses = {KSP} 4318} 4319 4320% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4321% LiteralHTML:<font color="#FF0000"> 4322% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 4323% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 4324% LiteralHTML:variety of these simulations.</p> 4325% LiteralHTML:</font> 4326% LiteralHTML: 4327@InProceedings{ appelbe1, 4328 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4329 year = {2003}, 4330 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 4331 computational methodology}, 4332 page = {781}, 4333 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 4334 Proceedings}, 4335 publisher = {Springer-Verlag}, 4336 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 4337 petsc_uses = {KSP} 4338} 4339 4340% LiteralHTML:<a name="katz"> 4341@InProceedings{ gd1, 4342 author = {Guillaume Dumont and Michel Kern}, 4343 title = {Parallelization of a {3D} Seismic Migration Code with {PETSc}}, 4344 year = {1999}, 4345 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 4346 Computing}, 4347 petsc_uses = {KSP} 4348} 4349 4350% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 4351% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 4352% LiteralHTML:<font color="#FF0000"> 4353% LiteralHTML: Figures from the work of Richard Katz 4354@PhDThesis{ katzthesis, 4355 author = {R.F. Katz}, 4356 title = {The deep roots of volcanoes: models of magma dynamics with applications to 4357 subduction zones}, 4358 school = {Columbia University}, 4359 year = {2005}, 4360 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 4361 petsc_uses = {KSP} 4362} 4363 4364@InCollection{ knepleykatzsmith06, 4365 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 4366 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 4367 USA}, 4368 title = {Developing a Geodynamics Simulator with {PETSc}}, 4369 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 4370 series = {Lecture Notes in Computational Science and Engineering}, 4371 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 4372 publisher = {Springer Berlin Heidelberg}, 4373 isbn = {978-3-540-31619-0}, 4374 keyword = {Mathematics and Statistics}, 4375 pages = {413-438}, 4376 volume = {51}, 4377 doi = {10.1007/3-540-31619-1_12}, 4378 year = {2006}, 4379 petsc_uses = {KSP} 4380} 4381 4382@Article{ katz04, 4383 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 4384 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 4385 the global mid-ocean ridge system}, 4386 journal = {Geophys.\ Res.\ Letts.}, 4387 year = {2004}, 4388 volume = {31}, 4389 pages = {L15605}, 4390 petsc_uses = {KSP} 4391} 4392 4393@Article{ katz07, 4394 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 4395 Ethan Coon}, 4396 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 4397 Toolkit for Scientific Computation}}, 4398 journal = {Phys. Earth Planet. In.}, 4399 volume = {163}, 4400 pages = {52--68}, 4401 year = {2007}, 4402 petsc_uses = {KSP} 4403} 4404 4405@Article{ williams2006development, 4406 title = {{Development of a package for modeling stress in the lithosphere}}, 4407 author = {Williams, CA}, 4408 journal = {Eos Trans. AGU}, 4409 volume = {87}, 4410 pages = {36}, 4411 year = {2006}, 4412 petsc_uses = {KSP} 4413} 4414 4415@Article{ goverswortel05, 4416 author = {R. Govers and M.J.R. Wortel}, 4417 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 4418 journal = {Earth and Planetary Science Letters}, 4419 volume = {236/1-2}, 4420 pages = {505-523}, 4421 year = {2005}, 4422 petsc_uses = {KSP} 4423} 4424 4425@InProceedings{ snark2, 4426 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4427 year = {2002}, 4428 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 4429 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 4430 petsc_uses = {KSP} 4431} 4432 4433@Article{ snark1, 4434 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 4435 Tan and Feng Wang}, 4436 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 4437 journal = {Submitted to Pure and Applied Geosciences}, 4438 petsc_uses = {KSP} 4439} 4440 4441@InProceedings{ earthquake2003, 4442 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 4443 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 4444 Tiankai Tu}, 4445 year = {2003}, 4446 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 4447 booktitle = {Proceedings of SC2003}, 4448 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 4449 petsc_uses = {KSP} 4450} 4451 4452@InProceedings{ stefano12, 4453 author = {Michele De Stefano}, 4454 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 4455 booktitle = {PIERS Proceedings}, 4456 month = aug, 4457 address = {Moscow, RUSSIA}, 4458 pages = {491--495}, 4459 year = {2012}, 4460 petsc_uses = {KSP} 4461} 4462 4463%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 4464 4465% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4466% LiteralHTML: <center><img alt="" 4467% LiteralHTML: src="images/ocean.jpg"></center></p> 4468@Article{ khatiwala07, 4469 author = {Khatiwala, S.}, 4470 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 4471 journal = {Glob. Biogeochem. Cycles}, 4472 volume = {21}, 4473 doi = {10.1029/2007GB002923}, 4474 year = {2007}, 4475 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 4476} 4477 4478@Article{ dks2004, 4479 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 4480 journal = {Ocean Modelling}, 4481 year = {2004}, 4482 volume = {6(2)}, 4483 pages = {125-150}, 4484 title = {A finite-element Ocean Model: Principles and Evaluation}, 4485 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 4486 petsc_uses = {KSP} 4487} 4488 4489@Article{ danilov1, 4490 author = {S. Danilov and G. Kivman and J. Schroter}, 4491 year = {2004}, 4492 title = {Evaluation of an eddy-permitting finite-element ocean model in the {N}orth 4493 {A}tlantic}, 4494 journal = {Ocean Modelling}, 4495 petsc_uses = {KSP} 4496} 4497 4498@Article{ nerger1, 4499 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 4500 year = {2004}, 4501 title = {Data Assimilation with the Ensemble {K}alman Filter and the {SEIK} Filter applied to 4502 a Finite Element Model of the {N}orth {A}tlantic}, 4503 journal = {Journal of marine systems}, 4504 petsc_uses = {KSP} 4505} 4506 4507@Conference{ rakowsky2003self, 4508 title = {{A self-adaptive finite element model of the atmosphere}}, 4509 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 4510 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 4511 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 4512 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 4513 pages = {279}, 4514 isbn = {981238376X}, 4515 year = {2003}, 4516 organization = {World Scientific Pub Co}, 4517 petsc_uses = {KSP} 4518} 4519 4520@Article{ lauter3, 4521 author = {M. Lauter}, 4522 year = {2004}, 4523 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4524 AtmosphArenmodell}, 4525 journal = {Berichte zur Polar- und Meeresforschung}, 4526 petsc_uses = {KSP} 4527} 4528 4529@Article{ lauter2, 4530 author = {M. Lauter and D. Handorf and K. Dethloff}, 4531 year = {2004}, 4532 title = {Unsteady analytical solutions of the spherical shallow water equations}, 4533 journal = {Journal of computational physics}, 4534 petsc_uses = {KSP} 4535} 4536 4537@PhDThesis{ lauter1, 4538 author = {M. Lauter}, 4539 year = {2004}, 4540 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4541 AtmosphArenmodell}, 4542 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 4543 petsc_uses = {KSP} 4544} 4545 4546@Article{ frickenhaus1, 4547 author = {S. Frickenhaus and W. Hiller and M. Best}, 4548 year = {2005}, 4549 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 4550 parallel numerical atmosphere and ocean models}, 4551 journal = {Ocean Modelling}, 4552 volume = {10}, 4553 pages = {185--191}, 4554 petsc_uses = {KSP} 4555} 4556 4557@Article{ 0266-5611-24-3-034015, 4558 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 4559 title = {A {N}ewton-{CG} method for large-scale three-dimensional elastic full-waveform 4560 seismic inversion}, 4561 journal = {Inverse Problems}, 4562 volume = {24}, 4563 number = {3}, 4564 pages = {034015 (26pp)}, 4565 url = {http://stacks.iop.org/0266-5611/24/034015}, 4566 year = {2008}, 4567 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 4568 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 4569 iterations with inner conjugate gradient linear iterations, globalized by an 4570 Armijo backtracking line search, solved on a sequence of finer grids and higher 4571 frequencies to remain in the vicinity of the global optimum, inexactly terminated 4572 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 4573 variation operator to capture sharp interfaces, finely discretized by finite 4574 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 4575 implemented in matrix-free fashion with adjoint-based computation of reduced 4576 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 4577 waveform storage, and partitioned spatially across processors to parallelize the 4578 solutions of the forward and adjoint wave equations and the evaluation of 4579 gradient-like information. Several numerical examples demonstrate the grid 4580 independence of linear and nonlinear iterations, the effectiveness of the 4581 preconditioner, the ability to solve inverse problems with up to 17 million 4582 inversion parameters on up to 2048 processors, the effectiveness of multiscale 4583 continuation in keeping iterates in the basin of attraction of the global minimum, 4584 and the ability to fit the observational data while reconstructing the model with 4585 reasonable resolution and capturing sharp interfaces.}, 4586 petsc_uses = {KSP} 4587} 4588 4589% LiteralHTML: 4590% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 4591% LiteralHTML: 4592% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4593% LiteralHTML:<font color="#FF0000"> 4594% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 4595% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 4596% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 4597% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 4598% LiteralHTML:for a variety of these simulations.</p> 4599% LiteralHTML:</font> 4600% LiteralHTML: 4601@Article{ mills2009modeling, 4602 title = {Modeling subsurface reactive flows using leadership-class computing}, 4603 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4604 Mahinthakumar, G.K. and Smith, B.F.}, 4605 journal = {Journal of Physics: Conference Series}, 4606 volume = {180}, 4607 pages = {012062}, 4608 year = {2009}, 4609 publisher = {IOP Publishing}, 4610 petsc_uses = {KSP} 4611} 4612 4613@Conference{ mills2007simulating, 4614 title = {{Simulating subsurface flow and transport on ultrascale computers using 4615 PFLOTRAN}}, 4616 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 4617 booktitle = {Journal of Physics: Conference Series}, 4618 volume = {78}, 4619 pages = {012051}, 4620 year = {2007}, 4621 organization = {IOP Publishing}, 4622 petsc_uses = {KSP} 4623} 4624 4625@InProceedings{ mills2009, 4626 title = {Modeling subsurface reactive flows using leadership-class computing}, 4627 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4628 Mahinthakmuar, G. and Smith, B.}, 4629 booktitle = {Journal of Physics: Conference Series}, 4630 volume = {180}, 4631 pages = {102062}, 4632 year = {2009}, 4633 organization = {IOP Publishing}, 4634 petsc_uses = {KSP} 4635} 4636 4637@Article{ guo2013parallel, 4638 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 4639 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 4640 }, 4641 journal = {Advances in Water Resources }, 4642 volume = {53}, 4643 number = {0}, 4644 pages = {101 - 108}, 4645 year = {2013}, 4646 note = {}, 4647 issn = {0309-1708}, 4648 doi = {10.1016/j.advwatres.2012.10.010}, 4649 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 4650 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 4651 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 4652 preconditioner}, 4653 petsc_uses = {KSP} 4654} 4655 4656@Unpublished{ stomp, 4657 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 4658 url = {http://stomp.pnl.gov/}, 4659 petsc_uses = {KSP} 4660} 4661 4662@InProceedings{ htfc2003, 4663 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 4664 title = {Methods and Experiences For Parallelizing Flood Models}, 4665 year = {2003}, 4666 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 4667 European PVM/MPI User's Group Meeting}, 4668 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 4669 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 4670 petsc_uses = {KSP} 4671} 4672 4673@InProceedings{ hulchy-tran-astalos-fmsip, 4674 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 4675 D.Froehlich}, 4676 title = {Flood Modeling System and Its Parallelization}, 4677 year = {2002}, 4678 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 4679 Engineering}, 4680 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 4681 petsc_uses = {KSP} 4682} 4683 4684@InProceedings{ gy1, 4685 author = {J. P. Gwo and G. T. Yeh}, 4686 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 4687 Transport at Watershed Scale}, 4688 year = {2004}, 4689 booktitle = {The International Conference on Computational Methods}, 4690 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 4691 petsc_uses = {KSP} 4692} 4693 4694@Conference{ cheng2009efficient, 4695 title = {{An efficient parallel method for large-scale groundwater flow equation based on 4696 PETSc}}, 4697 author = {Cheng, T. and Ji, X. and Wang, Q.}, 4698 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 4699 Conference on}, 4700 pages = {190--193}, 4701 organization = {IEEE}, 4702 petsc_uses = {KSP} 4703} 4704 4705@Unpublished{ sfrsm, 4706 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 4707 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 4708 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 4709 its linear solves}, 4710 petsc_uses = {KSP} 4711} 4712 4713% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4714@InProceedings{ bart_omar:sc05, 4715 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 4716 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 4717 title = {Dynamic data driven inversion for terascale simulations: real-time 4718 indentification of airborne contaminants}, 4719 booktitle = {Proceedings of SC2005}, 4720 organization = {IEEE/ACM}, 4721 address = {Seattle, WA}, 4722 year = {2005}, 4723 month = nov, 4724 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 4725 lab = {SNL}, 4726 petsc_uses = {KSP} 4727} 4728 4729@InProceedings{ anton-krassimir-lscc, 4730 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 4731 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 4732 Simulations}, 4733 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 4734 volume = {2907}, 4735 year = {2003}, 4736 publisher = {Springer-Verlag}, 4737 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 4738 petsc_uses = {KSP} 4739} 4740 4741@InProceedings{ aa2001, 4742 author = {Anton Antonov}, 4743 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 4744 year = {2001}, 4745 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 4746 Sozopol, Bulgaria}, 4747 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 4748 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 4749 petsc_uses = {KSP} 4750} 4751 4752% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4753@Article{ grassley-simmons-kercher-00, 4754 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 4755 year = {2000}, 4756 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 4757 reactive transport models}, 4758 journal = {Applied Geochemistry}, 4759 volume = {17}, 4760 pages = {699--708}, 4761 lab = {LLNL} 4762} 4763 4764@Article{ glassey-nitao-03, 4765 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 4766 and Carl I. Steefel and James R. Kercher}, 4767 year = {2003}, 4768 title = {The impact of climate change on vadose zone pore waters and its implication for 4769 long-term monitoring}, 4770 journal = {Computers and Geosciences}, 4771 volume = {29}, 4772 pages = {399-411}, 4773 lab = {LLNL}, 4774 petsc_uses = {KSP} 4775} 4776 4777@Article{ steefel-depaolo-lichtner-05, 4778 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 4779 year = {2005}, 4780 title = {Reactive transport modeling: An essential tool and a new research approach for 4781 the Earth sciences}, 4782 journal = {Earth and Planetary Science Letters}, 4783 lab = {LLNL,LANL}, 4784 petsc_uses = {KSP} 4785} 4786 4787% LiteralHTML:<a name="scalinglarge"> 4788% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4789% LiteralHTML: <center><img alt="" 4790% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 4791% LiteralHTML:<font color="#FF0000"> 4792% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 4793@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 4794 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 4795 Strategies for Large-Scale Numerical Simulations}, 4796 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 4797 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 4798 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 4799 Large-Scale Systems (scalA)}, 4800 pages = {65-72}, 4801 doi = {10.1109/ScalA.2018.00012}, 4802 month = nov, 4803 year = {2018}, 4804 petsc_uses = {KSP} 4805} 4806 4807@Article{ km2004, 4808 author = {A. Keese and H. G. Matthies}, 4809 journal = {Computers and Structures}, 4810 year = {2005}, 4811 volume = {83}, 4812 pages = {1033--1047}, 4813 title = {Hierarchical parallelisation for the solution of stochastic finite element 4814 equations}, 4815 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 4816 petsc_uses = {KSP} 4817} 4818 4819@Unpublished{ hvl2002, 4820 title = {Numerical Modeling of {NAPL} Source Zone Treatment}, 4821 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 4822 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 4823 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 4824 year = {2002}, 4825 lab = {LANL}, 4826 petsc_uses = {KSP} 4827} 4828 4829@PhDThesis{ hammond2003, 4830 author = {Glenn E. Hammond}, 4831 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 4832 Transport on Supercomputers}, 4833 school = {University of Illinois at Urbana-Champaign}, 4834 year = {2003}, 4835 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 4836 petsc_uses = {KSP} 4837} 4838 4839@Unpublished{ uk, 4840 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 4841 Scale Environmental Flows and Transport Processes}, 4842 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 4843 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 4844 buildings and in Green Bay. Used PETSc for its linear solvers}, 4845 year = {1999}, 4846 petsc_uses = {KSP} 4847} 4848 4849@InProceedings{ hammond2002, 4850 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 4851 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 4852 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 4853 year = {2002}, 4854 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 4855 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 4856 Resources, Delft, The Netherlands.}, 4857 lab = {LANL}, 4858 petsc_uses = {KSP} 4859} 4860 4861@TechReport{ steefel1, 4862 author = {C. I. Steefel}, 4863 title = {Software for modeling multicomponent, multidimensional reactive transport}, 4864 year = {2001}, 4865 institution = {Lawrence Livermore National Laboratory}, 4866 number = {UCRL-MA-143182}, 4867 lab = {LLNL}, 4868 petsc_uses = {KSP} 4869} 4870 4871@Article{ steefel2, 4872 author = {C. I. Steefel and A. C. Lasaga}, 4873 title = {A coupled model for transport of multiple chemical-species and kinetic 4874 precipitation dissolution reactions with application to reactive flow in 4875 single-phase hydrothermal systems}, 4876 journal = {Americal Journal of Science}, 4877 year = {1994}, 4878 pages = {529-592}, 4879 volume = {294}, 4880 number = {5}, 4881 petsc_uses = {KSP} 4882} 4883 4884@TechReport{ steefel3, 4885 author = {C. I. Steefel and S. B. Yabusaki}, 4886 title = {{OS3D/GIMRT}, Software for Multicomponent-Multidimensional reactive transport: 4887 User's manual and programmer's guide}, 4888 year = {1996}, 4889 institution = {Pacific Northwest National Laboratory}, 4890 number = {PNNL-11166}, 4891 lab = {PNNL}, 4892 petsc_uses = {KSP} 4893} 4894 4895@Article{ 2005hvl, 4896 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 4897 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 4898 preconditioning to biogeochemical transport}, 4899 journal = {Advances in Water Resources}, 4900 year = {2005}, 4901 pages = {359--376}, 4902 volume = {28}, 4903 url = { 4904 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 4905 lab = {LANL}, 4906 petsc_uses = {KSP} 4907} 4908 4909@Article{ wang-zabar-05, 4910 author = {J Wang and N Zabaras}, 4911 journal = {Int. J. Heat and Mass Transfer}, 4912 title = {A Markov random field model of contamination source identification in porous 4913 media flow}, 4914 year = {2005}, 4915 petsc_uses = {KSP} 4916} 4917 4918@InBook{ kp1, 4919 author = {Jong G. Kim and Hyoung W. Park}, 4920 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 4921 Media}, 4922 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 4923 title = {Lecture Notes in Computer Science}, 4924 publisher = {Springer-Verlag}, 4925 volume = {3044}, 4926 year = {2004}, 4927 petsc_uses = {KSP} 4928} 4929 4930@Article{ 2001agusm...h32a06k, 4931 author = {{Kim}, J.~G. and {Kim}, J.}, 4932 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 4933 journal = {AGU Spring Meeting Abstracts}, 4934 year = {2001}, 4935 pages = {32-+}, 4936 petsc_uses = {KSP} 4937} 4938 4939@Article{ lzb2005, 4940 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 4941 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 4942 journal = {Journal of Hydraulic Engineering}, 4943 year = {2005}, 4944 volume = {131}, 4945 number = {4}, 4946 pages = {247--258}, 4947 petsc_uses = {KSP} 4948} 4949 4950@Article{ rao2005, 4951 author = {Prasada Rao}, 4952 title = {A parallel {RMA2} model for simulating large-scale free surface flows}, 4953 journal = {Environmental Modelling and Software}, 4954 year = {2005}, 4955 pages = {47--53}, 4956 petsc_uses = {KSP} 4957} 4958 4959@InProceedings{ pr1, 4960 author = {Prasada Rao}, 4961 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 4962 Hydrodynamic Flows}, 4963 year = {2003}, 4964 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 4965 Conference}, 4966 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 4967 petsc_uses = {KSP} 4968} 4969 4970@InProceedings{ lichtner2004, 4971 author = {Peter C. Lichtner and Andrew Wolfsberg}, 4972 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 4973 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 4974 Challenge Supercomputing Problem}, 4975 year = {2004}, 4976 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 4977 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 4978 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 4979 lab = {LANL}, 4980 petsc_uses = {KSP} 4981} 4982 4983% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4984@Article{ aba01:petsc-app, 4985 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 4986 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 4987 journal = {Int. J. High Performance Computing Applications}, 4988 year = {2001}, 4989 volume = {15}, 4990 number = {1}, 4991 pages = {13--21}, 4992 petsc_uses = {KSP} 4993} 4994 4995@PhDThesis{ tjb200, 4996 author = {Thomas James Byer}, 4997 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 4998 Facilities}, 4999 school = {Stanford}, 5000 year = {2000}, 5001 petsc_uses = {KSP} 5002} 5003 5004@InProceedings{ puchyr2006, 5005 author = {Peter J. Puchyr}, 5006 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 5007 {Win32} Cluster}, 5008 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 5009 note = {Paper number CIPC2006-207}, 5010 year = {2006}, 5011 petsc_uses = {KSP} 5012} 5013 5014@InProceedings{ texas98, 5015 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 5016 and G. A. Pope}, 5017 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 5018 Simulation}, 5019 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 5020 Symposium}, 5021 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 5022 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 5023 year = {1998}, 5024 petsc_uses = {KSP} 5025} 5026 5027% LiteralHTML: 5028% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 5029% LiteralHTML: 5030@Article{ farrellmitchellscottwechsung2021, 5031 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 5032 stationary incompressible {Navier-Stokes} equations}, 5033 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 5034 Wechsung}, 5035 journal = {The SMAI journal of computational mathematics}, 5036 volume = {7}, 5037 pages = {75--96}, 5038 year = {2021}, 5039 petsc_uses = {KSP} 5040} 5041 5042@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 5043 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 5044 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 5045 P MacLachlan and Ray S Tuminaro}, 5046 journal = {SIAM Journal on Scientific Computing}, 5047 number = {0}, 5048 pages = {S70--S91}, 5049 year = {2021}, 5050 petsc_uses = {KSP} 5051} 5052 5053@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 5054 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 5055 hyperelasticity}, 5056 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 5057 Oyar\'ua and Ricardo Ruiz-Baier}, 5058 journal = {Computer Methods in Applied Mechanics and Engineering}, 5059 volume = {374}, 5060 pages = {113562}, 5061 issn = {0045-7825}, 5062 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 5063 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 5064 year = {2021}, 5065 petsc_uses = {KSP} 5066} 5067 5068@Article{ farrellmitchellwechsung2018, 5069 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 5070 {Navier-Stokes} equations at high {Reynolds} number}, 5071 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 5072 journal = {SIAM Journal on Scientific Computing}, 5073 volume = {41}, 5074 number = {5}, 5075 eprint = {1810.03315}, 5076 pages = {A3073-A3096}, 5077 year = {2019}, 5078 petsc_uses = {KSP} 5079} 5080 5081@Article{ hevuikklaij2017, 5082 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 5083 discretized by a finite volume method}, 5084 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 5085 journal = {Journal of Numerical Mathematics}, 5086 volume = {25}, 5087 number = {2}, 5088 pages = {89--105}, 5089 year = {2017}, 5090 petsc_uses = {KSP} 5091} 5092 5093@InProceedings{ zou2015newton, 5094 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 5095 appearance/disappearance}, 5096 author = {Zou, L and Zhao, H and Zhang, H}, 5097 booktitle = {ANS 2015 Annual Meeting, June}, 5098 volume = {7}, 5099 number = {11}, 5100 year = {2015}, 5101 petsc_uses = {KSP} 5102} 5103 5104@Article{ guermond2009nonlinear, 5105 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 5106 Fourier/finite element technique and an interior penalty method}, 5107 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 5108 journal = {Journal of computational physics}, 5109 volume = {228}, 5110 number = {8}, 5111 pages = {2739--2757}, 5112 year = {2009}, 5113 publisher = {Elsevier}, 5114 petsc_uses = {KSP} 5115} 5116 5117@Article{ erzincanlisahin2015, 5118 title = {The numerical simulation of the wing kinematics effects on near wake topology and 5119 aerodynamic performance in hovering {D}rosophila flight}, 5120 author = {Belkis Erzincanli and Mehmet Sahin}, 5121 journal = {Computers \& Fluids}, 5122 volume = {122}, 5123 pages = {90--110}, 5124 year = {2015}, 5125 publisher = {Elsevier}, 5126 petsc_uses = {KSP} 5127} 5128 5129@Article{ ekensahin2015, 5130 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 5131 structure interaction problems}, 5132 author = {Ali Eken and Mehmet Sahin}, 5133 journal = {International Journal for Numerical Methods in Fluids}, 5134 year = {2015}, 5135 publisher = {Wiley Online Library}, 5136 petsc_uses = {KSP} 5137} 5138 5139@Article{ hwangsucai2015, 5140 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 5141 for transonic full potential equation}, 5142 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 5143 journal = {Computers \& Fluids}, 5144 volume = {110}, 5145 number = {30}, 5146 pages = {96--107}, 5147 year = {2015}, 5148 doi = {10.1016/j.compfluid.2014.04.005}, 5149 petsc_uses = {KSP} 5150} 5151 5152@Article{ yanghwangcai2016, 5153 title = {Nonlinear Preconditioning Techniques for Full-Space {L}agrange--{N}ewton Solution of 5154 {PDE}-Constrained Optimization Problems}, 5155 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 5156 journal = {SIAM Journal on Scientific Computing}, 5157 volume = {38}, 5158 number = {5}, 5159 pages = {A2756--A2778}, 5160 year = {2016}, 5161 petsc_uses = {KSP} 5162} 5163 5164@Article{ khanaidun2011, 5165 author = {Irfan Khan and Cyrus K. Aidun}, 5166 title = {Direct numerical simulation of saturated deformable porous media using parallel 5167 hybrid Lattice-{B}oltzmann and finite element method}, 5168 journal = {Int. J. Numer. Meth. Eng.}, 5169 volume = {86}, 5170 pages = {1379--1395}, 5171 year = {2011}, 5172 petsc_uses = {KSP} 5173} 5174 5175@Article{ khanaidun2014, 5176 author = {Irfan Khan and Cyrus K. Aidun}, 5177 title = {Modeling the deformation of saturate porous media using direct numerical 5178 simulation}, 5179 journal = {Int. J. Multiphase Flow}, 5180 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 5181 year = {2014}, 5182 petsc_uses = {KSP} 5183} 5184 5185@Article{ mofidi2014simulations, 5186 author = {A. Mofidi and P. M. Carrica}, 5187 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 5188 and Propeller}, 5189 journal = {Computers and Fluids}, 5190 pages = {191--203}, 5191 year = {2014}, 5192 petsc_uses = {KSP} 5193} 5194 5195@Article{ paik2014fluidstructure, 5196 author = {K. Paik and P. M. Carrica}, 5197 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 5198 Surface in a Rolling Tank}, 5199 journal = {Ocean Engineering}, 5200 pages = {201--212}, 5201 year = {2014}, 5202 petsc_uses = {KSP} 5203} 5204 5205@Article{ castro2013bubble, 5206 author = {A. M. Castro and P. M. Carrica}, 5207 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 5208 evaluation and numerical issues}, 5209 journal = {International Journal of Multiphase Flow 57}, 5210 pages = {131--150}, 5211 year = {2013}, 5212 petsc_uses = {KSP} 5213} 5214 5215@Article{ carrica2013turn, 5216 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 5217 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 5218 Dynamic Overset Grids}, 5219 journal = {Journal of Marine Science and Technology}, 5220 pages = {166--181}, 5221 year = {2013}, 5222 petsc_uses = {KSP} 5223} 5224 5225@Article{ castro2013eulerian, 5226 author = {A. M. Castro and P. M. Carrica}, 5227 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 5228 {Athena} {R}/V,}, 5229 journal = {International Shipbuilding Progress}, 5230 pages = {403--433}, 5231 year = {2013}, 5232 petsc_uses = {KSP} 5233} 5234 5235@Article{ chase2013overset, 5236 author = {N. Chase and T. Michael and P. M. Carrica}, 5237 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 5238 {Maneuvering} {Conditions}}, 5239 journal = {International Shipbuilding Progress}, 5240 pages = {171--205}, 5241 year = {2013}, 5242 petsc_uses = {KSP} 5243} 5244 5245@Article{ sadathosseini2013wu, 5246 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 5247 Stern}, 5248 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 5249 Free Surge Conditions in Short and Long Head Waves}, 5250 journal = {Ocean Engineering}, 5251 volume = {59}, 5252 pages = {240--273}, 5253 year = {2013}, 5254 petsc_uses = {KSP} 5255} 5256 5257@Article{ chase2013cfd, 5258 author = {N. Chase and P. M. Carrica}, 5259 title = {{CFD} Simulations of a Submarine Propeller and Application to Self-Propulsion of a 5260 Submarine}, 5261 journal = {Ocean Engineering}, 5262 pages = {68--80}, 5263 year = {2013}, 5264 petsc_uses = {KSP} 5265} 5266 5267@Article{ carrica2012cfd, 5268 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 5269 title = {{CFD} Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 5270 of Moving Rudders and Rotating Propellers}, 5271 journal = {Computers and Fluids 53}, 5272 pages = {117--132}, 5273 year = {2012}, 5274 petsc_uses = {KSP} 5275} 5276 5277@Article{ sakamoto2012urans, 5278 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5279 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 5280 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 5281 publisher = {Journal of Marine Science and Technology}, 5282 pages = {422--445}, 5283 year = {2012}, 5284 petsc_uses = {KSP} 5285} 5286 5287@Article{ sakamoto2012uransb, 5288 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5289 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 5290 Analysis and Validation of Local Flow Characteristics}, 5291 journal = {Journal of Marine Science and Technology}, 5292 pages = {446--468}, 5293 year = {2012}, 5294 petsc_uses = {KSP} 5295} 5296 5297@Article{ li2012dynamic, 5298 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 5299 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 5300 journal = {Renewable Energy}, 5301 pages = {285--298}, 5302 year = {2012}, 5303 petsc_uses = {KSP} 5304} 5305 5306@Article{ huang2012a, 5307 author = {J. Huang and P. M. Carrica and F. Stern}, 5308 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 5309 journal = {International Journal for Numerical Methods in Fluids}, 5310 pages = {160--180}, 5311 year = {2012}, 5312 petsc_uses = {KSP} 5313} 5314 5315@Article{ huang2012b, 5316 author = {J. Huang and P. M. Carrica and F. Stern}, 5317 title = {A geometry-based level set method for curvilinear overset grids with application 5318 to ship hydrodynamics}, 5319 journal = {International Journal for Numerical Methods in Fluids}, 5320 pages = {494--521}, 5321 year = {2012}, 5322 petsc_uses = {KSP} 5323} 5324 5325@Article{ carrica2011computations, 5326 author = {P. M. Carrica and H. Fu and F. Stern}, 5327 title = {Computations of self-propulsion free to sink and trim and of motions in head 5328 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 5329 journal = {Applied Ocean Research}, 5330 pages = {309--320}, 5331 year = {2011}, 5332 petsc_uses = {KSP} 5333} 5334 5335@Article{ bhushan2011scalability, 5336 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 5337 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 5338 Using {CFDShip}-Iowa}, 5339 journal = {International Journal of High Performance Computing Applications}, 5340 pages = {466--487}, 5341 year = {2011}, 5342 petsc_uses = {KSP} 5343} 5344 5345@Article{ castro2011full, 5346 author = {A. M. Castro and P. M. Carrica and F. Stern}, 5347 title = {Full scale self-propulsion computations using discretized propeller for the 5348 {KRISO} container ship {KCS}}, 5349 journal = {Computers and Fluids}, 5350 pages = {35--47}, 5351 year = {2011}, 5352 petsc_uses = {KSP} 5353} 5354 5355@Article{ kandasamy2011multifidelity, 5356 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5357 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5358 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing {C}atamaran 5359 for Low Wake}, 5360 journal = {Journal of Marine Science and Technology}, 5361 pages = {143--156}, 5362 year = {2011}, 5363 petsc_uses = {KSP} 5364} 5365 5366@Article{ kandasamy2011cfd, 5367 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5368 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5369 title = {{CFD} Validation Studies for a High-speed Foil-assisted Semi-planing {C}atamaran}, 5370 journal = {Journal of Marine Science and Technology}, 5371 pages = {157--167}, 5372 year = {2011}, 5373 petsc_uses = {KSP} 5374} 5375 5376@Article{ sadathosseini2011cfd, 5377 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 5378 and S. Yamamura and A. Mastuda}, 5379 title = {{CFD} System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 5380 Periodic Motion and Broaching}, 5381 journal = {Ocean Engineering}, 5382 pages = {88--110}, 5383 year = {2011}, 5384 petsc_uses = {KSP} 5385} 5386 5387@Article{ mosaviraad2010development, 5388 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 5389 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 5390 with Comparison to Regular Wave and Transient Wave Group Procedures Using 5391 {URANS}}, 5392 journal = {Ocean Engineering}, 5393 pages = {653--666}, 5394 year = {2010}, 5395 petsc_uses = {KSP} 5396} 5397 5398@Article{ carrica2010largescale, 5399 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5400 Stern}, 5401 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5402 Heave Problems for a Surface Combatant}, 5403 journal = {Computers and Fluids}, 5404 pages = {1095--1111}, 5405 year = {2010}, 5406 petsc_uses = {KSP} 5407} 5408 5409@Article{ carrica2010selfpropulsion, 5410 author = {P. M. Carrica and A. M. Castro and F. Stern}, 5411 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 5412 with Dynamic Overset Grids}, 5413 journal = {Journal of Marine Science and Technology}, 5414 pages = {316--330}, 5415 year = {2010}, 5416 petsc_uses = {KSP} 5417} 5418 5419@Article{ ismail2010evaluation, 5420 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 5421 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 5422 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 5423 journal = {International Journal of Numerical Methods in Fluids}, 5424 pages = {850--886}, 5425 year = {2010}, 5426 petsc_uses = {KSP} 5427} 5428 5429@Article{ kandasamy2010integral, 5430 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 5431 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 5432 journal = {Journal of Fluids Engineering}, 5433 pages = {101103}, 5434 year = {2010}, 5435 petsc_uses = {KSP} 5436} 5437 5438@Article{ kirk:2014de, 5439 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 5440 title = {{Modeling hypersonic entry with the fully-implicit {N}avier--{S}tokes (FIN-S) 5441 stabilized finite element flow solver}}, 5442 journal = {Computers {\&} Fluids}, 5443 year = {2014}, 5444 volume = {92}, 5445 number = {0}, 5446 pages = {281--292}, 5447 month = mar, 5448 petsc_uses = {KSP} 5449} 5450 5451@Article{ carracciuolo20111382, 5452 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 5453 in high performance computing environment}, 5454 journal = {Journal of Non-Newtonian Fluid Mechanics }, 5455 volume = {166}, 5456 number = {23--24}, 5457 pages = {1382--1395}, 5458 year = {2011}, 5459 issn = {0377-0257}, 5460 doi = {10.1016/j.jnnfm.2011.08.014}, 5461 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 5462 Maffettone and A. Murli}, 5463 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 5464 method, High performance computing}, 5465 petsc_uses = {KSP} 5466} 5467 5468@Article{ bungartzgatzhammerliebmehlneckel11, 5469 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 5470 Miriam and Neckel, Tobias}, 5471 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 5472 journal = {Computational Mechanics}, 5473 volume = {48}, 5474 number = {3}, 5475 pages = {365-376}, 5476 year = {2011}, 5477 issn = {0178-7675}, 5478 doi = {10.1007/s00466-011-0626-1}, 5479 publisher = {Springer-Verlag}, 5480 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 5481 Thermohydraulics; Two-phase flow}, 5482 language = {English}, 5483 petsc_uses = {KSP} 5484} 5485 5486@Article{ bpr:cfl, 5487 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 5488 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 5489 Equations}}, 5490 journal = {International Journal for Numerical Methods in Fluids}, 5491 year = {2009}, 5492 volume = {59}, 5493 number = {1}, 5494 pages = {1--18}, 5495 doi = {10.1002/fld.1798}, 5496 petsc_uses = {KSP} 5497} 5498 5499@InBook{ bonfiglioli_campobasso_carpentieri_2010, 5500 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 5501 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 5502 preconditioned newton-krylov solver}, 5503 publisher = {Curran Associates}, 5504 year = {2010}, 5505 url = {http://www.proceedings.com/05932.html}, 5506 petsc_uses = {KSP} 5507} 5508 5509@Article{ bonfiglioli_rans_2005, 5510 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 5511 Bernardo}, 5512 title = {RANS simulations of a junction flow}, 5513 journal = {International Journal of Computational Fluid Dynamics}, 5514 volume = {19}, 5515 number = {2}, 5516 pages = {179-189}, 5517 year = {2005}, 5518 doi = {10.1080/10618560410001729126}, 5519 petsc_uses = {KSP} 5520} 5521 5522@InCollection{ bonfiglioli__carpentieri_rans_2008, 5523 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 5524 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 5525 Italy}, 5526 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 5527 Equations Using Fluctuation Splitting Schemes}, 5528 booktitle = {Numerical Mathematics and Advanced Applications}, 5529 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 5530 publisher = {Springer Berlin Heidelberg}, 5531 isbn = {978-3-540-69777-0}, 5532 pages = {151-158}, 5533 doi = {10.1007/978-3-540-69777-0_17}, 5534 year = {2008}, 5535 petsc_uses = {KSP} 5536} 5537 5538@InCollection{ bonfiglioli__carpentieri_ens_2007, 5539 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 5540 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 5541 Italy}, 5542 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 5543 Problems on Unstructured Grids}, 5544 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 5545 series = {Lecture Notes in Computer Science}, 5546 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 5547 publisher = {Springer Berlin / Heidelberg}, 5548 isbn = {978-3-540-75754-2}, 5549 pages = {676-685}, 5550 volume = {4699}, 5551 doi = {10.1007/978-3-540-75755-9_83}, 5552 year = {2007}, 5553 petsc_uses = {KSP} 5554} 5555 5556@Article{ terrelscottknepleykirby08, 5557 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 5558 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 5559 journal = {BIT}, 5560 volume = {48}, 5561 number = {2}, 5562 year = {2008}, 5563 petsc_uses = {KSP} 5564} 5565 5566@Article{ martamadermartinsweidealonso07, 5567 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 5568 J. Alonso}, 5569 title = {A methodology for the development of discrete adjoint solvers using automatic 5570 differentiation tools}, 5571 journal = {Computational Fluid Dyanmics}, 5572 volume = {21}, 5573 pages = {307--327}, 5574 year = {2007}, 5575 petsc_uses = {KSP} 5576} 5577 5578@TechReport{ avb2008, 5579 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 5580 title = {Variational Space-time (Dis)continuous {G}alerkin Method for Linear Free Surface 5581 Waves}, 5582 year = {2008}, 5583 institution = {University of Twente, the Netherlands}, 5584 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 5585 petsc_uses = {KSP} 5586} 5587 5588@InProceedings{ bdsm2005, 5589 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 5590 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 5591 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 5592 year = {2005}, 5593 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 5594 petsc_uses = {KSP} 5595} 5596 5597@InProceedings{ ms2006, 5598 author = {S. Muller and Y. Stiriba}, 5599 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 5600 STEADY COMPRESSIBLE FLOWS}, 5601 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 5602 year = {2006}, 5603 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 5604 petsc_uses = {KSP} 5605} 5606 5607@Article{ araujoteixeiracunhagroth08, 5608 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 5609 title = {Parallel three-dimensional simulation of the injection molding process}, 5610 journal = {International Journal for Numerical Methods in Fluids}, 5611 year = {2008}, 5612 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 5613 petsc_uses = {KSP} 5614} 5615 5616@PhDThesis{ a2008, 5617 author = {A. Cubero}, 5618 title = {a parallel coupled algorithm for collocated grids and its application to Large 5619 Eddy Simulation of a turbulent wake}, 5620 school = {University of Zaragoza (Spain)}, 5621 year = {2008}, 5622 petsc_uses = {KSP} 5623} 5624 5625@Article{ afa2007, 5626 author = {A. Cubero and N. Fueyo}, 5627 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 5628 journal = {Numerical Heat Transfer, part B-Fundamentals}, 5629 volume = {56}, 5630 number = {6}, 5631 pages = {507--529}, 5632 year = {2007}, 5633 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 5634 petsc_uses = {KSP} 5635} 5636 5637@TechReport{ af2007, 5638 title = {Preconditioning based on a partially implicit implementation of Momentum 5639 Interpolation for coupled solvers}, 5640 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 5641 year = {2007}, 5642 author = {A. Cubero and N. Fueyo}, 5643 petsc_uses = {KSP} 5644} 5645 5646@InCollection{ dwight2004, 5647 author = {Richard Dwight}, 5648 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 5649 booktitle = {Computational Fluid Dynamics 2006}, 5650 editor = {H. Deconinck and E. Dick}, 5651 publisher = {Springer}, 5652 year = {2006}, 5653 url = {http://www.maths.man.ac.uk/\~{ 5654 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 5655 petsc_uses = {KSP} 5656} 5657 5658@InProceedings{ dwight2006, 5659 author = {Richard Dwight and Joel Brezillon}, 5660 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 5661 Optimization}, 5662 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 5663 AIAA-2006-0690}, 5664 year = {2006}, 5665 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 5666 petsc_uses = {KSP} 5667} 5668 5669@PhDThesis{ dwight2006a, 5670 author = {Richard Dwight}, 5671 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 5672 and Adjoint Methods on Unstructured Grids}, 5673 school = {School of Mathematics, University of Manchester}, 5674 year = {2006}, 5675 url = {http://www.maths.man.ac.uk/\~{ 5676 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 5677 petsc_uses = {KSP} 5678} 5679 5680@InProceedings{ lhdfrh, 5681 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 5682 W. Hiller}, 5683 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 5684 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 5685 March, 10-14, 2003, Munich University of Technology, German}, 5686 year = {2003}, 5687 petsc_uses = {KSP} 5688} 5689 5690@InProceedings{ brios-ying-2002, 5691 author = {George Biros and Lexing Ying and Denis Zorin}, 5692 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 5693 {Navier-Stokes} equations}, 5694 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 5695 year = {2002}, 5696 petsc_uses = {KSP} 5697} 5698 5699@InProceedings{ mohsen-straatman-ins, 5700 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 5701 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 5702 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 5703 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 5704 Systems and Applications}, 5705 pages = {11--16}, 5706 year = {2005}, 5707 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 5708 petsc_uses = {KSP} 5709} 5710 5711@TechReport{ bonglioli-icnmfd98, 5712 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 5713 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 5714 institution = {Universita della Basilicata via della Tecnica 3}, 5715 year = {1996}, 5716 author = {A. Bonglioli}, 5717 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 5718 petsc_uses = {KSP} 5719} 5720 5721@Article{ deng-piquet-ctf, 5722 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 5723 title = {A new fully coupled method for computing turbulent flows}, 5724 journal = {Computers and Fluids}, 5725 volume = {30}, 5726 pages = {445--472}, 5727 year = {2001}, 5728 petsc_uses = {KSP} 5729} 5730 5731@InProceedings{ knepleysarinsameh99b, 5732 title = {Multilevel Preconditioning for Parallel {CFD}}, 5733 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 5734 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 5735 Problems In Industrial Applications}, 5736 address = {Minneapolis, MN}, 5737 year = {1999}, 5738 petsc_uses = {KSP} 5739} 5740 5741@InProceedings{ garbey1, 5742 author = {M. Garbey and B. Hadri and W. Shyy.}, 5743 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 5744 Problems on the Grid}, 5745 booktitle = {Aerospace Sciences Meeting and Exhibit}, 5746 note = {Paper No. 2005-1386}, 5747 year = {2005}, 5748 petsc_uses = {KSP} 5749} 5750 5751@Article{ carrica2007unsteady, 5752 title = {An unsteady single-phase level set method for viscous free surface flows}, 5753 author = {Carrica, PM and Wilson, RV and Stern, F.}, 5754 journal = {International Journal for Numerical Methods in Fluids}, 5755 volume = {53}, 5756 number = {2}, 5757 pages = {229--256}, 5758 year = {2007}, 5759 publisher = {Chichester; New York: Wiley, c1981-}, 5760 petsc_uses = {KSP} 5761} 5762 5763@Article{ pctw2004, 5764 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 5765 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 5766 Spillways}, 5767 journal = {Journal of Hydraulic Research}, 5768 note = {accepted for publication}, 5769 year = {2004}, 5770 petsc_uses = {KSP} 5771} 5772 5773@Article{ wcs2004, 5774 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 5775 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 5776 Combatant}, 5777 journal = {Computers and Fluids}, 5778 note = {in press}, 5779 year = {2004}, 5780 petsc_uses = {KSP} 5781} 5782 5783@Article{ cws2005, 5784 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 5785 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 5786 journal = {Computers and Fluids}, 5787 note = {accepted for publication}, 5788 year = {2005}, 5789 petsc_uses = {KSP} 5790} 5791 5792@Article{ chndss2010, 5793 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5794 Stern}, 5795 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5796 Heave Problems for a Surface Combatant}, 5797 journal = {Computers and Fluids}, 5798 year = {2010}, 5799 volume = {39}, 5800 number = {7}, 5801 pages = {1095--1111}, 5802 petsc_uses = {KSP} 5803} 5804 5805@InProceedings{ chnkss2008, 5806 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5807 Stern}, 5808 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 5809 Grids}, 5810 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 5811 year = {2008}, 5812 petsc_uses = {KSP} 5813} 5814 5815@MastersThesis{ mtj, 5816 author = {M. T. Jozkowski}, 5817 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 5818 About Submerged Bodies}, 5819 school = {The Pennsylvania State University}, 5820 year = {2005}, 5821 petsc_uses = {KSP} 5822} 5823 5824@Article{ pp, 5825 author = {E. G. Paterson and L. J. Peltier}, 5826 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 5827 Wakes}, 5828 journal = {ASME Journal of Fluids Engineering}, 5829 note = {In press}, 5830 year = {2005}, 5831 petsc_uses = {KSP} 5832} 5833 5834@Article{ eps, 5835 author = {B. A. Edge and E. G. Paterson and G. Settles}, 5836 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 5837 journal = {ASME Journal of Fluids Engineering}, 5838 note = {In press}, 5839 year = {2005}, 5840 petsc_uses = {KSP} 5841} 5842 5843@InProceedings{ rp, 5844 author = {B. Racine and E. G. Paterson}, 5845 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 5846 Using Unsteady {RANS} {CFD}}, 5847 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 5848 year = {2005}, 5849 petsc_uses = {KSP} 5850} 5851 5852@InProceedings{ etpp, 5853 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 5854 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 5855 and DES}, 5856 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5857 year = {2004}, 5858 petsc_uses = {KSP} 5859} 5860 5861@InProceedings{ pp8, 5862 author = {E. G. Paterson and L. J. Peltier}, 5863 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 5864 refinement grids and detached-eddy simulation}, 5865 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5866 year = {2004}, 5867 petsc_uses = {KSP} 5868} 5869 5870@InProceedings{ mzwp, 5871 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 5872 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 5873 booktitle = {25th Symposium on Naval Hydrodynamics}, 5874 year = {2004}, 5875 petsc_uses = {KSP} 5876} 5877 5878@InProceedings{ ppph, 5879 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 5880 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 5881 booktitle = {25th Symposium on Naval Hydrodynamics}, 5882 year = {2004}, 5883 petsc_uses = {KSP} 5884} 5885 5886@InProceedings{ ppd, 5887 author = {E. G. Paterson and L. J. Peltier}, 5888 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 5889 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 5890 year = {2004}, 5891 petsc_uses = {KSP} 5892} 5893 5894@InProceedings{ bp, 5895 author = {W. J. Baker and E. G. and Paterson}, 5896 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 5897 Control Wing}, 5898 booktitle = {NASA/ONR Workshop on Circulation Control}, 5899 year = {2004}, 5900 petsc_uses = {KSP} 5901} 5902 5903@InProceedings{ pb, 5904 author = {E. G. Paterson and W. J. Baker}, 5905 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 5906 booktitle = {NASA/ONR Workshop on Circulation Control}, 5907 year = {2004}, 5908 petsc_uses = {KSP} 5909} 5910 5911@InProceedings{ pb3, 5912 author = {E. G. Paterson and W. J. Baker}, 5913 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 5914 Surfaces}, 5915 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 5916 year = {2004}, 5917 petsc_uses = {KSP} 5918} 5919 5920@InProceedings{ gid1, 5921 author = {G. Frank and J. D'Elia}, 5922 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 5923 year = {2004}, 5924 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 5925 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 5926 petsc_uses = {KSP} 5927} 5928 5929@InBook{ b1, 5930 author = {A.Bonfiglioli}, 5931 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 5932 year = {2001}, 5933 title = {Science and Supercomputing at CINECA}, 5934 pages = {397--400}, 5935 petsc_uses = {KSP} 5936} 5937 5938@InProceedings{ b2004, 5939 author = {L. A. Barba}, 5940 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 5941 fully meshless formulation}, 5942 year = {2004}, 5943 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 5944 note = {Submitted}, 5945 petsc_uses = {KSP} 5946} 5947 5948@InProceedings{ bl2004, 5949 author = {L. A. Barba and A. Leonard}, 5950 title = {Computation of Viscous Vortices with Fully Meshless Method}, 5951 year = {2004}, 5952 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 5953 note = {Submitted}, 5954 petsc_uses = {KSP} 5955} 5956 5957@Article{ vws1, 5958 author = {B. G. M. Van Wachem and J. C. Schouten}, 5959 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 5960 Velocity}, 5961 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 5962 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 5963 Netherlands}, 5964 journal = {AIChE}, 5965 volumne = {48}, 5966 number = {12}, 5967 month = dec, 5968 year = {2002}, 5969 petsc_uses = {KSP} 5970} 5971 5972@TechReport{ lbam1, 5973 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 5974 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 5975 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 5976 di Bari Italy}, 5977 year = {2002}, 5978 number = {25/02}, 5979 petsc_uses = {KSP} 5980} 5981 5982@Article{ kees_miller_02, 5983 author = {C. E. Kees and C. T. Miller}, 5984 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 5985 journal = {Advances in Water Resources}, 5986 year = {2002}, 5987 volume = {25}, 5988 number = {2}, 5989 pages = {159-177.}, 5990 petsc_uses = {KSP} 5991} 5992 5993@InProceedings{ lepotmeersessers2001, 5994 author = {I. Lepot and F. Meers and J.A. Essers}, 5995 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 5996 Unstructured Meshes}, 5997 year = {2001}, 5998 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 5999 url = {http://www.ulg.ac.be/aerodyn}, 6000 petsc_uses = {KSP} 6001} 6002 6003@InProceedings{ knepley98, 6004 author = {Matthew Knepley and Denis Vanderstraeten}, 6005 title = {Parallel Building Blocks for Finite Element Simulations: Application to 6006 Solid-Liquid Mixture Flows}, 6007 booktitle = {Proceedings of Parallel CFD'97}, 6008 publisher = {Elsevier}, 6009 pages = {281--287}, 6010 year = {1998}, 6011 petsc_uses = {KSP} 6012} 6013 6014@InProceedings{ pcfd97, 6015 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6016 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 6017 publisher = {Elsevier}, 6018 year = {1998}, 6019 booktitle = {Proceedings of Parallel CFD'97}, 6020 pages = {333-344}, 6021 petsc_uses = {KSP} 6022} 6023 6024@InProceedings{ knepleysamehsari98, 6025 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6026 title = {Parallel Simulation of Particulate Flows}, 6027 booktitle = {Solving Irregularly Structured Problems in Parallel}, 6028 editors = {A. Ferreira et al}, 6029 year = {1998}, 6030 series = {Lecture Notes in Computer Science}, 6031 volume = {1457}, 6032 pages = {226--237}, 6033 petsc_uses = {KSP} 6034} 6035 6036@Article{ gkmt98, 6037 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 6038 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 6039 Implicit {CFD}}, 6040 journal = {Int. J. High Performance Computing Applications}, 6041 year = {2000}, 6042 volume = {14}, 6043 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 6044 pages = {102-136}, 6045 petsc_uses = {KSP} 6046} 6047 6048@InProceedings{ agkks-sc99, 6049 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 6050 Smith}, 6051 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 6052 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 6053 editor = {}, 6054 publisher = {}, 6055 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 6056 year = {1999}, 6057 note = {Winner of Gordon Bell Special Prize at SC 99}, 6058 petsc_uses = {KSP} 6059} 6060 6061@Article{ gkks01, 6062 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6063 title = {High Performance Parallel Implicit {CFD}}, 6064 journal = {Journal of Parallel Computing}, 6065 year = {2001}, 6066 volume = {27}, 6067 pages = {337-362}, 6068 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 6069 petsc_uses = {KSP} 6070} 6071 6072@Article{ cristea-sofonea-02, 6073 author = {Artur Cristea and Victor Sofonea}, 6074 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 6075 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6076 Sciences, Information Sciences}, 6077 volume = {3}, 6078 number = {3}, 6079 year = {2002}, 6080 petsc_uses = {KSP} 6081} 6082 6083@Article{ cristea2, 6084 author = {Artur Cristea and Victor Sofonea}, 6085 title = {Two component lattice Boltzmann model with flux limiter techniques}, 6086 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 6087 Sciences, Information Sciences}, 6088 volume = {4}, 6089 number = {1}, 6090 year = {2003}, 6091 pages = {59--64}, 6092 petsc_uses = {KSP} 6093} 6094 6095@Article{ cristea1, 6096 author = {Artur Cristea and Victor Sofonea}, 6097 title = {Two component lattice Boltzmann model with flux limiters}, 6098 journal = {Central European Journal of Physics}, 6099 volume = {2}, 6100 number = {2}, 6101 year = {2004}, 6102 pages = {382--396}, 6103 petsc_uses = {KSP} 6104} 6105 6106@Article{ sofnea-lamura1, 6107 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 6108 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 6109 systems}, 6110 journal = {Physical Review E}, 6111 volume = {70}, 6112 number = {4}, 6113 year = {2004}, 6114 pages = {046702-1 / 046702-9}, 6115 petsc_uses = {KSP} 6116} 6117 6118@InProceedings{ gkks01b, 6119 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6120 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 6121 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 6122 Mechanics}, 6123 editor = {}, 6124 location = {Cambridge, MA}, 6125 year = {2001}, 6126 month = jun, 6127 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 6128 petsc_uses = {KSP} 6129} 6130 6131@InProceedings{ gkks00, 6132 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6133 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 6134 Code}, 6135 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 6136 (HiPC '2000)}, 6137 editor = {}, 6138 location = {Bangalore, India}, 6139 year = {2000}, 6140 pages = {395--404}, 6141 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 6142 petsc_uses = {KSP} 6143} 6144 6145@InProceedings{ gkks-sc00, 6146 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6147 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 6148 booktitle = {Proceedings of SC2000}, 6149 editor = {}, 6150 publisher = {IEEE Computer Society}, 6151 year = {2000}, 6152 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 6153 petsc_uses = {KSP} 6154} 6155 6156@InProceedings{ knepleysamehsarin99, 6157 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 6158 title = {Design of Large Scale Parallel Simulations}, 6159 booktitle = {Proceedings of Parallel CFD'99}, 6160 editors = {A. {Ecer et al.}}, 6161 publisher = {Elsevier}, 6162 year = {1999}, 6163 petsc_uses = {KSP} 6164} 6165 6166@InProceedings{ gkks-pcfd99, 6167 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 6168 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 6169 booktitle = {Proceedings of Parallel CFD'99}, 6170 editors = {A. {Ecer et al.}}, 6171 publisher = {Elsevier}, 6172 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 6173 year = {1999}, 6174 petsc_uses = {KSP} 6175} 6176 6177@InProceedings{ kks97, 6178 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6179 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 6180 Parallelization of an Unstructured Grid Incompressible Flow Code}, 6181 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 6182 Methods}, 6183 editor = {J. Mandel et al.}, 6184 pages = {311--319}, 6185 publisher = {Wiley}, 6186 note = {}, 6187 year = {1997}, 6188 petsc_uses = {KSP} 6189} 6190 6191@InProceedings{ kks99, 6192 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6193 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 6194 Incompressible Flows on Unstructured Grids}, 6195 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6196 Methods}, 6197 editors = {C.-H. {Lai et al.}}, 6198 publisher = {Domain Decomposition Press, Bergen}, 6199 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 6200 year = {1999}, 6201 petsc_uses = {KSP} 6202} 6203 6204@InCollection{ kks97_cfd, 6205 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 6206 title = {Perspectives for {CFD} on Petaflops Systems}, 6207 booktitle = {CFD Review 1998}, 6208 editor = {M. Hafez and K. Oshima}, 6209 publisher = {World Scientific, Singapore}, 6210 pages = {1079--1096}, 6211 note = {}, 6212 year = {1998}, 6213 petsc_uses = {KSP} 6214} 6215 6216@Article{ hm99, 6217 author = {P. D. Hovland and L. C. McInnes}, 6218 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 6219 {PETSc}}, 6220 year = {2000}, 6221 journal = {Parallel Computing}, 6222 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 6223 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 6224 petsc_uses = {KSP} 6225} 6226 6227@InProceedings{ cruzbarbaknepley08, 6228 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 6229 title = {Fast Multipole Method for particle interactions: an open source parallel library 6230 component}, 6231 booktitle = {Proceedings of ParCFD2008}, 6232 year = {2008}, 6233 editor = {Tromeur-Dervout et. al.}, 6234 publisher = {Elsevier}, 6235 petsc_uses = {KSP} 6236} 6237 6238@Article{ hwangcai05, 6239 author = {F.-N. Hwang and X.-C. Cai}, 6240 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 6241 for incompressible {Navier-Stokes} equations}, 6242 journal = {J. Comput. Phys.}, 6243 volume = {204}, 6244 year = {2005}, 6245 pages = {666--691}, 6246 petsc_uses = {KSP} 6247} 6248 6249@Article{ barbaleonard07, 6250 author = {Lorena A Barba and Anthony Leonard}, 6251 title = {Emergence and evolution of tripole vortices from net-circulation initial 6252 conditions}, 6253 journal = {Phys. Fluids}, 6254 volume = {19}, 6255 pages = {017101}, 6256 year = {2007}, 6257 doi = {10.1063/1.2409734}, 6258 petsc_uses = {KSP} 6259} 6260 6261@Article{ barba07, 6262 author = {Lorena A Barba}, 6263 title = {Non-shielded multipolar vortices at high Reynolds number}, 6264 journal = {Phys. Rev. E}, 6265 volume = {73}, 6266 pages = {065303}, 6267 year = {2006}, 6268 doi = {10.1103/PhysRevE.73.065303}, 6269 petsc_uses = {KSP} 6270} 6271 6272@Article{ schofield2010multi, 6273 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 6274 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 6275 Lowrie, R.B. and Swartz, B.K.}, 6276 journal = {International Journal for Numerical Methods in Fluids}, 6277 volume = {63}, 6278 number = {8}, 6279 pages = {931--952}, 6280 year = {2010}, 6281 publisher = {Wiley Online Library}, 6282 petsc_uses = {KSP} 6283} 6284 6285% LiteralHTML: 6286% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 6287% LiteralHTML: 6288% LiteralHTML: article{DeGersem99, 6289% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 6290% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 6291% LiteralHTML: } 6292@Article{ nagler2014, 6293 title = {Sound transmission through a poroelastic layered panel}, 6294 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 6295 journal = {Computational Mechanics}, 6296 volume = {53}, 6297 number = {4}, 6298 pages = {549--560}, 6299 issn = {1432-0924}, 6300 doi = {10.1007/s00466-013-0916-x}, 6301 year = {2014}, 6302 petsc_uses = {KSP} 6303} 6304 6305@Article{ sheikh2013, 6306 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 6307 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 6308 deflation}, 6309 journal = {Numerical Linear Algebra with Applications}, 6310 volume = {20}, 6311 number = {4}, 6312 issn = {1099-1506}, 6313 doi = {10.1002/nla.1882}, 6314 pages = {645--662}, 6315 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 6316 analysis}, 6317 year = {2013}, 6318 petsc_uses = {KSP} 6319} 6320 6321@InProceedings{ silence, 6322 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 6323 Fuenmayor}, 6324 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 6325 Application to the study of acoustic behaviour of silencers}, 6326 year = {2004}, 6327 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 6328 (ECCOMAS)}, 6329 petsc_uses = {KSP} 6330} 6331 6332@Article{ degersem99, 6333 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 6334 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 6335 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 6336 journal = {COMPEL}, 6337 year = {1999}, 6338 volume = {18}, 6339 number = {3}, 6340 pages = {298--310}, 6341 bibdate = {}, 6342 petsc_uses = {KSP} 6343} 6344 6345@InProceedings{ widlund-wave-98, 6346 author = {Olof B. Widlund}, 6347 title = {Schwarz Methods for {H}elmholtz's Equation}, 6348 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6349 editor = {John A. DeSanto}, 6350 year = {1998}, 6351 publisher = {SIAM}, 6352 pages = {620--622}, 6353 address = {Philadelphia}, 6354 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6355 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6356 petsc_uses = {KSP} 6357} 6358 6359@InProceedings{ toselli-wave-98, 6360 author = {Andrea Toselli}, 6361 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 6362 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6363 editor = {John A. DeSanto}, 6364 year = {1998}, 6365 publisher = {SIAM}, 6366 address = {Philadelphia}, 6367 pages = {540--542}, 6368 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6369 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6370 petsc_uses = {KSP} 6371} 6372 6373@InProceedings{ mcinnes-wave-98, 6374 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 6375 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 6376 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6377 editor = {John A. DeSanto}, 6378 year = {1998}, 6379 publisher = {SIAM}, 6380 address = {Philadelphia}, 6381 pages = {623--625}, 6382 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6383 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6384 petsc_uses = {KSP} 6385} 6386 6387@InProceedings{ mska98, 6388 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 6389 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 6390 Parallel Computation of {H}elmholtz Problems}, 6391 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6392 editor = {J. Mandel et al.}, 6393 publisher = {AMS}, 6394 pages = {349--357}, 6395 year = {1998}, 6396 petsc_uses = {KSP} 6397} 6398 6399@InProceedings{ ccew98, 6400 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 6401 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 6402 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6403 editor = {J. Mandel et al.}, 6404 publisher = {AMS}, 6405 pages = {437-445}, 6406 year = {1998}, 6407 petsc_uses = {KSP} 6408} 6409 6410@InProceedings{ ra98a, 6411 author = {R. Susan-Resiga and H. M. Atassi}, 6412 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 6413 Problems}, 6414 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 6415 publisher = {AIAA}, 6416 pages = {86-96}, 6417 note = {AIAA paper 98-2218}, 6418 year = {1998}, 6419 petsc_uses = {KSP} 6420} 6421 6422@InProceedings{ ar98c, 6423 author = {H. M. Atassi and R. Susan-Resiga}, 6424 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 6425 General Formulation}, 6426 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6427 publisher = {ASME}, 6428 note = {NCA-25}, 6429 pages = {375-379}, 6430 year = {1998}, 6431 petsc_uses = {KSP} 6432} 6433 6434@InProceedings{ ra98b, 6435 author = {R. Susan-Resiga and H. M. Atassi}, 6436 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 6437 Numerical Implementation and Applications}, 6438 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6439 publisher = {ASME}, 6440 note = {NCA-25}, 6441 pages = {381 -388}, 6442 year = {1998}, 6443 petsc_uses = {KSP} 6444} 6445 6446@InProceedings{ cai-dd10-98, 6447 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 6448 Widlund}, 6449 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 6450 booktitle = {Domain Decomposition Methods 10}, 6451 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 6452 series = {Contemporary Mathematics}, 6453 volume = {218}, 6454 publisher = {American Mathematical Society}, 6455 address = {Providence, Rhode Island}, 6456 year = {1998}, 6457 pages = {437--445}, 6458 petsc_uses = {KSP} 6459} 6460 6461@InProceedings{ alghamdi2011petclaw, 6462 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 6463 booktitle = {Proceedings of SpringSim 2011}, 6464 publisher = {ACM}, 6465 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 6466 Kyle T. Mandli and Lisandro Dalcin}, 6467 year = {2011}, 6468 petsc_uses = {KSP} 6469} 6470 6471@Article{ pyclaw2012, 6472 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 6473 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 6474 Emmett}, 6475 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 6476 journal = {SIAM Journal on Scientific Computing}, 6477 volume = {34}, 6478 number = {4}, 6479 pages = {C210--C231}, 6480 note = {\url{http://arxiv.org/abs/1111.6583}}, 6481 year = {2012}, 6482 petsc_uses = {KSP} 6483} 6484 6485% LiteralHTML: 6486% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 6487% LiteralHTML: 6488@Article{ sojkahorakhaplacermak2018, 6489 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 6490 decomposition method}, 6491 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 6492 journal = {Applied Mathematics and Computation}, 6493 volume = {319}, 6494 pages = {586--597}, 6495 year = {2018}, 6496 petsc_uses = {KSP} 6497} 6498 6499@Article{ chencai2014, 6500 title = {A parallel two-level domain decomposition based one-shot method for shape 6501 optimization problems}, 6502 author = {Rongliang Chen and Xiao‐Chuan Cai}, 6503 journal = {International Journal for Numerical Methods in Engineering}, 6504 volume = {99}, 6505 number = {13}, 6506 year = {2014}, 6507 doi = {10.1002/nme.4711}, 6508 petsc_uses = {KSP} 6509} 6510 6511@PhDThesis{ prudencio2005, 6512 author = {Ernesto Prudencio}, 6513 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 6514 for Optimization Problems Constrained by Partial Differential Equations}, 6515 school = {University of Colorado, Boulder}, 6516 year = {2005}, 6517 petsc_uses = {KSP} 6518} 6519 6520@Article{ prudenciocai2007, 6521 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 6522 for {PDE}-constrained optimization}, 6523 author = {Ernesto Prudencio and X. C. Cai}, 6524 journal = {SIAM J. Sci. Comp.}, 6525 volume = {29}, 6526 number = {3}, 6527 pages = {964--985}, 6528 year = {2007}, 6529 petsc_uses = {KSP} 6530} 6531 6532@Article{ prudenciobyrdcai2006, 6533 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6534 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 6535 {PDE}-constrained Optimization Problems}, 6536 journal = {SIAM J. Sci. Comp.}, 6537 volume = {27}, 6538 pages = {1305--1328}, 6539 year = {2006}, 6540 petsc_uses = {KSP} 6541} 6542 6543@InProceedings{ prudenciobyrdcai2004, 6544 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 6545 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6546 booktitle = {VECPAR 2004}, 6547 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 6548 publisher = {Springer}, 6549 pages = {569--582}, 6550 year = {2004}, 6551 petsc_uses = {KSP} 6552} 6553 6554@Article{ belhamadia-fortin-pcp, 6555 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 6556 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 6557 journal = {Journal of Computational Physics}, 6558 volume = {201}, 6559 pages = {753-770}, 6560 year = {2004}, 6561 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 6562 petsc_uses = {KSP} 6563} 6564 6565@Article{ biros00, 6566 author = {George Biros and Omar Ghattas}, 6567 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 6568 journal = {SIAG-Opt Views and News}, 6569 volume = {11}, 6570 number = {2}, 6571 year = {2000}, 6572 month = aug, 6573 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 6574 petsc_uses = {KSP} 6575} 6576 6577@Article{ bmm01, 6578 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 6579 journal = {ACM Transactions on Mathematical Software}, 6580 title = {A case study in the performance and scalability of optimization algorithms}, 6581 year = {2001}, 6582 volume = {27}, 6583 number = {3}, 6584 pages = {361--376}, 6585 petsc_uses = {KSP} 6586} 6587 6588@InProceedings{ oghattas1999, 6589 author = {George Biros and Omar Ghattas}, 6590 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 6591 incompressible flows}, 6592 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 6593 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 6594 year = {1999}, 6595 petsc_uses = {KSP} 6596} 6597 6598@InProceedings{ hkms00, 6599 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 6600 PDE-constrained Optimization}, 6601 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 6602 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 6603 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 6604 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 6605 Hasco\"{e}t and Uwe Naumann}, 6606 publisher = {Springer}, 6607 year = {2002}, 6608 petsc_uses = {KSP} 6609} 6610 6611% old version: replace with biros2005pln1 6612@TechReport{ bg011, 6613 author = {George Biros and Omar Ghattas}, 6614 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 6615 Part I: The Krylov-Schur Solver}, 6616 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6617 year = {2001}, 6618 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 6619 petsc_uses = {KSP} 6620} 6621 6622% old version: replace with biros2005pln2 6623@TechReport{ bg012, 6624 author = {George Biros and Omar Ghattas}, 6625 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 6626 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 6627 Optimal Control of Steady Viscous Flows}, 6628 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6629 year = {2001}, 6630 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 6631 petsc_uses = {KSP} 6632} 6633 6634% LiteralHTML: 6635% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 6636% LiteralHTML: 6637@InProceedings{ ly2003, 6638 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 6639 title = {A New Parallel Kernel-independent Fast Multipole Method}, 6640 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 6641 year = {2003}, 6642 note = {Winner of the Best Student Paper at SC2003}, 6643 petsc_uses = {KSP} 6644} 6645 6646@Article{ yokotabarbaknepley10, 6647 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 6648 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 6649 journal = {Computer Methods in Applied Mechanics and Engineering}, 6650 volume = {199}, 6651 number = {25-28}, 6652 pages = {1793--1804}, 6653 url = {http://arxiv.org/abs/0909.5413v1}, 6654 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 6655 year = {2010}, 6656 petsc_uses = {KSP} 6657} 6658 6659@Article{ cruzknepleybarba10, 6660 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 6661 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 6662 journal = {International Journal of Numerical Methods in Engineering}, 6663 volume = {85}, 6664 number = {4}, 6665 pages = {403--428}, 6666 url = {http://arxiv.org/abs/0905.2637}, 6667 note = {\url{http://arxiv.org/abs/0905.2637}}, 6668 year = {2010}, 6669 petsc_uses = {KSP} 6670} 6671 6672% LiteralHTML: 6673% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 6674% LiteralHTML: 6675@Article{ buchanpainumplebysmedleystevenson2012, 6676 title = {A sub-grid scale finite element agglomeration multigrid method with application 6677 to the Boltzmann transport equation}, 6678 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 6679 journal = {International Journal for Numerical Methods in Engineering}, 6680 volume = {92}, 6681 number = {3}, 6682 pages = {318--342}, 6683 year = {2012}, 6684 publisher = {Wiley Online Library}, 6685 petsc_uses = {KSP} 6686} 6687 6688@Article{ magoulesahamedsuzuki2015, 6689 title = {Green computing on graphics processing units}, 6690 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 6691 journal = {Concurrency and Computation: Practice and Experience}, 6692 year = {2015}, 6693 publisher = {Wiley Online Library}, 6694 petsc_uses = {KSP} 6695} 6696 6697@InProceedings{ yanrhodes11, 6698 author = {Yan, Baoqiang and Rhodes, Philip J.}, 6699 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 6700 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 6701 series = {ICPP '11}, 6702 pages = {355--364}, 6703 year = {2011}, 6704 isbn = {978-0-7695-4510-3}, 6705 numpages = {10}, 6706 doi = {10.1109/ICPP.2011.70}, 6707 acmid = {2066965}, 6708 publisher = {IEEE Computer Society}, 6709 address = {Washington, DC, USA}, 6710 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 6711 petsc_uses = {KSP} 6712} 6713 6714@Article{ hakansson2013mdstochasticliouville, 6715 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 6716 Stulz, Eugen}, 6717 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 6718 equation study}, 6719 journal = {Phys. Chem. Chem. Phys.}, 6720 year = {2013}, 6721 volume = {15}, 6722 issue = {26}, 6723 pages = {10930-10941}, 6724 publisher = {The Royal Society of Chemistry}, 6725 doi = {10.1039/C3CP50788B}, 6726 petsc_uses = {KSP} 6727} 6728 6729@Article{ hakansson2011stochasticliouville, 6730 author = {Hakansson, Par and Nair, Prasanth B.}, 6731 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 6732 form}, 6733 journal = {Phys. Chem. Chem. Phys.}, 6734 year = {2011}, 6735 volume = {13}, 6736 issue = {20}, 6737 pages = {9578-9589}, 6738 publisher = {The Royal Society of Chemistry}, 6739 doi = {10.1039/C1CP20400A}, 6740 petsc_uses = {KSP} 6741} 6742 6743@InProceedings{ wang:lee:scidac2011, 6744 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 6745 McInnes and Todd Munson and Barry Smith}, 6746 title = {A Differential Variational Inequality Approach for the Simulation of 6747 Heterogeneous Materials}, 6748 booktitle = {Proceedings of SciDAC 2011 Conference}, 6749 year = {2011}, 6750 petsc_uses = {KSP} 6751} 6752 6753@Article{ bourdinlarsenrichardson2011, 6754 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 6755 title = {A time-discrete model for dynamic fracture based on crack regularization}, 6756 journal = {International Journal of Fracture}, 6757 volume = {168}, 6758 issue = {2}, 6759 pages = {133--143}, 6760 doi = {10.1007/s10704-010-9562-x}, 6761 year = {2011}, 6762 petsc_uses = {KSP} 6763} 6764 6765@Article{ bourdinfrancfortmarigo2008, 6766 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 6767 title = {The Variational Approach to Fracture}, 6768 journal = {J. Elasticity}, 6769 volume = {91}, 6770 issue = {1}, 6771 pages = {1--148}, 6772 doi = {10.1007/s10659-007-9107-3}, 6773 year = {2008}, 6774 petsc_uses = {KSP} 6775} 6776 6777@Article{ lahtinen2008spectrum, 6778 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 6779 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 6780 J.K.}, 6781 journal = {Annals of Physics}, 6782 volume = {323}, 6783 number = {9}, 6784 pages = {2286--2310}, 6785 year = {2008}, 6786 publisher = {Elsevier}, 6787 petsc_uses = {KSP} 6788} 6789 6790@InProceedings{ roark2004discriminative, 6791 title = {Discriminative language modeling with conditional random fields and the 6792 perceptron algorithm}, 6793 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 6794 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 6795 Linguistics}, 6796 pages = {47}, 6797 year = {2004}, 6798 organization = {Association for Computational Linguistics}, 6799 petsc_uses = {KSP} 6800} 6801 6802@Article{ roark2007discriminative, 6803 title = {Discriminative n-gram language modeling}, 6804 author = {Roark, B. and Saraclar, M. and Collins, M.}, 6805 journal = {Computer Speech \& Language}, 6806 volume = {21}, 6807 number = {2}, 6808 pages = {373--392}, 6809 year = {2007}, 6810 publisher = {Elsevier}, 6811 petsc_uses = {KSP} 6812} 6813 6814@Conference{ garcia2011parallel, 6815 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 6816 nanodevice simulators}}, 6817 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 6818 Aldegunde, M.}, 6819 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 6820 pages = {1--4}, 6821 organization = {IEEE}, 6822 petsc_uses = {KSP} 6823} 6824 6825@Conference{ wesley2006parallel, 6826 title = {{A parallel artificial neural network implementation}}, 6827 author = {Wesley-Smith, I.}, 6828 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 6829 year = {2006}, 6830 petsc_uses = {KSP} 6831} 6832 6833@Article{ hcsw1, 6834 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 6835 title = {Parallel {N}ewton--{K}rylov--{S}chwarz algorithms for the three-dimensional 6836 {P}oisson--{B}oltzmann equation in numerical simulation of colloidal particle 6837 interactions}, 6838 journal = {Computer Physics Communications}, 6839 volumne = {181}, 6840 year = {2010}, 6841 pages = {1529--1537}, 6842 petsc_uses = {KSP} 6843} 6844 6845@Article{ hh1, 6846 author = {C.-Y. Huang and F.-N. Hwang}, 6847 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 6848 bifurcation analysis of incompressible sudden expansion flows}, 6849 journal = {Applied Numerical Mathematics}, 6850 volume = {60}, 6851 year = {2010}, 6852 pages = {738--751}, 6853 petsc_uses = {KSP} 6854} 6855 6856@Article{ hwhw1, 6857 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 6858 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 6859 polynomial eigenvalue problems in quantum dot simulation}, 6860 journal = {Journal of Computational Physics}, 6861 volume = {229}, 6862 year = {2010}, 6863 pages = {2932--2947}, 6864 petsc_uses = {KSP} 6865} 6866 6867@Article{ wei2011parallel, 6868 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 6869 Application in Quantum Dot Simulation}}, 6870 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 6871 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 6872 pages = {157--164}, 6873 year = {2011}, 6874 publisher = {Springer}, 6875 petsc_uses = {KSP} 6876} 6877 6878@Article{ flores2007sequential, 6879 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 6880 equation using second-degree iterative methods}}, 6881 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 6882 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 6883 pages = {426--438}, 6884 year = {2007}, 6885 publisher = {Springer}, 6886 petsc_uses = {KSP} 6887} 6888 6889@InProceedings{ gordonbell09, 6890 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 6891 Siegel and Won Sik Yang}, 6892 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 6893 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 6894 note = {{SC'09 Gordon Bell} Prize Finalist}, 6895 year = {2009}, 6896 petsc_uses = {KSP} 6897} 6898 6899@Article{ knepleykarpeevdavidovitseisenberggillespie10, 6900 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 6901 Eisenberg and Dirk Gillespie}, 6902 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 6903 Dimensions: Ionic Solutions}, 6904 journal = {Journal of Physical Chemistry}, 6905 volume = {132}, 6906 number = {12}, 6907 pages = {124101--124111}, 6908 url = {http://arxiv.org/abs/0910.1531}, 6909 year = {2010}, 6910 petsc_uses = {KSP} 6911} 6912 6913@Article{ knepleykarpeeveisenberggillespie09, 6914 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 6915 D.}, 6916 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 6917 Functional Theory Approach}}, 6918 journal = {Biophysical Journal}, 6919 month = feb, 6920 volume = {96}, 6921 pages = {661}, 6922 doi = {10.1016/j.bpj.2008.12.3494}, 6923 year = {2009}, 6924 petsc_uses = {KSP} 6925} 6926 6927@Article{ scx2008, 6928 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 6929 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 6930 CONCRETE}, 6931 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 6932 volume = {3}, 6933 number = {4}, 6934 year = {2006}, 6935 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 6936 petsc_uses = {KSP} 6937} 6938 6939@TechReport{ kdgs2008, 6940 year = {2008}, 6941 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 6942 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 6943 Chips}, 6944 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 6945 Stortia}, 6946 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 6947 petsc_uses = {KSP} 6948} 6949 6950@Article{ springerlink:10.1007/s10915-011-9551-x, 6951 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 6952 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 6953 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 6954 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 6955 Coupled FEM/SBFEM Approach}, 6956 journal = {Journal of Scientific Computing}, 6957 publisher = {Springer Netherlands}, 6958 issn = {0885-7474}, 6959 keyword = {Mathematics and Statistics}, 6960 pages = {1-22}, 6961 doi = {10.1007/s10915-011-9551-x}, 6962 petsc_uses = {KSP} 6963} 6964 6965@TechReport{ jj2007, 6966 author = {Boris Jeremic and Guanzhou Jie}, 6967 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 6968 Problems Report}, 6969 institution = {UCD CompGeoMech 02--2007}, 6970 year = {2007}, 6971 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 6972 petsc_uses = {KSP} 6973} 6974 6975@Unpublished{ kuiper08, 6976 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 6977 author = {Rolf Kuiper}, 6978 institution = {Max-Planck-Institute for Astronomy}, 6979 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 6980 year = {2008}, 6981 petsc_uses = {KSP} 6982} 6983 6984@Article{ williamson2012multidimensional, 6985 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 6986 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 6987 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 6988 journal = {Journal of Nuclear Materials}, 6989 volume = {423}, 6990 number = {1}, 6991 pages = {149--163}, 6992 year = {2012}, 6993 publisher = {Elsevier}, 6994 petsc_uses = {KSP} 6995} 6996 6997@InProceedings{ kucukboyaci2015cobra, 6998 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 6999 analysis}, 7000 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 7001 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 7002 Nuclear Applications and the Monte Carlo Method}, 7003 pages = {1--18}, 7004 year = {2015}, 7005 petsc_uses = {KSP} 7006} 7007 7008@Article{ hales2012solving, 7009 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 7010 {K}rylov Method}, 7011 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 7012 M.R.}, 7013 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 7014 volume = {84}, 7015 number = {2}, 7016 pages = {123--153}, 7017 year = {2012}, 7018 publisher = {Tech Science Press}, 7019 petsc_uses = {KSP} 7020} 7021 7022@InProceedings{ srksyp2008, 7023 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 7024 Palmiotti}, 7025 title = {Fast reactor core simulations using the {UNIC} code}, 7026 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 7027 Power: A Sustainable Resource}, 7028 year = {2008}, 7029 petsc_uses = {KSP} 7030} 7031 7032@InProceedings{ psrlkssl2007, 7033 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 7034 Siegel and B. Smith and E. E. Lewis}, 7035 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 7036 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7037 Supercomputing in Nuclear Applications}, 7038 year = {2007}, 7039 petsc_uses = {KSP} 7040} 7041 7042@InProceedings{ sprkssl2007, 7043 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 7044 Smith and E. E. Lewis}, 7045 title = {{PNFE} Component of the {UNIC} Code}, 7046 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 7047 Supercomputing in Nuclear Applications}, 7048 year = {2007}, 7049 petsc_uses = {KSP} 7050} 7051 7052@InProceedings{ dc-oop-03, 7053 author = {H. Digonnet and T. Coupez}, 7054 title = {Object-oriented programming for fast-and-easy development of parallel 7055 applications in forming processes simulation}, 7056 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 7057 Mechanics}, 7058 year = {2003}, 7059 petsc_uses = {KSP} 7060} 7061 7062@InProceedings{ dc-cfm-03, 7063 author = {H. Digonnet and T. Coupez}, 7064 title = {Calcul parallele en mise en forme des materiaux}, 7065 booktitle = {XVIeme Congres Francais de Mecanique}, 7066 year = {2003}, 7067 petsc_uses = {KSP} 7068} 7069 7070@InProceedings{ dsc-pcsev-04, 7071 author = {H. Digonnet and L. Silva and T. Coupez}, 7072 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 7073 booktitle = {Proceedings of ECCOMAS 2004}, 7074 year = {2004}, 7075 petsc_uses = {KSP} 7076} 7077 7078@InProceedings{ dsc-pca3fs-04, 7079 author = {H. Digonnet and L. Silva and T. Coupez}, 7080 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 7081 booktitle = {Proceedings of WCCM VI}, 7082 year = {2004}, 7083 petsc_uses = {KSP} 7084} 7085 7086@InProceedings{ dbcs-cpaac-05, 7087 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 7088 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 7089 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 7090 year = {2005}, 7091 petsc_uses = {KSP} 7092} 7093 7094@Article{ sz2010, 7095 author = {B. Smith and H. Zhang}, 7096 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 7097 Performance}, 7098 journal = {International Journal of High Performance Computing Applications}, 7099 volume = {25}, 7100 number = {4}, 7101 pages = {386--391}, 7102 year = {2011}, 7103 petsc_uses = {KSP} 7104} 7105 7106@Article{ zssz2006, 7107 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 7108 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 7109 journal = {TOMS}, 7110 url = {http://math.nist.gov/toms/Current.html#v33n2}, 7111 volumne = {33}, 7112 number = {2}, 7113 year = {2007}, 7114 petsc_uses = {KSP} 7115} 7116 7117@Article{ gs2006, 7118 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 7119 title = {The detachment of a viscous drop in a viscous solution in the presence of a 7120 soluble surfactant}, 7121 journal = {Phys. Fluids}, 7122 volume = {18}, 7123 year = {2006}, 7124 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 7125 petsc_uses = {KSP} 7126} 7127 7128@Article{ jmemsci, 7129 author = {Bo Zhou and Adam Powell}, 7130 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 7131 of Polymeric Membranes in 2D and 3D}, 7132 journal = {J. Membrane Sci.}, 7133 volume = {268}, 7134 number = {2}, 7135 pages = {150--164}, 7136 year = {2006}, 7137 month = jan, 7138 day = {15}, 7139 doi = {10.1016/j.memsci.2005.05.030}, 7140 petsc_uses = {KSP} 7141} 7142 7143@InProceedings{ vbde2002, 7144 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 7145 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 7146 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 7147 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7148 year = {2002}, 7149 petsc_uses = {KSP} 7150} 7151 7152@InProceedings{ wid2005, 7153 author = {Alexander I. Bobenko and Peter Schrader}, 7154 title = {Discrete Willmore Flow}, 7155 booktitle = {Eurographics Symposium on Geometry Processing}, 7156 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 7157 year = {2005}, 7158 editor = {M. Desbrun and H. Pottmann}, 7159 petsc_uses = {KSP} 7160} 7161 7162@Article{ stj2003, 7163 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 7164 journal = {International Journal for Numerical Methods in Fluids}, 7165 volume = {41}, 7166 issue = {4}, 7167 title = {A numerical method for inverse design based on the inverse Euler equations}, 7168 year = {2003}, 7169 pages = {339--355}, 7170 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 7171 petsc_uses = {KSP} 7172} 7173 7174@PhDThesis{ as2001, 7175 author = {ANDREA SCASCIGHINI}, 7176 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 7177 Inverse Euler Equations}, 7178 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 7179 year = {2001}, 7180 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 7181 petsc_uses = {KSP} 7182} 7183 7184@Article{ hb2005, 7185 author = {E. McKay Hyde and Oscar P. Bruno}, 7186 journal = {Journal of Computational Physics}, 7187 volume = {202}, 7188 title = {A fast, higher-order solver for scattering by penetrable bodies in three 7189 dimensions}, 7190 year = {2005}, 7191 pages = {236--261}, 7192 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 7193 petsc_uses = {KSP} 7194} 7195 7196@MastersThesis{ d2002, 7197 author = {Matthew F Dixon}, 7198 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 7199 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 7200 school = {READING UNIVERSITY}, 7201 year = {2002}, 7202 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 7203 petsc_uses = {KSP} 7204} 7205 7206@TechReport{ gzb, 7207 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 7208 title = {Fast Parallel PageRank: A Linear System Approach}, 7209 institution = {Stanford University}, 7210 year = {2004}, 7211 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 7212 petsc_uses = {KSP} 7213} 7214 7215@PhDThesis{ yergeau-99, 7216 author = {Daniel W. Yergeau}, 7217 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 7218 SEMICONDUCTORS}, 7219 school = {Stanford}, 7220 year = {1999}, 7221 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 7222 petsc_uses = {KSP} 7223} 7224 7225@InProceedings{ rathkopf-miller-00, 7226 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 7227 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 7228 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 7229 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 7230 year = {2000}, 7231 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 7232 Physics and Mathematics and Computation into the Next Millennium}, 7233 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 7234 lab = {LLNL}, 7235 petsc_uses = {KSP} 7236} 7237 7238@Article{ bonfi-palma-pas-05, 7239 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 7240 journal = {Journal of Turbomachinery}, 7241 volume = {127}, 7242 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 7243 year = {2005}, 7244 pages = {395-401}, 7245 petsc_uses = {KSP} 7246} 7247 7248@InProceedings{ fettig-sobh-05, 7249 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 7250 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 7251 year = {2005}, 7252 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 7253 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 7254 petsc_uses = {KSP} 7255} 7256 7257@TechReport{ melnikov-matagne-05, 7258 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 7259 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 7260 title = {Spin configurations in circular and rectangular vertical quantum dots in a 7261 magnetic field: Three-dimensional self-consistent simulation}, 7262 year = {2005}, 7263 number = {Arxiv preprint cond-mat/0506585}, 7264 url = {http://arxiv.org/pdf/cond-mat/0506585}, 7265 petsc_uses = {KSP} 7266} 7267 7268@InProceedings{ richard-smedley-03, 7269 author = {Richard P. Smedley-Stevenson}, 7270 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 7271 year = {2003}, 7272 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 7273 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 7274 petsc_uses = {KSP} 7275} 7276 7277@Article{ guan-godoy-ravaioli-03, 7278 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 7279 journal = {Journal of Computational Electronics}, 7280 volume = {2}, 7281 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 7282 for Transport in a Silicon Quantum Wire Structure}, 7283 year = {2003}, 7284 pages = {335--339}, 7285 petsc_uses = {KSP} 7286} 7287 7288@Article{ ovtchinnikovcai04, 7289 author = {S. Ovtchinnikov and X.-C. Cai}, 7290 journal = {Numer. Lin. Alg. Applics}, 7291 volume = {11}, 7292 title = {One-level {N}ewton--{K}rylov--{S}chwarz algorithm for unsteady nonlinear radiation 7293 diffusion problem}, 7294 year = {2004}, 7295 pages = {867--881}, 7296 petsc_uses = {KSP} 7297} 7298 7299@Article{ mixedstress, 7300 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 7301 author = {Adam Powell and David Dussault}, 7302 journal = {Appl. Numer. Anal. Comp. Math.}, 7303 volume = {2}, 7304 number = {1}, 7305 year = {2005}, 7306 pages = {157--166}, 7307 petsc_uses = {KSP} 7308} 7309 7310@Article{ dhh2005, 7311 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 7312 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 7313 journal = {International Journal for Computation and Mathematics in Electrical and 7314 Electronic Engineering (COMPEL)}, 7315 year = {2005}, 7316 petsc_uses = {KSP} 7317} 7318 7319@Article{ dhh2004, 7320 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 7321 title = {Finite element modelling of ion convection by electrostatic forces}, 7322 journal = {IEE Proceedings Science, Measurement and Technology}, 7323 year = {2004}, 7324 volume = {151}, 7325 number = {6}, 7326 petsc_uses = {KSP} 7327} 7328 7329@Article{ adams-07b, 7330 author = {Adams M.F.}, 7331 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 7332 Frequency Response Analysis in Solid Mechanics}, 7333 journal = {Computional Mechanics}, 7334 year = {2007}, 7335 volume = {39}, 7336 number = {4}, 7337 pages = {497-507}, 7338 petsc_uses = {KSP} 7339} 7340 7341@InProceedings{ wc2004, 7342 author = {A. Wheelock and D. Cooke}, 7343 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 7344 Dimensions}, 7345 year = {2004}, 7346 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 7347 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 7348 petsc_uses = {KSP} 7349} 7350 7351@InProceedings{ allard-gouranton-ipts2002, 7352 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 7353 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 7354 year = {2002}, 7355 booktitle = {Immersive Projection Technology Symposium}, 7356 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 7357 petsc_uses = {KSP} 7358} 7359 7360@Article{ icc, 7361 author = {D Ioan and G Ciuprina and C Ciobotaru}, 7362 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 7363 journal = {IEEE Transactions on Magnetics}, 7364 year = {2000}, 7365 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 7366 petsc_uses = {KSP} 7367} 7368 7369@InProceedings{ hs1, 7370 author = {Brian J. Henz and Dale R. Shires}, 7371 title = {Development and Performance Analysis of a Parallel Finite Element Application 7372 Implemented in an Object-Oriented Programming Framework}, 7373 year = {2003}, 7374 booktitle = {PDPTA 2003}, 7375 pages = {1286-1292}, 7376 note = {Resin Transfer Modeling}, 7377 petsc_uses = {KSP} 7378} 7379 7380@TechReport{ b2000, 7381 author = {Rickard Bergstrom}, 7382 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 7383 year = {2000}, 7384 institution = {Chalmers}, 7385 number = {2000-05}, 7386 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 7387 petsc_uses = {KSP} 7388} 7389 7390@Article{ fs2004, 7391 author = {Petri Fast and Michael J. Shelley}, 7392 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 7393 Shaw Flow}, 7394 journal = {Journal of Computational Physics}, 7395 year = {2004}, 7396 volume = {195}, 7397 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 7398 pages = {117-142}, 7399 petsc_uses = {KSP} 7400} 7401 7402@MastersThesis{ wallach, 7403 author = {Hanna Wallach}, 7404 title = {Efficient Training of Conditional Random Fields}, 7405 school = {University of Edinburgh}, 7406 year = {2002}, 7407 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 7408 }osborne/msc-projects/wallach.ps.gz}, 7409 petsc_uses = {KSP} 7410} 7411 7412@Article{ something, 7413 author = {T Rylander and A Bondeson}, 7414 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 7415 equations}, 7416 journal = {Journal of Computational Physics}, 7417 year = {2002}, 7418 volume = {179}, 7419 pages = {426-438}, 7420 petsc_uses = {KSP} 7421} 7422 7423@TechReport{ uf1, 7424 author = {Uwe Fabricius}, 7425 title = {Comparison of two implementations of {AMG}-preconditioned {CG} considering an 7426 electrostatic problem}, 7427 year = {2004}, 7428 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 7429 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 7430 number = {04-1}, 7431 petsc_uses = {KSP} 7432} 7433 7434@InBook{ sg1, 7435 author = {Natalia Seoane and A.J.Garca-Loureiro}, 7436 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 7437 Equation}, 7438 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 7439 title = {Lecture Notes in Computer Science}, 7440 publisher = {Springer-Verlag}, 7441 volume = {3037}, 7442 year = {2004}, 7443 petsc_uses = {KSP} 7444} 7445 7446@Article{ nikyilmazgivisheikhipope10, 7447 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 7448 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 7449 journal = {AIAA Journal}, 7450 volume = {48}, 7451 number = {7}, 7452 pages = {1513--1522}, 7453 year = {2010}, 7454 petsc_uses = {KSP} 7455} 7456 7457@Article{ nikyilmazsheikhigivi10, 7458 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 7459 title = {Grid Resolution Effects on VSFMDF/LES}, 7460 journal = {Flow, Turbulence and Combustion}, 7461 doi = {10.1007/s10494-010-9272-5}, 7462 year = {2010}, 7463 petsc_uses = {KSP} 7464} 7465 7466@Article{ idema2013towards, 7467 title = {Towards faster solution of large power flow problems}, 7468 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 7469 and van der Sluis, Lou}, 7470 journal = {Power Systems, IEEE Transactions on}, 7471 volume = {28}, 7472 number = {4}, 7473 pages = {4918--4925}, 7474 year = {2013}, 7475 publisher = {IEEE}, 7476 petsc_uses = {KSP} 7477} 7478 7479@Article{ 6026245, 7480 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 7481 journal = {Power Systems, IEEE Transactions on}, 7482 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 7483 year = {2012}, 7484 month = feb, 7485 volume = {27}, 7486 number = {1}, 7487 pages = {390-396}, 7488 doi = {10.1109/TPWRS.2011.2165860}, 7489 issn = {0885-8950}, 7490 petsc_uses = {KSP} 7491} 7492 7493@Book{ idema2014computational, 7494 title = {Computational Methods in Power System Analysis}, 7495 author = {Idema, Reijer and Lahaye, Domenico JP}, 7496 year = {2014}, 7497 publisher = {Springer}, 7498 petsc_uses = {KSP} 7499} 7500 7501@PhDThesis{ abhyankar2011thesis, 7502 author = {Shrirang Abhyankar}, 7503 title = {Development of an implicitly coupled electromechanical and electromagnetic 7504 transients simulator for power systems}, 7505 school = {Illinois Institute of Technology}, 7506 year = {2011}, 7507 petsc_uses = {KSP} 7508} 7509 7510@InProceedings{ abhyankarhipcna11-1, 7511 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 7512 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 7513 year = {2011}, 7514 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7515 Networking and Analytics for the Power Grid}, 7516 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 7517 publisher = {ACM}, 7518 petsc_uses = {KSP} 7519} 7520 7521@InProceedings{ abhyankarhipcna11-2, 7522 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 7523 title = {Development of a parallel three-phase transient stability simulator for power 7524 systems}, 7525 year = {2011}, 7526 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7527 Networking and Analytics for the Power Grid}, 7528 publisher = {ACM}, 7529 petsc_uses = {KSP} 7530} 7531 7532@InProceedings{ abhyankarpesgeneral2012, 7533 author = {Shrirang Abhyankar and A. Flueck}, 7534 title = {An implicitly-coupled solution approach for combined electromechanical and 7535 electromagnetic transients simulation}, 7536 year = {2012}, 7537 booktitle = {Proceedings of the IEEE PES General Meeting}, 7538 publisher = {IEEE}, 7539 petsc_uses = {KSP} 7540} 7541 7542@Article{ idemalahayevuiksluis2012, 7543 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 7544 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 7545 journal = {IEEE Transactions on Power Systems}, 7546 year = {2012}, 7547 volume = {27}, 7548 pages = {390-396}, 7549 petsc_uses = {KSP} 7550} 7551 7552@Article{ korrestzavellasgalinas2013, 7553 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 7554 title = {A distributed implementation of multi-area power system state estimation on a 7555 cluster of computers }, 7556 journal = {Electric Power Systems Research }, 7557 volume = {102}, 7558 number = {0}, 7559 pages = {20 - 32}, 7560 year = {2013}, 7561 issn = {0378-7796}, 7562 doi = {10.1016/j.epsr.2013.04.002}, 7563 petsc_uses = {KSP} 7564} 7565 7566% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7567% LiteralHTML:<font color="#FF0000"> 7568% LiteralHTML: Material failure, for example, cracking of steel beams resulting 7569% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 7570% LiteralHTML: are important for prediction and prevention. PETSc has been used 7571% LiteralHTML: in a variety of studies of material failure.</p> 7572% LiteralHTML:</font> 7573% LiteralHTML: 7574@InProceedings{ gray2, 7575 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 7576 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 7577 year = {2004}, 7578 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 7579 petsc_uses = {KSP} 7580} 7581 7582@InProceedings{ gray1, 7583 author = {J. Gray and C. Homescu and L. Petzold and Richard Alkire}, 7584 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 7585 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 7586 year = {2003}, 7587 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 7588 petsc_uses = {KSP} 7589} 7590 7591@InProceedings{ crack2, 7592 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 7593 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 7594 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 7595 Conference}, 7596 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 7597 year = {2003}, 7598 petsc_uses = {KSP} 7599} 7600 7601@TechReport{ hdams1, 7602 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 7603 Lynd Stringer}, 7604 title = {Fracture Mechanics on the Intel Itanium Architecture}, 7605 year = {2001}, 7606 institution = {Intel Corporation}, 7607 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 7608 petsc_uses = {KSP} 7609} 7610 7611@InProceedings{ ihwi, 7612 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 7613 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 7614 booktitle = {International Conference ON Computational Engineering and Sciences}, 7615 year = {2002}, 7616 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 7617 petsc_uses = {KSP} 7618} 7619 7620@InProceedings{ crack, 7621 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 7622 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 7623 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 7624 and Paul A. Wawrzynek}, 7625 title = {Parallel FEM Simulation of Crack Propagation}, 7626 booktitle = {Proceedings of Irregular 2000}, 7627 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 7628 year = {2000}, 7629 petsc_uses = {KSP} 7630} 7631 7632@InProceedings{ beaudoin98, 7633 author = {A. J. Beaudoin}, 7634 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 7635 booktitle = {Simulation of materials processing: Theory, methods, and applications - 7636 Proceedings of the Sixth International Conference, NUMIFORM'98}, 7637 editor = {J. Hu\'etink and F. P. T. Baaijens}, 7638 optvolume = {}, 7639 optnumber = {}, 7640 optseries = {}, 7641 year = {1998}, 7642 optorganization={}, 7643 publisher = {A. A. Balkema Publishers}, 7644 address = {Rotterdam, Netherlands}, 7645 month = jun, 7646 optpages = {}, 7647 petsc_uses = {KSP} 7648} 7649 7650% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7651@TechReport{ defordheld1, 7652 author = {JF DeFord and BL Held}, 7653 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 7654 year = {2002}, 7655 institution = {Simulation Technology and Applied Research}, 7656 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 7657 note = {Discusses their parallel commercial solver that uses PETSc}, 7658 petsc_uses = {KSP} 7659} 7660 7661@PhDThesis{ sande2003, 7662 author = {Hans Vande Sande}, 7663 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 7664 Quasi-Static Electromagnetic Systems}, 7665 school = {Katholieke Universiteit Leuven, Belgium}, 7666 year = {2003}, 7667 petsc_uses = {KSP} 7668} 7669 7670@Article{ sdchh2004, 7671 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 7672 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 7673 Tolerance}, 7674 journal = {IEEE Transactions on Magnetics}, 7675 year = {2004}, 7676 volume = {40}, 7677 pages = {1306--1309}, 7678 petsc_uses = {KSP} 7679} 7680 7681@Article{ holst-lindblom-etal:2004, 7682 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 7683 Scheel and Lawrence E. Kidder}, 7684 title = {Optimal constraint projection for hyperbolic evolution systems, }, 7685 journal = {Phys. Rev. D}, 7686 year = {2004}, 7687 volume = {70}, 7688 pages = {084017}, 7689 petsc_uses = {KSP} 7690} 7691 7692@Article{ marm2005, 7693 author = {Matthew Anderson and Richard A. Matzner}, 7694 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 7695 journal = {Foundations of Physics}, 7696 volume = {35}, 7697 pages = {1572--9516}, 7698 year = {2005}, 7699 petsc_uses = {KSP} 7700} 7701 7702@Article{ cook-pfeiffer:2004, 7703 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 7704 title = {Excision boundary conditions for black hole initial data}, 7705 journal = {Phys. Rev. D}, 7706 volume = {70}, 7707 pages = {104016--24}, 7708 year = {2004}, 7709 petsc_uses = {KSP} 7710} 7711 7712@Article{ pfeiffer-kidder-etal:2005, 7713 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 7714 Shoemaker}, 7715 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 7716 journal = {Phys. Rev. D}, 7717 year = {2005}, 7718 volume = {71}, 7719 pages = {024020}, 7720 petsc_uses = {KSP} 7721} 7722 7723@Article{ pfeiffer-kidder-etal:2003, 7724 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 7725 Saul A.}, 7726 title = {A multidomain spectral method for solving elliptic equations}, 7727 journal = {CPC}, 7728 year = {2003}, 7729 volume = {152}, 7730 pages = {253--273}, 7731 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 7732 For a related online version, see arXiv:gr-qc/0202096}, 7733 petsc_uses = {KSP} 7734} 7735 7736@Article{ pfeiffer-cook-teukolsky:2002, 7737 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 7738 title = {Comparing initial-data sets for binary black hole}, 7739 journal = {PRD}, 7740 year = {2002}, 7741 volume = {66}, 7742 pages = {024047}, 7743 note = {for a related online version, seearXiv:gr-qc/0203085}, 7744 petsc_uses = {KSP} 7745} 7746 7747@PhDThesis{ pfeiffer:2003, 7748 author = {Pfeiffer, Harald P.}, 7749 title = {Initial Data for Black Hole Evolutions}, 7750 school = {Cornell University}, 7751 year = {2003}, 7752 petsc_uses = {KSP} 7753} 7754 7755@TechReport{ h1, 7756 author = {Erik Schnetter}, 7757 title = {A fast apparent horizon algorithm}, 7758 year = {2002}, 7759 number = {Arxiv preprint gr-qc/0206003}, 7760 url = {http://arxiv.org/pdf/gr-qc/0206003}, 7761 petsc_uses = {KSP} 7762} 7763 7764@Article{ h2, 7765 author = {Erik Schnetter}, 7766 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 7767 year = {2003}, 7768 journal = {Class. Quantum Grav.}, 7769 pages = {4719-4737}, 7770 volume = {20}, 7771 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 7772 petsc_uses = {KSP} 7773} 7774 7775@Article{ adams-03a, 7776 author = {Adams, M.~F.}, 7777 journal = {Numerical Linear Algebra with Applications}, 7778 number = {2-3}, 7779 pages = {141-153}, 7780 title = {Algebraic multigrid methods for constrained linear systems with applications to 7781 contact problems in solid mechanics}, 7782 volume = {11}, 7783 year = {2004}, 7784 petsc_uses = {KSP} 7785} 7786 7787@Article{ vandesande1, 7788 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 7789 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 7790 year = {2003}, 7791 volume = {39}, 7792 pages = {1709--1712}, 7793 title = {Solving Nonlinear Magnetic Problems Using {N}ewton Trust Region Methods}, 7794 petsc_uses = {KSP} 7795} 7796 7797@InProceedings{ vbde1, 7798 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 7799 year = {2002}, 7800 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 7801 Uintah PSE}, 7802 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 7803 2002}, 7804 pages = {49-55}, 7805 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7806 note = {Extended abstract}, 7807 petsc_uses = {KSP} 7808} 7809 7810@Unpublished{ ep1, 7811 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 7812 author = {Bradley R. Eccleston and Todd S. Palmer}, 7813 institution = {Department of Nuclear Engineering, Oregon State University}, 7814 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 7815 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 7816 Parallel Simulations}, 7817 year = {1999}, 7818 petsc_uses = {KSP} 7819} 7820 7821@InProceedings{ teo2007scalable, 7822 title = {A scalable modular convex solver for regularized risk minimization}, 7823 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 7824 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 7825 discovery and data mining}, 7826 pages = {727--736}, 7827 year = {2007}, 7828 organization = {ACM}, 7829 petsc_uses = {KSP} 7830} 7831 7832@InProceedings{ rm02, 7833 author = {Robert Malouf}, 7834 year = {2002}, 7835 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 7836 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 7837 (CoNLL-2002)}, 7838 pages = {49-55}, 7839 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 7840 petsc_uses = {KSP} 7841} 7842 7843@Unpublished{ hrv02, 7844 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 7845 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7846 note = {Submitted to CMMSE}, 7847 petsc_uses = {KSP} 7848} 7849 7850@Article{ tmh2001, 7851 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 7852 journal = {Journal of Economic Dynamics and Control}, 7853 year = {2002}, 7854 volume = {26}, 7855 pages = {1499-1515}, 7856 title = {Solving finite difference schemes arising in trivariate option pricing}, 7857 petsc_uses = {KSP} 7858} 7859 7860@InProceedings{ a2, 7861 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 7862 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 7863 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 7864 Methods}, 7865 editor = {C.-H. Lai et al.}, 7866 publisher = {Domain Decomposition Press, Bergen}, 7867 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 7868 year = {1999}, 7869 petsc_uses = {KSP} 7870} 7871 7872@Unpublished{ mmmdcmaa-web-page, 7873 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 7874 {A}coustics {W}eb Page}, 7875 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 7876 author = {David E. Keyes}, 7877 institution = {Old Dominion University}, 7878 petsc_uses = {KSP} 7879} 7880 7881@Conference{ liu2010parallelization, 7882 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 7883 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 7884 booktitle = {International Symposium on Parallel and Distributed Processing with 7885 Applications}, 7886 pages = {528--535}, 7887 year = {2010}, 7888 organization = {IEEE}, 7889 petsc_uses = {KSP} 7890} 7891 7892@Unpublished{ oil-reservoir-sim-web-page, 7893 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 7894 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 7895 institution = {University of Texas at Austin and Argonne National Laboratory}, 7896 key = {University of Texas at Austin and Argonne National Laboratory}, 7897 petsc_uses = {KSP} 7898} 7899 7900@Article{ tmh2001b, 7901 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 7902 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 7903 year = {2001}, 7904 volume = {37}, 7905 pages = {143--146}, 7906 title = {Adapting EMAP3D to parallel processing}, 7907 petsc_uses = {KSP} 7908} 7909 7910@Article{ harbury98, 7911 author = {HK Harbury and W Porod}, 7912 journal = {VLSI Design}, 7913 year = {1998}, 7914 volume = {6}, 7915 pages = {47--51}, 7916 title = {Parallel computation for electronic waves in quantum corrals}, 7917 petsc_uses = {KSP} 7918} 7919 7920@Article{ bludszuwei98, 7921 author = {Mark Bludszuweit}, 7922 journal = {Journal of Lightwave Technology}, 7923 year = {1998}, 7924 volume = {16}, 7925 number = {7}, 7926 pages = {1336--42}, 7927 title = {Mixed Finite Element Beam Propagation Method}, 7928 petsc_uses = {KSP} 7929} 7930 7931@Article{ s1, 7932 author = {J. L. Friedman and N. Stergioulas}, 7933 journal = {Astrophysics Journal}, 7934 year = {1998}, 7935 volume = {492}, 7936 number = {301}, 7937 pages = {}, 7938 title = {}, 7939 petsc_uses = {KSP} 7940} 7941 7942@Article{ s1a, 7943 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 7944 journal = {Astrophysics Journal}, 7945 year = {1999}, 7946 volume = {510}, 7947 number = {854}, 7948 pages = {}, 7949 title = {}, 7950 petsc_uses = {KSP} 7951} 7952 7953@PhDThesis{ s2, 7954 author = {N. Stergioulas}, 7955 title = {Ph. D. thesis}, 7956 year = {1996}, 7957 institution = {University of Wisconsin-Milwaukee}, 7958 petsc_uses = {KSP} 7959} 7960 7961@InProceedings{ coral1, 7962 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7963 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 7964 Parallel Computing Environment}, 7965 booktitle = {Proceedings of the Miami TEAM Workshop}, 7966 location = {Florida International University, Department of Electrical Engineering and 7967 Computing Science}, 7968 month = nov, 7969 year = {1993}, 7970 petsc_uses = {KSP} 7971} 7972 7973@InProceedings{ coral2, 7974 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7975 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 7976 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 7977 month = dec, 7978 year = {1994}, 7979 petsc_uses = {KSP} 7980} 7981 7982@InProceedings{ coral3, 7983 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7984 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 7985 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 7986 location = {Florida International University, Department of Electrical Engineering and 7987 Computing Science}, 7988 year = {1995}, 7989 petsc_uses = {KSP} 7990} 7991 7992@InProceedings{ mijalkovic, 7993 author = {Slobodan Mijalkovi\'{c}}, 7994 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 7995 Process Simulation}, 7996 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 7997 Gent, Belgium, September 27--30, 1999.}, 7998 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 7999 optvolume = {14}, 8000 optseries = {Lecture Notes in Computational Science and Engineering}, 8001 year = {2000}, 8002 publisher = {Springer}, 8003 address = {Berlin}, 8004 optpages = {179--184}, 8005 petsc_uses = {KSP} 8006} 8007 8008@Article{ bludszuwei98a, 8009 author = {Mark Bludszuweit}, 8010 journal = {Journal of Lightwave Technology}, 8011 year = {1998}, 8012 volume = {16}, 8013 number = {7}, 8014 pages = {1336--42}, 8015 title = {Mixed Finite Element Beam Propagation Method}, 8016 petsc_uses = {KSP} 8017} 8018 8019@Article{ gilli-pauletto-1998, 8020 author = {Manfred Gilli and Giorgio Pauletto}, 8021 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 8022 journal = {Computational Economics}, 8023 year = {2000}, 8024 volume = {16}, 8025 pages = {173--186}, 8026 petsc_uses = {KSP} 8027} 8028 8029% LiteralHTML: 8030% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 8031% LiteralHTML: 8032@Article{ collierdalcincalo2013, 8033 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 8034 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 8035 journal = {arxiv}, 8036 year = {2013}, 8037 number = {1305.4452}, 8038 note = {\url{http://arxiv.org/abs/1305.4452}}, 8039 petsc_uses = {KSP} 8040} 8041 8042@Article{ collierdalcinvignalcortescalo2016, 8043 title = {PetIGA: A framework for high-performance isogeometric analysis}, 8044 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 8045 Victor M. Calo}, 8046 journal = {Computer Methods in Applied Mechanics and Engineering}, 8047 year = {2016}, 8048 petsc_uses = {KSP} 8049} 8050 8051@Misc{ petiga-web-page, 8052 author = {N. Collier and L. Dalcin and V.M. Calo}, 8053 title = {{PetIGA} {W}eb page}, 8054 url = {https://bitbucket.org/dalcinl/petiga/}, 8055 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 8056 year = {2014}, 8057 petsc_uses = {KSP} 8058} 8059 8060@Article{ logg07, 8061 author = {Logg, Anders}, 8062 title = {Automating the Finite Element Method}, 8063 journal = {Archives of Computational Methods in Engineering}, 8064 volume = {14}, 8065 number = {2}, 8066 pages = {93-138}, 8067 year = {2007}, 8068 doi = {10.1007/s11831-007-9003-9}, 8069 publisher = {Kluwer Academic Publishers}, 8070 issn = {1134-3060}, 8071 language = {English}, 8072 petsc_uses = {KSP} 8073} 8074 8075@Article{ jezequelcouturierdenis12, 8076 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 8077 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 8078 versus the PETSc library}, 8079 journal = {The Journal of Supercomputing}, 8080 volume = {59}, 8081 number = {3}, 8082 pages = {1517-1532}, 8083 year = {2012}, 8084 issn = {0920-8542}, 8085 doi = {10.1007/s11227-011-0563-y}, 8086 publisher = {Springer US}, 8087 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 8088 Sparse linear solver}, 8089 language = {English}, 8090 petsc_uses = {KSP} 8091} 8092 8093@Unpublished{ feap-web-page, 8094 title = {FEAP: A Finite Element Analysis Program}, 8095 url = {http://www.ce.berkeley.edu/projects/feap/}, 8096 author = {FEAP Team}, 8097 note = {Uses PETSc linear solvers - iterative and direct}, 8098 petsc_uses = {KSP} 8099} 8100 8101@Unpublished{ parpre-web-page, 8102 title = {{ParPre} {W}eb {P}age}, 8103 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 8104 institution = {University of Tennessee}, 8105 author = {Victor Eijkhout}, 8106 note = {This is no longer supported. A set of preconditioners built on PETSc}, 8107 petsc_uses = {KSP} 8108} 8109 8110@Unpublished{ pism, 8111 title = {{PISM}: a Parallel Ice Sheet Model}, 8112 author = {{PISM Team}}, 8113 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 8114 Sheet Model). The thickness, temperature, velocity and age of the ice are all 8115 simulated, as is the deformation of the earth underneath the ice. New techniques 8116 for fast ice dynamics, earth deformation, and verification have are included.}, 8117 note = {\url{http://www.pism-docs.org/}}, 8118 petsc_uses = {KSP} 8119} 8120 8121@Unpublished{ oofem, 8122 title = {OOFEM - an object oriented finite element package}, 8123 author = {Borek Patzak}, 8124 url = {http://www.oofem.org}, 8125 petsc_uses = {KSP} 8126} 8127 8128@Unpublished{ dks2openfvm, 8129 title = {OpenFVM - a finite volume based general purpose CFD solver}, 8130 author = {Open source development}, 8131 url = {http://openfvm.sourceforge.net/}, 8132 petsc_uses = {KSP} 8133} 8134 8135@Unpublished{ sundar-2008w, 8136 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 8137 octree meshes}, 8138 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 8139 institution = {University of Pennsylvania}, 8140 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 8141 petsc_uses = {KSP} 8142} 8143 8144@Unpublished{ khatiwala07-software, 8145 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 8146 author = {Khatiwala, S.}, 8147 institution = {Columbia University}, 8148 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 8149 petsc_uses = {KSP} 8150} 8151 8152@InBook{ jiaolima99, 8153 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 8154 chapter = {{SIFFEA}:Scalable Integrated Framework for Finite Element Analysis}, 8155 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 8156 title = {Lecture Notes in Computer Science}, 8157 publisher = {Springer-Verlag}, 8158 volume = {1732}, 8159 year = {1999}, 8160 petsc_uses = {KSP} 8161} 8162 8163@Article{ crow1, 8164 author = {C. S. Crow IV}, 8165 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 8166 journal = {Hopkins Undergraduate Research Journal}, 8167 year = {2003}, 8168 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 8169 petsc_uses = {KSP} 8170} 8171 8172@Unpublished{ petsc-python, 8173 title = {PETSc for Python}, 8174 author = {L. Dalcin}, 8175 url = {https://petsc.org/main/petsc4py}, 8176 note = {Provides Python bindings for PETSc}, 8177} 8178 8179@Unpublished{ cfdship, 8180 title = {{CFDShip-Iowa}}, 8181 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 8182 institution = {University of Iowa}, 8183 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 8184 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 8185 structured grids, designed for ship applications}, 8186 petsc_uses = {KSP} 8187} 8188 8189@Unpublished{ bvw, 8190 title = {Multiflow}, 8191 author = {Berend van Wachem}, 8192 institution = {Mechanical Engineering - Chalmers University of Technology}, 8193 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 8194 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 8195 flows.}, 8196 petsc_uses = {KSP} 8197} 8198 8199@Unpublished{ dks2, 8200 title = {FENA - A Finite Element Model for the North Atlantic}, 8201 author = {Jens Schroeter}, 8202 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 8203 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 8204 petsc_uses = {KSP} 8205} 8206 8207@TechReport{ piwonski2010idea, 8208 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 8209 and Simulation in {3-D}}, 8210 author = {Piwonski, J. and Slawig, T.}, 8211 year = {2010}, 8212 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8213 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 8214 petsc_uses = {KSP} 8215} 8216 8217@Unpublished{ metos3d-web, 8218 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 8219 author = {Piwonski, J. and Slawig, T.}, 8220 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8221 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 8222 petsc_uses = {KSP} 8223} 8224 8225@Unpublished{ magpar, 8226 author = {W. Scholz}, 8227 title = {Magpar: Parallel Micromagnetics Code}, 8228 institution = {Vienna University of Technology}, 8229 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 8230 petsc_uses = {KSP} 8231} 8232 8233@Misc{ libmesh:sourceforge, 8234 author = {}, 8235 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 8236 equations on serial and parallel platforms}, 8237 note = {[Online]}, 8238 url = {http://libmesh.github.io}, 8239 petsc_uses = {KSP} 8240} 8241 8242@Misc{ moose-web-page, 8243 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 8244 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 8245 Gaston and John Peterson and Jason Miller}, 8246 institution = {Idaho National Laboratory}, 8247 howpublished = {\url{http://mooseframework.org}}, 8248 petsc_uses = {KSP} 8249} 8250 8251@Article{ gaston2009moose, 8252 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 8253 equations}, 8254 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 8255 journal = {Nuclear Engineering and Design}, 8256 volume = {239}, 8257 number = {10}, 8258 pages = {1768--1778}, 8259 year = {2009}, 8260 publisher = {Elsevier}, 8261 petsc_uses = {KSP} 8262} 8263 8264@Article{ tonks2012object, 8265 title = {An object-oriented finite element framework for multiphysics phase field 8266 simulations}, 8267 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 8268 journal = {Computational Materials Science}, 8269 volume = {51}, 8270 number = {1}, 8271 pages = {20--29}, 8272 year = {2012}, 8273 publisher = {Elsevier}, 8274 petsc_uses = {KSP} 8275} 8276 8277@Misc{ pylithmanual, 8278 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 8279 Strand and Charles Williams}, 8280 title = {{PyLith} User Manual Version 2.0.0}, 8281 year = {2014}, 8282 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 8283 petsc_uses = {KSP} 8284} 8285 8286@Misc{ pylith-web-page, 8287 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 8288 title = {{PyLith}}, 8289 year = {2012}, 8290 url = {http://geodynamics.org/resources/pylith/}, 8291 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 8292 petsc_uses = {KSP} 8293} 8294 8295@Misc{ galemanual, 8296 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 8297 title = {Gale User Manual Version 2.0.0}, 8298 year = {2011}, 8299 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 8300 petsc_uses = {KSP} 8301} 8302 8303@Unpublished{ underworld, 8304 author = {Louis Moresi}, 8305 title = {{UnderWorld}: A Geodynamics Modelling Code}, 8306 institution = {Monash University}, 8307 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 8308 petsc_uses = {KSP} 8309} 8310 8311@Article{ moresi2007computational, 8312 title = {Computational approaches to studying non-linear dynamics of the crust and 8313 mantle}, 8314 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 8315 M{\"u}hlhaus, H.B.}, 8316 journal = {Physics of the Earth and Planetary Interiors}, 8317 volume = {163}, 8318 number = {1-4}, 8319 pages = {69--82}, 8320 year = {2007}, 8321 publisher = {Elsevier}, 8322 petsc_uses = {KSP} 8323} 8324 8325@Article{ pitt2009chaste, 8326 title = {Chaste: a test-driven approach to software development for biological modelling}, 8327 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 8328 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 8329 and Walter, A. and others}, 8330 journal = {Computer Physics Communications}, 8331 volume = {180}, 8332 number = {12}, 8333 pages = {2452--2471}, 8334 year = {2009}, 8335 publisher = {Elsevier}, 8336 petsc_uses = {KSP} 8337} 8338 8339@Misc{ fenicsproject, 8340 title = {{The FEniCS project}}, 8341 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 8342 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 8343 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 8344 url = {http://fenicsproject.org}, 8345 year = {2011}, 8346 petsc_uses = {KSP} 8347} 8348 8349@Unpublished{ snark, 8350 title = {Snark: A suite of software for geoscientific applications and a philosophy of 8351 scientific software development}, 8352 institution = {Victorian Partnership for Advanced Computing}, 8353 url = {http://vpac.org/Snark}, 8354 petsc_uses = {KSP} 8355} 8356 8357@Misc{ imoose:sourceforge, 8358 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 8359 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 8360 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 8361 note = {[Online]}, 8362 url = {http://imoose.sourceforge.net}, 8363 petsc_uses = {KSP} 8364} 8365 8366@Unpublished{ fossi, 8367 author = {Stephan Frickenhaus}, 8368 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 8369 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 8370 codes}, 8371 institution = {AWI-Bremerhaven, Germanny}, 8372 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 8373 petsc_uses = {KSP} 8374} 8375 8376@Unpublished{ fun3dweb, 8377 author = {Dinesh Kaushik}, 8378 title = {PETSC-FUN3D Benchmark Page}, 8379 institution = {ODU/ANL}, 8380 url = {http://www.mcs.anl.gov/petsc-fun3d}, 8381 note = {CFD Benchmark of some solvers in PETSc}, 8382 petsc_uses = {KSP} 8383} 8384 8385@Unpublished{ scirun, 8386 author = {SCIRun Development Team}, 8387 title = {SCIRun}, 8388 institution = {University of Utah}, 8389 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 8390 note = {SCIRun now uses PETSc linear solvers}, 8391 petsc_uses = {KSP} 8392} 8393 8394@Misc{ prometheus, 8395 author = {Mark F. Adams}, 8396 title = {Prometheus - A scalable unstructured finite element solver}, 8397 institution = {Berkeley}, 8398 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 8399 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 8400 petsc_uses = {KSP} 8401} 8402 8403@Unpublished{ illuminator, 8404 author = {Adam C. Powell, IV}, 8405 title = {Illuminator Distributed Visualization Library}, 8406 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 8407 petsc_uses = {KSP} 8408} 8409 8410@Unpublished{ rheoplast, 8411 title = {RheoPlast Phase Field Multi-Physics Code}, 8412 author = {Adam Powell and David Dussault and Bo Zhou}, 8413 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 8414 petsc_uses = {KSP} 8415} 8416 8417@Misc{ tao-web-page, 8418 title = {{Toolkit for Advanced Optimization ({TAO})} {W}eb Page}, 8419 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8420 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 8421 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8422 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 8423 petsc_uses = {KSP} 8424} 8425 8426@TechReport{ tao-user-ref, 8427 title = {{Toolkit for Advanced Optimization ({TAO}) users manual}}, 8428 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8429 and Steve Benson and Lois Curfman McInnes}, 8430 institution = {Argonne National Laboratory}, 8431 year = {2019}, 8432 number = {ANL/MCS-TM-322 - Rev 3.12}, 8433 petsc_uses = {KSP} 8434} 8435 8436% url = "http://www.mcs.anl.gov/tao", 8437@Unpublished{ mefpp-web-page, 8438 title = {{MEF++} {W}eb {P}age}, 8439 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 8440 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 8441 author = {Eric Chamberland}, 8442 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 8443 multiphysics}, 8444 petsc_uses = {KSP} 8445} 8446 8447@Unpublished{ tipetsc-titanium, 8448 title = {Ti-PETSc - an interface to PETSc from Titanium}, 8449 institution = {Berkeley}, 8450 author = {He, Yun and Liblit, Bun and Lin, Chang}, 8451 url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, 8452 year = {1999}, 8453 petsc_uses = {KSP}, 8454} 8455 8456@Unpublished{ ptatin-web-page, 8457 title = {ptatin3d}, 8458 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 8459 url = {https://bitbucket.org/jedbrown/ptatin3d}, 8460 year = {2018}, 8461 petsc_uses = {KSP} 8462} 8463 8464@Misc{ multiphase-web-page, 8465 author = {Q. Zou}, 8466 title = {Multiphase flow with {PETSc}}, 8467 institution = {LANL}, 8468 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 8469 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 8470 lab = {LANL}, 8471 petsc_uses = {KSP} 8472} 8473 8474@Misc{ electromag-web-page, 8475 title = {{EMSolve Web} page}, 8476 institution = {LLNL}, 8477 howpublished = {http://www.llnl.gov/casc/emsolve}, 8478 url = {http://www.Llnl.gov/casc/emsolve}, 8479 author = {Daniel {White et al.}}, 8480 lab = {LLNL}, 8481 petsc_uses = {KSP} 8482} 8483 8484@Unpublished{ fe-software-web-page, 8485 institution = {Kuleuven}, 8486 title = {Finite element software}, 8487 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 8488 petsc_uses = {KSP} 8489} 8490 8491@Misc{ petsc-web-page, 8492 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8493 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 8494 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8495 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8496 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8497 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8498 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8499 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8500 Zhang}, 8501 title = {{PETS}c {W}eb page}, 8502 url = {https://petsc.org/}, 8503 howpublished = {\url{https://petsc.org/}}, 8504 year = {2023} 8505} 8506 8507@Unpublished{ petsc-debian-package, 8508 author = {Adam C. Powell, IV}, 8509 title = {Debian package for PETSc}, 8510 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 8511 petsc_uses = {KSP} 8512} 8513 8514@Unpublished{ cactus, 8515 title = {Cactus Website}, 8516 url = {http://www.cactuscode.org/}, 8517 note = {Provides two interface to the PETSc solvers}, 8518 petsc_uses = {KSP} 8519} 8520 8521@Unpublished{ petsc-fem, 8522 author = {Mario Storti and Norberto Nigro}, 8523 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 8524 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 8525 url = {http://www.cimec.org.ar/petscfem}, 8526 petsc_uses = {KSP} 8527} 8528 8529@Misc{ fidap, 8530 title = {FIDAP 8.5}, 8531 howpublished = {\url{http://www.fluent.com}}, 8532 url = {http://www.fluent.com}, 8533 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 8534 solves.}, 8535 key = {FIDAP 8.5}, 8536 petsc_uses = {KSP} 8537} 8538 8539@Unpublished{ slepc, 8540 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8541 Vicente Hern\'andez and Vicent Vidal}, 8542 title = {{SLEPc} Website}, 8543 url = {http://slepc.upv.es/}, 8544 note = {Scalable Library for Eigenvalue Problem Computations}, 8545 petsc_uses = {KSP} 8546} 8547 8548@TechReport{ slepc-users-manual, 8549 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8550 Vicente Hern\'andez and Vicent Vidal}, 8551 title = {{SLEPc} Users Manual}, 8552 number = {DISC-II/24/02}, 8553 url = {http://slepc.upv.es/}, 8554 note = {Scalable Library for Eigenvalue Problem Computations}, 8555 petsc_uses = {KSP} 8556} 8557 8558@Misc{ deal.ii, 8559 title = {deal.II}, 8560 howpublished = {\url{http://www.dealii.org}}, 8561 url = {http://www.dealii.org}, 8562 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 8563 It allows PETSc linear algebra and solvers to be used underneath.}, 8564 key = {deal.II 5.0}, 8565 petsc_uses = {KSP} 8566} 8567 8568@Article{ bangerth2007deal, 8569 title = {{deal.II---A general-purpose object-oriented finite element library}}, 8570 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 8571 journal = {ACM Transactions on Mathematical Software (TOMS)}, 8572 volume = {33}, 8573 number = {4}, 8574 pages = {24--es}, 8575 issn = {0098-3500}, 8576 year = {2007}, 8577 publisher = {ACM}, 8578 petsc_uses = {KSP} 8579} 8580 8581@Misc{ globalarrays, 8582 author = {Jarek {Nieplocha et al.}}, 8583 title = {Global Arrays}, 8584 institution = {Pacific Northwest National Laboratories}, 8585 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 8586 url = {http://www.emsl.pnl.gov/docs/global}, 8587 note = {Global arrays can use PETSc linear solvers}, 8588 lab = {PNNL}, 8589 petsc_uses = {KSP} 8590} 8591 8592% LiteralHTML: 8593% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 8594% LiteralHTML: 8595@Article{ petsccommunity2022, 8596 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 8597 Community}, 8598 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 8599 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 8600 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 8601 and Hong Zhang and Junchao Zhang}, 8602 journal = {Computing in Science and Engineering}, 8603 volume = {24}, 8604 number = {03}, 8605 pages = {6--15}, 8606 issn = {1558-366X}, 8607 doi = {10.1109/MCSE.2022.3169974}, 8608 publisher = {IEEE Computer Society}, 8609 address = {Los Alamitos, CA, USA}, 8610 month = may, 8611 year = {2022}, 8612 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 8613 petsc_uses = {KSP} 8614} 8615 8616@Article{ brownknepleysmith14, 8617 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 8618 title = {Run-time extensibility and librarization of simulation software}, 8619 journal = {IEEE Computing in Science and Engineering}, 8620 month = jan, 8621 volume = {17}, 8622 number = {1}, 8623 pages = {38--45}, 8624 doi = {10.1109/MCSE.2014.95}, 8625 year = {2015}, 8626 petsc_uses = {KSP} 8627} 8628 8629@TechReport{ ass2012, 8630 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 8631 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 8632 institution = {Argonne National Laboratory}, 8633 type = {Preprint}, 8634 year = {2012}, 8635 number = {ANL/MCS-P2011-0112}, 8636 petsc_uses = {KSP} 8637} 8638 8639@TechReport{ clearyknepley99, 8640 author = {Andrew Cleary and Matthew G. Knepley}, 8641 title = {Solvers as Operators}, 8642 institution = {Lawrence Livermore National Laboratory}, 8643 type = {Technical Report}, 8644 number = {UCRL-ID-135342}, 8645 year = {1999}, 8646 petsc_uses = {KSP} 8647} 8648 8649@TechReport{ smcabbkz2012, 8650 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 8651 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 8652 title = {{PETSc's} software strategy for the design space of composable extreme-scale 8653 solvers}, 8654 institution = {Argonne National Laboratory}, 8655 type = {Preprint}, 8656 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 8657 year = {2012}, 8658 number = {ANL/MCS-P2059-0312}, 8659 petsc_uses = {KSP} 8660} 8661 8662@InProceedings{ mhwpmhs2009, 8663 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 8664 and G. E. Hammond and B. Smith}, 8665 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 8666 Toolkit {MPI} at Scale}, 8667 booktitle = {Cray Users Group Conference}, 8668 year = {2009}, 8669 petsc_uses = {KSP} 8670} 8671 8672@InProceedings{ msmhls2010, 8673 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 8674 Lichtner and B. F. Smith}, 8675 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 8676 {BlueGene} Architectures}, 8677 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 8678 year = {2010}, 8679 petsc_uses = {KSP} 8680} 8681 8682@InCollection{ msk2013, 8683 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 8684 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 8685 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8686 series = {Lecture Notes in Earth System Sciences}, 8687 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8688 Yaolin Shi}, 8689 doi = {10.1007/978-3-642-16405-7_7}, 8690 publisher = {Springer Berlin Heidelberg}, 8691 pages = {131--140}, 8692 year = {2013}, 8693 isbn = {978-3-642-16404-0}, 8694 petsc_uses = {KSP} 8695} 8696 8697@InCollection{ knepleyyuen13, 8698 author = {Matthew G. Knepley and David A. Yuen}, 8699 title = {Why Scientists and Engineers need {GPU}s today}, 8700 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8701 series = {Lecture Notes in Earth System Sciences}, 8702 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8703 Yaolin Shi}, 8704 doi = {10.1007/978-3-642-16405-7_1}, 8705 publisher = {Springer Berlin Heidelberg}, 8706 pages = {131--140}, 8707 year = {2013}, 8708 isbn = {978-3-642-16404-0}, 8709 petsc_uses = {KSP} 8710} 8711 8712@InCollection{ karpeevknepleybrune13, 8713 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 8714 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 8715 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8716 series = {Lecture Notes in Earth System Sciences}, 8717 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8718 Yaolin Shi}, 8719 doi = {10.1007/978-3-642-16405-7_30}, 8720 publisher = {Springer Berlin Heidelberg}, 8721 pages = {487--501}, 8722 year = {2013}, 8723 isbn = {978-3-642-16404-0}, 8724 petsc_uses = {KSP} 8725} 8726 8727@InCollection{ zhengetal13, 8728 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 8729 Variable Viscosity}, 8730 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8731 Zhang and Yaolin Shi}, 8732 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8733 series = {Lecture Notes in Earth System Sciences}, 8734 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8735 Yaolin Shi}, 8736 doi = {10.1007/978-3-642-16405-7_21}, 8737 publisher = {Springer Berlin Heidelberg}, 8738 pages = {321--333}, 8739 year = {2013}, 8740 isbn = {978-3-642-16404-0}, 8741 petsc_uses = {KSP} 8742} 8743 8744@Article{ zhengetal13b, 8745 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 8746 strongly variable viscosity based on {M}atlab and {CUDA}}, 8747 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8748 Zhang and Yaolin Shi}, 8749 journal = {IJHPCA}, 8750 volume = {28}, 8751 number = {1}, 8752 pages = {50--60}, 8753 doi = {10.1177/1094342013478640}, 8754 year = {2013}, 8755 petsc_uses = {KSP} 8756} 8757 8758@InBook{ s2011, 8759 author = {B. Smith}, 8760 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 8761 title = {Encyclopedia of Parallel Computing}, 8762 bookeditor = {D. Padua}, 8763 publisher = {Springer}, 8764 year = {2011}, 8765 petsc_uses = {KSP} 8766} 8767 8768@Article{ acostamejia06, 8769 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 8770 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 8771 journal = {Lecturas Matem\'aticas}, 8772 volume = {27}, 8773 year = {2006}, 8774 pages = {213--224}, 8775 petsc_uses = {KSP} 8776} 8777 8778@InProceedings{ quenettemoresisunterappelbe07, 8779 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 8780 title = {Explaining StGermain: An aspect oriented environment for building extensible 8781 computational mechanics modeling software}, 8782 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 8783 publisher = {IEEE}, 8784 pages = {1--8}, 8785 yerar = {2007}, 8786 petsc_uses = {KSP} 8787} 8788 8789@Article{ dfm1, 8790 title = {Vectorized sparse matrix multiply for compressed row storage format}, 8791 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 8792 journal = {Lecture Notes in Computer Science}, 8793 year = {2005}, 8794 pages = {99--106}, 8795 volume = {3514}, 8796 lab = {ORNL}, 8797 petsc_uses = {KSP} 8798} 8799 8800@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 8801 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 8802 Vandewalle and Stefaan Poedts}, 8803 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 8804 Scientific Computing Software}, 8805 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 8806 year = {2005}, 8807 note = {Lecture Notes in Computer Science}, 8808 volume = {3514}, 8809 publisher = {Springer-Verlag GmbH}, 8810 petsc_uses = {KSP} 8811} 8812 8813@InProceedings{ dalcin-paz-storti, 8814 author = {L. Dalcin and R. Paz and M. Storti}, 8815 title = {Desarrollo de Aplicaciones Paralelas en Python}, 8816 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 8817 Bariloche, Argentina}, 8818 year = {2004}, 8819 petsc_uses = {KSP} 8820} 8821 8822@Article{ mpi-python, 8823 author = {L. Dalcin and R. Paz and M. Storti}, 8824 title = {MPI for Python}, 8825 journal = {Journal of Parallel and Distributed Computing}, 8826 year = {2005}, 8827 petsc_uses = {KSP} 8828} 8829 8830@Unpublished{ hrv02a, 8831 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 8832 author = {V. Hernandex and J. E. Roman and V. Vidal}, 8833 note = {Submited to VecPar 2002}, 8834 year = {2002}, 8835 petsc_uses = {KSP} 8836} 8837 8838@Article{ knyazev2007block, 8839 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 8840 {PETSc}}, 8841 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 8842 journal = {SIAM Journal on Scientific Computing}, 8843 volume = {29}, 8844 pages = {2224-2239}, 8845 doi = {10.1137/060661624}, 8846 year = {2007}, 8847 petsc_uses = {KSP} 8848} 8849 8850@MastersThesis{ aarrestad-master, 8851 author = {Asbjorn Hoiland Aarrestad}, 8852 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 8853 school = {University of Bergen}, 8854 month = aug, 8855 year = {2003}, 8856 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 8857 note = {Implemented Runge-Kutta methods using PETSc}, 8858 petsc_uses = {KSP} 8859} 8860 8861@PhDThesis{ kaushik-phd, 8862 author = {D. K. Kaushik}, 8863 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 8864 Differential Equations on Unstructured Grids}, 8865 school = {Old Dominion University}, 8866 month = dec, 8867 year = {2002}, 8868 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 8869 petsc_uses = {KSP} 8870} 8871 8872@TechReport{ rb1, 8873 author = {Rickard Bergstrom}, 8874 title = {Object Oriented Implementation of a General Finite Element Code}, 8875 number = {2002-13}, 8876 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 8877 year = {2002}, 8878 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 8879 note = {Discribes a finite element software package that uses PETSc for its solvers}, 8880 petsc_uses = {KSP} 8881} 8882 8883@InProceedings{ dbl1, 8884 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 8885 title = {A Parallel General Purpose Finite Element System}, 8886 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 8887 publisher = {SIAM}, 8888 year = {1999}, 8889 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 8890 note = {Describes software that uses PETSc for its parallel linear solves}, 8891 petsc_uses = {KSP} 8892} 8893 8894@Article{ p1, 8895 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 8896 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 8897 and B. Smith}, 8898 journal = {Parallel Computing}, 8899 year = {2002}, 8900 pages = {1811--1831}, 8901 volume = {28 (12)}, 8902 petsc_uses = {KSP} 8903} 8904 8905@Article{ automatic-ad, 8906 author = {Paul Hovland and Boyana Norris and Barry Smith}, 8907 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 8908 year = {2005}, 8909 journal = {Future Generation Computer Systems}, 8910 volume = {21}, 8911 number = {8}, 8912 pages = {1426--1438}, 8913 petsc_uses = {KSP} 8914} 8915 8916@TechReport{ remote-math, 8917 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 8918 Smith}, 8919 title = {Remote Access to Mathematical Software}, 8920 number = {ANL/MCS-P889-0601}, 8921 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8922 month = jun, 8923 year = {2001}, 8924 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 8925 petsc_uses = {KSP} 8926} 8927 8928@InProceedings{ gropp98, 8929 author = {William D. Gropp}, 8930 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 8931 publisher = {SIAM}, 8932 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8933 Scientific and Engineering Computing}, 8934 year = {1999}, 8935 pages = {21-29}, 8936 petsc_uses = {KSP} 8937} 8938 8939@InProceedings{ knepleysarin99, 8940 author = {Matthew Knepley and Vivek Sarin}, 8941 title = {Algorithm Development for Large Scale Computing}, 8942 publisher = {SIAM}, 8943 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8944 Scientific and Engineering Computing}, 8945 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 8946 year = {1999}, 8947 petsc_uses = {KSP} 8948} 8949 8950@InBook{ bgms00, 8951 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8952 chapter = {Software for the Scalable Solution of {PDEs}}, 8953 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 8954 title = {CRPC Handbook of Parallel Computing}, 8955 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 8956 and A. White}, 8957 publisher = {Morgan Kaufmann Publishers}, 8958 year = {2002}, 8959 petsc_uses = {KSP} 8960} 8961 8962@InProceedings{ hovland_norris_smith98, 8963 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 8964 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 8965 Computations}, 8966 publisher = {SIAM}, 8967 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8968 Scientific and Engineering Computing}, 8969 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 8970 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 8971 year = {1999}, 8972 pages = {129-137}, 8973 petsc_uses = {KSP} 8974} 8975 8976@InProceedings{ efficient, 8977 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8978 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 8979 Libraries}, 8980 booktitle = {Modern Software Tools in Scientific Computing}, 8981 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 8982 publisher = {Birkhauser Press}, 8983 pages = {163--202}, 8984 year = {1997}, 8985 petsc_uses = {KSP} 8986} 8987 8988% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 8989@TechReport{ petsc-user-ref, 8990 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8991 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 8992 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8993 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8994 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8995 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8996 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8997 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8998 Zhang}, 8999 title = {{PETSc/TAO} Users Manual}, 9000 institution = {Argonne National Laboratory}, 9001 number = {ANL-21/39 - Revision 3.20}, 9002 doi = {10.2172/2205494}, 9003 year = {2023} 9004} 9005 9006% url = {https://petsc.org/release} 9007@TechReport{ petsc-developers, 9008 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 9009 title = {{PETS}c Developers Guide}, 9010 institution = {Argonne National Laboratory}, 9011 number = {ANL-18/18}, 9012 year = {2018}, 9013 url = {https://petsc.org/release/developers}, 9014 petsc_uses = {KSP} 9015} 9016 9017@Unpublished{ alice-memory-snooper, 9018 author = {Ibrahima Ba and Barry~F. Smith}, 9019 title = {The {ALICE} Memory Snooper}, 9020 year = {1999}, 9021 petsc_uses = {KSP} 9022} 9023 9024@TechReport{ petsc-user-ref-polish, 9025 author = {Marcin Bojko and Piotr Krzyzanowski}, 9026 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 9027 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 9028 year = {1998}, 9029 note = {An introduction to PETSc in Polish}, 9030 petsc_uses = {KSP} 9031} 9032 9033@InProceedings{ abghmn00, 9034 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 9035 High-Performance Scientific Computing}, 9036 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 9037 Norris}, 9038 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 9039 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 9040 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 9041 Hasco\"{e}t and Uwe Naumann}, 9042 publisher = {Springer}, 9043 year = {2002}, 9044 petsc_uses = {KSP} 9045} 9046 9047@Unpublished{ petsc-mpi-paper, 9048 author = {Lois Curfman McInnes and Barry F. Smith}, 9049 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 9050 Libraries}, 9051 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 9052 month = jun, 9053 year = {1995}, 9054 petsc_uses = {KSP} 9055} 9056 9057@InProceedings{ miss-paper, 9058 author = {William D. Gropp and Barry F. Smith}, 9059 title = {Scalable, Extensible, and Portable Numerical Libraries}, 9060 publisher = {IEEE}, 9061 year = {1994}, 9062 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9063 address = {Mississippi State University}, 9064 pages = {87--93}, 9065 keyword = {numerical libraries, scientific computing, parallel computing}, 9066 petsc_uses = {KSP} 9067} 9068 9069@InProceedings{ snes-paper, 9070 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9071 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 9072 Minimization Problems}, 9073 publisher = {IEEE}, 9074 year = {1995}, 9075 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 9076 address = {Mississippi State University}, 9077 pages = {60-67}, 9078 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 9079 petsc_uses = {KSP} 9080} 9081 9082@Article{ dsneutral, 9083 author = {Barry F. Smith and William D. Gropp}, 9084 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 9085 Sparse Linear Systems}, 9086 journal = {Scientific Programming}, 9087 volume = {5}, 9088 pages = {329--336}, 9089 key = {GroppSmith96 ! KSP design}, 9090 year = {1996}, 9091 petsc_uses = {KSP} 9092} 9093 9094@InProceedings{ bgms98, 9095 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 9096 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 9097 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 9098 Scientific and Engineering Computing}, 9099 publisher = {SIAM}, 9100 pages = {58-67}, 9101 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 9102 year = {1998}, 9103 petsc_uses = {KSP} 9104} 9105 9106@Article{ hkm98, 9107 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 9108 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 9109 {PDE} Computation}, 9110 journal = {Advances in Engineering Software}, 9111 volume = {29}, 9112 pages = {415-424}, 9113 year = {1998}, 9114 petsc_uses = {KSP} 9115} 9116 9117@TechReport{ pdpta99, 9118 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 9119 Smith}, 9120 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 9121 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 9122 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 9123 Vegas, Nevada}, 9124 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9125 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 9126 number = {ANL/MCS-P751-0599}, 9127 year = {1999}, 9128 petsc_uses = {KSP} 9129} 9130 9131@InProceedings{ bbh:com, 9132 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 9133 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 9134 Computing}}, 9135 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 9136 Euro-Par Conference, Munich, Germany, August/September 2000}, 9137 year = {2000}, 9138 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 9139 volume = {1900}, 9140 series = {Lecture Notes in Computer Science}, 9141 pages = {86--94}, 9142 address = {Berlin}, 9143 publisher = {Springer}, 9144 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 9145 petsc_uses = {KSP} 9146} 9147 9148@InProceedings{ overture00, 9149 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 9150 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 9151 Components}, 9152 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 9153 booktitle = {Proceedings of the International Federation for Information Processing Working 9154 Conference on Software Architectures for Scientific Computing, Kluwer}, 9155 year = {2000}, 9156 pages = {57--68}, 9157 petsc_uses = {KSP} 9158} 9159 9160@TechReport{ smith97, 9161 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 9162 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 9163 number = {ANL/MCS-P701}, 9164 author = {Barry F. Smith}, 9165 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 9166 petsc_uses = {KSP} 9167} 9168 9169@Article{ smith98, 9170 author = {Barry Smith}, 9171 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 9172 journal = {SIGNUM Newsletter}, 9173 year = {1998}, 9174 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 9175 petsc_uses = {KSP} 9176} 9177 9178@TechReport{ ad-petsc-tm, 9179 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 9180 {PETSc}}, 9181 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 9182 year = {1997}, 9183 type = {Technical Memorandum}, 9184 institution = {ANL}, 9185 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 9186 number = {ANL/MCS-TM-233}, 9187 petsc_uses = {KSP} 9188} 9189 9190% LiteralHTML: 9191% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 9192% LiteralHTML: 9193@PhDThesis{ klotzthesis2019, 9194 author = {Thomas S. Klotz}, 9195 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 9196 Biology}, 9197 school = {Rice University}, 9198 year = {2019}, 9199 petsc_uses = {KSP} 9200} 9201 9202@Article{ klotzbardhanknepley2018, 9203 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 9204 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 9205 journal = {arXiv e-prints}, 9206 eprint = {1708.06028}, 9207 archiveprefix = {arXiv}, 9208 primaryclass = {math.na}, 9209 year = {2018}, 9210 note = {\url{http://arxiv.org/abs/1708.06028}}, 9211 petsc_uses = {KSP} 9212} 9213 9214@Misc{ brown2016, 9215 title = {Threading Tradeoffs in Domain Decomposition}, 9216 author = {Jed Brown}, 9217 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 9218 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 9219 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 9220 year = {2016}, 9221 petsc_uses = {KSP} 9222} 9223 9224@Article{ changnakshatralaknepleyjohnsson2017, 9225 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 9226 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 9227 Johnsson}, 9228 journal = {Concurency: Practice and Experience}, 9229 volume = {30}, 9230 number = {11}, 9231 eprint = {1705.03625}, 9232 doi = {10.1002/cpe.4401}, 9233 year = {2017}, 9234 petsc_uses = {KSP} 9235} 9236 9237@Article{ changfabienknepleymills2018, 9238 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 9239 spectrum analysis}, 9240 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 9241 journal = {SIAM Journal on Scientific Computing}, 9242 volume = {40}, 9243 number = {6}, 9244 pages = {C779--C802}, 9245 eprint = {1802.07832}, 9246 doi = {10.1137/18M1172260}, 9247 year = {2018}, 9248 petsc_uses = {KSP} 9249} 9250 9251@Article{ joshaghanichangnakshatralaknepley2019, 9252 title = {Composable solvers for the four-field double porosity/permeability model}, 9253 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 9254 Knepley}, 9255 journal = {Journal of Computational Physics}, 9256 volume = {386}, 9257 pages = {428--466}, 9258 doi = {10.1016/j.jcp.2019.02.020}, 9259 year = {2019}, 9260 petsc_uses = {KSP} 9261} 9262 9263@InProceedings{ barralknepleylangepiggottgorman2016, 9264 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 9265 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 9266 and Gerard J. Gorman}, 9267 booktitle = {25th International Meshing Roundtable}, 9268 editor = {Steve Owen and Hang Si}, 9269 month = sep, 9270 address = {Washington, DC}, 9271 pages = {1--5}, 9272 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 9273 year = {2016}, 9274 petsc_uses = {KSP} 9275} 9276 9277@Article{ adamsbrownknepleysamtaney2016, 9278 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 9279 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 9280 journal = {SIAM Journal on Scientific Computing}, 9281 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 9282 epub = {http://arxiv.org/abs/1406.7808}, 9283 volume = {8}, 9284 number = {4}, 9285 pages = {C426--C440}, 9286 doi = {10.1137/140975127}, 9287 year = {2016}, 9288 petsc_uses = {KSP} 9289} 9290 9291@InProceedings{ maysananruppknepleysmith2016, 9292 title = {Extreme-Scale Multigrid Components within {PETSc}}, 9293 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 9294 Smith}, 9295 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 9296 series = {PASC '16}, 9297 isbn = {978-1-4503-4126-4}, 9298 location = {Lausanne, Switzerland}, 9299 pages = {5:1--5:12}, 9300 articleno = {5}, 9301 numpages = {12}, 9302 doi = {10.1145/2929908.2929913}, 9303 acmid = {2929913}, 9304 publisher = {ACM}, 9305 address = {New York, NY, USA}, 9306 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 9307 preconditioning}, 9308 year = {2016}, 9309 petsc_uses = {KSP} 9310} 9311 9312@Article{ liu2015field, 9313 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 9314 author = {Lulu Liu and David E Keyes}, 9315 journal = {SIAM Journal on Scientific Computing}, 9316 volume = {37}, 9317 number = {3}, 9318 pages = {A1388--A1409}, 9319 year = {2015}, 9320 publisher = {SIAM}, 9321 petsc_uses = {KSP} 9322} 9323 9324@Article{ lujiaomissirlis2014, 9325 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 9326 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 9327 journal = {Numerical Linear Algebra with Applications}, 9328 volume = {21}, 9329 number = {2}, 9330 pages = {221--238}, 9331 year = {2014}, 9332 publisher = {Wiley Online Library}, 9333 petsc_uses = {KSP} 9334} 9335 9336@Article{ badiamartinprincipe2013, 9337 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 9338 solid mechanics}, 9339 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 9340 journal = {International Journal for Numerical Methods in Engineering}, 9341 volume = {96}, 9342 number = {4}, 9343 pages = {203--230}, 9344 year = {2013}, 9345 petsc_uses = {KSP} 9346} 9347 9348@Article{ morganknepleysananscott2016, 9349 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 9350 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 9351 journal = {Concurrency and Computation: Practice and Experience}, 9352 volume = {28}, 9353 pages = {4532--4542}, 9354 year = {2016}, 9355 url = {http://arxiv.org/abs/1602.04873}, 9356 doi = {10.1002/cpe.3820}, 9357 petsc_uses = {KSP} 9358} 9359 9360@Article{ morgansananknepleymills2020, 9361 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 9362 solvers}, 9363 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 9364 journal = {The International Journal of High Performance Computing Applications}, 9365 volume = {35}, 9366 issue = {1}, 9367 doi = {10.1177/1094342020966835}, 9368 url = {https://doi.org/10.1177/1094342020966835}, 9369 eprint = {https://doi.org/10.1177/1094342020966835}, 9370 year = {2020}, 9371 petsc_uses = {KSP} 9372} 9373 9374@Article{ msz2013, 9375 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 9376 author = {M. McCourt and B. F. Smith and H. Zhang}, 9377 journal = {SIAM Journal on Matrix Analysis and Applications}, 9378 year = {2015}, 9379 note = {To appear}, 9380 petsc_uses = {KSP} 9381} 9382 9383@Article{ bassi2014agglomeration, 9384 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 9385 free}, 9386 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 9387 journal = {Mathematical Models and Methods in Applied Sciences}, 9388 volume = {24}, 9389 number = {08}, 9390 pages = {1495--1539}, 9391 year = {2014}, 9392 publisher = {World Scientific}, 9393 petsc_uses = {KSP} 9394} 9395 9396@Article{ jhuranidemkowicz12, 9397 author = {{Jhurani}, C. and {Demkowicz}, L.}, 9398 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 9399 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 9400 journal = {Computer Methods in Applied Mechanics and Engineering}, 9401 volume = {213}, 9402 pages = {418-426}, 9403 year = {2012}, 9404 month = mar, 9405 doi = {10.1016/j.cma.2011.06.003}, 9406 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 9407 petsc_uses = {KSP} 9408} 9409 9410@Article{ yangcai11, 9411 author = {Yang, Haijian and Cai, Xiao-Chuan}, 9412 title = {Parallel Two-Grid Semismooth {N}ewton--{K}rylov--{S}chwarz Method for Nonlinear 9413 Complementarity Problems}, 9414 journal = {J. Sci. Comput.}, 9415 issue_date = {May 2011}, 9416 volume = {47}, 9417 number = {2}, 9418 month = may, 9419 pages = {258--280}, 9420 year = {2011}, 9421 issn = {0885-7474}, 9422 numpages = {23}, 9423 doi = {10.1007/s10915-010-9436-4}, 9424 acmid = {1971246}, 9425 publisher = {Plenum Press}, 9426 address = {New York, NY, USA}, 9427 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 9428 preconditioners, Semismooth Newton, Two-level methods}, 9429 petsc_uses = {KSP} 9430} 9431 9432@Article{ rheinbach09, 9433 author = {Rheinbach, Oliver}, 9434 title = {Parallel Iterative Substructuring in Structural Mechanics}, 9435 journal = {Archives of Computational Methods in Engineering}, 9436 volume = {16}, 9437 number = {4}, 9438 pages = {425-463}, 9439 year = {2009}, 9440 issn = {1134-3060}, 9441 doi = {10.1007/s11831-009-9035-4}, 9442 publisher = {Springer Netherlands}, 9443 language = {English}, 9444 petsc_uses = {KSP} 9445} 9446 9447@Article{ knepleyterrel2013, 9448 author = {Matthew G. Knepley and Andy R. Terrel}, 9449 title = {Finite Element Integration on {GPUs}}, 9450 journal = {{ACM} Transactions on Mathematical Software}, 9451 volume = {39}, 9452 number = {2}, 9453 accepted = {17 April 2012}, 9454 year = {2013}, 9455 abstract = {We present a novel finite element integration method for low order elements on 9456 GPUs. We achieve more than 100GF for element integration on first order 9457 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 9458 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 9459 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 9460 url = {http://arxiv.org/abs/1103.0066}, 9461 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 9462 petsc_uses = {KSP} 9463} 9464 9465@Article{ knepleyruppterrel2016, 9466 title = {Finite Element Integration with Quadrature on the GPU}, 9467 journal = {ArXiv e-prints}, 9468 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 9469 version = {1}, 9470 date = {2016-07-14}, 9471 eprinttype = {arxiv}, 9472 eprintclass = {cs.MS}, 9473 eprint = {1607.04245v1}, 9474 petsc_uses = {KSP} 9475} 9476 9477@Article{ klawonnlanserrheinbach2014, 9478 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 9479 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 9480 journal = {SIAM Journal on Scientific Computing}, 9481 volume = {36}, 9482 number = {2}, 9483 pages = {A737--A765}, 9484 year = {2014}, 9485 petsc_uses = {KSP} 9486} 9487 9488@Article{ bruneknepleysmithtu15, 9489 title = {Composing Scalable Nonlinear Algebraic Solvers}, 9490 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 9491 journal = {SIAM Review}, 9492 volume = {57}, 9493 number = {4}, 9494 pages = {535--565}, 9495 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 9496 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 9497 doi = {10.1137/130936725}, 9498 year = {2015}, 9499 petsc_uses = {KSP} 9500} 9501 9502@Article{ mszm2014, 9503 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 9504 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9505 volume = {40}, 9506 pages = {17--31}, 9507 year = {2014}, 9508 journal = {Parallel Computing}, 9509 doi = {10.1016/j.parco.2013.10.001}, 9510 petsc_uses = {KSP} 9511} 9512 9513@TechReport{ mszm2012, 9514 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 9515 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9516 year = {2012}, 9517 number = {ANL/MCS-P2097-0512}, 9518 institution = {Argonne National Laboratory}, 9519 petsc_uses = {KSP} 9520} 9521 9522@InProceedings{ bkmms2012, 9523 author = {Jed Brown and Matthew G. Knepley and David A. May and Lois C. McInnes and Barry 9524 F. Smith}, 9525 title = {Composable linear solvers for multiphysics}, 9526 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 9527 Computing} ({ISPDC} 2012)}, 9528 year = {2012}, 9529 doi = {10.1109/ISPDC.2012.16}, 9530 publisher = {IEEE Computer Society}, 9531 pages = {55--62}, 9532 petsc_uses = {KSP} 9533} 9534 9535@Article{ bourdinbucuroudet2009, 9536 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 9537 title = {Optimal Partitions for Eigenvalues}, 9538 journal = {SIAM J. Sci. Comput.}, 9539 volume = {31}, 9540 number = {6}, 9541 pages = {4100--4114}, 9542 year = {2009}, 9543 petsc_uses = {KSP} 9544} 9545 9546@InBook{ kimnbourdin2007, 9547 author = {J.-H. Kimn and Blaise Bourdin}, 9548 title = {Numerical implementation of overlapping balancing domain decomposition methods on 9549 unstructured meshes}, 9550 editor = {O. B. Widlund and D. E. Keyes}, 9551 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 9552 series = {Lecture Notes in Computational Science and Engineering}, 9553 number = {55}, 9554 publisher = {Springer-Verlag}, 9555 pages = {309--315}, 9556 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 9557 year = {2007}, 9558 petsc_uses = {KSP} 9559} 9560 9561@Article{ bjm2005, 9562 author = {AH Baker and ER Jessup and T Manteuffel}, 9563 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 9564 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 9565 year = {2005}, 9566 petsc_uses = {KSP} 9567} 9568 9569@Unpublished{ sundar-2008a, 9570 author = {R.S. Sampath and G. Biros}, 9571 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 9572 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9573 petsc_uses = {KSP} 9574} 9575 9576@Article{ sundar-2008, 9577 author = {H. Sundar and R.S. Sampath and G. Biros}, 9578 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 9579 journal = {SIAM Journal on Scientific Computing}, 9580 year = {2008}, 9581 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9582 petsc_uses = {KSP} 9583} 9584 9585@InProceedings{ sundar-2007, 9586 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 9587 title = {Low-constant parallel algorithms for finite element simulations using linear 9588 octrees}, 9589 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 9590 year = {2007}, 9591 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9592 petsc_uses = {KSP} 9593} 9594 9595@InProceedings{ adams-98a, 9596 author = {Adams, Mark ~F.}, 9597 title = {A Parallel Maximal Independent Set Algorithm}, 9598 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 9599 year = {1998}, 9600 petsc_uses = {KSP} 9601} 9602 9603@Article{ akcelik2005ddd, 9604 title = {{Dynamic data-driven inversion for terascale simulations: real-time 9605 identification of airborne contaminants}}, 9606 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 9607 van Bloemen Waanders, B.}, 9608 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 9609 year = {2005}, 9610 publisher = {IEEE Computer Society Washington, DC, USA}, 9611 petsc_uses = {KSP} 9612} 9613 9614@InBook{ akcelik-2006, 9615 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 9616 Bloemen Waanders}, 9617 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 9618 title = {Frontiers of Parallel Computing}, 9619 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 9620 publisher = {SIAM}, 9621 year = {2006}, 9622 petsc_uses = {KSP} 9623} 9624 9625@Article{ dt, 9626 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 9627 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 9628 Convection Diffusion Equations}, 9629 journal = {The Journal of Supercomputing}, 9630 year = {2004}, 9631 pages = {235--253}, 9632 volume = {28}, 9633 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 9634 petsc_uses = {KSP} 9635} 9636 9637@PhDThesis{ hwang2004, 9638 author = {Feng-Nan Hwang}, 9639 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 9640 Computational Fluid Dynamics}, 9641 school = {University of Colorado at Boulder}, 9642 year = {2004}, 9643 petsc_uses = {KSP} 9644} 9645 9646@PhDThesis{ baker, 9647 author = {{A. H.} Baker}, 9648 title = {On improving the performance of the linear solver restarted {GMRES}}, 9649 school = {University of Colorado at Boulder}, 9650 year = {2003}, 9651 petsc_uses = {KSP} 9652} 9653 9654@TechReport{ klawonnrheinbach601, 9655 author = {Axel Klawonn and Oliver Rheinbach}, 9656 title = {A Parallel Implementation of Dual-Primal {FETI-DP} Methods for Three Dimensional 9657 Linear Elasticity Using a Transformation of Basis}, 9658 institution = {Universit\"at Duisburg-Essen}, 9659 year = {2005}, 9660 type = {Technical Report}, 9661 number = {SM-E-601}, 9662 petsc_uses = {KSP} 9663} 9664 9665@TechReport{ klawonnrheinbach609, 9666 author = {Axel Klawonn and Oliver Rheinbach}, 9667 title = {Inexact FETI-DP Methods}, 9668 institution = {Universit\"at Duisburg-Essen}, 9669 year = {2005}, 9670 type = {Technical Report}, 9671 number = {SM-E-609}, 9672 petsc_uses = {KSP} 9673} 9674 9675@TechReport{ klawonnrheinbach607, 9676 author = {Axel Klawonn and Oliver Rheinbach}, 9677 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 9678 institution = {Universit\"at Duisburg-Essen}, 9679 year = {2005}, 9680 type = {Technical Report}, 9681 number = {SM-E-607}, 9682 petsc_uses = {KSP} 9683} 9684 9685@Article{ kul-natraj-pbp, 9686 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 9687 title = {Performance of a parallel mixed finite element implementation for fourth order 9688 clamped anisotropic plate bending problems in distributed memory environments}, 9689 journal = {Applied Mathematics and Computation}, 9690 volume = {155}, 9691 year = {2004}, 9692 number = {3}, 9693 pages = {753--777}, 9694 petsc_uses = {KSP} 9695} 9696 9697@Article{ bramkamp2006uej, 9698 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 9699 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 9700 journal = {Computers \& Fluids}, 9701 volume = {35}, 9702 number = {10}, 9703 pages = {1063--1073}, 9704 doi = {10.1016/j.compfluid.2005.10.003}, 9705 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 9706 derivation of the analytic flux Jacobian can become quite complicated depending on 9707 the complexity of the numerical flux calculation. Practically, the derivation of 9708 the exact Jacobian by hand is an unrealistic option because of the enormous 9709 man-hour investment needed. In this work, automatic differentiation is used to 9710 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 9711 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 9712 approximated by first-order forward differences. For a two-dimensional airfoil 9713 under three different flight conditions (quasi-incompressible flow, compressible 9714 subsonic flow, and transonic flow), we show that the robustness and performance of 9715 the present finite volume scheme is significantly improved by using exact 9716 Jacobians.}, 9717 year = {2006}, 9718 petsc_uses = {KSP} 9719} 9720 9721@Article{ shahbazi1, 9722 author = {Khosro Shahbazi}, 9723 title = {An explicit expression for the penalty parameter of the interior penalty method}, 9724 journal = {Journal of Computational Physics}, 9725 volume = {205}, 9726 year = {2005}, 9727 pages = {401--407}, 9728 petsc_uses = {KSP} 9729} 9730 9731@TechReport{ kk, 9732 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 9733 author = {Hans-Peter Kersken and Uwe Kuster}, 9734 year = {1999}, 9735 institution = {University of Stuttgart}, 9736 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 9737 number = {310}, 9738 petsc_uses = {KSP} 9739} 9740 9741@Article{ miha-mija, 9742 author = {M. D. Mihajlovi and S. Mijalkovi}, 9743 title = {A component decomposition preconditioning for 3D stress analysis problems}, 9744 journal = {Numerical Linear Algebra with Applications}, 9745 volume = {9}, 9746 year = {2002}, 9747 pages = {567--583}, 9748 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 9749 petsc_uses = {KSP} 9750} 9751 9752@Article{ bjm, 9753 author = {M Benzi and W Joubert and G Mateescu}, 9754 journal = {Electronic Transactions on Numerical Analysis}, 9755 year = {1999}, 9756 volume = {8}, 9757 pages = {88--114}, 9758 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 9759 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 9760 petsc_uses = {KSP} 9761} 9762 9763@PhDThesis{ hyde, 9764 author = {EMK Hyde}, 9765 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 9766 school = {Caltech}, 9767 year = {2003}, 9768 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 9769 petsc_uses = {KSP} 9770} 9771 9772@Article{ km2003, 9773 author = {A. Keese and H. G. Matthies}, 9774 journal = {Proceedings in Applied Mathematics and Mechanics}, 9775 year = {2003}, 9776 volume = {2}, 9777 pages = {485--486}, 9778 title = {Parallel Solution of Stochastic PDEs}, 9779 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 9780 petsc_uses = {KSP} 9781} 9782 9783@Article{ whszss, 9784 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 9785 and Otmar Scherzer and H. Siegfried Stiehl}, 9786 journal = {Real Time Imaging}, 9787 year = {2001}, 9788 volume = {7}, 9789 pages = {31--45}, 9790 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 9791 approaches}, 9792 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 9793 petsc_uses = {KSP} 9794} 9795 9796@TechReport{ baker1, 9797 title = {An Efficient Block Variant of GMRES}, 9798 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 9799 year = {2003}, 9800 type = {Technical Report}, 9801 institution = {University of Colorado, Boulder}, 9802 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 9803 number = {CU-CS-957-03}, 9804 petsc_uses = {KSP} 9805} 9806 9807@InProceedings{ mc2003, 9808 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 9809 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 9810 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9811 Methods}, 9812 pages = {639--646}, 9813 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9814 note = {}, 9815 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9816 year = {2003}, 9817 petsc_uses = {KSP} 9818} 9819 9820@InProceedings{ kt2003, 9821 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 9822 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 9823 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9824 Methods}, 9825 pages = {615--622}, 9826 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9827 note = {}, 9828 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9829 year = {2003}, 9830 petsc_uses = {KSP} 9831} 9832 9833@InProceedings{ krw2003, 9834 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 9835 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 9836 3D}, 9837 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9838 Methods}, 9839 pages = {361--368}, 9840 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9841 note = {}, 9842 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9843 year = {2003}, 9844 petsc_uses = {KSP} 9845} 9846 9847@InProceedings{ hc2003, 9848 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 9849 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 9850 Nonlinear Preconditioning}, 9851 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9852 Methods}, 9853 pages = {201--208}, 9854 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9855 note = {}, 9856 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9857 year = {2003}, 9858 petsc_uses = {KSP} 9859} 9860 9861@InProceedings{ g2003, 9862 author = {P. Goldfeld}, 9863 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 9864 (Generalized) {Stokes} and Parallel Implementation}, 9865 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9866 Methods}, 9867 pages = {209--216}, 9868 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9869 publisher = {National Autonomous University of Mexico (UNAM)}, 9870 note = {}, 9871 url = {http://www.ddm.org/DD14}, 9872 year = {2003}, 9873 petsc_uses = {KSP} 9874} 9875 9876@InProceedings{ dhv2003, 9877 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 9878 title = {Toward scalable {FETI} algorithm for variational inequalities with applications to 9879 composites}, 9880 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9881 Methods}, 9882 pages = {395--401}, 9883 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9884 publisher = {National Autonomous University of Mexico (UNAM)}, 9885 note = {}, 9886 url = {http://www.ddm.org/DD14}, 9887 year = {2003}, 9888 petsc_uses = {KSP} 9889} 9890 9891@InProceedings{ dhsv2002, 9892 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9893 title = {Scalabilities of {FETI} for variational inequalities and contact shape 9894 optimization}, 9895 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9896 Methods}, 9897 pages = {359--367}, 9898 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9899 publisher = {CIMNE, Barcelona, Spain}, 9900 note = {}, 9901 url = {http://www.ddm.org/DD13}, 9902 year = {2002}, 9903 petsc_uses = {KSP} 9904} 9905 9906@InProceedings{ cky2002, 9907 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 9908 title = {A Nonlinear Additive {S}chwarz Preconditioned Inexact {N}ewton Method for Shocked 9909 Duct Flows}, 9910 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9911 Methods}, 9912 pages = {343--350}, 9913 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9914 publisher = {CIMNE, Barcelona, Spain}, 9915 note = {}, 9916 url = {http://www.ddm.org/DD13}, 9917 year = {2002}, 9918 petsc_uses = {KSP} 9919} 9920 9921@Conference{ li-etal:03, 9922 author = {Li, Z. and Lanteri S. and Saad, Y.}, 9923 title = {Multiplicative-additive preconditioning combination for general sparse linear 9924 systems}, 9925 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 9926 Matrix Problems in Scientific and Industrial Applications}, 9927 address = {Napa, California, USA}, 9928 date = {october 27-29}, 9929 year = {2003}, 9930 petsc_uses = {KSP} 9931} 9932 9933@Article{ bashir2008hessian, 9934 title = {Hessian-based model reduction for large-scale systems with initial-condition 9935 inputs}, 9936 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 9937 J.}, 9938 journal = {International journal for numerical methods in engineering}, 9939 volume = {73}, 9940 number = {6}, 9941 pages = {844--868}, 9942 year = {2008}, 9943 publisher = {Wiley Online Library}, 9944 petsc_uses = {KSP} 9945} 9946 9947@Article{ bashir2007hessian, 9948 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 9949 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 9950 K.}, 9951 journal = {Computational Science--ICCS 2007}, 9952 pages = {1010--1017}, 9953 year = {2007}, 9954 publisher = {Springer}, 9955 petsc_uses = {KSP} 9956} 9957 9958@Article{ akcelik2011fast, 9959 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 9960 inverse problems based on low-rank partial {H}essian approximations}, 9961 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 9962 Waanders, B. and Wilcox, L.}, 9963 journal = {SIAM Journal on Scientific Computing}, 9964 volume = {33}, 9965 number = {1}, 9966 year = {2011}, 9967 petsc_uses = {KSP} 9968} 9969 9970@InProceedings{ ff2003, 9971 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 9972 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 9973 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 9974 year = {2003}, 9975 petsc_uses = {KSP} 9976} 9977 9978@InProceedings{ d2b2004, 9979 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 9980 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 9981 Ordering Strategies}, 9982 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 9983 year = {2004}, 9984 petsc_uses = {KSP} 9985} 9986 9987@InProceedings{ d2v2005, 9988 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 9989 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 9990 Flow Equations}, 9991 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 9992 year = {2005}, 9993 petsc_uses = {KSP} 9994} 9995 9996@InProceedings{ dvs2006, 9997 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 9998 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 9999 Mixed Convection Equations}, 10000 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 10001 year = {2006}, 10002 petsc_uses = {KSP} 10003} 10004 10005@Article{ dsv2006, 10006 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 10007 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 10008 Flow Equations}, 10009 journal = {Computational Fluid Dynamics}, 10010 year = {2006}, 10011 volume = {15}, 10012 number = {1}, 10013 petsc_uses = {KSP} 10014} 10015 10016@Article{ lahaye03, 10017 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 10018 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10019 journal = {J. Comput. Appl. Math.}, 10020 year = {2004}, 10021 pages = {267--275}, 10022 volume = {168}, 10023 petsc_uses = {KSP} 10024} 10025 10026@TechReport{ brmn, 10027 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 10028 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 10029 year = {2002}, 10030 type = {Technical Report}, 10031 institution = {ANL}, 10032 number = {ANL/MCS-P993-0902}, 10033 note = {To appear in Future Generation Computer Systems}, 10034 petsc_uses = {KSP} 10035} 10036 10037@InProceedings{ mnbr, 10038 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 10039 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 10040 Algorithms}, 10041 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 10042 Mechanics}, 10043 year = {2003}, 10044 petsc_uses = {KSP} 10045} 10046 10047@InProceedings{ bmnr, 10048 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 10049 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 10050 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 10051 Applications, Lecture notes in Computer Science 2677}, 10052 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 10053 pages = {828--839}, 10054 year = {2003}, 10055 petsc_uses = {KSP} 10056} 10057 10058@Article{ ph03, 10059 author = {M. Pernice and R. D. Hornung}, 10060 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 10061 journal = {Computing and Visualization in Science}, 10062 year = {2003}, 10063 lab = {LANL}, 10064 petsc_uses = {KSP} 10065} 10066 10067@Article{ adams-02, 10068 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 10069 journal = {J. Comp. Phys.}, 10070 number = {2}, 10071 pages = {593-610}, 10072 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 10073 volume = {188}, 10074 year = {2003}, 10075 petsc_uses = {KSP} 10076} 10077 10078@InProceedings{ adams2001distributed, 10079 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 10080 smoothers}, 10081 author = {Adams, M.F.}, 10082 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 10083 pages = {14--14}, 10084 year = {2001}, 10085 organization = {IEEE}, 10086 petsc_uses = {KSP} 10087} 10088 10089@PhDThesis{ els01, 10090 author = {Ulrich Elsner}, 10091 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 10092 algorithms}, 10093 school = {Technical University Chemnitz}, 10094 year = {2002}, 10095 publisher = {Logos Verlag, Berlin}, 10096 isbn = {3-89722-923-4}, 10097 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 10098 different graph partitioning algorithms}, 10099 petsc_uses = {KSP} 10100} 10101 10102@TechReport{ ckk02, 10103 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 10104 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 10105 year = {2002}, 10106 type = {Technical Report}, 10107 institution = {ODU}, 10108 url = {http://www.math.odu.edu/\~{ }keyes}, 10109 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 10110 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 10111 Methods}, 10112 petsc_uses = {KSP} 10113} 10114 10115@Article{ gpw2002, 10116 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 10117 Heterogeneous Problems in Linear Elasticity}, 10118 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 10119 year = {2003}, 10120 pages = {283--324}, 10121 volume = {95}, 10122 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 10123 journal = {Numerische Mathematik}, 10124 petsc_uses = {KSP} 10125} 10126 10127@Article{ dh1, 10128 title = {Scalability and FETI based algorithm for large discretized variational 10129 inequalities}, 10130 author = {Z Dostal and D Horak}, 10131 year = {2003}, 10132 pages = {347--357}, 10133 volume = {61}, 10134 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 10135 journal = {Mathematics and Computers in Simulation}, 10136 petsc_uses = {KSP} 10137} 10138 10139@InProceedings{ dhsv1, 10140 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 10141 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 10142 title = {36 Scalabilities of {FETI} for Variational Inequalities and Contact Shape 10143 Optimization}, 10144 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10145 Methods}, 10146 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10147 Kuznetsov}, 10148 petsc_uses = {KSP} 10149} 10150 10151@Article{ lahaye02, 10152 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 10153 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 10154 journal = {IEEEMAGN}, 10155 year = {2002}, 10156 volume = {38}, 10157 number = {2}, 10158 pages = {413-416}, 10159 petsc_uses = {KSP} 10160} 10161 10162@Article{ ckm01, 10163 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 10164 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 10165 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 10166 fluid dynamics}, 10167 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 10168 year = {2002}, 10169 volume = {40}, 10170 pages = {1463--1470}, 10171 petsc_uses = {KSP} 10172} 10173 10174@InProceedings{ cky01, 10175 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 10176 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 10177 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 10178 duct flow}, 10179 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 10180 Methods}, 10181 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10182 Kuznetsov}, 10183 year = {2002}, 10184 petsc_uses = {KSP} 10185} 10186 10187@Article{ ck02, 10188 author = {X.-C. Cai and D. E. Keyes}, 10189 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 10190 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 10191 journal = {SIAM J. Sci. Comput.}, 10192 year = {2002}, 10193 pages = {183--200}, 10194 volume = {24}, 10195 petsc_uses = {KSP} 10196} 10197 10198@Article{ c04, 10199 author = {Feng-Nan Hwang and X.-C. Cai}, 10200 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 10201 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 10202 for incompressible {Navier-Stokes} equations}, 10203 journal = {Journal of Computational Physics}, 10204 year = {2005}, 10205 volume = {204}, 10206 pages = {666--691}, 10207 petsc_uses = {KSP} 10208} 10209 10210@Article{ hc06, 10211 author = {Feng-Nan Hwang and X.-C. Cai}, 10212 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 10213 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 10214 Algorithms}, 10215 journal = {Computer Methods in Applied Mechanics and Engineering}, 10216 year = {2006}, 10217 volume = {196}, 10218 pages = {1603--1611}, 10219 petsc_uses = {KSP} 10220} 10221 10222@InProceedings{ adams-01, 10223 author = {Mark F. Adams}, 10224 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 10225 Smoothers}, 10226 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 10227 address = {Denver, Colorado}, 10228 month = nov, 10229 year = {2001}, 10230 petsc_uses = {KSP} 10231} 10232 10233@Book{ 1dl, 10234 author = {Domenico Lahaye}, 10235 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 10236 Computations}, 10237 year = {2001}, 10238 publisher = {Katholieke Universiteit Leuven}, 10239 notes = {Thesis}, 10240 petsc_uses = {KSP} 10241} 10242 10243@Article{ adams-00, 10244 author = {Adams, M.~F.}, 10245 journal = {International Journal for Numerical Methods in Engineering}, 10246 number = {8}, 10247 pages = {1241-1262}, 10248 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 10249 Deformation Elasticity and Plasticity}, 10250 volume = {48}, 10251 year = {2000}, 10252 petsc_uses = {KSP} 10253} 10254 10255@Article{ adams2002evaluation, 10256 author = {Adams, M.~F.}, 10257 journal = {International Journal for Numerical Methods in Engineering}, 10258 number = {1}, 10259 pages = {519-534}, 10260 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 10261 Problems in Solid Mechanics}, 10262 volume = {55}, 10263 year = {2002}, 10264 petsc_uses = {KSP} 10265} 10266 10267@Article{ lahaye00, 10268 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 10269 title = {Algebraic Multigrid for Complex Symmetric Systems}, 10270 journal = {IEEEMAGN}, 10271 year = {2000}, 10272 volume = {36}, 10273 number = {4}, 10274 pages = {1535--1538}, 10275 petsc_uses = {KSP} 10276} 10277 10278@InProceedings{ adams-99c, 10279 author = {Mark F. Adams and J. Demmel}, 10280 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 10281 Finite Element Problems}, 10282 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 10283 address = {Portland, Oregon}, 10284 month = nov, 10285 year = {1999}, 10286 petsc_uses = {KSP} 10287} 10288 10289@Article{ chan95, 10290 author = {T. Chan and B. Smith and J. Zou}, 10291 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 10292 Grids}, 10293 journal = {Numer. Math.}, 10294 year = {1995}, 10295 volume = {73}, 10296 pages = {149--167}, 10297 petsc_uses = {KSP} 10298} 10299 10300@TechReport{ adams-csd-98-993, 10301 pages = {11}, 10302 year = {1998}, 10303 type = {Technical Report}, 10304 number = {CSD-98-993}, 10305 institution = {University of California, Berkeley}, 10306 title = {A Parallel Maximal Independent Set Algorithm}, 10307 bibdate = {March 11, 1998}, 10308 author = {Mark F. Adams and James Demmel}, 10309 abstract = {The parallel construction of maximal independent sets is a useful building block 10310 for many algorithms in the computational sciences, including graph coloring and 10311 multigrid coarse grid creation on unstructured meshes. We present an efficient 10312 asynchronous maximal independent set algorithm for use on parallel computers, for 10313 ``well partitioned'' graphs, that arise from finite element (FE) models. For 10314 appropriately partitioned bounded degree graphs, it is shown that the running time 10315 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 10316 improvement over the previous best P-RAM complexity for this class of graphs. We 10317 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 10318 model is indicative of the performance one can expect with practical partitions on 10319 graphs from FE problems.}, 10320 month = mar, 10321 petsc_uses = {KSP} 10322} 10323 10324@Article{ benzigolubliesen2005, 10325 title = {Numerical solution of saddle point problems}, 10326 author = {Michele Benzi and Gene H. Golub and J\"org Liesen}, 10327 volume = {14}, 10328 journal = {Acta Numerica}, 10329 pages = {1-–137}, 10330 doi = {10.1017/S0962492904000212}, 10331 year = {2005} 10332} 10333 10334@Article{ mardal2011preconditioning, 10335 title = {Preconditioning discretizations of systems of partial differential equations}, 10336 author = {Kent-Andre Mardal and Ragnar Winther}, 10337 journal = {Numerical Linear Algebra with Applications}, 10338 volume = {18}, 10339 number = {1}, 10340 pages = {1--40}, 10341 year = {2011} 10342} 10343 10344@TechReport{ k676, 10345 year = {1994}, 10346 type = {Technical Report}, 10347 number = {TR1994-676}, 10348 institution = {New York University}, 10349 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 10350 Term}, 10351 author = {Axel Klawonn}, 10352 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 10353 petsc_uses = {KSP} 10354} 10355 10356@Book{ ak1, 10357 author = {Axel Klawonn}, 10358 title = {Preconditioners for Indefinite Problems}, 10359 year = {1995}, 10360 publisher = {Westfalishen Wilhelms-Universitat Munster}, 10361 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 10362 notes = {Thesis}, 10363 petsc_uses = {KSP} 10364} 10365 10366@TechReport{ knepleykarpeev05, 10367 pages = {41}, 10368 year = {2005}, 10369 type = {Technical Report}, 10370 number = {ANL/MCS-P1295-1005}, 10371 institution = {Argonne National Laboratory}, 10372 title = {Flexible Representation of Computational Meshes}, 10373 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10374 abstract = {}, 10375 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 10376 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 10377 month = oct, 10378 petsc_uses = {DMPlex} 10379} 10380 10381@TechReport{ knepleykarpeev07a, 10382 pages = {14}, 10383 year = {2007}, 10384 type = {Technical Report}, 10385 number = {ANL/MCS-P1455-0907}, 10386 institution = {Argonne National Laboratory}, 10387 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10388 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10389 abstract = {}, 10390 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 10391 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 10392 month = feb, 10393 petsc_uses = {DMPlex} 10394} 10395 10396@Article{ knepleykarpeev09, 10397 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10398 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10399 journal = {Scientific Programming}, 10400 volume = {17}, 10401 number = {3}, 10402 pages = {215--230}, 10403 year = {2009}, 10404 doi = {10.3233/SPR-2009-0249}, 10405 url = {http://arxiv.org/abs/0908.4427}, 10406 note = {\url{http://arxiv.org/abs/0908.4427}}, 10407 petsc_uses = {DMPlex} 10408} 10409 10410@Article{ biezuner2012computing, 10411 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 10412 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 10413 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 10414 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 10415 Sublinear Supersolutions}, 10416 journal = {Journal of Scientific Computing}, 10417 publisher = {Springer Netherlands}, 10418 issn = {0885-7474}, 10419 keyword = {Mathematics and Statistics}, 10420 pages = {180--201}, 10421 volume = {52}, 10422 issue = {1}, 10423 year = {2012}, 10424 doi = {10.1007/s10915-011-9540-0}, 10425 petsc_uses = {KSP} 10426} 10427 10428% LiteralHTML: 10429% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 10430% LiteralHTML: 10431@Book{ knepley2017, 10432 title = {Computational Science I}, 10433 author = {Matthew G. Knepley}, 10434 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 10435 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 10436 publisher = {PETSc}, 10437 year = {2017}, 10438 petsc_uses = {KSP} 10439} 10440 10441@Article{ verleyeuser, 10442 title = {{User friendly permeability predicting software for technical textiles}}, 10443 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 10444 Roose, D.}, 10445 journal = {status: published}, 10446 issn = {1560-6074}, 10447 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 10448 petsc_uses = {KSP} 10449} 10450 10451@Book{ pacheco, 10452 author = {Peter Pacheco}, 10453 title = {Parallel Programming with MPI}, 10454 year = {1997}, 10455 publisher = {Morgan-Kaufmann}, 10456 note = {Devotes a couple of sections to PETSc}, 10457 petsc_uses = {KSP} 10458} 10459 10460@Book{ 1sbg, 10461 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 10462 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 10463 Differential Equations}, 10464 year = {1996}, 10465 publisher = {Cambridge University Press}, 10466 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 10467 petsc_uses = {KSP} 10468} 10469 10470@Misc{ petsc-fem:homepage, 10471 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 10472 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 10473 G. Rodriguez and G. Filippini}, 10474 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 10475 petsc_uses = {KSP} 10476} 10477 10478@Misc{ petsc4py-web-page, 10479 author = {Lisandro Dalcin}, 10480 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 10481 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 10482 note = {http://code.google.com/p/petsc4py/}, 10483 petsc_uses = {KSP} 10484} 10485 10486@Article{ libmeshpaper06, 10487 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 10488 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 10489 Simulations}}, 10490 journal = {Engineering with Computers}, 10491 volume = {22}, 10492 number = {3--4}, 10493 pages = {237--254}, 10494 year = {2006}, 10495 doi = {10.1007/s00366-006-0049-3}, 10496 petsc_uses = {KSP} 10497} 10498 10499@Misc{ sisiphus:homepage, 10500 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 10501 High-Resolution, Unstructured Simulations}, 10502 author = {T. {Tautges et al.}}, 10503 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 10504 petsc_uses = {KSP} 10505} 10506 10507@Misc{ pflotran:homepage, 10508 title = {{PFLOTRAN} project}, 10509 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 10510 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 10511 howpublished = {\url{http://pflotran.org/}}, 10512 petsc_uses = {KSP} 10513} 10514 10515@Misc{ pism:homepage, 10516 title = {{PISM}: A Parallel Ice Sheet Model}, 10517 author = {E. {Bueler et al.}}, 10518 howpublished = {\url{http://pism-docs.org}}, 10519 petsc_uses = {KSP} 10520} 10521 10522@Misc{ dohp:homepage, 10523 title = {Dohp: Dual order $hp$-finite elements}, 10524 author = {J. Brown}, 10525 howpublished = {\url{http://dohp.org}}, 10526 petsc_uses = {KSP} 10527} 10528 10529@Article{ mccourtrognlienetal12, 10530 title = {Improving parallel scalability for edge plasma transport simulations with neutral 10531 gas species}, 10532 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 10533 journal = {Computational Science and Discovery}, 10534 year = {2012}, 10535 volume = {5}, 10536 number = {014012}, 10537 doi = {10.1088/1749-4699/5/1/014012}, 10538 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 10539 2011)}, 10540 petsc_uses = {KSP} 10541} 10542 10543@Misc{ petclaw-github, 10544 title = {Pet{C}law Software}, 10545 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 10546 year = {2011}, 10547 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 10548 petsc_uses = {KSP} 10549} 10550 10551@Misc{ pyclaw-web-page, 10552 author = {Kyle T. Mandli and David I. Ketcheson and others}, 10553 title = {{PyClaw} software}, 10554 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 10555 url = {http://clawpack.github.io/doc/pyclaw/}, 10556 year = {2012}, 10557 petsc_uses = {KSP} 10558} 10559 10560@Article{ ketcheson2011highorder, 10561 title = {High-order wave propagation algorithms for general hyperbolic systems}, 10562 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 10563 year = {2011}, 10564 note = {submitted}, 10565 petsc_uses = {KSP} 10566} 10567 10568@Article{ biros2005pln1, 10569 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 10570 optimization. Part I: The {Krylov-Schur} solver}}, 10571 author = {Biros, G. and Ghattas, O.}, 10572 journal = {SIAM Journal on Scientific Computing}, 10573 volume = {27}, 10574 number = {2}, 10575 pages = {687--713}, 10576 year = {2005}, 10577 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10578 petsc_uses = {KSP} 10579} 10580 10581@Article{ biros2005pln2, 10582 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 10583 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 10584 optimal control of steady viscous flows}, 10585 author = {Biros, G. and Ghattas, O.}, 10586 journal = {SIAM Journal on Scientific Computing}, 10587 volume = {27}, 10588 number = {2}, 10589 pages = {714--739}, 10590 year = {2005}, 10591 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10592 petsc_uses = {KSP} 10593} 10594 10595@Misc{ issm:homepage, 10596 title = {{I}ce {S}heet {S}ystem {M}odel}, 10597 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 10598 year = {2010}, 10599 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 10600 petsc_uses = {KSP} 10601} 10602 10603@Article{ morlighem2010spatial, 10604 title = {Spatial patterns of basal drag inferred using control methods from a 10605 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 10606 {A}ntarctica}, 10607 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 10608 Aubry, D.}, 10609 journal = {Geophysical Research Letters}, 10610 volume = {37}, 10611 number = {14}, 10612 pages = {L14502}, 10613 year = {2010}, 10614 publisher = {American Geophysical Union}, 10615 petsc_uses = {KSP} 10616} 10617 10618@Article{ jardin2012plasmas, 10619 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 10620 of tokamak plasmas}, 10621 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 10622 journal = {Computational Science \& Discovery}, 10623 volume = {5}, 10624 number = {1}, 10625 url = {http://stacks.iop.org/1749-4699/5/014002}, 10626 year = {2012}, 10627 petsc_uses = {KSP} 10628} 10629 10630@Article{ cmz2016, 10631 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10632 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 10633 journal = {Journal of Scientific Computing}, 10634 publisher = {Springer}, 10635 pages = {803--825}, 10636 volume = {68}, 10637 issue = {2}, 10638 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 10639 doi = {10.1007/s10915-015-0159-4}, 10640 year = {2016}, 10641 note = {Also preprint ANL/MCS-P3039-0912}, 10642 petsc_uses = {KSP} 10643} 10644 10645@Article{ knepleybrownruppsmith13, 10646 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 10647 title = {Achieving High Performance with Unified Residual Evaluation}, 10648 journal = {ArXiv e-prints}, 10649 eprint = {1309.1204}, 10650 archiveprefix = {arXiv}, 10651 primaryclass = {cs.MS}, 10652 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 10653 Engineering, Finance, and Science}, 10654 year = {2013}, 10655 month = sep, 10656 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 10657 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10658 petsc_uses = {KSP} 10659} 10660 10661@Book{ fenicsbook, 10662 title = {Automated Solution of Differential Equations by the Finite Element Method: The 10663 FEniCS Book}, 10664 series = {Lecture Notes in Computational Science and Engineering}, 10665 volume = {84}, 10666 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 10667 publisher = {Springer}, 10668 isbn = {978-3-642-23098-1}, 10669 year = {2012}, 10670 petsc_uses = {KSP} 10671} 10672 10673@Article{ demidovahnertruppgottschling12, 10674 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 10675 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 10676 journal = {ArXiv e-prints}, 10677 archiveprefix = {arXiv}, 10678 eprint = {1212.6326}, 10679 primaryclass = {cs.MS}, 10680 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 10681 Parallel, and Cluster Computing, Physics - Computational Physics}, 10682 year = {2012}, 10683 month = dec, 10684 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 10685 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10686 petsc_uses = {KSP} 10687} 10688 10689@InProceedings{ viennacl, 10690 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 10691 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 10692 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 10693 year = {2010}, 10694 pages = {51-56}, 10695 petsc_uses = {KSP} 10696} 10697 10698@Article{ knepleybrownmcinnessmithruppadams2015, 10699 title = {Exascale Computing without Threads}, 10700 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10701 Karl Rupp and Mark Adams}, 10702 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 10703 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10704 Scientific Software Architecture for Portability and Performance}, 10705 doi = {10.6084/m9.figshare.5824950.v1}, 10706 year = {2015}, 10707 petsc_uses = {KSP} 10708} 10709 10710@Article{ knepleybrownmcinnessmithruppadams2015b, 10711 title = {Overview of the {PETSc} Library}, 10712 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10713 Karl Rupp and Mark Adams}, 10714 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 10715 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10716 Scientific Software Architecture for Portability and Performance}, 10717 year = {2015}, 10718 petsc_uses = {KSP} 10719} 10720 10721@InCollection{ balaybrownknepleymcinnessmith2015, 10722 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 10723 Smith}, 10724 title = {Providing Mixed Language and Legacy Support within a Library}, 10725 editor = {J. Carver}, 10726 booktitle = {Software Engineering for Science}, 10727 publisher = {Taylor \& Francis}, 10728 year = {2015}, 10729 petsc_uses = {KSP} 10730} 10731 10732@Article{ ruppbalaybrownknepleymcinnessmith2015, 10733 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 10734 Software}, 10735 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 10736 McInnes and Barry F. Smith}, 10737 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 10738 Productivity Challenges}, 10739 journal = {ArXiv e-prints}, 10740 archiveprefix = {arXiv}, 10741 eprint = {1510.01122}, 10742 year = {2015}, 10743 petsc_uses = {KSP} 10744} 10745 10746@InProceedings{ knepley2013accurately, 10747 title = {Accurately Citing Software and Algorithms Used in Publications}, 10748 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 10749 F.}, 10750 year = {2013}, 10751 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10752 (WSSSPE), held at SC13}, 10753 doi = {10.6084/m9.figshare.785731}, 10754 petsc_uses = {KSP} 10755} 10756 10757@InProceedings{ milleretal2013, 10758 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 10759 Strategies Developed for {FASTMath}}, 10760 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 10761 Barry Smith}, 10762 year = {2013}, 10763 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10764 (WSSSPE), held at SC13}, 10765 doi = {10.6084/m9.figshare.789055}, 10766 petsc_uses = {KSP} 10767} 10768 10769@TechReport{ dudsonetal2012, 10770 title = {Improved Nonlinear Solvers in {BOUT++}}, 10771 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 10772 institution = {Argonne National Laboratory}, 10773 number = {ANL/MCS-P3025-0812}, 10774 year = {2012}, 10775 petsc_uses = {KSP} 10776} 10777 10778@Misc{ brown13, 10779 author = {J. Brown}, 10780 title = {Scalable Repository Workflows}, 10781 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10782 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10783 year = {2013}, 10784 petsc_uses = {KSP} 10785} 10786 10787@Misc{ starforest11, 10788 title = {Star forests as a parallel communication model}, 10789 author = {Jed Brown}, 10790 url = {https://jedbrown.org/files/StarForest.pdf}, 10791 year = {2011}, 10792 petsc_uses = {KSP} 10793} 10794 10795@Misc{ brownknepleysmith13, 10796 author = {J. Brown and M. Knepley and B. Smith}, 10797 title = {Run-time Extensibility: Anything Less is Unsustainable}, 10798 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10799 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10800 year = {2013}, 10801 petsc_uses = {KSP} 10802} 10803 10804@Article{ jzhaoyliwkliu15, 10805 author = {J. Zhao and Y. Li and W.K. Liu}, 10806 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 10807 via {XFEM}}, 10808 journal = {Computational Mechanics}, 10809 year = {2015}, 10810 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 10811 petsc_uses = {KSP} 10812} 10813 10814@Article{ alisic14, 10815 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 10816 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 10817 journal = {J. Geophys. Res.}, 10818 year = {2014}, 10819 volume = {119}, 10820 number = {7}, 10821 pages = {5903-5920}, 10822 doi = {10.1002/2013JB010906}, 10823 petsc_uses = {KSP} 10824} 10825 10826@Article{ rhebergen14, 10827 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 10828 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 10829 journal = {SIAM J. Sci. Comp.}, 10830 year = {2014}, 10831 volume = {36}, 10832 number = {4}, 10833 pages = {1960-1977}, 10834 doi = {10.1137/130946678}, 10835 petsc_uses = {KSP} 10836} 10837 10838@Article{ allwright14, 10839 author = {J. Allwright and R.F. Katz}, 10840 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 10841 journal = {Geophys. J. Int.}, 10842 year = {2014}, 10843 volume = {199}, 10844 number = {3}, 10845 pages = {1608--1624}, 10846 doi = {10.1093/gji/ggu345}, 10847 petsc_uses = {KSP} 10848} 10849 10850@Misc{ gropp10, 10851 author = {William D. Gropp}, 10852 title = {Update on libraries for {B}lue {W}aters}, 10853 address = {Bordeaux, France}, 10854 year = {2010}, 10855 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 10856 petsc_uses = {KSP} 10857} 10858 10859@InProceedings{ mayknepley2017, 10860 title = {{DMSwarm}: Particles in {PETSc}}, 10861 author = {Dave A May and Matthew G Knepley}, 10862 booktitle = {EGU General Assembly Conference Abstracts}, 10863 volume = {19}, 10864 pages = {10133}, 10865 year = {2017}, 10866 petsc_uses = {KSP} 10867} 10868 10869@InProceedings{ adamsbrownknepley2013, 10870 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 10871 title = {Low-communication techniques for extreme-scale multilevel solvers}, 10872 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 10873 organization = {DOE Office of Advanced Scientific Computing Research}, 10874 year = {2013}, 10875 petsc_uses = {KSP} 10876} 10877 10878@Article{ bhallagriffithknepleyadamsguy2017, 10879 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 10880 boundary equations}, 10881 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 10882 Adams and Robert D. Guy}, 10883 journal = {arXiv e-prints}, 10884 eprint = {1612.02208}, 10885 year = {2017}, 10886 note = {\url{http://arxiv.org/abs/1612.02208}}, 10887 petsc_uses = {KSP} 10888} 10889 10890@Article{ zampini2016pcbddc, 10891 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 10892 author = {Zampini, Stefano}, 10893 journal = {SIAM Journal on Scientific Computing}, 10894 volume = {38}, 10895 number = {5}, 10896 pages = {S282--S306}, 10897 year = {2016}, 10898 publisher = {SIAM}, 10899 petsc_uses = {KSP} 10900} 10901 10902@Article{ jolivetromanzampini2020, 10903 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 10904 robust multilevel overlapping {Schwarz} preconditioners}, 10905 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 10906 journal = {Computers and Mathematics with Applications}, 10907 volume = {84}, 10908 pages = {277--295}, 10909 year = {2020} 10910} 10911 10912@Article{ zampinitu2017, 10913 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 10914 porous media}, 10915 author = {Stefano Zampini and Xuemin Tu}, 10916 journal = {SIAM Journal of Scientific Computing}, 10917 volume = {39}, 10918 number = {4}, 10919 pages = {A1389--A1415}, 10920 year = {2017} 10921} 10922 10923@Article{ ohwidlundzampinidohrmann2017, 10924 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 10925 constraints for {Raviart-Thomas} vector fields}, 10926 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 10927 journal = {Mathematics of Computation}, 10928 volume = {87}, 10929 number = {310}, 10930 pages = {659--692}, 10931 year = {2017} 10932} 10933 10934@Article{ veigapavarinoscacchiwidlundzampini2016, 10935 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 10936 preconditioners}, 10937 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 10938 Stefano Zampini}, 10939 journal = {SIAM Journal of Scientific Computing}, 10940 volume = {39}, 10941 number = {1}, 10942 pages = {A281--A302}, 10943 year = {2016} 10944} 10945 10946@Article{ pavarinoscacchiwidlundzampini2018, 10947 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 10948 analysis}, 10949 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 10950 journal = {Mathematical Models and Methods in Applied Sciences}, 10951 volume = {28}, 10952 number = {7}, 10953 pages = {1337--1370}, 10954 year = {2018} 10955} 10956 10957@Article{ bergervergiatwaisman2017, 10958 title = {An overlapping Domain Decomposition preconditioning method for monolithic 10959 solution of shear bands}, 10960 author = {Luc Berger-Vergiat and Haim Waisman}, 10961 journal = {Computer Methods in Applied Mechanics and Engineering}, 10962 volume = {318}, 10963 pages = {33--60}, 10964 year = {2017}, 10965 petsc_uses = {KSP} 10966} 10967 10968@Article{ abhyankarmaldonadosmithzhang2020, 10969 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 10970 Simulations}, 10971 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 10972 H. Zhang}, 10973 journal = {ACM Transactions on Mathematical Software}, 10974 volume = {46}, 10975 number = {1}, 10976 year = {2020}, 10977 doi = {10.1145/3344587}, 10978 petsc_uses = {KSP} 10979} 10980 10981@InProceedings{ zhangellpack2018, 10982 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 10983 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 10984 {AVX-512}}, 10985 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 10986 year = {2018}, 10987 petsc_uses = {KSP} 10988} 10989 10990@Misc{ petsc-user-meetings:website, 10991 title = {{PETSc User Meetings}}, 10992 key = {PETSc User Meetings}, 10993 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 10994 petsc_uses = {KSP} 10995} 10996 10997@Article{ flexible-bicgstab-chen16, 10998 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10999 author = {J. Chen and L.C. McInnes and H. Zhang}, 11000 journal = {Journal of Scientific Computing}, 11001 volume = {68}, 11002 number = {2}, 11003 month = jul, 11004 year = {2016}, 11005 pages = {803--825}, 11006 doi = {10.1007/s10915-015-0159-4}, 11007 petsc_uses = {KSP} 11008} 11009 11010@Misc{ petsc-extensibility2016, 11011 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 11012 title = {{Extensibility in PETSc}}, 11013 note = {SIAM News, available via 11014 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 11015 year = {2016}, 11016 petsc_uses = {KSP} 11017} 11018 11019@Misc{ error-estimation-whitepaper2017, 11020 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 11021 title = {End-to-end error estimation and control}, 11022 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 11023 doi = {10.6084/m9.figshare.5339866}, 11024 year = {2017}, 11025 petsc_uses = {KSP} 11026} 11027 11028@Misc{ petsc-user-support15, 11029 title = {On the Evolution of User Support Topics in Computational Science and Engineering 11030 Software}, 11031 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 11032 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 11033 15-16, 2015}, 11034 year = {2015}, 11035 petsc_uses = {KSP} 11036} 11037 11038@InBook{ petsc-mixed-language-support2016, 11039 title = {Numerical Library Support for High-Performance Mixed Language Applications and 11040 Legacy Code}, 11041 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 11042 booktitle = {Software Engineering for Science}, 11043 editors = {J. Carver et al.}, 11044 publisher = {CRC Press}, 11045 pages = {201--214}, 11046 year = {2016}, 11047 petsc_uses = {KSP} 11048} 11049 11050@InProceedings{ konolige2018parallel, 11051 title = {A Parallel Solver for Graph {L}aplacians}, 11052 author = {Tristan Konolige and Jed Brown}, 11053 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 11054 doi = {10.1145/3218176.3218227}, 11055 note = {Best Paper Award}, 11056 archiveprefix = {arXiv}, 11057 eprint = {1705.06266}, 11058 year = {2018}, 11059 petsc_uses = {KSP} 11060} 11061 11062@InProceedings{ werner-kimn2019, 11063 title = {Parallel implementation of {AC} optimal power flow and time-constrained optimal 11064 power flow using high-performance computing}, 11065 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 11066 Jung-Han Kimn}, 11067 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 11068 note = {Best Paper in Track}, 11069 year = {2019}, 11070 petsc_uses = {KSP} 11071} 11072 11073@MastersThesis{ rinaldo-ceresoli18, 11074 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 11075 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 11076 Applications}, 11077 school = {Politecnico di Milano}, 11078 year = {2018}, 11079 month = apr, 11080 petsc_uses = {KSP} 11081} 11082 11083@Article{ sananschneppmay2016, 11084 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 11085 author = {P. Sanan and S. M. Schnepp and D. A. May}, 11086 journal = {SIAM Journal on Scientific Computing}, 11087 volume = {38}, 11088 number = {5}, 11089 pages = {C441-C470}, 11090 year = {2016}, 11091 doi = {10.1137/15M1049130}, 11092 petsc_uses = {KSP} 11093} 11094 11095@Article{ petscsf2022, 11096 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 11097 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 11098 Smith, Barry F. and Zampini, Stefano}, 11099 journal = {IEEE Transactions on Parallel and Distributed Systems}, 11100 title = {The {PetscSF} Scalable Communication Layer}, 11101 year = {2022}, 11102 volume = {33}, 11103 number = {4}, 11104 pages = {842-853}, 11105 doi = {10.1109/TPDS.2021.3084070} 11106} 11107 11108@Article{ brandt2000, 11109 title = {General highly accurate algebraic coarsening}, 11110 author = {Achi Brandt}, 11111 journal = {Electronic Transactions on Numerical Analysis}, 11112 volume = {10}, 11113 number = {9680}, 11114 pages = {1--20}, 11115 issn = {10689613}, 11116 year = {2000} 11117} 11118 11119@Article{ dalcinpazklercosimo2011, 11120 title = {Parallel distributed computing using Python}, 11121 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 11122 journal = {Advances in Water Resources}, 11123 volume = {34}, 11124 number = {9}, 11125 pages = {1124 - 1139}, 11126 note = {New Computational Methods and Software Tools}, 11127 issn = {0309-1708}, 11128 doi = {10.1016/j.advwatres.2011.04.013}, 11129 year = {2011} 11130} 11131 11132@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 11133 title = {Cython: The Best of Both Worlds}, 11134 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 11135 Seljebotn,Dag Sverre and Smith,Kurt }, 11136 journal = {Computing in Science \& Engineering}, 11137 volume = {13}, 11138 number = {2}, 11139 pages = {31-39}, 11140 doi = {10.1109/MCSE.2010.118}, 11141 year = {2011} 11142} 11143 11144@Article{ dalcinpazstorti2005, 11145 title = {MPI for Python}, 11146 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 11147 journal = {Journal of Parallel and Distributed Computing}, 11148 volume = {65}, 11149 number = {9}, 11150 pages = {1108 - 1115}, 11151 issn = {0743-7315}, 11152 doi = {10.1016/j.jpdc.2005.03.010}, 11153 year = {2005} 11154} 11155 11156@Article{ dalcincolliervignalcortescalo2016, 11157 title = {PetIGA: A framework for high-performance isogeometric analysis}, 11158 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 11159 Calo}, 11160 journal = {Computer Methods in Applied Mechanics and Engineering}, 11161 volume = {308}, 11162 pages = {151 - 181}, 11163 issn = {0045-7825}, 11164 doi = {10.1016/j.cma.2016.05.011}, 11165 year = {2016} 11166} 11167 11168@Article{ collierpardodalcinpaszynskicalo2012, 11169 title = {The cost of continuity: A study of the performance of isogeometric finite 11170 elements using direct solvers}, 11171 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 11172 Calo}, 11173 journal = {Computer Methods in Applied Mechanics and Engineering}, 11174 volume = {213-216}, 11175 pages = {353 - 361}, 11176 issn = {0045-7825}, 11177 doi = {10.1016/j.cma.2011.11.002}, 11178 year = {2012} 11179} 11180 11181@Article{ collierdalcinpardocalo2013, 11182 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 11183 Elements}, 11184 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 11185 journal = {SIAM Journal on Scientific Computing}, 11186 volume = {35}, 11187 number = {2}, 11188 pages = {A767-A784}, 11189 doi = {10.1137/120881038}, 11190 year = {2013} 11191} 11192 11193@Article{ dunning2017jump, 11194 title = {{JuMP}: a modeling language for mathematical optimization}, 11195 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 11196 journal = {SIAM Review}, 11197 volume = {59}, 11198 number = {2}, 11199 pages = {295--320}, 11200 year = {2017}, 11201 publisher = {SIAM} 11202} 11203 11204@InProceedings{ prudencioschulz2011, 11205 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 11206 Estimation, Simulation and Optimization}, 11207 author = {Ernesto E Prudencio and Karl W Schulz}, 11208 booktitle = {European Conference on Parallel Processing}, 11209 pages = {398--407}, 11210 year = {2011} 11211} 11212 11213@Misc{ rol-website, 11214 key = {ROL}, 11215 title = {{Rapid Optimization Library} Website}, 11216 howpublished = {\url{https://trilinos.org/packages/rol}}, 11217 year = {2018} 11218} 11219 11220@Article{ more1994line, 11221 title = {Line search algorithms with guaranteed sufficient decrease}, 11222 author = {Mor{\'e}, Jorge J and Thuente, David J}, 11223 journal = {ACM Transactions on Mathematical Software}, 11224 volume = {20}, 11225 number = {3}, 11226 pages = {286--307}, 11227 year = {1994}, 11228 publisher = {ACM} 11229} 11230 11231@Article{ griewank2000algorithm, 11232 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 11233 adjoint mode of computational differentiation}, 11234 author = {Griewank, Andreas and Walther, Andrea}, 11235 journal = {ACM Transactions on Mathematical Software}, 11236 volume = {26}, 11237 number = {1}, 11238 pages = {19--45}, 11239 year = {2000}, 11240 publisher = {ACM} 11241} 11242 11243@Article{ metcalf2011seven, 11244 title = {The seven ages of fortran}, 11245 author = {Metcalf, Michael}, 11246 journal = {Journal of Computer Science \& Technology}, 11247 volume = {11}, 11248 year = {2011} 11249} 11250 11251@Article{ giraldo_2013, 11252 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 11253 model of the atmosphere {(NUMA)}}, 11254 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 11255 journal = {SIAM Journal on Scientific Computing}, 11256 year = {2013}, 11257 number = {5}, 11258 pages = {B1162-B1194}, 11259 volume = {35}, 11260 doi = {10.1137/120876034} 11261} 11262 11263@Article{ constantinescu_tr2016b, 11264 author = {Constantinescu, E.M.}, 11265 title = {Estimating Global Errors in Time Stepping}, 11266 journal = {ArXiv e-prints}, 11267 archiveprefix = {arXiv}, 11268 eprint = {1503.05166}, 11269 primaryclass = {math.NA}, 11270 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 11271 year = {2016}, 11272 month = mar, 11273 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 11274 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 11275} 11276 11277@Article{ pareschi_2005, 11278 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 11279 with Relaxation}, 11280 author = {L. Pareschi and G. Russo}, 11281 journal = {Journal of Scientific Computing}, 11282 year = {2005}, 11283 number = {1}, 11284 pages = {129--155}, 11285 volume = {25} 11286} 11287 11288@Article{ kennedy_2003, 11289 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 11290 author = {C.A. Kennedy and M.H. Carpenter}, 11291 journal = {Appl. Numer. Math.}, 11292 year = {2003}, 11293 number = {1-2}, 11294 pages = {139--181}, 11295 volume = {44}, 11296 doi = {10.1016/S0168-9274(02)00138-1}, 11297 publisher = {Elsevier Science Publishers B. V.} 11298} 11299 11300@Unpublished{ boscarino_tr2011, 11301 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 11302 equations in the diffusion limit}, 11303 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 11304 note = {Arxiv preprint arXiv:1110.4375}, 11305 year = {2011} 11306} 11307 11308@Article{ ascher_1997, 11309 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 11310 equations}, 11311 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 11312 journal = {Applied Numerical Mathematics}, 11313 year = {1997}, 11314 pages = {151--167}, 11315 volume = {25} 11316} 11317 11318@Book{ ascherpetzold1998, 11319 title = {Computer methods for ordinary differential equations and differential-algebraic 11320 equations}, 11321 author = {Uri M Ascher and Linda R Petzold}, 11322 volume = {61}, 11323 publisher = {SIAM}, 11324 year = {1998} 11325} 11326 11327@Article{ colomesbadia2016, 11328 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 11329 equations}, 11330 author = {Oriol Colom{\'e}s and Santiago Badia}, 11331 journal = {International Journal for Numerical Methods in Engineering}, 11332 volume = {105}, 11333 number = {5}, 11334 pages = {372--400}, 11335 year = {2016} 11336} 11337 11338@Article{ sandu_1997, 11339 title = {Benchmarking stiff {ODE} solvers for atmospheric chemistry problems {II}: 11340 {R}osenbrock solvers}, 11341 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 11342 Potra}, 11343 journal = {Atmospheric Environment}, 11344 year = {1997}, 11345 number = {20}, 11346 pages = {3459--3472}, 11347 volume = {31}, 11348 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 11349 task is the integration of the stiff systems of ordinary differential equations 11350 describing the chemical transformations. It is therefore of interest to 11351 systematically search for stiff solvers which can be identified as close to 11352 optimal for atmospheric applications. In this paper we continue our investigation 11353 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 11354 and compare eight solvers on a set of seven box-models used in present day models. 11355 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 11356 application when they are provided with highly efficient sparse matrix techniques 11357 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 11358 the literature, viz. and 4, and two are new and specially developed for air 11359 quality applications, viz. 3 and 3. } 11360} 11361 11362@Article{ rang_2005, 11363 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 11364 equations of index 1}, 11365 author = {Rang, J. and Angermann, L.}, 11366 journal = {BIT Numerical Mathematics}, 11367 year = {2005}, 11368 number = {4}, 11369 pages = {761--787}, 11370 volume = {45}, 11371 publisher = {Springer} 11372} 11373 11374@Article{ gottliebketchesonshu2009, 11375 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 11376 title = {{High order strong stability preserving time discretizations}}, 11377 journal = {Journal of Scientific Computing}, 11378 volume = {38}, 11379 number = {3}, 11380 pages = {251--289}, 11381 doi = {10.1007/s10915-008-9239-z}, 11382 year = {2009} 11383} 11384 11385@Article{ ketcheson_2008, 11386 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 11387 Low-Storage Implementations}, 11388 author = {D.I. Ketcheson}, 11389 journal = {SIAM Journal on Scientific Computing}, 11390 year = {2008}, 11391 number = {4}, 11392 pages = {2113--2136}, 11393 volume = {30}, 11394 doi = {10.1137/07070485X}, 11395 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 11396 RungeKutta methods}, 11397 publisher = {SIAM} 11398} 11399 11400@Article{ jansen_2000, 11401 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 11402 equations with a stabilized finite element method}, 11403 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 11404 journal = {Computer Methods in Applied Mechanics and Engineering}, 11405 year = {2000}, 11406 number = {3}, 11407 pages = {305--319}, 11408 volume = {190}, 11409 publisher = {Elsevier} 11410} 11411 11412@Article{ butcher_2007, 11413 title = {Error propagation of general linear methods for ordinary differential equations}, 11414 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 11415 journal = {Journal of Complexity}, 11416 year = {2007}, 11417 number = {4-6}, 11418 pages = {560--580}, 11419 volume = {23}, 11420 abstract = {We discuss error propagation for general linear methods for ordinary differential 11421 equations up to terms of order p+2, where p is the order of the method. These 11422 results are then applied to the estimation of local discretization errors for 11423 methods of order p and for the adjacent order p+1. The results of numerical 11424 experiments confirm the reliability of these estimates. This research has 11425 applications in the design of robust stepsize and order changing strategies for 11426 algorithms based on general linear methods.}, 11427 doi = {10.1016/j.jco.2007.01.009}, 11428 issn = {0885-064X} 11429} 11430 11431@Article{ constantinescu_a2010a, 11432 title = {Extrapolated implicit-explicit time stepping}, 11433 author = {E.M. Constantinescu and A. Sandu}, 11434 journal = {SIAM Journal on Scientific Computing}, 11435 year = {2010}, 11436 number = {6}, 11437 pages = {4452-4477}, 11438 volume = {31}, 11439 comment = {Preprint \# ANL/MCS-P1612-0409}, 11440 doi = {10.1137/080732833} 11441} 11442 11443@InProceedings{ devito2011liszt, 11444 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 11445 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 11446 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 11447 Aiken, Alex and Duraisamy, Karthik and others}, 11448 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 11449 Networking, Storage and Analysis}, 11450 pages = {9}, 11451 year = {2011}, 11452 organization = {ACM} 11453} 11454 11455@Article{ devito2011designing, 11456 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 11457 author = {DeVito, Zachary and Hanrahan, Pat}, 11458 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 11459 year = {2011} 11460} 11461 11462@Misc{ pgasintro, 11463 author = {Tim Stitt}, 11464 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 11465 Model}, 11466 note = {\url{http://cnx.org/content/m20649/latest/}} 11467} 11468 11469@InProceedings{ el2006upc, 11470 title = {UPC: unified parallel C}, 11471 author = {El-Ghazawi, Tarek and Smith, Lauren}, 11472 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 11473 pages = {27}, 11474 year = {2006}, 11475 organization = {ACM} 11476} 11477 11478@InProceedings{ numrich1998co, 11479 title = {Co-Array Fortran for parallel programming}, 11480 author = {Numrich, Robert W and Reid, John}, 11481 booktitle = {ACM Sigplan Fortran Forum}, 11482 volume = {17}, 11483 number = {2}, 11484 pages = {1--31}, 11485 year = {1998}, 11486 organization = {ACM} 11487} 11488 11489@Article{ aiken1997titanium, 11490 title = {Titanium: A high-performance Java dialect}, 11491 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 11492 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 11493 Geoff and Semenzato, Luigi and others}, 11494 year = {1997} 11495} 11496 11497@Article{ charles2005x10, 11498 title = {X10: an object-oriented approach to non-uniform cluster computing}, 11499 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 11500 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 11501 Sarkar, Vivek}, 11502 journal = {Acm Sigplan Notices}, 11503 volume = {40}, 11504 number = {10}, 11505 pages = {519--538}, 11506 year = {2005}, 11507 publisher = {ACM} 11508} 11509 11510@Article{ chamberlain2007parallel, 11511 title = {Parallel programmability and the chapel language}, 11512 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 11513 journal = {International Journal of High Performance Computing Applications}, 11514 volume = {21}, 11515 number = {3}, 11516 pages = {291--312}, 11517 year = {2007}, 11518 publisher = {SAGE Publications} 11519} 11520 11521@InProceedings{ charmppoopsla93, 11522 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 11523 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 11524 editor = {Paepcke, A.}, 11525 fulleditor = {Paepcke, Andreas}, 11526 pages = {91--108}, 11527 month = sep, 11528 year = {1993}, 11529 booktitle = {{Proceedings of OOPSLA'93}}, 11530 publisher = {{ACM Press}} 11531} 11532 11533@InProceedings{ hewitt1973universal, 11534 title = {A universal modular actor formalism for artificial intelligence}, 11535 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 11536 booktitle = {Proceedings of the 3rd international joint conference on Artificial 11537 intelligence}, 11538 pages = {235--245}, 11539 year = {1973}, 11540 organization = {Morgan Kaufmann Publishers Inc.} 11541} 11542 11543@Book{ yonezawa1990abcl, 11544 title = {ABCL: an object-oriented concurrent system}, 11545 author = {Yonezawa, Akinori}, 11546 year = {1990}, 11547 publisher = {MIT press} 11548} 11549 11550@InProceedings{ dally1988object, 11551 title = {Object-oriented concurrent programming in CST}, 11552 author = {Dally, William J and Chien, Andrew A}, 11553 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 11554 applications: Architecture, software, computer systems, and general issues-Volume 11555 1}, 11556 pages = {434--439}, 11557 year = {1988}, 11558 organization = {ACM} 11559} 11560 11561@Article{ grimshaw1993easy, 11562 title = {Easy-to-use object-oriented parallel processing with Mentat}, 11563 author = {Grimshaw, Andrew S.}, 11564 journal = {Computer}, 11565 volume = {26}, 11566 number = {5}, 11567 pages = {39--51}, 11568 year = {1993}, 11569 publisher = {IEEE} 11570} 11571 11572@InProceedings{ gannon1991object, 11573 title = {Object oriented parallelism: pC++ ideas and experiments}, 11574 author = {Gannon, Dennis and Lee, JK}, 11575 booktitle = {Proceedings of}, 11576 pages = {13--23}, 11577 year = {1991} 11578} 11579 11580@InProceedings{ lau1992object, 11581 title = {An object-oriented class library for scalable parallel heuristic search}, 11582 author = {Lau, Wing-cheong and Singh, Vineet}, 11583 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 11584 pages = {252--267}, 11585 year = {1992}, 11586 organization = {Springer} 11587} 11588 11589@Book{ chase1989amber, 11590 title = {The Amber system: Parallel programming on a network of multiprocessors}, 11591 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 11592 Littlefield, Richard}, 11593 volume = {23}, 11594 number = {5}, 11595 year = {1989}, 11596 publisher = {ACM} 11597} 11598 11599@InProceedings{ kaiser2009parallex, 11600 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 11601 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 11602 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 11603 pages = {394--401}, 11604 year = {2009}, 11605 organization = {IEEE} 11606} 11607 11608@TechReport{ ipm, 11609 author = {Barry F. Smith}, 11610 title = {A New Parallel Programming Model for Computer Simulation}, 11611 institution = {Argonne National Laboratory}, 11612 year = {2014}, 11613 number = {ANL/MCS-P5135-0414} 11614} 11615 11616@Article{ groppsnir, 11617 author = {William Gropp and Marc Snir}, 11618 title = {Programming for Exascale Computers}, 11619 journal = {Computing in Science and Engineering}, 11620 volume = {15}, 11621 number = {6}, 11622 issn = {1521-9615}, 11623 year = {2013}, 11624 pages = {27-35}, 11625 doi = {10.1109/MCSE.2013.96}, 11626 publisher = {IEEE Computer Society}, 11627 address = {Los Alamitos, CA} 11628} 11629 11630@Book{ mpi3, 11631 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 11632 author = {Message Passing Interface Forum}, 11633 year = {2012}, 11634 publisher = {High Performance Computing Center Stuttgart (HLRS)} 11635} 11636 11637@Book{ openmp4, 11638 title = {OpenMP Application Program Interface, Version 4.0}, 11639 year = {2013}, 11640 publisher = {OpenMP Architecture Review Board} 11641} 11642 11643@InProceedings{ hartono2009annotation, 11644 title = {Annotation-based empirical performance tuning using {Orio}}, 11645 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 11646 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 11647 Symposium on}, 11648 pages = {1--11}, 11649 year = {2009}, 11650 organization = {IEEE} 11651} 11652 11653@Book{ toselli2005domain, 11654 title = {Domain Decomposition Methods: Algorithms and Theory}, 11655 author = {Toselli, Andrea and Widlund, Olof B}, 11656 volume = {34}, 11657 year = {2005}, 11658 publisher = {Springer} 11659} 11660 11661@InBook{ st2016, 11662 author = {Barry F. Smith and Xumin Tu}, 11663 chapter = {Domain Decomposition}, 11664 title = {Encyclopedia of Applied and Computational Mathematics}, 11665 bookeditor = {B. Engquist}, 11666 publisher = {Springer}, 11667 pages = {375--381}, 11668 year = {2016} 11669} 11670 11671@TechReport{ saws, 11672 author = {Matt Otten and Jed Brown and Barry F. Smith}, 11673 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 11674 institution = {Argonne National Laboratory}, 11675 year = {2013} 11676} 11677 11678@Article{ smith1997domain, 11679 title = {Domain Decomposition Methods for Partial Differential Equations}, 11680 author = {Smith, B.F.}, 11681 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 11682 volume = {4}, 11683 pages = {225--244}, 11684 year = {1997}, 11685 publisher = {Citeseer} 11686} 11687 11688@Article{ spillane2011abstract, 11689 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 11690 in the overlaps}, 11691 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 11692 Scheichl, R}, 11693 journal = {NuMa-Report}, 11694 volume = {7}, 11695 pages = {2007}, 11696 year = {2011} 11697} 11698 11699@InProceedings{ jolivet2013scalabledd, 11700 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 11701 problems}, 11702 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 11703 Prud'homme, Christophe}, 11704 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 11705 Networking, Storage and Analysis}, 11706 pages = {80}, 11707 year = {2013}, 11708 organization = {ACM} 11709} 11710 11711@Book{ ks2000, 11712 author = {D. Kinderlehrer and G. Stampacchia}, 11713 publisher = {Society for Industrial Mathematics}, 11714 title = {An Introduction to Variational Inequalities and Their Applications}, 11715 year = {2000} 11716} 11717 11718@Article{ wan2000energy, 11719 title = {An energy-minimizing interpolation for robust multigrid methods}, 11720 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 11721 journal = {SIAM Journal on Scientific Computing}, 11722 volume = {21}, 11723 number = {4}, 11724 pages = {1632--1649}, 11725 year = {2000}, 11726 publisher = {Philadelphia, PA: SIAM, c1993-} 11727} 11728 11729@Article{ chansmith1994, 11730 title = {Domain decomposition and multigrid algorithms for elliptic problems on 11731 unstructured meshes}, 11732 author = {Chan, T.F. and Smith, B.F.}, 11733 journal = {Electronic Transactions on Numerical Analysis}, 11734 volume = {2}, 11735 pages = {171--182}, 11736 year = {1994} 11737} 11738 11739@TechReport{ proto-fsp, 11740 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 11741 and Michael Zarnstorff and Michael Zika}, 11742 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 11743 institution = {Princeton Plasma Physics Laboratory}, 11744 year = {2010}, 11745 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 11746} 11747 11748@Article{ hirvijoki2021, 11749 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 11750 particle-in-cell codes}, 11751 journal = {Plasma Phys. Control. Fusion}, 11752 author = {Eero Hirvijoki}, 11753 note = {in press}, 11754 doi = {10.1088/1361-6587/abe884}, 11755 year = {2021} 11756} 11757 11758@Article{ ipsen2001, 11759 author = {Ilse C. F. Ipsen}, 11760 journal = {SIAM J. Sci. Comput.}, 11761 pages = {1050--1051}, 11762 volume = {23}, 11763 publisher = {SIAM}, 11764 title = {A Note on Preconditioning Nonsymmetric Matrices}, 11765 year = {2001} 11766} 11767 11768% Random papers on solvers for GPUs 11769@InProceedings{ gpus-suck, 11770 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 11771 title = { On the Limits of {GPU} Acceleration}, 11772 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 11773 year = {2010}, 11774 publisher = {USENIX} 11775} 11776 11777@InProceedings{ 882364, 11778 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 11779 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11780 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 11781 year = {2003}, 11782 isbn = {1-58113-709-5}, 11783 pages = {917--924}, 11784 location = {San Diego, California}, 11785 doi = {10.1145/1201775.882364}, 11786 publisher = {ACM}, 11787 address = {New York, NY} 11788} 11789 11790@Conference{ feng2008multigrid, 11791 author = {Feng, Z. and Li, P.}, 11792 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 11793 date-added = {2010-08-19 15:57:06 -0500}, 11794 date-modified = {2010-08-19 15:57:06 -0500}, 11795 pages = {647--654}, 11796 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 11797 year = {2008} 11798} 11799 11800@Conference{ goodnight2003multigrid, 11801 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 11802 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 11803 date-added = {2010-08-19 15:45:20 -0500}, 11804 date-modified = {2010-08-19 15:45:20 -0500}, 11805 organization = {Eurographics Association}, 11806 pages = {102--111}, 11807 title = {A multigrid solver for boundary value problems using programmable graphics 11808 hardware}, 11809 year = {2003} 11810} 11811 11812@Article{ buatois2007concurrent, 11813 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 11814 date-added = {2010-08-19 15:45:02 -0500}, 11815 date-modified = {2010-08-19 15:45:02 -0500}, 11816 journal = {High Performance Computing and Communications}, 11817 pages = {358--371}, 11818 publisher = {Citeseer}, 11819 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 11820 year = {2007} 11821} 11822 11823@Article{ joldes2010real, 11824 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 11825 date-added = {2010-08-19 15:44:41 -0500}, 11826 date-modified = {2010-08-19 15:44:41 -0500}, 11827 journal = {Computer Methods in Applied Mechanics and Engineering}, 11828 publisher = {Elsevier}, 11829 title = {Real-time nonlinear finite element computations on {GPU}-application to 11830 neurosurgical simulation}, 11831 year = {2010} 11832} 11833 11834@Misc{ aharon2005gpu, 11835 author = {Aharon, S.}, 11836 date-added = {2010-08-19 15:44:32 -0500}, 11837 date-modified = {2010-08-19 15:44:32 -0500}, 11838 month = apr, 11839 note = {US Patent App. 11/115,642}, 11840 publisher = {Google Patents}, 11841 title = {{GPU}-based Finite Element}, 11842 year = {2005} 11843} 11844 11845@Article{ cevahir2009fast, 11846 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 11847 date-added = {2010-08-19 15:44:01 -0500}, 11848 date-modified = {2010-08-19 15:44:01 -0500}, 11849 journal = {Computational Science--ICCS 2009}, 11850 pages = {893--903}, 11851 publisher = {Springer}, 11852 title = {Fast conjugate gradients with multiple {GPU}s}, 11853 year = {2009} 11854} 11855 11856@Article{ maier1995symmetric, 11857 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 11858 date-added = {2010-08-19 15:43:57 -0500}, 11859 date-modified = {2010-08-19 15:43:57 -0500}, 11860 journal = {Computational Mechanics}, 11861 number = {1}, 11862 pages = {115--129}, 11863 publisher = {Springer}, 11864 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 11865 plasticity}, 11866 volume = {17}, 11867 year = {1995} 11868} 11869 11870@Article{ corrigan-running, 11871 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 11872 date-added = {2010-08-19 15:43:47 -0500}, 11873 date-modified = {2010-08-19 15:43:47 -0500}, 11874 journal = {International Journal for Numerical Methods in Fluids}, 11875 publisher = {John Wiley \& Sons}, 11876 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 11877} 11878 11879@InProceedings{ volkov08, 11880 author = {Vasily Volkov and James W. Demmel}, 11881 title = {Benchmarking GPUs to tune dense linear algebra}, 11882 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 11883 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 11884 year = {2008} 11885} 11886 11887@TechReport{ cray-mvmult, 11888 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 11889 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 11890 institution = {School of Computer Science, Carnegie Mellon University}, 11891 number = {CMU-CS-93-173}, 11892 month = aug, 11893 year = {1993} 11894} 11895 11896@Conference{ bell2009implementing, 11897 author = {Bell, N. and Garland, M.}, 11898 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 11899 and Analysis}, 11900 date-added = {2010-08-19 15:43:42 -0500}, 11901 date-modified = {2010-08-19 15:43:42 -0500}, 11902 organization = {ACM}, 11903 pages = {1--11}, 11904 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 11905 processors}, 11906 year = {2009} 11907} 11908 11909@Article{ bell2008efficient, 11910 author = {Bell, N. and Garland, M.}, 11911 date-added = {2010-08-19 15:43:36 -0500}, 11912 date-modified = {2010-08-19 15:43:36 -0500}, 11913 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 11914 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 11915 year = {2008} 11916} 11917 11918@Article{ cohen-fast, 11919 author = {Cohen, J. and Molemaker, M.J.}, 11920 date-added = {2010-08-19 15:43:34 -0500}, 11921 date-modified = {2010-08-19 15:43:34 -0500}, 11922 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 11923 pages = {414}, 11924 publisher = {DEStech Publications}, 11925 title = {A fast double precision CFD code using CUDA} 11926} 11927 11928@Article{ kazhdan2008streaming, 11929 author = {Kazhdan, M. and Hoppe, H.}, 11930 date-added = {2010-08-19 15:43:32 -0500}, 11931 date-modified = {2010-08-19 15:43:32 -0500}, 11932 journal = {ACM Transactions on Graphics (TOG)}, 11933 number = {3}, 11934 pages = {21}, 11935 publisher = {ACM}, 11936 title = {Streaming multigrid for gradient-domain operations on large images}, 11937 volume = {27}, 11938 year = {2008} 11939} 11940 11941@Article{ bonnet1998symmetric, 11942 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 11943 date-added = {2010-08-19 15:43:18 -0500}, 11944 date-modified = {2010-08-19 15:43:18 -0500}, 11945 journal = {Appl. Mech. Rev}, 11946 pages = {669--704}, 11947 title = {Symmetric {G}alerkin boundary element method.}, 11948 volume = {51}, 11949 year = {1998} 11950} 11951 11952@Conference{ zamith2007gpu, 11953 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 11954 Valente, L.}, 11955 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 11956 Entertainment}, 11957 date-added = {2010-08-19 15:43:14 -0500}, 11958 date-modified = {2010-08-19 15:43:14 -0500}, 11959 pages = {37--43}, 11960 title = {The {GPU} used as a math co-processor in real time applications}, 11961 year = {2007} 11962} 11963 11964@Article{ baskaran2009optimizing, 11965 author = {Baskaran, M.M. and Bordawekar, R.}, 11966 date-added = {2010-08-19 15:42:56 -0500}, 11967 date-modified = {2010-08-19 15:42:56 -0500}, 11968 journal = {IBM Research Report RC24704, IBM}, 11969 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 11970 year = {2009} 11971} 11972 11973@Misc{ szeliski2006locally, 11974 author = {Szeliski, R.}, 11975 date-added = {2010-08-19 15:42:45 -0500}, 11976 date-modified = {2010-08-19 15:42:45 -0500}, 11977 month = jul, 11978 note = {US Patent App. 11/459,724}, 11979 publisher = {Google Patents}, 11980 title = {Locally adapted hierarchical basis preconditioning}, 11981 year = {2006} 11982} 11983 11984@Article{ jung2006cholesky, 11985 author = {Jung, J.H. and O'Leary, D.P.}, 11986 date-added = {2010-08-19 15:42:34 -0500}, 11987 date-modified = {2010-08-19 15:42:34 -0500}, 11988 journal = {Scholarly Paper, University of Maryland}, 11989 publisher = {Citeseer}, 11990 title = {Cholesky decomposition and linear programming on a {GPU}}, 11991 year = {2006} 11992} 11993 11994@Conference{ filipovic2009gpu, 11995 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 11996 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 11997 date-added = {2010-08-19 15:42:33 -0500}, 11998 date-modified = {2010-08-19 15:42:33 -0500}, 11999 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 12000 Results}, 12001 year = {2009} 12002} 12003 12004@Article{ taylor2009modelling, 12005 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 12006 Atkinson, D. and Ourselin, S.}, 12007 date-added = {2010-08-19 15:42:23 -0500}, 12008 date-modified = {2010-08-19 15:42:23 -0500}, 12009 journal = {Medical Image Analysis}, 12010 number = {2}, 12011 pages = {234--244}, 12012 publisher = {Elsevier}, 12013 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 12014 solution and {GPU} execution}, 12015 volume = {13}, 12016 year = {2009} 12017} 12018 12019@Conference{ owens2007survey, 12020 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 12021 and Lefohn, A.E. and Purcell, T.J.}, 12022 booktitle = {Computer Graphics Forum}, 12023 date-added = {2010-08-19 15:42:21 -0500}, 12024 date-modified = {2010-08-19 15:42:21 -0500}, 12025 number = {1}, 12026 organization = {John Wiley \& Sons}, 12027 pages = {80--113}, 12028 title = {A survey of general-purpose computation on graphics hardware}, 12029 volume = {26}, 12030 year = {2007} 12031} 12032 12033@Article{ strzodka2005scientific, 12034 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 12035 date-added = {2010-08-19 15:42:18 -0500}, 12036 date-modified = {2010-08-19 15:42:18 -0500}, 12037 journal = {Simulation Modelling Practice and Theory}, 12038 number = {8}, 12039 pages = {667--680}, 12040 publisher = {Elsevier}, 12041 title = {Scientific computation for simulations on programmable graphics hardware}, 12042 volume = {13}, 12043 year = {2005} 12044} 12045 12046@Conference{ rumpf2001using, 12047 author = {Rumpf, M. and Strzodka, R.}, 12048 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 12049 (VIIP-01)}, 12050 date-added = {2010-08-19 15:42:15 -0500}, 12051 date-modified = {2010-08-19 15:42:15 -0500}, 12052 organization = {Citeseer}, 12053 pages = {193--202}, 12054 title = {Using graphics cards for quantized FEM computations}, 12055 year = {2001} 12056} 12057 12058@Article{ sirtori1992galerkin, 12059 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 12060 date-added = {2010-08-19 15:42:14 -0500}, 12061 date-modified = {2010-08-19 15:42:14 -0500}, 12062 journal = {International Journal for Numerical Methods in Engineering}, 12063 number = {2}, 12064 pages = {255--282}, 12065 publisher = {John Wiley \& Sons}, 12066 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 12067 implementation}, 12068 volume = {35}, 12069 year = {1992} 12070} 12071 12072@Article{ tejada2005large, 12073 author = {Tejada, E. and Ertl, T.}, 12074 date-added = {2010-08-19 15:42:09 -0500}, 12075 date-modified = {2010-08-19 15:42:09 -0500}, 12076 journal = {Simulation Modelling Practice and Theory}, 12077 number = {8}, 12078 pages = {703--715}, 12079 publisher = {Elsevier}, 12080 title = {Large steps in {GPU}-based deformable bodies simulation}, 12081 volume = {13}, 12082 year = {2005} 12083} 12084 12085@Article{ goddeke2008using, 12086 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 12087 and Becker, C. and Turek, S.}, 12088 date-added = {2010-08-19 15:42:06 -0500}, 12089 date-modified = {2010-08-19 15:42:06 -0500}, 12090 journal = {International Journal of Computational Science and Engineering}, 12091 number = {1}, 12092 pages = {36--55}, 12093 publisher = {Inderscience}, 12094 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 12095 volume = {4}, 12096 year = {2008} 12097} 12098 12099@Article{ garland2008parallel, 12100 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 12101 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 12102 date-added = {2010-08-19 15:41:51 -0500}, 12103 date-modified = {2010-08-19 15:41:51 -0500}, 12104 journal = {IEEE Micro}, 12105 number = {4}, 12106 pages = {13--27}, 12107 title = {Parallel computing experiences with CUDA}, 12108 volume = {28}, 12109 year = {2008} 12110} 12111 12112@Article{ wong1985method, 12113 author = {Wong, SH and Ciric, IR}, 12114 date-added = {2010-08-19 15:41:48 -0500}, 12115 date-modified = {2010-08-19 15:41:48 -0500}, 12116 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 12117 and Electronic Engineering}, 12118 publisher = {MCB UP Ltd}, 12119 title = {Method of conformal transformation for the finite-element solution of 12120 axisymmetric exterior-field problems}, 12121 volume = {4}, 12122 year = {1985} 12123} 12124 12125@Article{ turek-feast, 12126 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 12127 H.}, 12128 date-added = {2010-08-19 15:41:47 -0500}, 12129 date-modified = {2010-08-19 15:41:47 -0500}, 12130 journal = {Concurrency and Computation: Practice and Experience}, 12131 publisher = {John Wiley \& Sons}, 12132 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 12133 elements} 12134} 12135 12136@Article{ abedi2006space, 12137 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 12138 date-added = {2010-08-19 15:41:46 -0500}, 12139 date-modified = {2010-08-19 15:41:46 -0500}, 12140 journal = {Computer Methods in Applied Mechanics and Engineering}, 12141 number = {25-28}, 12142 pages = {3247--3273}, 12143 publisher = {Elsevier}, 12144 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 12145 element-wise momentum balance}, 12146 volume = {195}, 12147 year = {2006} 12148} 12149 12150@Conference{ georgii2005interactiveb, 12151 author = {Georgii, J. and Westermann, R.}, 12152 booktitle = {Proceedings of VMV}, 12153 date-added = {2010-08-19 15:41:36 -0500}, 12154 date-modified = {2010-08-19 15:41:36 -0500}, 12155 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 12156 year = {2005} 12157} 12158 12159@Article{ mosegaard2005gpu, 12160 author = {Mosegaard, J. and others}, 12161 date-added = {2010-08-19 15:41:35 -0500}, 12162 date-modified = {2010-08-19 15:41:35 -0500}, 12163 publisher = {IEEE Computer Society}, 12164 title = {{GPU} accelerated surgical simulators for complex morphology}, 12165 year = {2005} 12166} 12167 12168@Article{ meyer2007particle, 12169 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 12170 date-added = {2010-08-19 15:41:33 -0500}, 12171 date-modified = {2010-08-19 15:41:33 -0500}, 12172 journal = {IEEE Transactions on Visualization and Computer Graphics}, 12173 pages = {1015--1026}, 12174 publisher = {Published by the IEEE Computer Society}, 12175 title = {Particle systems for efficient and accurate high-order finite element 12176 visualization}, 12177 year = {2007} 12178} 12179 12180@Conference{ rumpf2001nonlinear, 12181 author = {Rumpf, M. and Strzodka, R.}, 12182 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 12183 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 12184 date-added = {2010-08-19 15:41:29 -0500}, 12185 date-modified = {2010-08-19 15:41:29 -0500}, 12186 organization = {Springer Verlag Wien}, 12187 pages = {75}, 12188 title = {Nonlinear diffusion in graphics hardware}, 12189 year = {2001} 12190} 12191 12192@Article{ georgii2005interactive, 12193 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 12194 date-added = {2010-08-19 15:41:28 -0500}, 12195 date-modified = {2010-08-19 15:41:28 -0500}, 12196 journal = {Simulation and Visualisation}, 12197 pages = {247--258}, 12198 publisher = {Citeseer}, 12199 title = {Interactive simulation of deformable bodies on {GPU}s}, 12200 volume = {2005}, 12201 year = {2005} 12202} 12203 12204@Article{ harish2007accelerating, 12205 author = {Harish, P. and Narayanan, P.}, 12206 date-added = {2010-08-19 15:41:27 -0500}, 12207 date-modified = {2010-08-19 15:41:27 -0500}, 12208 journal = {High Performance Computing--HiPC 2007}, 12209 pages = {197--208}, 12210 publisher = {Springer}, 12211 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 12212 year = {2007} 12213} 12214 12215@Article{ keunings1995parallel, 12216 author = {Keunings, R.}, 12217 date-added = {2010-08-19 15:41:19 -0500}, 12218 date-modified = {2010-08-19 15:41:19 -0500}, 12219 journal = {Computers and Chemical Engineering}, 12220 number = {6}, 12221 pages = {647--670}, 12222 publisher = {Oxford; New York: Pergamon Press, 1977-}, 12223 title = {Parallel finite element algorithms applied to computational rheology}, 12224 volume = {19}, 12225 year = {1995} 12226} 12227 12228@Conference{ taylor2007real, 12229 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12230 booktitle = {Proceedings of the 10th international conference on Medical image computing and 12231 computer-assisted intervention-Volume Part I}, 12232 date-added = {2010-08-19 15:41:17 -0500}, 12233 date-modified = {2010-08-19 15:41:17 -0500}, 12234 organization = {Springer-Verlag}, 12235 pages = {701--708}, 12236 title = {Real-time nonlinear finite element analysis for surgical simulation using 12237 graphics processing units}, 12238 year = {2007} 12239} 12240 12241@Article{ liu2000finite, 12242 author = {Liu, R. and Li, DY}, 12243 date-added = {2010-08-19 15:41:16 -0500}, 12244 date-modified = {2010-08-19 15:41:16 -0500}, 12245 journal = {Materials Science and Engineering A}, 12246 number = {1-2}, 12247 pages = {169--175}, 12248 publisher = {Elsevier}, 12249 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 12250 volume = {277}, 12251 year = {2000} 12252} 12253 12254@Conference{ kakadiaris1994active, 12255 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 12256 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 12257 date-added = {2010-08-19 15:41:15 -0500}, 12258 date-modified = {2010-08-19 15:41:15 -0500}, 12259 organization = {Citeseer}, 12260 pages = {980--980}, 12261 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 12262 physics-based approach}, 12263 year = {1994} 12264} 12265 12266@Conference{ de2004gpu, 12267 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 12268 booktitle = {Proceedings of Eurohaptics}, 12269 date-added = {2010-08-19 15:41:14 -0500}, 12270 date-modified = {2010-08-19 15:41:14 -0500}, 12271 organization = {Citeseer}, 12272 pages = {44--51}, 12273 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 12274 volume = {2004}, 12275 year = {2004} 12276} 12277 12278@Book{ taflove1995computational, 12279 author = {Taflove, A. and Hagness, S.C.}, 12280 date-added = {2010-08-19 15:41:14 -0500}, 12281 date-modified = {2010-08-19 15:41:14 -0500}, 12282 publisher = {Artech House Norwood, MA}, 12283 title = {Computational electrodynamics}, 12284 year = {1995} 12285} 12286 12287@Conference{ galoppo2005lu, 12288 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 12289 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 12290 date-added = {2010-08-19 15:41:13 -0500}, 12291 date-modified = {2010-08-19 15:41:13 -0500}, 12292 organization = {IEEE Computer Society}, 12293 pages = {3}, 12294 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 12295 hardware}, 12296 year = {2005} 12297} 12298 12299@Conference{ ryoo2008optimization, 12300 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 12301 and Hwu, W.W.}, 12302 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 12303 parallel programming}, 12304 date-added = {2010-08-19 15:41:12 -0500}, 12305 date-modified = {2010-08-19 15:41:12 -0500}, 12306 organization = {ACM}, 12307 pages = {73--82}, 12308 title = {Optimization principles and application performance evaluation of a multithreaded 12309 {GPU} using CUDA}, 12310 year = {2008} 12311} 12312 12313@Conference{ micikevicius20093d, 12314 author = {Micikevicius, P.}, 12315 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 12316 Units}, 12317 date-added = {2010-08-19 15:41:11 -0500}, 12318 date-modified = {2010-08-19 15:41:11 -0500}, 12319 organization = {ACM}, 12320 pages = {79--84}, 12321 title = {3D finite difference computation on {GPU}s using {CUDA}}, 12322 year = {2009} 12323} 12324 12325@Conference{ zhou2004pixel, 12326 author = {Zhou, Y. and Garland, M. and Haber, R.}, 12327 booktitle = {IEEE Visualization, 2004}, 12328 date-added = {2010-08-19 15:41:03 -0500}, 12329 date-modified = {2010-08-19 15:41:03 -0500}, 12330 pages = {425--432}, 12331 title = {Pixel-exact rendering of spacetime finite element solutions}, 12332 year = {2004} 12333} 12334 12335@Article{ komatitsch2009porting, 12336 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 12337 date-added = {2010-08-19 15:41:01 -0500}, 12338 date-modified = {2010-08-19 15:41:01 -0500}, 12339 journal = {Journal of Parallel and Distributed Computing}, 12340 number = {5}, 12341 pages = {451--460}, 12342 publisher = {Elsevier}, 12343 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 12344 graphics cards using CUDA}, 12345 volume = {69}, 12346 year = {2009} 12347} 12348 12349@Article{ komatitsch1998spectral, 12350 author = {Komatitsch, D. and Vilotte, J.P.}, 12351 date-added = {2010-08-19 15:40:59 -0500}, 12352 date-modified = {2010-08-19 15:40:59 -0500}, 12353 journal = {Bulletin of the Seismological Society of America}, 12354 number = {2}, 12355 pages = {368--392}, 12356 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 12357 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 12358 of 2D and 3D geological structures}, 12359 volume = {88}, 12360 year = {1998} 12361} 12362 12363@Article{ wu2005improved, 12364 author = {Wu, W. and Heng, P.A.}, 12365 date-added = {2010-08-19 15:40:59 -0500}, 12366 date-modified = {2010-08-19 15:40:59 -0500}, 12367 journal = {The Visual Computer}, 12368 number = {8}, 12369 pages = {707--716}, 12370 publisher = {Springer}, 12371 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 12372 cutting and deformation}, 12373 volume = {21}, 12374 year = {2005} 12375} 12376 12377@Article{ taylor2008high, 12378 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12379 date-added = {2010-08-19 15:40:57 -0500}, 12380 date-modified = {2010-08-19 15:40:57 -0500}, 12381 journal = {IEEE transactions on medical imaging}, 12382 number = {5}, 12383 pages = {650}, 12384 title = {High-speed nonlinear finite element analysis for surgical simulation using 12385 graphics processing units.}, 12386 volume = {27}, 12387 year = {2008} 12388} 12389 12390@Conference{ bolz2003sparse, 12391 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 12392 booktitle = {ACM SIGGRAPH 2003 Papers}, 12393 date-added = {2010-08-19 15:40:55 -0500}, 12394 date-modified = {2010-08-19 15:40:55 -0500}, 12395 organization = {ACM}, 12396 pages = {924}, 12397 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 12398 year = {2003} 12399} 12400 12401@Article{ wu2004hybrid, 12402 author = {Wu, W. and Heng, P.A.}, 12403 date-added = {2010-08-19 15:40:54 -0500}, 12404 date-modified = {2010-08-19 15:40:54 -0500}, 12405 journal = {Computer Animation and Virtual Worlds}, 12406 number = {3-4}, 12407 pages = {219--227}, 12408 publisher = {John Wiley \& Sons}, 12409 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 12410 3D soft tissue cutting}, 12411 volume = {15}, 12412 year = {2004} 12413} 12414 12415% ---------------------------------------------------------------------------------------------------------------- 12416@TechReport{ davis97, 12417 author = {T. Davis}, 12418 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 12419 institution = {University of Florida}, 12420 year = {1997} 12421} 12422 12423@Article{ davis2011, 12424 author = {Davis, T. A. and Hu, Y.}, 12425 title = {The {U}niversity of {F}lorida sparse matrix collection}, 12426 journal = {ACM Transactions on Mathematical Software}, 12427 volume = {38}, 12428 issue = {1}, 12429 year = {2011}, 12430 pages = {1--25} 12431} 12432 12433@Article{ davis2004algorithm, 12434 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 12435 author = {Davis, Timothy A}, 12436 journal = {ACM Transactions on Mathematical Software}, 12437 volume = {30}, 12438 number = {2}, 12439 pages = {196--199}, 12440 year = {2004}, 12441 publisher = {ACM} 12442} 12443 12444@TechReport{ streams, 12445 author = {J. D. McCalpin}, 12446 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 12447 institution = {University of Virginia}, 12448 url = {http://www.cs.virginia.edu/stream}, 12449 year = {1995} 12450} 12451 12452@Article{ areusken_1988b, 12453 author = {A. Reusken}, 12454 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 12455 mildly nonlinear boundary value problems}, 12456 journal = {Numer. Math.}, 12457 volume = {52}, 12458 year = {1988}, 12459 pages = {251--277} 12460} 12461 12462@Article{ areusken_1988c, 12463 author = {A. Reusken}, 12464 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 12465 journal = {Numer. Math.}, 12466 volume = {53}, 12467 year = {1988}, 12468 pages = {663--686} 12469} 12470 12471@Unpublished{ mgnet, 12472 title = {Multigrid Net; http://www.mgnet.org/}, 12473 author = {Craig Douglas}, 12474 note = {Contains enormous bibliography on multigrid publications}, 12475 year = {2009} 12476} 12477 12478@Unpublished{ copper, 12479 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 12480 author = {}, 12481 note = {Held bi-annually}, 12482 year = {2009} 12483} 12484 12485@Book{ wessling1992, 12486 author = {Pieter Wesseling}, 12487 title = {An Introduction to Multigrid Methods}, 12488 year = {2004}, 12489 publisher = {R. T. Edwards} 12490} 12491 12492@Book{ bhm2000, 12493 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 12494 title = {A Multigrid Tutorial}, 12495 year = {2000}, 12496 publisher = {SIAM} 12497} 12498 12499@Book{ trottenberg2001multigrid, 12500 title = {{Multigrid}}, 12501 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 12502 isbn = {012701070X}, 12503 year = {2001}, 12504 publisher = {Academic Press} 12505} 12506 12507@TechReport{ brandt1984, 12508 author = {Achi Brandt}, 12509 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 12510 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 12511 number = {GMD-Studien Nr. 85}, 12512 year = {1984} 12513} 12514 12515@Article{ yavneh1998coarse, 12516 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 12517 author = {Yavneh, I.}, 12518 journal = {SIAM Journal on Scientific Computing}, 12519 volume = {19}, 12520 number = {5}, 12521 pages = {1682--1699}, 12522 year = {1998}, 12523 publisher = {Society for Industrial and Applied Mathematics} 12524} 12525 12526@Article{ wan2003phase, 12527 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 12528 author = {Wan, WL and Chan, T.F.}, 12529 journal = {SIAM Journal on Scientific Computing}, 12530 volume = {25}, 12531 pages = {857}, 12532 year = {2003} 12533} 12534 12535@Article{ imex, 12536 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 12537 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 12538 journal = {SIAM Journel on Numerical Analysis}, 12539 volume = {32}, 12540 number = {3}, 12541 pages = {797--823}, 12542 year = {1995} 12543} 12544 12545@Article{ ow1, 12546 author = {T. Washio and C. W. Oosterlee}, 12547 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 12548 Recirculating Flow}, 12549 journal = {SIAM Journal on Scientific Computing}, 12550 volume = {21}, 12551 number = {5}, 12552 pages = {1670--1690}, 12553 year = {2000} 12554} 12555 12556@Article{ vm1, 12557 author = {V. A. Mousseau}, 12558 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 12559 Heat Conduction}, 12560 journal = {Journal Of Computational Physics}, 12561 volume = {200}, 12562 pages = {104--132}, 12563 year = {2004} 12564} 12565 12566@Article{ vm2, 12567 author = {V. A. Mousseau}, 12568 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 12569 journal = {Journal Of Heat Transfer}, 12570 volume = {127}, 12571 pages = {531--539}, 12572 year = {2005} 12573} 12574 12575@Misc{ salome1, 12576 author = {Laurent Dada and Daniel Caruge}, 12577 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 12578 Simulation}, 12579 year = {2005}, 12580 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 12581 note = {Presentation at an ESA/ESTEC conference} 12582} 12583 12584@InProceedings{ downar1, 12585 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 12586 A. Mousseau and D. E. Ebert}, 12587 title = {Application of a generalized interface module to the coupling of {PARCS} with 12588 both {RELAP5} and {TRAC-M}}, 12589 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 12590 year = {1999} 12591} 12592 12593@Article{ lopez1, 12594 author = {A. P. Lopez and J. B. Sandova}, 12595 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 12596 thermal-hydraulics}, 12597 journal = {Annals of Nuclear Energy}, 12598 volume = {32(6)}, 12599 pages = {621--634}, 12600 year = {2005} 12601} 12602 12603@InProceedings{ og-1996, 12604 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 12605 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 12606 Transport Code}, 12607 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 12608 Transport Codes}, 12609 editor = {}, 12610 publisher = {}, 12611 pages = {}, 12612 note = {Paris, France}, 12613 month = dec, 12614 year = {1996} 12615} 12616 12617@Article{ wo-2000, 12618 author = {P. Warner and C. R. E. de Oliveira}, 12619 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 12620 {EVENT} for Shielding Applications}, 12621 journal = {J. Nucl. Sci. and Tech.}, 12622 volume = {Supplement 1}, 12623 pages = {466--470}, 12624 year = {2000} 12625} 12626 12627@Unpublished{ gnep-web, 12628 author = {{U.S. Department of Energy}}, 12629 title = {Global Nuclear Energy Partnership ({GNEP})}, 12630 note = {\url{ http://www.gnep.energy.gov}}, 12631 year = {2007} 12632} 12633 12634@Book{ lewis-miller-1984, 12635 author = {E. E. Lewis and W. F. Miller, Jr.}, 12636 title = {Computational Methods of Neutron Transport}, 12637 address = {}, 12638 publisher = {Wiley}, 12639 year = {1984} 12640} 12641 12642@Article{ couple1, 12643 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 12644 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 12645 THE {IBM-704}}, 12646 journal = {Nuclear Sci. and Eng.}, 12647 year = {1959}, 12648 pages = {113--115}, 12649 volume = {2(1)} 12650} 12651 12652@InProceedings{ weber1, 12653 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 12654 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 12655 and component design}, 12656 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 12657 year = {2000} 12658} 12659 12660@Misc{ gnep:report, 12661 author = {Phillip Finck and David Keyes and Rick Stevens}, 12662 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 12663 Nuclear Energy Systems}}, 12664 year = {2006} 12665} 12666 12667@Misc{ subsurface-workshop-ref, 12668 author = {D. {Zachman (Chair)}}, 12669 title = {{Computational Subsurface Sciences Workshop}}, 12670 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 12671} 12672 12673@Misc{ fusion:report, 12674 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 12675 Panel}}, 12676 author = {{Fusion Energy Sciences Advisory Committee}}, 12677 year = {2002}, 12678 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 12679} 12680 12681@Misc{ hecrtf:report, 12682 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 12683 key = {HECRTF}, 12684 year = {2004}, 12685 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 12686} 12687 12688@Misc{ doesc20years, 12689 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 12690 key = {Office of Science, U.S. Department of Energy}, 12691 year = {2003}, 12692 howpublished = {Office of Science, U.S. Department of Energy, see 12693 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 12694} 12695 12696@PhDThesis{ karpeev-thesis, 12697 author = {D. A. Karpeyev}, 12698 title = {Geometric Integrators for Hamiltonian PDEs}, 12699 school = {Old Dominion University}, 12700 year = {2002} 12701} 12702 12703@InCollection{ fjp:ima, 12704 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12705 title = {The Scalability of Mesh Improvement Algorithms}, 12706 booktitle = {Algorithms for Parallel Processing}, 12707 publisher = {Springer-Verlag}, 12708 volume = {105}, 12709 series = {The IMA Volumes in Mathematics and Its Applications}, 12710 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 12711 year = {1998}, 12712 pages = {185--212} 12713} 12714 12715@InProceedings{ poet, 12716 author = {Rob Armstrong and Alex Cheung}, 12717 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 12718 for Scientific Distributed Computing}, 12719 booktitle = {Proceedings of {HICSS97}}, 12720 year = {1997} 12721} 12722 12723@Misc{ pseware-web-page, 12724 author = {}, 12725 title = {{PSEware} {Web} page}, 12726 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 12727 key = {{PSEware} {Web} page} 12728} 12729 12730@Article{ epperly2011high, 12731 title = {High-performance language interoperability for scientific computing through 12732 {B}abel}, 12733 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 12734 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 12735 journal = {International Journal of High Performance Computing Applications}, 12736 pages = {1094342011414036}, 12737 year = {2011}, 12738 publisher = {SAGE Publications} 12739} 12740 12741@Misc{ babel-web-page, 12742 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 12743 title = {{Babel} {Web} page}, 12744 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 12745} 12746 12747@Misc{ infospheres-web-page, 12748 author = {K.~M. {Chandy et al.}}, 12749 title = {{Infospheres} {W}eb page}, 12750 note = {\url{http://www.infospheres.caltech.edu}}, 12751 key = {{Infospheres} {Web} page} 12752} 12753 12754@Misc{ hammond, 12755 author = {Glenn Hammond}, 12756 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 12757 communication} 12758} 12759 12760@Misc{ ornl, 12761 author = {Oak Ridge National Laboratory}, 12762 title = {Private communication via petsc-maint email support} 12763} 12764 12765@Unpublished{ cumulvs-web-page, 12766 author = {}, 12767 title = {{Cumulvs} {W}eb page}, 12768 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 12769 key = {{Cumulvs} {W}eb page} 12770} 12771 12772@Article{ nonlineargmres, 12773 author = {T. Washio and C. W. Oosterlee}, 12774 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 12775 journal = {ETNA}, 12776 year = {1997}, 12777 pages = {271--290}, 12778 volume = {6} 12779} 12780 12781@Article{ pcice, 12782 author = {Richard C. Martineau and Ray A. Berry}, 12783 title = {The pressure-corrected ICE finite element method for compressible flows on 12784 unstructured meshes}, 12785 journal = {Journal of Computational Physics}, 12786 year = {2004}, 12787 pages = {659--685}, 12788 volume = {198(2)} 12789} 12790 12791@Article{ cumulvs97, 12792 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 12793 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 12794 Applications}, 12795 journal = {International Journal of Supercomputing Applications}, 12796 year = {1997} 12797} 12798 12799@TechReport{ daly2012interagency, 12800 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 12801 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 12802 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 12803 Paul Woodward}, 12804 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 12805 year = {2012}, 12806 publisher = {US Department of Defense} 12807} 12808 12809@Article{ karpeev1, 12810 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 12811 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 12812 journal = {J. Comp. Phys.}, 12813 year = {2001}, 12814 pages = {116--148}, 12815 volume = {173} 12816} 12817 12818@InProceedings{ scirun97, 12819 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 12820 title = {The {SCIRun} Computational Steering System}, 12821 booktitle = {Modern Software Tools in Scientific Computing}, 12822 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 12823 publisher = {Birkhauser Press}, 12824 year = {1997} 12825} 12826 12827@TechReport{ szyld, 12828 author = {Valeria Simoncini and Daniel B. Szyld}, 12829 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 12830 Computing}, 12831 year = {2002}, 12832 institution = {Department of Mathematics, Temple University}, 12833 number = {02-4-12} 12834} 12835 12836@TechReport{ pdelab, 12837 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 12838 and C. C. Chui and S. Markus}, 12839 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 12840 for {PDE} Based Applications}, 12841 year = {1994}, 12842 institution = {Department of Computer Sciences, Purdue University}, 12843 number = {CSD-TR-94-021} 12844} 12845 12846@Unpublished{ ilu-web-page, 12847 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 12848 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 12849 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 12850} 12851 12852@Unpublished{ doe2k-web-page, 12853 title = {{DOE2000 Initiative} {W}eb page}, 12854 note = {http://www.mcs.anl.gov/DOE2000}, 12855 key = {DOE2000 Initiative} 12856} 12857 12858@Misc{ pvode-web-page, 12859 title = {{PVODE} {W}eb Page}, 12860 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 12861 author = {A. {Hindmarsh et al.}} 12862} 12863 12864@Book{ szyperski97, 12865 author = {Clemens Szyperski}, 12866 title = {Component Software: Beyond Object-Oriented Programming}, 12867 publisher = {ACM Press}, 12868 address = {New York}, 12869 year = {1997} 12870} 12871 12872@Unpublished{ petsc:coloringuse, 12873 title = {Code for computing sparse {J}acobians}, 12874 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12875 institution = {Argonne National Laboratory} 12876} 12877 12878@Unpublished{ petsc:external, 12879 author = {B. F. {Smith et al.}}, 12880 title = {{External Software Used by PETSc}}, 12881 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12882 institution = {Argonne National Laboratory} 12883} 12884 12885@Unpublished{ petsc:use-by-external-packages, 12886 author = {B. F. {Smith et al.}}, 12887 title = {{Software Packages that Use or Interface to PETSc}}, 12888 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 12889 institution = {Argonne National Laboratory} 12890} 12891 12892@Unpublished{ petsc:prizes, 12893 author = {B. F. {Smith et al.}}, 12894 title = {{Prizes Won Using PETSc}}, 12895 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12896 institution = {Argonne National Laboratory} 12897} 12898 12899@Unpublished{ petsc:csgf, 12900 author = {B. F. {Smith et al.}}, 12901 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 12902 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12903 institution = {Argonne National Laboratory} 12904} 12905 12906@Unpublished{ flash-web-page, 12907 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 12908 {W}eb Page}, 12909 note = {http://www.asci.uchicago.edu}, 12910 author = {R. {Rosner et al.}}, 12911 institution = {University of Chicago} 12912} 12913 12914@Unpublished{ esi-web-page, 12915 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 12916 note = {http://z.ca.sandia.gov/esi}, 12917 author = {R. {Clay et al.}} 12918} 12919 12920@Unpublished{ infobus-web-page, 12921 title = {{I}nfo{B}us {W}eb Page}, 12922 note = {http://www.java.sun.com/beans/infobus}, 12923 key = {infobus} 12924} 12925 12926@Unpublished{ xray-web-page, 12927 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 12928 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 12929 note = {http://www.mcs.anl.gov/xray/}, 12930 institution = {Argonne National Laboratory} 12931} 12932 12933@InProceedings{ kohn98, 12934 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 12935 title = {Language Interoperability Mechanisms for High-Performance Scientific 12936 Applications}, 12937 publisher = {SIAM}, 12938 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12939 Scientific and Engineering Computing}, 12940 year = {1999}, 12941 pages = {30-39} 12942} 12943 12944@InProceedings{ kohn01, 12945 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 12946 title = {Divorcing Language Dependencies from a Scientific Software Library}, 12947 publisher = {SIAM}, 12948 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 12949 year = {2001} 12950} 12951 12952@InProceedings{ freitag_jones_plassmann98, 12953 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12954 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 12955 publisher = {SIAM}, 12956 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12957 Scientific and Engineering Computing}, 12958 year = {1999}, 12959 pages = {215-224} 12960} 12961 12962@Book{ templates, 12963 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 12964 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 12965 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 12966 Methods}, 12967 publisher = {SIAM}, 12968 year = {1994}, 12969 address = {Philadelphia, PA} 12970} 12971 12972@InProceedings{ parasha2, 12973 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 12974 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 12975 {PDE} Solutions}, 12976 booktitle = {SC97 Proceedings}, 12977 publisher = {IEEE Computer Society Press}, 12978 year = {1997} 12979} 12980 12981@TechReport{ parasha, 12982 author = {M. Parashar and J. C. Browne}, 12983 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 12984 Techniques}, 12985 institution = {Department of Computer Science, University of Texas at Austin}, 12986 year = {1995} 12987} 12988 12989@Article{ parti, 12990 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 12991 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 12992 Memory Architectures}, 12993 journal = {Journal of Parallel and Distributed Computing}, 12994 year = {1994}, 12995 volume = {22}, 12996 pages = {462--478} 12997} 12998 12999@Article{ mparti, 13000 author = {G. Agrawal and A. Sussman and J. Saltz}, 13001 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 13002 Block Structured Applications}, 13003 journal = {IEEE Trans. on Parallel and Distributed Systems}, 13004 volume = {6}, 13005 number = {7}, 13006 year = {1995} 13007} 13008 13009@Article{ gropp-lusk-doss-skjellum, 13010 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 13011 title = {A high-performance, portable implementation of the {MPI} Message Passing 13012 Interface standard}, 13013 journal = {Parallel Computing}, 13014 year = {1996}, 13015 volume = {22}, 13016 pages = {789--828} 13017} 13018 13019@InProceedings{ lam, 13020 author = {Greg Burns and Raja Daoud and James Vaigl}, 13021 title = {{LAM}: An Open Cluster Environment for {MPI}}, 13022 booktitle = {Proceedings of Supercomputing Symposium '94}, 13023 editor = {John W. Ross}, 13024 publisher = {University of Toronto}, 13025 pages = {379--386}, 13026 year = {1994} 13027} 13028 13029@Article{ cs99, 13030 author = {X.-C. Cai and M. Sarkis}, 13031 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 13032 systems}, 13033 journal = {SIAM J. Scientific Computing}, 13034 year = {1999}, 13035 volume = {21}, 13036 pages = {792-797} 13037} 13038 13039@Article{ cai2003restricted, 13040 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 13041 positive definite linear systems}, 13042 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 13043 journal = {SIAM Journal on Numerical Analysis}, 13044 volume = {41}, 13045 issue = {1}, 13046 pages = {1209--1231}, 13047 year = {2003}, 13048 doi = {10.1137/S0036142901389621} 13049} 13050 13051@TechReport{ caisaad, 13052 author = {Xiao-Chuan Cai and Youcef Saad}, 13053 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 13054 institution = {Army High Performance Computing Research Center, University of Minnesota }, 13055 year = {1993}, 13056 number = {Preprint 93-027 }, 13057 note = {SIAM J. Sci. Comp. (submitted)} 13058} 13059 13060@Book{ ruminations, 13061 author = {Andrew Koenig and Barbara Moo}, 13062 title = {Ruminations on C++}, 13063 year = {1996}, 13064 publisher = {Addison-Wesley} 13065} 13066 13067@Book{ mpi-complete, 13068 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 13069 Dongarra}, 13070 title = {{MPI}: The Complete Reference}, 13071 year = {1995}, 13072 publisher = {MIT Press} 13073} 13074 13075@Unpublished{ tcl-tk-web-page, 13076 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 13077 note = {http://www.sunlabs.com/research/tcl/}, 13078 year = {1996}, 13079 month = aug 13080} 13081 13082@Misc{ mpich-web-page, 13083 author = {William Gropp and {et. al.}}, 13084 title = {{MPICH} {W}eb page}, 13085 key = {MPICH}, 13086 url = {http://www.mpich.org}, 13087 howpublished = {\url{http://www.mpich.org}} 13088} 13089 13090@Article{ mpi-final, 13091 author = {MPI Forum}, 13092 title = {{MPI}: A Message-Passing Interface Standard}, 13093 journal = {International J. Supercomputing Applications}, 13094 volume = {8}, 13095 number = {3/4}, 13096 year = {1994}, 13097 key = {MPI Standard - final} 13098} 13099 13100@Unpublished{ npb-web-page, 13101 key = {NAS Parallel Benchmarks}, 13102 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 13103 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 13104 year = {1996}, 13105 month = dec 13106} 13107 13108@Book{ george81, 13109 title = {Computer Solution of Large Sparse Positive Definite Systems}, 13110 author = {Alan George and Joseph W. Liu}, 13111 publisher = {Prentice-Hall}, 13112 year = {1981}, 13113 key = {SparseDirect} 13114} 13115 13116@Book{ p4-book, 13117 title = {Portable Programs for Parallel Processors}, 13118 publisher = {Holt, Rinehart, {and} Winston}, 13119 year = {1987}, 13120 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 13121 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 13122 key = {P4Book} 13123} 13124 13125@Article{ stones, 13126 author = {H. L. Stone}, 13127 title = {Iterative solution of implicit approximations of multidimensional partial 13128 differential equations}, 13129 journal = {SIAM J. Numerical Analysis}, 13130 pages = {87--113}, 13131 volumne = {5}, 13132 year = {1968} 13133} 13134 13135@Article{ parallelstones, 13136 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 13137 title = {Parallel versions of {S}tones strongly implicit algorithm}, 13138 journal = {Concurrency and Computation: Practice and Experience}, 13139 pages = {1049--1062}, 13140 volumne = {13}, 13141 year = {2001} 13142} 13143 13144@Article{ p4-paper, 13145 author = {Ralph Butler and Ewing Lusk}, 13146 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 13147 journal = {Journal of Parallel Computing}, 13148 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 13149 Division preprint P362-0493)}, 13150 year = {1993} 13151} 13152 13153@TechReport{ picl, 13154 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 13155 title = {{PICL}: A portable instrumented communications library}, 13156 institution = {Oak Ridge National Laboratory}, 13157 number = {TM-11130}, 13158 year = {1990}, 13159 key = {PICL} 13160} 13161 13162@TechReport{ upshot, 13163 author = {Virginia Herrarte and Ewing Lusk}, 13164 title = {Studying Parallel Program Behavior with {U}pshot}, 13165 institution = {Argonne National Laboratory}, 13166 number = {ANL-91/15}, 13167 month = aug, 13168 year = {1991}, 13169 key = {Upshot} 13170} 13171 13172@TechReport{ p4-manual, 13173 author = {Ralph Butler and Ewing Lusk}, 13174 title = {User's Guide to the p4 Parallel Programming System}, 13175 institution = {Argonne National Laboratory}, 13176 number = {ANL-92/17}, 13177 month = oct, 13178 year = {1992}, 13179 key = {p4-Manual} 13180} 13181 13182@InProceedings{ oldparti, 13183 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 13184 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 13185 booktitle = {Proceedings of Supercomputing '93}, 13186 pages = {578--587}, 13187 year = {1993} 13188} 13189 13190@Article{ parti2, 13191 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 13192 and J. Saltz}, 13193 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 13194 journal = {ACM SIGPLAN Notices}, 13195 year = {1995}, 13196 pages = {68-79}, 13197 volume = {30}, 13198 number = {8} 13199} 13200 13201@Article{ parti3, 13202 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 13203 title = {Run-Time Parallelization and Scheduling of Loops}, 13204 journal = {IEEE Trans. Computers}, 13205 year = {1991}, 13206 pages = {604-612}, 13207 volume = {40}, 13208 number = {5} 13209} 13210 13211@InProceedings{ disz-lusk:wamtrace, 13212 author = {Terrence Disz and Ewing Lusk}, 13213 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 13214 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13215 year = {1987}, 13216 pages = {46--53} 13217} 13218 13219@InProceedings{ gorlick-kesselman:gauge, 13220 author = {Michael Gorlick and Carl Kesselman}, 13221 title = {Timing {Prolog} programs without Clocks}, 13222 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13223 year = {1996}, 13224 publisher = {Birkhauser} 13225} 13226 13227@TechReport{ aztec, 13228 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 13229 title = {Aztec User's Guide Version 1.1}, 13230 institution = {Sandia National Laboratories}, 13231 month = oct, 13232 year = {1995}, 13233 number = {SAND95/1559} 13234} 13235 13236@TechReport{ aztec2, 13237 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 13238 title = {Official {Aztec} User's Guide Version 2.1}, 13239 institution = {Sandia National Laboratories}, 13240 year = {1999} 13241} 13242 13243@Book{ taylor-chandy:pcn, 13244 author = {Chandy, M. and Taylor, S.}, 13245 title = {An Introduction to Parallel Programming}, 13246 year = {1991}, 13247 publisher = {Jones and Bartlett} 13248} 13249 13250@Book{ foster-taylor:strand, 13251 title = {Strand: New Concepts in Parallel Programming}, 13252 author = {Ian Foster and Stephen Taylor}, 13253 publisher = {Prentice-Hall}, 13254 adress = { Englewood Cliffs, New Jersey}, 13255 year = {1990} 13256} 13257 13258@Article{ aurora, 13259 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 13260 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 13261 Carlsson and A. Ciepielewski and B. Hausman}, 13262 title = {The Aurora OR-Parallel Prolog System}, 13263 journal = {New Generation Computing}, 13264 volume = {7}, 13265 number = {3}, 13266 year = {1990}, 13267 pages = {243--271} 13268} 13269 13270@TechReport{ roo, 13271 author = {E. Lusk and W. McCune and J. Slaney}, 13272 title = {Roo---a Parallel Theorem Prover}, 13273 institution = {Argonne National Laboratory}, 13274 number = {MCS--TM--149}, 13275 year = {1991} 13276} 13277 13278@TechReport{ heath-etheridge:vppp, 13279 author = {M. T. Heath and J. A. Etheridge}, 13280 title = {Visualizing the Performance of Parallel Programs}, 13281 institution = {Oak Ridge National Laboratory}, 13282 number = {ORNL TM-11813}, 13283 year = {1991} 13284} 13285 13286@TechReport{ chem:vis, 13287 author = {Ewing L. Lusk}, 13288 title = {Performance Visualization for Parallel Programs}, 13289 institution = {Argonne National Laboratory}, 13290 number = {ANL/MCS--P287--0192}, 13291 year = {1991}, 13292 note = {(to appear in {\em Theoretica Chimica Acta})} 13293} 13294 13295@TechReport{ picltrace, 13296 author = {P.~H.~Worley}, 13297 title = {A new {PICL} trace file format}, 13298 institution = {Oak Ridge National Laboratory}, 13299 number = {ORNL TM-12125}, 13300 month = jun, 13301 year = {1992} 13302} 13303 13304@InProceedings{ hideo, 13305 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 13306 title = {Inference of Phylogenetic trees using maximum likelihood}, 13307 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 13308 year = {1992}, 13309 pages = {247--262} 13310} 13311 13312@InProceedings{ dw90, 13313 author = {M. Dryja and O. Widlund}, 13314 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 13315 Problems}, 13316 booktitle = {Third International Symposium on Domain Decomposition Methods}, 13317 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 13318 year = {1990}, 13319 pages = {3-21}, 13320 publisher = {SIAM}, 13321 address = {Philadelphia}, 13322 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 13323 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 13324 references, good introduction to the theory. No computations}, 13325 key = {DryjaWidlund90 !AS} 13326} 13327 13328@Unpublished{ rosing, 13329 author = {Matt Rosing and Joel Saltz}, 13330 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 13331 key = {LowLatency}, 13332 note = {manuscript, 1992} 13333} 13334 13335@TechReport{ jp:incomplete, 13336 author = {Mark T. Jones and Paul E. Plassmann}, 13337 title = {An Improved Incomplete {C}holesky Factorization}, 13338 institution = {Argonne National Laboratory}, 13339 address = {Argonne, IL}, 13340 type = {Preprint}, 13341 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 13342 number = {MCS-P206-0191}, 13343 year = {1991}, 13344 key = {jones} 13345} 13346 13347@InCollection{ jp:ima, 13348 author = {Mark Jones and Paul Plassmann}, 13349 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 13350 booktitle = {Graph Theory and Sparse Matrix Computation}, 13351 publisher = {Springer-Verlag}, 13352 series = {The IMA Volumes in Mathematics and Its Applications}, 13353 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 13354 volume = {56}, 13355 year = {1993}, 13356 pages = {229--245} 13357} 13358 13359@Article{ pw98, 13360 author = {M. Pernice and H. F. Walker}, 13361 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 13362 journal = {SIAM J. Sci. Stat. Comput.}, 13363 year = {1998}, 13364 volume = {19}, 13365 pages = {302--318} 13366} 13367 13368@TechReport{ ysmp83, 13369 key = {Eisenstat}, 13370 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13371 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13372 institution = {Department of Computer Science, Yale University}, 13373 number = {YALE/DCS/RR-265}, 13374 month = apr, 13375 year = {1983} 13376} 13377 13378@InBook{ ysmp84, 13379 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13380 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13381 title = {Elliptic Problem Solvers II}, 13382 publisher = {Academic Press}, 13383 pages = {45--52}, 13384 editors = {G. Birkhoff and A. Schoenstadt}, 13385 year = {1984} 13386} 13387 13388@TechReport{ sparsekit, 13389 key = {Saad}, 13390 author = {Youcef Saad}, 13391 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 13392 institution = {Center for Supercomputing Research and Development, University of Illinois at 13393 Urbana-Champaign}, 13394 number = {1029}, 13395 year = {1990} 13396} 13397 13398@TechReport{ pde-user-ref, 13399 author = {Barry F. Smith}, 13400 title = {Extensible {PDE} Solvers Package Users Manual}, 13401 institution = {Argonne National Laboratory}, 13402 month = sep, 13403 year = {1994}, 13404 number = {ANL-93/40}, 13405 key = {Smith94 ! PDE} 13406} 13407 13408@TechReport{ bs-user-ref, 13409 author = {Mark T. Jones and Paul E. Plassmann}, 13410 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 13411 of Sparse Linear Systems}, 13412 institution = {Argonne National Laboratory}, 13413 month = dec, 13414 year = {1995}, 13415 number = {ANL-95/48} 13416} 13417 13418@TechReport{ snes-user-ref, 13419 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 13420 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 13421 institution = {Argonne National Laboratory}, 13422 month = feb, 13423 year = {1995}, 13424 number = {ANL/MCS-TM-193}, 13425 key = {GroppMcInnesSmith95 ! SNES} 13426} 13427 13428@TechReport{ sles-user-ref, 13429 author = {William D. Gropp and Barry F. Smith}, 13430 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 13431 institution = {Argonne National Laboratory}, 13432 month = mar, 13433 year = {1993}, 13434 number = {ANL-93/8}, 13435 key = {GroppSmith93 ! SLES} 13436} 13437 13438@TechReport{ chameleon-user-ref, 13439 author = {William D. Gropp and Barry F. Smith}, 13440 title = {Chameleon Parallel programming tools Users Manual}, 13441 institution = {Argonne National Laboratory}, 13442 month = mar, 13443 year = {1993}, 13444 number = {ANL-93/23}, 13445 key = {GroppSmith93 ! Chameleon} 13446} 13447 13448@Article{ euclid2, 13449 author = {D. Hysom and A. Pothen}, 13450 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 13451 journal = {SIAM J. Sci. Comput.}, 13452 volume = {22}, 13453 number = {6}, 13454 pages = {2194--2215} 13455} 13456 13457@TechReport{ euclid1, 13458 author = {D. Hysom and A. Pothen}, 13459 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 13460 Solution of Sparse Linear Systems)}, 13461 institution = {Old Dominion University}, 13462 year = {2001} 13463} 13464 13465@TechReport{ ksp-user-ref, 13466 author = {William D. Gropp and Barry F. Smith}, 13467 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 13468 Methods}, 13469 institution = {Argonne National Laboratory}, 13470 month = aug, 13471 year = {1993}, 13472 number = {ANL-93/30}, 13473 key = {GroppSmith93 ! KSP} 13474} 13475 13476@TechReport{ mpi-chameleon, 13477 author = {William D. Gropp and Ewing Lusk}, 13478 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 13479 institution = {Argonne National Laboratory}, 13480 month = dec, 13481 year = {1992}, 13482 number = {ANL-92/47}, 13483 key = {GroppLusk92 ! MPI} 13484} 13485 13486@TechReport{ blockcomm-fortran, 13487 author = {William D. Gropp}, 13488 title = {Block{C}omm for {F}ortran}, 13489 institution = {Argonne National Laboratory}, 13490 month = may, 13491 year = {1993}, 13492 number = {ANL-93/00 (to appear)}, 13493 key = {Gropp93 ! BlockComm} 13494} 13495 13496@TechReport{ autodocument, 13497 author = {William D. Gropp}, 13498 title = {Automatic documentation of {C} programs}, 13499 institution = {Argonne National Laboratory}, 13500 month = may, 13501 year = {1993}, 13502 number = {ANL-93/00}, 13503 key = {Gropp93 ! Autodoc} 13504} 13505 13506@TechReport{ zipcode, 13507 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 13508 Manfred Morari}, 13509 title = {The {Z}ipcode message-passing system}, 13510 institution = {Lawrence Livermore National Laboratory}, 13511 month = sep, 13512 year = {1992}, 13513 number = {Unpublished}, 13514 key = {Skjellum92 ! Zipcode} 13515} 13516 13517@Article{ paragraph, 13518 author = {Michael T. Heath and Jennifer Etheridge Finger}, 13519 title = {Visualizing performance of parallel programs}, 13520 journal = {IEEE Software}, 13521 volume = {8}, 13522 number = {5}, 13523 month = sep, 13524 year = {1991}, 13525 pages = {29--39}, 13526 key = {Heath91 ! Paragraph} 13527} 13528 13529@Article{ gropp90, 13530 author = {William Gropp and Edward Smith}, 13531 title = {Computational Fluid Dynamics on Parallel Processors}, 13532 journal = {Computers and Fluids}, 13533 volume = {18}, 13534 year = {1990}, 13535 pages = {289--304}, 13536 key = {Gropp90 ! performance} 13537} 13538 13539@Article{ foster92, 13540 author = {Ian Foster and William Gropp and Rick Stevens}, 13541 title = {The parallel scalability of the spectral transform method}, 13542 journal = {Monthly Weather Review}, 13543 volume = {120}, 13544 year = {1992}, 13545 pages = {835--850}, 13546 key = {Foster92 ! performance} 13547} 13548 13549@InBook{ fgn, 13550 author = {R. Freund and G. H. Golub and N. Nachtigal}, 13551 title = {Iterative Solution of Linear Systems}, 13552 series = {Acta Numerica}, 13553 year = {1992}, 13554 publisher = {Cambridge University Press}, 13555 pages = {57--100} 13556} 13557 13558@TechReport{ nachtigal90, 13559 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 13560 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13561 institution = {Massachusetts Institute of Technology}, 13562 month = mar, 13563 year = {1990}, 13564 number = {90-2}, 13565 key = {Nachtigal | Krylov} 13566} 13567 13568@Article{ nachtigal1992fnm, 13569 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13570 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 13571 journal = {SIAM Journal on Matrix Analysis and Applications}, 13572 volume = {13}, 13573 pages = {778}, 13574 year = {1992}, 13575 publisher = {SIAM} 13576} 13577 13578@TechReport{ embree1999descriptive, 13579 title = {How descriptive are {GMRES} convergence bounds}, 13580 author = {Embree, M.}, 13581 year = {1999}, 13582 number = {08}, 13583 institution = {Oxford University Computing Laboratory} 13584} 13585 13586@Article{ vorst92, 13587 author = {H. van der Vorst}, 13588 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 13589 of nonsymmetric linear systems}, 13590 journal = {SIAM J. Sci. Stat. Comput.}, 13591 year = {1992}, 13592 volume = {13}, 13593 pages = {631--644} 13594} 13595 13596@Article{ eisenstat81, 13597 author = {S. Eisenstat}, 13598 title = {Efficient Implementation of a Class of {CG} Methods}, 13599 journal = {SIAM J. Sci. Stat. Comput.}, 13600 year = {1981}, 13601 volume = {2}, 13602 pages = {1--4} 13603} 13604 13605@Manual{ ibm-essl, 13606 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 13607 Reference}, 13608 organization = {IBM}, 13609 year = {1992}, 13610 key = {IBM-ESSL} 13611} 13612 13613@Manual{ ibm-eui, 13614 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 13615 Release 2.0}, 13616 organization = {IBM}, 13617 month = jun, 13618 year = {1994}, 13619 key = {IBM-EUI} 13620} 13621 13622@Manual{ ibm-euih, 13623 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 13624 organization = {IBM}, 13625 author = {Peter Hochschild}, 13626 year = {1993}, 13627 key = {IBM-EUIH} 13628} 13629 13630@TechReport{ mpi, 13631 title = {Document for a Standard Message-Passing Interface}, 13632 author = {Message Passing Interface Forum}, 13633 institution = {University of Tennessee}, 13634 number = {CS-93-214}, 13635 month = nov, 13636 year = {1993}, 13637 key = {MPI Standard} 13638} 13639 13640@Unpublished{ mpi-final-web, 13641 author = {Message Passing Interface Forum}, 13642 title = {{MPI}: A Message-Passing Interface Standard}, 13643 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 13644 year = {1994}, 13645 month = may 13646} 13647 13648@Book{ hockney-jesshope, 13649 author = {R. W. Hockney and C. R. Jesshope}, 13650 title = {Parallel Computers 2}, 13651 publisher = {Adam Hilger}, 13652 year = {1988} 13653} 13654 13655@Book{ cm-fortran, 13656 author = {{Thinking Machines Corporation}}, 13657 title = {Users Manual for CM-Fortran}, 13658 publisher = {Thinking Machines Corporation}, 13659 year = {1993} 13660} 13661 13662@TechReport{ chang93, 13663 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 13664 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 13665 institution = {Yale Department of Computer Science}, 13666 number = {YALEU/DCS/RR-994}, 13667 month = nov, 13668 year = {1993}, 13669 key = {BDD|diag} 13670} 13671 13672@InProceedings{ gropplevine93, 13673 author = {N. Galbreath and W. Gropp and D. Levine}, 13674 title = {Applications-Driven Parallel {I/O}}, 13675 booktitle = {Proceedings of Supercomputing '93}, 13676 year = {1993}, 13677 pages = {462--471} 13678} 13679 13680@Book{ siegle85, 13681 author = {H. J. Siegel}, 13682 title = {Interconnection Networks for Large Scale Parallel Processing}, 13683 publisher = {Lexington Books}, 13684 year = {1985}, 13685 key = {Network Comparison} 13686} 13687 13688@Article{ lawrie75, 13689 author = {D. H. Lawrie}, 13690 title = {Access and alignment of data in an array processor}, 13691 journal = {IEEE Transactions on Computers}, 13692 volume = {C-24}, 13693 number = {12}, 13694 month = dec, 13695 year = {1975}, 13696 pages = {1145--1155}, 13697 key = {Omega Network} 13698} 13699 13700@Book{ knuth1986, 13701 title = {The {\TeX}{Book}}, 13702 author = {Donald Ervin Knuth and Duane Bibby}, 13703 volume = {1993}, 13704 year = {1986}, 13705 publisher = {Addison-Wesley Reading, Massachusetts} 13706} 13707 13708@Book{ lamport86, 13709 author = {Leslie Lamport}, 13710 title = {{LaTeX}: A document preparation system}, 13711 publisher = {Addison-Wesley}, 13712 year = {1986}, 13713 key = {Latex Manual} 13714} 13715 13716@InProceedings{ gropp-lusk:unix-tools, 13717 author = {William Gropp and Ewing Lusk}, 13718 title = {Scalable {U}nix Tools on Parallel Processors}, 13719 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 13720 publisher = {IEEE}, 13721 pages = {56--62} 13722} 13723 13724@InProceedings{ jp:bell_prize, 13725 author = {Mark Jones and Paul Plassmann}, 13726 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 13727 Applications}, 13728 booktitle = {Proceedings of Supercomputing '92}, 13729 publisher = {IEEE Computer Society Press}, 13730 year = {1992}, 13731 pages = {551--560} 13732} 13733 13734@COMMENT{WEB, CWEB references (for doctext)} 13735@TechReport{ web, 13736 author = {Donald E. Knuth}, 13737 title = {The {\tt WEB} system of structured documentation}, 13738 institution = {Computer Science Department, Stanford University}, 13739 year = {1983}, 13740 number = {980}, 13741 month = sep 13742} 13743 13744@Article{ literatepgm, 13745 author = {Donald E. Knuth}, 13746 title = {Literate Programming}, 13747 journal = {Computer Journal}, 13748 year = {1984}, 13749 volume = {27}, 13750 number = {2}, 13751 pages = {91--111} 13752} 13753 13754@Unpublished{ cweb-code, 13755 author = {Silvio Levy and Donald E. Knuth}, 13756 title = {CWEB}, 13757 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 13758} 13759 13760@Article{ jp:scalable, 13761 author = {Mark Jones and Paul Plassmann}, 13762 title = {Scalable Iterative Solution of Sparse Linear Systems}, 13763 journal = {Parallel Computing}, 13764 volume = {20}, 13765 number = {5}, 13766 month = may, 13767 year = {1994}, 13768 pages = {753--773} 13769} 13770 13771@Article{ jp:pcolor, 13772 author = {Mark T. Jones and Paul E. Plassmann}, 13773 title = {A Parallel Graph Coloring Heuristic}, 13774 journal = {SIAM J. Sci. Comput.}, 13775 volume = {14}, 13776 number = {3}, 13777 pages = {654-669}, 13778 year = {1993} 13779} 13780 13781@TechReport{ block_solve, 13782 author = {Mark T. Jones and Paul E. Plassmann}, 13783 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 13784 Sparse Linear Systems}, 13785 institution = {Argonne National Laboratory}, 13786 year = {1992}, 13787 number = {ANL-92/46}, 13788 key = {JonesPlassmann92 ! block_solve} 13789} 13790 13791@InProceedings{ supercond, 13792 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 13793 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 13794 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 13795 Conference}, 13796 month = feb, 13797 year = {1994}, 13798 key = {McInnesPalumbo94 ! superconductivity } 13799} 13800 13801@Unpublished{ preosti:93, 13802 author = {Gianfranco Preosti}, 13803 title = { }, 13804 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 13805 year = {1993}, 13806 key = {preosti93 ! GL-tilt3d} 13807} 13808 13809@Unpublished{ more:93, 13810 author = {Jorge J. Mor\'{e}}, 13811 title = { }, 13812 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 13813 {A}rgonne {N}ational {L}aboratory}, 13814 year = {1993}, 13815 key = {more93 ! MINPACK-2} 13816} 13817 13818@Article{ brownsaad:90, 13819 author = {Peter N. Brown and Youcef Saad}, 13820 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 13821 journal = {SIAM J. Sci. Stat. Comput.}, 13822 year = {1990}, 13823 volume = {11}, 13824 pages = {450-481} 13825} 13826 13827@Book{ using-mpi, 13828 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 13829 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 13830 publisher = {MIT Press}, 13831 year = {1994} 13832} 13833 13834@Book{ using-mpi2, 13835 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 13836 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 13837 publisher = {MIT Press}, 13838 year = {1999} 13839} 13840 13841@Article{ hs:52, 13842 author = {Magnus R. Hestenes and Eduard Steifel}, 13843 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 13844 journal = {J. Research of the National Bureau of Standards}, 13845 year = {1952}, 13846 volume = {49}, 13847 pages = {409-436} 13848} 13849 13850@Article{ so:89, 13851 author = {Peter Sonneveld}, 13852 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 13853 journal = {SIAM J. Sci. Stat. Comput.}, 13854 year = {1989}, 13855 volume = {10}, 13856 pages = {36-52} 13857} 13858 13859@Article{ v:92, 13860 author = {{H. A.} {van der Vorst}}, 13861 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 13862 of nonsymmetric linear systems}, 13863 journal = {SIAM J. Sci. Stat. Comput.}, 13864 volume = {13}, 13865 year = {1992}, 13866 pages = {631-644} 13867} 13868 13869@Article{ f:93, 13870 author = {Roland W. Freund}, 13871 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 13872 Systems}, 13873 journal = {SIAM J. Sci. Stat. Comput.}, 13874 volume = {14}, 13875 year = {1993}, 13876 pages = {470-482} 13877} 13878 13879@Article{ ish:89, 13880 author = {S. Ishizuka}, 13881 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 13882 journal = {Combustion and Flame}, 13883 volume = {75}, 13884 year = {1989}, 13885 pages = {367-379} 13886} 13887 13888@Book{ williams89, 13889 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 13890 author = {F.A. Williams}, 13891 publisher = {Addison-Wesley}, 13892 year = {1989}, 13893 pages = {367-379} 13894} 13895 13896@Book{ ra75, 13897 author = {R. Aris}, 13898 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 13899 publisher = {Oxford}, 13900 year = {1975} 13901} 13902 13903@Book{ bebernes89, 13904 author = {J. Bebernes and D. Eberly}, 13905 title = {Mathematical Problems from Combustion Theory}, 13906 publisher = {Springer-Verlag}, 13907 series = {Applied Mathematical Sciences 83}, 13908 year = {1989} 13909} 13910 13911@InProceedings{ kikuchi89, 13912 author = {F. Kikuchi}, 13913 booktitle = { Computing Methods in Applied Sciences and Engineering}, 13914 editor = {R. Glowinski and J. L. Lions}, 13915 publisher = {Springer-Verlag}, 13916 series = {Lecture Notes in Mathematics}, 13917 title = {Finite element approximations to bifurcation problems of turning point type}, 13918 year = {1977} 13919} 13920 13921@Article{ rg85, 13922 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 13923 title = {Continuation-conjugate Gradient Methods for the Least Squares Solution of 13924 Nonlinear Boundary Problems}, 13925 journal = {SIAM J. Sci. Stat. Comput.}, 13926 volume = {6}, 13927 year = {1985}, 13928 pages = {793-832} 13929} 13930 13931@InProceedings{ whitfield91, 13932 author = {D. Whitfield and L. Taylor}, 13933 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13934 Schemes}, 13935 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 13936 misc = {AIAA-91-1539}, 13937 pages = {134-145}, 13938 year = {1991} 13939} 13940 13941@InProceedings{ quinlan1, 13942 author = {M. Lemke and D. Quinlan}, 13943 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 13944 Architecture-Independent Development of Structured Grid Applications}, 13945 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 13946 publisher = {Springer Verlag}, 13947 year = {1992} 13948} 13949 13950@InProceedings{ quinlan2, 13951 author = {R. Parsons and D. Quinlan}, 13952 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 13953 Computations}, 13954 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 13955 year = {1994} 13956} 13957 13958% ***** Overview of functionality in Diffpack 13959@InBook{ dpoverview, 13960 author = {Bruaset, A. M. and Langtangen, H. P.}, 13961 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13962 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 13963 {Diffpack}}, 13964 publisher = {Birkh{\"{a}}user}, 13965 pages = {61--90}, 13966 year = {1997} 13967} 13968 13969% ***** Short overview of Diffpack 13970@InCollection{ dpoverview2, 13971 author = {Bruaset, A. M. and Langtangen, H. P.}, 13972 editor = {A. Sydow}, 13973 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 13974 and Applied Mathematics}, 13975 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 13976 pages = {553--558}, 13977 volume = {4}, 13978 year = {1997} 13979} 13980 13981% ***** Comprehensive documentation of Diffpack and 13982% associated numerical methods: 13983@Book{ dpbook, 13984 author = {H. P. Langtangen}, 13985 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 13986 Software. Part I}, 13987 series = {Lecture Notes in Computational Science and Engineering}, 13988 publisher = {Springer-Verlag}, 13989 year = {1998} 13990} 13991 13992% ***** Design issues of the linear solvers in Diffpack, serves also as a 13993% collection of examples on O-O in numerical computing 13994@Article{ ambhpl97a, 13995 author = {A. M. Bruaset and H. P. Langtangen }, 13996 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 13997 journal = {Transactions on Mathematical Software}, 13998 volume = {23 }, 13999 pages = {50--80}, 14000 year = {1997} 14001} 14002 14003@Misc{ dpurl, 14004 author = {{Diffpack Web page}}, 14005 howpublished = {\url{http://www.diffpack.com}} 14006} 14007 14008% ***** General intro to object-oriented numerics for "FORTRAN programmers" 14009@InCollection{ oonintro, 14010 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 14011 editor = {D{\ae}hlen, M. and Tveito, A.}, 14012 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14013 title = {Object-Oriented Numerics}, 14014 publisher = {Birkh{\"{a}}user}, 14015 year = {1997} 14016} 14017 14018% ***** Efficiency comparison: BLAS 1, Diffpack, C, 14019% and finite element applications (F77 vs Diffpack) 14020@InCollection{ dpefficiency, 14021 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 14022 H. P. and Miller, C. T.}, 14023 editor = {D{\ae}hlen, M. and Tveito, A.}, 14024 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 14025 title = {On the Efficiency of {C++} in Scientific Computing}, 14026 publisher = {Birkh{\"{a}}user}, 14027 pages = {91--118}, 14028 year = {1997} 14029} 14030 14031% ***** Parallel concept in Diffpack: 14032@InCollection{ dpparallel, 14033 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 14034 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 14035 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 14036 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 14037 Simulators}, 14038 publisher = {Springer--Verlag}, 14039 series = {Lecture Notes in Computer Science}, 14040 pages = {161--168}, 14041 year = {1997} 14042} 14043 14044% ***** DD and ML methods in Diffpack: 14045@InCollection{ dpddml, 14046 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 14047 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 14048 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 14049 title = {Domain decomposition and multilevel methods in Diffpack}, 14050 year = {1997} 14051} 14052 14053@InProceedings{ bsca98, 14054 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 14055 Alexander}, 14056 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 14057 Optimization}, 14058 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14059 Scientific and Engineering Computing}, 14060 editor = {Mike Henderson et al.}, 14061 pages = {165-173}, 14062 year = {1998} 14063} 14064 14065@Book{ scalapack-user-guide, 14066 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 14067 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 14068 Stanley and D. Walker and R. C. Whaley}, 14069 title = {Sca{LAPACK} Users' Guide}, 14070 publisher = {SIAM}, 14071 address = {Philadelphia, PA}, 14072 year = {1997} 14073} 14074 14075@InProceedings{ keyes99, 14076 author = {D. E. Keyes}, 14077 title = {How Scalable is Domain Decomposition in Practice?}, 14078 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 14079 Methods}, 14080 editor = {C.-H. Lai et al.}, 14081 publisher = {Domain Decomposition Press, Bergen}, 14082 note = {To appear}, 14083 year = {1999} 14084} 14085 14086@Article{ fun3d, 14087 author = {W. K. Anderson and D. L. Bonhaus}, 14088 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 14089 grids}, 14090 journal = {Computers and Fluids}, 14091 year = {1994}, 14092 volume = {23}, 14093 pages = {1--21} 14094} 14095 14096% ------------------------------------------------------------------------- 14097% ------------------------------------------------------------------------- 14098@Article{ torczon, 14099 author = {Dennis, Jr., J. E. and V.~Torczon}, 14100 title = {Direct Search Methods on Parallel Machines}, 14101 journal = {SIAM J. Optimization}, 14102 volume = {1}, 14103 pages = {448--474}, 14104 year = {1991}, 14105 key = {Torczon !PDS} 14106} 14107 14108@InProceedings{ wt91, 14109 author = {D. L. Whitfield and L. K. Taylor}, 14110 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 14111 Schemes}, 14112 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 14113 misc = {AIAA-91-1539}, 14114 pages = {134-145}, 14115 year = {1991} 14116} 14117 14118@Article{ ew96, 14119 author = {S. C. Eisenstat and H. F. Walker}, 14120 title = {Choosing the forcing terms in an inexact {N}ewton method}, 14121 journal = {SIAM J. Scientific Computing}, 14122 volume = {17}, 14123 year = {1996}, 14124 pages = {16--32} 14125} 14126 14127@Book{ thi93, 14128 author = {{Thinking Machines Corporation}}, 14129 title = {Users Manual for CM-Fortran}, 14130 publisher = {Thinking Machines Corporation}, 14131 year = {1993} 14132} 14133 14134@Book{ mortonmayers94, 14135 author = {K. W. Morton and D. F. Mayers}, 14136 title = {Numerical Solution of Partial Differential Equations}, 14137 publisher = {Press Syndicate of the University of Cambridge}, 14138 year = {1994} 14139} 14140 14141@Book{ heath97, 14142 author = {Michael T. Heath}, 14143 title = {Scientific Computing: An Introductory Survey}, 14144 publisher = {McGraw Hill}, 14145 year = {1997} 14146} 14147 14148@Article{ captools96, 14149 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 14150 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 14151 Performance on the Parallelization of Structured Mesh Codes}, 14152 journal = {Parallel Computing}, 14153 volume = {22}, 14154 pages = {197-226}, 14155 year = {1996} 14156} 14157 14158@Misc{ nastran-web-page, 14159 author = {{MSC Software Corporation}}, 14160 title = {{NASTRAN} {W}eb page}, 14161 howpublished = {\url{http://www.mechsolutions.com/products/nastran/}}, 14162 year = {2024} 14163} 14164 14165@Book{ hpf, 14166 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 14167 Zosel}, 14168 title = {The High Performance Fotran Handbook}, 14169 publisher = {MIT Press}, 14170 year = {1994} 14171} 14172 14173@InProceedings{ keyes98, 14174 author = {D. E. Keyes}, 14175 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 14176 Architectures}, 14177 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 14178 editors = {M. D. Salas and W. K. Anderson}, 14179 ppublisher = {Elsevier}, 14180 year = {1998} 14181} 14182 14183@InProceedings{ pooma-atlas, 14184 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 14185 J. V. W. Reynders and M. Tholburn}, 14186 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 14187 Applications}, 14188 year = {1995}, 14189 month = dec, 14190 booktitle = {Supercomputing '95 Proceedings} 14191} 14192 14193% --------------------------------------------------------------------------------- 14194% New bib entries for CRPC paper 14195@Misc{ mgnet-web-page, 14196 author = {Craig C. Douglas}, 14197 title = {{MGNet Web page}}, 14198 note = {See {\tt http://\-www.mgnet.org}} 14199} 14200 14201@Misc{ dagh-web-page, 14202 author = {M. Parashar and J. C. Browne}, 14203 title = {{DAGH Web page}}, 14204 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 14205} 14206 14207@Misc{ parasol-web-page, 14208 key = {PARASOL}, 14209 title = {{PARASOL Web page}}, 14210 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 14211} 14212 14213@Misc{ pooma-web-page, 14214 author = {{POOMA Web page}}, 14215 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 14216} 14217 14218@Misc{ mudpack-web-page, 14219 author = {John C. Adams}, 14220 title = {{MUDPACK Web page}}, 14221 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 14222} 14223 14224@Misc{ pellpack-web-page, 14225 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 14226 title = {{Parallel ELLPACK Web page}}, 14227 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 14228} 14229 14230@InProceedings{ pellpack95, 14231 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 14232 Catlin and S. Weerawarana and T.S. Papatheodorou}, 14233 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 14234 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 14235 address = {Albuquerque, NM}, 14236 year = {1995} 14237} 14238 14239@Misc{ nhse-web-page, 14240 author = {{National High-Performance Software Exchange Web page}}, 14241 note = {See {\tt http://\-www.nhse.org}} 14242} 14243 14244@Misc{ doug-web-page, 14245 author = {Mark J. Hagger and Linda Stals}, 14246 title = {{DOUG Web Page}}, 14247 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 14248} 14249 14250@TechReport{ doug97, 14251 author = {Mark J. Hagger}, 14252 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 14253 institution = {Mathematical Sciences, University of Bath}, 14254 year = {1997}, 14255 number = {9706}, 14256 note = {Advances in Computational Mathematics (to appear)} 14257} 14258 14259@Misc{ ug-web-page, 14260 author = {{UG Web Page}}, 14261 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 14262} 14263 14264@Article{ ug97, 14265 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 14266 Rentz-Reichert and C. Wieners}, 14267 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 14268 journal = {Computing and Visualization in Science}, 14269 year = {1997}, 14270 volume = {}, 14271 pages = {} 14272} 14273 14274@Misc{ vecfem-web-page, 14275 author = {Lutz Grosz}, 14276 title = {{VECFEM Web Page}}, 14277 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 14278} 14279 14280@Misc{ atlas-web-page, 14281 author = {R. Clint {Whaley et al.}}, 14282 title = {{ATLAS Web Page}}, 14283 howpublished = {\url{http://math-atlas.sourceforge.net}} 14284} 14285 14286@Misc{ fenics-web-page, 14287 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 14288 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 14289 title = {{FEniCS Web Page}}, 14290 note = {\url{http://www.fenicsproject.org}}, 14291 year = {2005} 14292} 14293 14294@Misc{ matlab-web-page, 14295 author = {{The} {MathWorks}}, 14296 title = {{Matlab} {Web} page}, 14297 url = {http://www.mathworks.com} 14298} 14299 14300@Misc{ phipac-web-page, 14301 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 14302 and D. Lam}, 14303 title = {{PHiPAC Web Page}}, 14304 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 14305} 14306 14307@InProceedings{ kelp, 14308 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 14309 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 14310 booktitle = {Irregular '96}, 14311 year = {1996} 14312} 14313 14314@Unpublished{ kelp-web-page, 14315 author = {Scott Baden}, 14316 title = {{KeLP} {W}eb page}, 14317 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 14318} 14319 14320@InProceedings{ hk99, 14321 author = {R. Hornung and S. Kohn}, 14322 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 14323 Framework}, 14324 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 14325 Scientific and Engineering Computing}, 14326 pages = {235-244}, 14327 year = {1999}, 14328 note = {See \url{http://www.llnl.gov/CASC/samrai}} 14329} 14330 14331@Unpublished{ samrai-web-page, 14332 title = {{SAMRAI} {W}eb Page}, 14333 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 14334 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 14335} 14336 14337@Misc{ overture-web-page, 14338 author = {William Henshaw and Kyle Chand}, 14339 title = {{Overture} {W}eb page}, 14340 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 14341} 14342 14343@InProceedings{ overture99, 14344 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 14345 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 14346 on Overlapping Grids}, 14347 publisher = {SIAM}, 14348 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14349 Scientific and Engineering Computing}, 14350 year = {1999}, 14351 pages = {215-224}, 14352 note = {See \url{http://www.llnl.gov/CASC/Overture}} 14353} 14354 14355@InProceedings{ diffpack, 14356 author = {A.M. Bruaset and H.P. Langtangen}, 14357 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 14358 {D}iffpack}, 14359 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 14360 year = {1997}, 14361 pages = {61--90}, 14362 publisher = {Birkhauser Press} 14363} 14364 14365@Article{ dongarra:1984:ila, 14366 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 14367 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 14368 Machine}, 14369 journal = {SIAM Review}, 14370 volume = {26}, 14371 number = {1}, 14372 pages = {91--112}, 14373 month = jan, 14374 year = {1984}, 14375 coden = {SIREAD}, 14376 issn = {0036-1445 (print), 1095-7200 (electronic)}, 14377 mrclass = {65F10 (65F30)}, 14378 mrnumber = {85c:65032}, 14379 bibdate = {Mon Jan 20 1997}, 14380 abstract = {The authors examine common implementations of linear algebra algorithms, such as 14381 matrix-vector multiplication, matrix-matrix multiplication and the solution of 14382 linear equations. The different versions are examined for efficiency on a computer 14383 architecture which uses vector processing and has pipelined instruction execution. 14384 By using the advanced architectural features of such machines, one can usually 14385 achieve maximum performance, and tremendous improvements in terms of execution 14386 speed can be seen over conventional computers.}, 14387 classification= {723; 921}, 14388 journalabr = {SIAM Rev}, 14389 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 14390 mathematical programming; vector pipeline machine} 14391} 14392 14393@Book{ qv99, 14394 author = {Alfio Quarteroni and Alberto Valli}, 14395 title = {Domain Decomposition Methods for Partial Differential Equations}, 14396 publisher = {Oxford Science Publications}, 14397 address = {Oxford}, 14398 year = {1999} 14399} 14400 14401@Book{ ksv97, 14402 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 14403 title = {Parallel Numerical Algorithms}, 14404 publisher = {Kluwer Academic Publishers}, 14405 address = {the Netherlands}, 14406 year = {1997} 14407} 14408 14409@Book{ hackbusch94, 14410 author = {Wolfgang Hackbusch}, 14411 title = {Iterative Solution of Large Sparse Systems of Equations}, 14412 publisher = {Springer-Verlag}, 14413 address = {New York}, 14414 year = {1994} 14415} 14416 14417@Article{ hackbusch1980fast, 14418 title = {Fast solution of elliptic control problems}, 14419 author = {Hackbusch, W.}, 14420 journal = {Journal of Optimization Theory and Applications}, 14421 volume = {31}, 14422 number = {4}, 14423 pages = {565--581}, 14424 year = {1980}, 14425 publisher = {Springer} 14426} 14427 14428@Book{ hackbusch1985multi, 14429 title = {{Multi-grid methods and applications}}, 14430 author = {Hackbusch, W.}, 14431 isbn = {3540127615}, 14432 issn = {0179-3632}, 14433 year = {1985}, 14434 publisher = {Springer Verlag} 14435} 14436 14437@Book{ axelsson94, 14438 author = {Owe Axelsson}, 14439 title = {Iterative Solution Methods}, 14440 publisher = {Cambridge University Press}, 14441 address = {Cambridge}, 14442 year = {1994} 14443} 14444 14445@Book{ saad96, 14446 author = {Yousef Saad}, 14447 title = {Iterative Methods for Sparse Linear Systems}, 14448 publisher = {PWS Publishing Company}, 14449 address = {Boston}, 14450 year = {1996} 14451} 14452 14453@Book{ saad2003, 14454 title = {Iterative Methods for Sparse Linear Systems}, 14455 author = {Saad, Yousef}, 14456 doi = {10.1016/S1570-579X(01)80025-2}, 14457 edition = {2nd}, 14458 publisher = {SIAM}, 14459 year = {2003} 14460} 14461 14462@Book{ vandervorst03, 14463 author = {Henk A. {van der Vorst}}, 14464 title = {Iterative Krylov Methods for Large Linear Systems}, 14465 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 14466 year = {2003} 14467} 14468 14469@Book{ koniges00, 14470 editor = {Alice E. Koniges}, 14471 title = {Industrial Strength Parallel Computing}, 14472 publisher = {Morgan Kaufmann Publishers}, 14473 address = {San Francisco}, 14474 year = {2000} 14475} 14476 14477@Misc{ fftw-web-page, 14478 key = {Fftw}, 14479 title = {{FFTW} {Web} page}, 14480 note = {\texttt{http://www.fftw.org/}}, 14481 annote = {fast FFT. Parallel versions with MPI and Cilk} 14482} 14483 14484@InProceedings{ frigojohnson93, 14485 author = {Matteo Frigo and Steven G. Johnson}, 14486 title = {The Design and Implementation of {FFTW3}}, 14487 booktitle = {Proceedings of the IEEE}, 14488 volume = {93}, 14489 number = {2}, 14490 pages = {216--231}, 14491 year = {2005} 14492} 14493 14494@Book{ kelley95, 14495 author = {C. T. Kelley}, 14496 title = {Iterative Methods for Linear and Nonlinear Equations}, 14497 year = {1995}, 14498 publisher = {SIAM}, 14499 address = {Philadelphia} 14500} 14501 14502@Unpublished{ spai-web-page, 14503 title = {{SPAI} {W}eb {P}age}, 14504 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 14505 author = {Steven Bernard and Marcus Grote}, 14506 institution = {NASA Ames Research Center and ETH Zurich} 14507} 14508 14509@Article{ gh97, 14510 author = {M. J. Grote and T. Huckle}, 14511 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 14512 year = {1997}, 14513 journal = {SIAM J. of Scient. Comput.}, 14514 volume = {18}, 14515 pages = {838-853} 14516} 14517 14518@Article{ zhang96, 14519 author = {Wen Zhang}, 14520 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 14521 simulation of a sintering process}, 14522 year = {1996}, 14523 journal = {Appl. Numer. Math.}, 14524 volume = {20}, 14525 pages = {235-244} 14526} 14527 14528@Article{ zhang98, 14529 author = {Wen Zhang and Ian Gladwell}, 14530 title = {The sintering of two particles by surface and grain boundary diffusion - a 14531 three-dimensional numerical study}, 14532 journal = {Comp. Mater. Sci.}, 14533 year = {1998}, 14534 volume = {12} 14535} 14536 14537@InProceedings{ mollerschwartzbach01, 14538 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 14539 title = {The Pointer Assertion Logic Engine}, 14540 booktitle = {ACM Proceedings of PLDI'01}, 14541 year = {2001} 14542} 14543 14544@InProceedings{ klarlandschwartzbach97, 14545 author = {Nils Klarland and Michael I. Schwartzbach}, 14546 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 14547 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 14548 publisher = {USENIX}, 14549 month = oct, 14550 year = {1997}, 14551 address = {Santa Barbara, CA} 14552} 14553 14554@InProceedings{ conselmarlet98, 14555 author = {C. Consel and R. Marlet}, 14556 title = {Architecturing software using a methodology for language development}, 14557 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 14558 Implementations, Logics and Programs}, 14559 year = {1998}, 14560 pages = {170-174}, 14561 month = sep, 14562 address = {Pisa, Italy} 14563} 14564 14565@Misc{ sundials:homepage, 14566 author = {C. {Woodward et al.}}, 14567 title = {{SUNDIALS {W}eb page}}, 14568 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 14569} 14570 14571@article{gardner2022sundials, 14572 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 14573 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 14574 journal = {ACM Transactions on Mathematical Software (TOMS)}, 14575 publisher = {ACM}, 14576 year = {2022}, 14577 doi = {10.1145/3539801} 14578} 14579 14580@Misc{ sundials-user-ref, 14581 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14582 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 14583 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 14584 and Dan Shumaker and Carol Woodward}, 14585 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14586 number = {UCRL-JP-200037}, 14587 year = {2003} 14588} 14589 14590@Article{ sundials05, 14591 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 14592 and C. Woodward}, 14593 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14594 journal = {ACM Transactions on Mathematical Software}, 14595 volume = {31}, 14596 number = {3}, 14597 pages = {363--396}, 14598 year = {2005} 14599} 14600 14601@InProceedings{ serban2005cvodes, 14602 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 14603 author = {Serban, Radu and Hindmarsh, Alan C}, 14604 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 14605 Dynamics and Control, Long Beach, CA}, 14606 year = {2005} 14607} 14608 14609@Article{ pvode99, 14610 author = {G. Byrne and A. Hindmarsh}, 14611 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 14612 journal = {Int. J. High Perf. Comput. Apps.}, 14613 volume = {13}, 14614 number = {4}, 14615 year = {1999}, 14616 pages = {354 -- 365} 14617} 14618 14619@Article{ cvode95, 14620 author = {S. Cohen and A. Hindmarsh}, 14621 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 14622 journal = {Computers in Physics}, 14623 volume = {10}, 14624 number = {2}, 14625 year = {1996}, 14626 pages = {138 -- 143} 14627} 14628 14629@TechReport{ ifpack, 14630 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 14631 author = {Marzio Sala and Michael Heroux}, 14632 institution = {Sandia National Laboratories}, 14633 number = {SAND2005-0662}, 14634 year = {2005} 14635} 14636 14637@TechReport{ kinsol-user-ref, 14638 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 14639 Computers}, 14640 author = {Allan Taylor and Alan Hindmarsh}, 14641 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14642 number = {UCRL-ID-131185}, 14643 year = {1998} 14644} 14645 14646@Article{ fiardmanteuffelmccormick98, 14647 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 14648 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 14649 numerical results}, 14650 journal = {SIAM J. Sci. Comp.}, 14651 year = {1998}, 14652 volume = {19}, 14653 pages = {1958--1979} 14654} 14655 14656@InProceedings{ vuduc02, 14657 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 14658 Rajesh Nishtala and Benjamin Lee}, 14659 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 14660 booktitle = {Proceedings of Supercomputing}, 14661 year = {2002}, 14662 month = nov, 14663 address = {Baltimore} 14664} 14665 14666@Article{ beckerbraackrannacher1999, 14667 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 14668 elements}, 14669 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 14670 journal = {Combustion Theory and Modelling}, 14671 volume = {3}, 14672 pages = {503--534}, 14673 year = {1999} 14674} 14675 14676@Article{ beckerrannacher01, 14677 author = {R. Becker and R. Rannacher}, 14678 title = {An optimal control approach to a posteriori error estimation in finite element 14679 methods}, 14680 journal = {Acta Numerica}, 14681 year = {2001}, 14682 volume = {10}, 14683 pages = {1--102} 14684} 14685 14686@Article{ babuskamiller84a, 14687 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14688 title = {The post-processing approach in the finite element method, {I}: Calculations of 14689 displacements, stresses, and other higher derivatives of the displacements}, 14690 journal = {Int. J. Numer. Meth. Eng.}, 14691 year = {1984}, 14692 volume = {20}, 14693 pages = {1085--1109} 14694} 14695 14696@Article{ babuskamiller84b, 14697 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14698 title = {The post-processing approach in the finite element method, {II}: The calculation 14699 of stress intensity factors}, 14700 journal = {Int. J. Numer. Meth. Eng.}, 14701 year = {1984}, 14702 volume = {20}, 14703 pages = {1111--1129} 14704} 14705 14706@Article{ babuskamiller84c, 14707 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14708 title = {The post-processing approach in the finite element method, {III}: A posteriori 14709 error estimation and adaptive mesh refinement}, 14710 journal = {Int. J. Numer. Meth. Eng.}, 14711 year = {1984}, 14712 volume = {20}, 14713 pages = {2311--2324} 14714} 14715 14716@Unpublished{ jtb-web-page, 14717 title = {{The Java Tree Builder}}, 14718 note = {See \url{http://www.cs.purdue.edu/jtb}}, 14719 author = {Jens Palsberg}, 14720 institution = {Purdue University} 14721} 14722 14723@Unpublished{ palsberg98, 14724 title = {Why Visitors?}, 14725 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 14726 author = {Jens Palsberg}, 14727 institution = {Purdue University}, 14728 year = {1998} 14729} 14730 14731@Unpublished{ ply-web-page, 14732 title = {{PLY (Python Lex-Yacc)}}, 14733 note = {\url{http://systems.cs.chicago.edu/ply}}, 14734 author = {David Beazley}, 14735 institution = {University of Chicago} 14736} 14737 14738@Misc{ adic-web-page, 14739 title = {{ADIC Web page}}, 14740 note = {\url{http://www.mcs.anl.gov/autodiff}}, 14741 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 14742 institution = {Argonne National Laboratory} 14743} 14744 14745@Article{ naumann02, 14746 author = {Uwe Naumann}, 14747 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 14748 computational graph}, 14749 journal = {Mathematical Programming (to appear)}, 14750 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 14751 year = {2003} 14752} 14753 14754@Article{ kaper1, 14755 author = {H. G. Kaper and T. J. Kaper}, 14756 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 14757 journal = {Physica D}, 14758 year = {2002}, 14759 pages = {66--93}, 14760 volume = {165} 14761} 14762 14763@Misc{ veltisto-web-page, 14764 author = {George Biros}, 14765 title = {{Veltisto Web page}}, 14766 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 14767} 14768 14769@Article{ karypiskumar98, 14770 author = {George Karypis and Vipin Kumar}, 14771 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 14772 Ordering}, 14773 journal = {Journal of Parallel and Distributed Computing}, 14774 volume = {48}, 14775 pages = {71--85}, 14776 year = {1998} 14777} 14778 14779@TechReport{ karypiskumar97, 14780 author = {Karypis, George and Kumar, V.}, 14781 institution = {Department of Computer Science, University of Minnesota}, 14782 keywords = {graph partitioning; ParMetis}, 14783 note = {http://www.cs.umn.edu/~metis}, 14784 number = {97-060}, 14785 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 14786 year = {1997} 14787} 14788 14789@Misc{ parmetis-web-page, 14790 author = {George {Karypis et al.}}, 14791 title = {{ParMETIS Web page}}, 14792 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 14793 year = {2005} 14794} 14795 14796@Misc{ sparskit-web-page, 14797 author = {Yousef {Saad et al.}}, 14798 title = {{SPARSKIT Web page}}, 14799 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 14800} 14801 14802@Misc{ dscpack-web-page, 14803 author = {Padma Raghavan}, 14804 title = {{DSCPACK Web page}}, 14805 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 14806} 14807 14808@Misc{ gaussian-web-page, 14809 author = {}, 14810 title = {{Gaussian Web page}}, 14811 note = {\url{http://gaussian.com}}, 14812 key = {{Gaussian} {Web} page} 14813} 14814 14815@Book{ lapack-user-guide, 14816 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 14817 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 14818 Sorensen}, 14819 title = {LAPACK Users' Guide, Third Edition}, 14820 publisher = {SIAM}, 14821 year = {1999} 14822} 14823 14824@Manual{ nwchem4.1, 14825 author = {High Performance Computational Chemistry Group}, 14826 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 14827 year = {2002}, 14828 organization = {Pacific Northwest National Laboratory}, 14829 address = {Richland, Washington 99325-0999 USA}, 14830 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 14831} 14832 14833@TechReport{ tchem, 14834 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 14835 author = {Cosmin Safta and Habib Najm and Omar Knio}, 14836 institution = {Sandia National Laboratories}, 14837 number = {SAND2011-3282}, 14838 year = {2011} 14839} 14840 14841@Misc{ scidac-web-page, 14842 author = {}, 14843 title = {{{SciDAC Initiative Web page}}}, 14844 note = {\url{http://www.osti.gov/scidac}}, 14845 key = {{SciDAC Initiative Web page}} 14846} 14847 14848@Misc{ cmrs:homepage, 14849 author = {Amitava {Bhattacharjee (PI)}}, 14850 title = {{Center for Magnetic Reconnection Studies}}, 14851 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 14852} 14853 14854@Misc{ tops:homepage, 14855 author = {David {Keyes (PI)}}, 14856 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 14857 howpublished = {\url{http://scalablesolvers.org}} 14858} 14859 14860@Misc{ tstt:homepage, 14861 author = {David Brown and Jim Glimm and Lori Freitag}, 14862 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 14863 howpublished = {\url{http://www.tstt-scidac.org}}, 14864 year = {2005} 14865} 14866 14867@Misc{ petsc:applications, 14868 author = {B. F. {Smith et al.}}, 14869 title = {{Scientific Applications Using {PETSc}}}, 14870 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 14871} 14872 14873@Misc{ petsc:users, 14874 author = {B. F. {Smith et al.}}, 14875 title = {{PETSc User Statistics}}, 14876 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 14877} 14878 14879@Misc{ cemm:homepage, 14880 author = {Steve {Jardin (PI)}}, 14881 title = {{Center for Extended MHD Modeling}}, 14882 howpublished = {\url{http://w3.pppl.gov/CEMM}} 14883} 14884 14885@Misc{ m3d:homepage, 14886 author = {Steve {Jardin et al.}}, 14887 title = {{M3D Web page}}, 14888 howpublished = {\url{http://w3.pppl.gov/m3d}} 14889} 14890 14891@Misc{ nimrod:homepage, 14892 author = {Carl R. {Sovinec et al.}}, 14893 title = {{NIMROD Web page}}, 14894 howpublished = {http://nimrodteam.org} 14895} 14896 14897@Misc{ grace-web-page, 14898 author = {Manish {Parashar et al.}}, 14899 title = {{GrACE Web Page}}, 14900 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 14901} 14902 14903@Misc{ accel1, 14904 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 14905 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 14906 author = {K. Ko and R. Ryne (PIs)} 14907} 14908 14909@Unpublished{ katzspiegelman03, 14910 author = {Richard F. Katz and Marc Spiegelman}, 14911 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 14912 advection-diffusion problems}, 14913 note = {Columbia University, in preparation} 14914} 14915 14916@Misc{ acts:homepage, 14917 author = {}, 14918 title = {{Advanced CompuTational Software (ACTS) Web page}}, 14919 howpublished = {\url{http://acts.nersc.gov}}, 14920 key = {{Advanced CompuTational Software (ACTS) Web page}} 14921} 14922 14923@Article{ superlu99, 14924 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 14925 Joseph W. H. Liu}, 14926 title = {A supernodal approach to sparse partial pivoting}, 14927 journal = {SIAM J. Matrix Analysis and Applications}, 14928 year = {1999}, 14929 volume = {20}, 14930 number = {3}, 14931 pages = {720-755} 14932} 14933 14934@Misc{ superlu:homepage, 14935 author = {J. Demmel and J. Gilbert and X. Li}, 14936 title = {{SuperLU Web page}}, 14937 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 14938} 14939 14940@InProceedings{ ccf98, 14941 author = {E. Chow and A. Cleary and R. Falgout}, 14942 title = {Design of the hypre Preconditioner Library}, 14943 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14944 Scientific and Engineering Computing}, 14945 publisher = {SIAM}, 14946 year = {1999} 14947} 14948 14949@TechReport{ hypre-users-manual, 14950 author = {R. Falgout}, 14951 title = {{hypre} Users Manual}, 14952 number = {Revision 2.28}, 14953 institution = {Lawrence Livermore National Laboratory}, 14954 year = {2023}, 14955 url = {https://hypre.readthedocs.io/} 14956} 14957 14958@Misc{ hypre:homepage, 14959 author = {R. Falgout}, 14960 title = {{hypre Web page}}, 14961 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 14962} 14963 14964@InProceedings{ trilinos:gpu, 14965 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 14966 title = {A Light-weight API for Portable Multicore Programming}, 14967 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 14968 Network-Based Processing (PDP)}, 14969 pages = {601--606}, 14970 publisher = {IEEE}, 14971 year = {2010} 14972} 14973 14974@InProceedings{ heroux2004design, 14975 title = {The design of {T}rilinos}, 14976 author = {Heroux, Michael A and Sala, Marzio}, 14977 booktitle = {International Workshop on Applied Parallel Computing}, 14978 pages = {620--628}, 14979 year = {2004}, 14980 organization = {Springer} 14981} 14982 14983@Misc{ trilinos:homepage, 14984 author = {M. {Heroux et al.}}, 14985 title = {{Trilinos Web page}}, 14986 howpublished = {{\tt http://trilinos.sandia.gov/}} 14987} 14988 14989@Article{ trilinos:overview, 14990 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 14991 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 14992 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 14993 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 14994 Kendall S. Stanley}, 14995 title = {An overview of the {T}rilinos project}, 14996 journal = {ACM Transactions on Mathematical Software}, 14997 volume = {31}, 14998 number = {3}, 14999 year = {2005}, 15000 issn = {0098-3500}, 15001 pages = {397--423}, 15002 publisher = {ACM Press}, 15003 doi = {10.1145/1089014.1089021} 15004} 15005 15006@Misc{ rythmos:homepage, 15007 author = {T. Coffey and R. Bartlett}, 15008 title = {Rythmos: Transient Integration of Differential Equations}, 15009 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 15010} 15011 15012@Misc{ triangle:homepage, 15013 author = {J. {Shewchuk}}, 15014 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 15015 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 15016 year = {2005} 15017} 15018 15019@Misc{ tetgen:homepage, 15020 author = {Hang {Si}}, 15021 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 15022 Triangulator}}, 15023 howpublished = {\url{http://tetgen.berlios.de}}, 15024 year = {2005} 15025} 15026 15027@Misc{ opencascade:homepage, 15028 author = {{OpenCASCADE SAS}}, 15029 title = {{Open CASCADE Technology (OCCT)}}, 15030 howpublished = {\url{https://dev.opencascade.org/}}, 15031 year = {2024} 15032} 15033 15034@Misc{ eigen:homepage, 15035 author = {Benoit Jacob and Ga\"el Guennebaud}, 15036 title = {{Eigen} {W}eb page}, 15037 key = {Jacob}, 15038 url = {http://eigen.tuxfamily.org/}, 15039 howpublished = {\url{http://eigen.tuxfamily.org/}}, 15040 year = {2015} 15041} 15042 15043@Misc{ dune:homepage, 15044 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 15045 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 15046 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 15047 Oliver Sander}, 15048 title = {{DUNE} {W}eb page}, 15049 key = {Bastian}, 15050 url = {http://www.dune-project.org/}, 15051 howpublished = {\url{http://www.dune-project.org/}}, 15052 year = {2015} 15053} 15054 15055@Misc{ thrust, 15056 author = {N. Bell and J. Hoberock}, 15057 title = {The {T}hrust Library}, 15058 howpublished = {{\tt http://code.google.com/p/thrust/}}, 15059 year = {2010} 15060} 15061 15062@Misc{ cusp, 15063 author = {N. Bell and M. Garland}, 15064 title = {The {C}usp Library}, 15065 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 15066 year = {2010} 15067} 15068 15069@Misc{ cig:homepage, 15070 author = {M. {Gurnis et al.}}, 15071 title = {{Computational Infrastructure for Geodynamics}}, 15072 howpublished = {\url{http://www.geodynamics.org}} 15073} 15074 15075@Article{ maltsevselkov00, 15076 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 15077 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 15078 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 15079 metabolic reconstruction}, 15080 journal = {Nucleic Acids Res.}, 15081 year = {2000}, 15082 month = jan, 15083 pages = {123-125}, 15084 volume = {28}, 15085 number = {1} 15086} 15087 15088@Article{ more:coloring, 15089 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 15090 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 15091 journal = {SIAM Journal on Numerical Analysis}, 15092 year = {1983}, 15093 month = feb, 15094 pages = {187--209}, 15095 volume = {20}, 15096 number = {1} 15097} 15098 15099@Article{ selkovmaltsev97, 15100 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 15101 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 15102 data}, 15103 journal = {Gene}, 15104 year = {1997}, 15105 pages = {GC11-GC26}, 15106 volume = {197}, 15107 number = {1-2} 15108} 15109 15110@Unpublished{ rocketcenter, 15111 title = {Center for Simulation of Advanced Rockets}, 15112 note = {http://www.csar.uiuc.edu}, 15113 institution = {University of Illinois at Urbana-Champaign} 15114} 15115 15116@Article{ kirby03, 15117 title = {A posteriori error estimates for the mixed hybrid finite element method}, 15118 author = {Robert C Kirby}, 15119 journal = {Computational Geosciences}, 15120 volume = {7}, 15121 pages = {197--214}, 15122 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 15123 year = {2003} 15124} 15125 15126@Article{ kirby2003b, 15127 title = {On the convergence of high resolution methods with multiple time scales for 15128 hyperbolic conservation laws}, 15129 author = {Robert C Kirby}, 15130 journal = {Mathematics of computation}, 15131 volume = {72}, 15132 number = {243}, 15133 pages = {1239--1250}, 15134 year = {2003} 15135} 15136 15137@Article{ dawsonkirby2001, 15138 title = {High resolution schemes for conservation laws with locally varying time steps}, 15139 author = {Clint Dawson and Robert C Kirby}, 15140 journal = {SIAM Journal on Scientific Computing}, 15141 volume = {22}, 15142 number = {6}, 15143 pages = {2256--2281}, 15144 year = {2001}, 15145 publisher = {SIAM} 15146} 15147 15148@Article{ dawsonkirby1999, 15149 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 15150 a dynamically changing mesh}, 15151 author = {Clint Dawson and Robert C Kirby}, 15152 journal = {SIAM Journal on Numerical Analysis}, 15153 volume = {37}, 15154 number = {2}, 15155 pages = {423--442}, 15156 year = {1999}, 15157 publisher = {SIAM} 15158} 15159 15160@Article{ barthlarson00, 15161 author = {T. J. Barth and M. G. Larson}, 15162 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 15163 Hyperbolic Systems}, 15164 journal = {LNCS}, 15165 year = {2000}, 15166 volume = {11}, 15167 publisher = {Spinger-Verlag} 15168} 15169 15170@Article{ xu1, 15171 author = {J. Xu}, 15172 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 15173 journal = {SIAM Review}, 15174 volume = {34}, 15175 pages = {581--613}, 15176 year = {1992} 15177} 15178 15179@Article{ brandt77, 15180 author = {Achi Brandt}, 15181 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 15182 journal = {Mathematics of Computation}, 15183 month = apr, 15184 year = {1977}, 15185 pages = {333--390}, 15186 volume = {31}, 15187 number = {138}, 15188 doi = {10.2307/2006422} 15189} 15190 15191@Article{ brandt1979multigrid, 15192 title = {{Multigrid solutions to elliptic flow problems}}, 15193 author = {Brandt, A. and Dinar, N.}, 15194 journal = {Numerical Methods for Partial Differential Equations}, 15195 pages = {53--147}, 15196 year = {1979} 15197} 15198 15199@InCollection{ brandt1979singular, 15200 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 15201 author = {Achi Brandt}, 15202 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 15203 editor = {Hemker, Pieter W. and Miller, John J.H.}, 15204 pages = {53--142}, 15205 year = {1979}, 15206 publisher = {Academic Press} 15207} 15208 15209@Article{ amge1, 15210 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 15211 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 15212 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 15213 journal = {SIAM J. Scientific Computing}, 15214 volume = {22}, 15215 pages = {1570--1592}, 15216 year = {2000} 15217} 15218 15219@Book{ bramble1, 15220 author = {J. H. Bramble}, 15221 title = {Multigrid Methods}, 15222 publisher = {Longman Scientific and Technical}, 15223 address = {Essex, England}, 15224 year = {1993} 15225} 15226 15227@Book{ arpack98, 15228 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 15229 title = {ARPACK, Users' Guide}, 15230 publisher = {SIAM}, 15231 year = {1998} 15232} 15233 15234@Article{ bbder96, 15235 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 15236 title = {Algorithmic bombardment for the iterative solution of linear systems: A 15237 polyIterative approach}, 15238 journal = {J. of Computational and Applied Mathematics}, 15239 year = {1996}, 15240 volume = {74}, 15241 pages = {91--110} 15242} 15243 15244@Article{ egks94, 15245 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 15246 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 15247 journal = {SIAM J. Scientific Computing}, 15248 year = {1994}, 15249 volume = {15}, 15250 number = {3}, 15251 pages = {681--703} 15252} 15253 15254@Article{ dftb02, 15255 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 15256 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 15257 diamond grain boundaries,}, 15258 journal = {Phys. Rev}, 15259 year = {2002}, 15260 volume = {B65}, 15261 pages = {045403} 15262} 15263 15264@InBook{ lsa, 15265 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 15266 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 15267 title = {The linear system analyzer}, 15268 series = {enabling technologies for computational science}, 15269 year = {2002}, 15270 publisher = {Kluwer}, 15271 location = {Dordrecht} 15272} 15273 15274@Article{ kk97, 15275 author = {Carl T. Kelley and David E. Keyes}, 15276 title = {Convergence analysis of pseudo-transient continuation}, 15277 journal = {SIAM J. Numerical Analysis}, 15278 year = {1998}, 15279 volume = {35}, 15280 pages = {508--523} 15281} 15282 15283@Article{ swtm01, 15284 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 15285 journal = {Journal of Computational Physics}, 15286 year = {2001}, 15287 volume = {172}, 15288 number = {2}, 15289 pages = {472--514}, 15290 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 15291 Method} 15292} 15293 15294@TechReport{ zhou03, 15295 author = {Y. Zhou}, 15296 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 15297 IIGD, RQI and Newton} Updates}, 15298 institution = {Argonne National Laboratory}, 15299 number = {ANL/MCS-P1074-0803}, 15300 note = {Submitted to Numerical Linear Algebra with Applications}, 15301 year = {2003} 15302} 15303 15304@Unpublished{ mtwm03, 15305 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 15306 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 15307 Detailed analysis of one-dimensional applications}, 15308 note = {to appear in the Journal of Chemical Physics}, 15309 year = {2003} 15310} 15311 15312@Article{ singhjosephheslaglowinskipan00, 15313 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 15314 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 15315 particulate flows}, 15316 journal = {J. Non-Newtonian Fluid Mech.}, 15317 volume = {91}, 15318 pages = {165--188}, 15319 year = {2000} 15320} 15321 15322@Book{ joseph02, 15323 author = {Daniel D. Joseph}, 15324 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 15325 publisher = {Springer-Verlag}, 15326 month = mar, 15327 year = {2002}, 15328 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 15329} 15330 15331@Misc{ triangle-web-page, 15332 author = {Jonathan R. Shewchuk}, 15333 title = {{Triangle Web} page}, 15334 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 15335} 15336 15337@InCollection{ shewchuk96, 15338 author = {Jonathan R. Shewchuk}, 15339 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 15340 Triangulator}, 15341 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 15342 editor = {Ming C. Lin and Dinesh Manocha}, 15343 series = {Lecture Notes in Computer Science}, 15344 volume = {1148}, 15345 publisher = {Springer-Verlag}, 15346 pages = {203--222}, 15347 month = may, 15348 year = {1996}, 15349 note = {From the First ACM Workshop on Applied Computational Geometry} 15350} 15351 15352@Article{ leaf1, 15353 author = {Transient Dynamics of Pinning of Domain Walls}, 15354 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 15355 journal = {J. Magnetism and Magnetic Materials}, 15356 volume = {241}, 15357 pages = {118--123}, 15358 year = {2002} 15359} 15360 15361@Article{ leaf2, 15362 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 15363 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 15364 Superconductivity}, 15365 journal = {SIAM J. Sci. Comp.}, 15366 volume = {23}, 15367 pages = {1944--1959}, 15368 year = {2002} 15369} 15370 15371@Article{ leaf3, 15372 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 15373 title = {Hysteresis in Layered Spring Magnets}, 15374 journal = { Discreet and Continuous Dynamical Systems, Series B}, 15375 volume = {1}, 15376 pages = {219--232}, 15377 year = {2001} 15378} 15379 15380@Article{ leaf4, 15381 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 15382 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 15383 journal = {J. Phys. D Appl. Phys.}, 15384 volume = {35}, 15385 pages = {2339--2343}, 15386 year = {2002} 15387} 15388 15389@Article{ leaf5, 15390 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 15391 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 15392 journal = {Submitted to Phys. Rev. B.}, 15393 note = {Submitted}, 15394 year = {2003} 15395} 15396 15397@Article{ graysumpternoidbarnes01, 15398 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 15399 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 15400 Nanospheres}, 15401 journal = {Chem. Phys. Lett.}, 15402 volume = {333}, 15403 pages = {308--313}, 15404 year = {2001} 15405} 15406 15407@InProceedings{ petsc-efficient, 15408 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 15409 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 15410 Libraries}, 15411 booktitle = {Modern Software Tools in Scientific Computing}, 15412 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 15413 publisher = {Birkh{\"{a}}user Press}, 15414 pages = {163--202}, 15415 year = {1997} 15416} 15417 15418@Article{ mumps01, 15419 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 15420 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 15421 journal = {SIAM Journal on Matrix Analysis and Applications}, 15422 volume = {23}, 15423 number = {1}, 15424 pages = {15--41}, 15425 year = {2001} 15426} 15427 15428@Article{ mumps19, 15429 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 15430 Multicore Architectures}}, 15431 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 15432 journal = {ACM Transactions on Mathematical Software}, 15433 volume = {45}, 15434 issue = {1}, 15435 pages = {2:1--2:26}, 15436 year = {2019} 15437} 15438 15439@Article{ zoltan06, 15440 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 15441 \c{C}ataly\"urek and Robert H. Bisseling}, 15442 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 15443 journal = {SIAM Parallel Processing for Scientific Computing}, 15444 month = feb, 15445 year = {2006} 15446} 15447 15448@Article{ lidemmel03, 15449 author = {Xiaoye S. Li and James W. Demmel}, 15450 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 15451 unsymmetric linear systems}, 15452 journal = {ACM Transactions on Mathematical Software}, 15453 year = {2003}, 15454 month = jun, 15455 volume = {29}, 15456 number = {2}, 15457 pages = {110--140} 15458} 15459 15460@TechReport{ superlu, 15461 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 15462 title = {{SuperLU} Users' Guide}, 15463 number = {LBNL-44289}, 15464 institution = {Lawrence Berkeley National Laboratory}, 15465 year = {2003}, 15466 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 15467} 15468 15469@TechReport{ trilinos-overview03, 15470 title = {{An Overview of {T}rilinos}}, 15471 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 15472 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 15473 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 15474 Willenbring and Alan Williams}, 15475 institution = {Sandia National Laboratories}, 15476 number = {SAND2003-2927}, 15477 year = {2003} 15478} 15479 15480@TechReport{ trilinos-users-guide, 15481 title = {{Trilinos} Users Guide}, 15482 author = {Michael A. Heroux and James M. Willenbring}, 15483 institution = {Sandia National Laboratories}, 15484 number = {SAND2003-2952}, 15485 url = {http://trilinos.sandia.gov/}, 15486 year = {2003} 15487} 15488 15489@Article{ pilut01, 15490 author = {David Hysom and Alex Pothen}, 15491 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 15492 journal = {SIAM Journal on Scientific Computing}, 15493 volume = {22}, 15494 pages = {2194--2215}, 15495 year = {2001} 15496} 15497 15498@TechReport{ boomeramg00, 15499 author = {V.~E. Henson and U.~M. Yang}, 15500 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 15501 institution = {Lawrence Livermore National Laboratory}, 15502 number = {UCRL-JC-133948}, 15503 year = {2000} 15504} 15505 15506@InCollection{ baker2012scaling, 15507 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 15508 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 15509 and Schulz, Martin and Yang, Ulrike Meier}, 15510 booktitle = {Competence in High Performance Computing 2010}, 15511 pages = {215--226}, 15512 year = {2012}, 15513 publisher = {Springer} 15514} 15515 15516@Article{ knollkeyes:04, 15517 author = {D. A. Knoll and D. E. Keyes}, 15518 year = {2004}, 15519 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 15520 journal = {J. Comp. Phys.}, 15521 volume = {193}, 15522 pages = {357-397} 15523} 15524 15525@Article{ chacon02, 15526 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 15527 title = {An implicit nonlinear reduced resistive {MHD} solver}, 15528 journal = {J. Comput. Phys}, 15529 volume = {188}, 15530 year = {2002}, 15531 pages = {15--36} 15532} 15533 15534@Article{ mousseau03, 15535 author = {V. A. Mousseau and D. A. Knoll}, 15536 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 15537 Radiation Diffusion}, 15538 journal = {J. Comput. Physics}, 15539 year = {2003} 15540} 15541 15542@Article{ mousseau00, 15543 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 15544 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 15545 Radiation Diffusion}, 15546 journal = {J. Comput. Physics}, 15547 year = {2000}, 15548 pages = {743--765}, 15549 volume = {160} 15550} 15551 15552@Unpublished{ facets:homepage, 15553 author = {John {Cary (PI)}}, 15554 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 15555 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 15556} 15557 15558@Unpublished{ cpes:homepage, 15559 author = {{C.S.} {Chang (PI)}}, 15560 title = {{Center for Plasma Edge Simulation (CPES)}}, 15561 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 15562} 15563 15564@Misc{ epsi:homepage, 15565 author = {{C.S.} {Chang (PI)}}, 15566 title = {{Center for Edge Physics Simulation (EPSI)}}, 15567 note = {\url{http://epsi.pppl.gov}} 15568} 15569 15570@Unpublished{ groundwater-scidac2:web, 15571 author = {Peter {Lichtner (PI)}}, 15572 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15573 Advanced Computing}, 15574 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 15575} 15576 15577@Misc{ pflotran:web, 15578 author = {Peter {Lichtner (PI)}}, 15579 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15580 Advanced Computing}}, 15581 note = {\url{http://ees.lanl.gov/pflotran/}} 15582} 15583 15584@Misc{ accel-scidac2-solicitation, 15585 author = {{DOE Office of Science}}, 15586 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 15587 year = {2006}, 15588 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 15589} 15590 15591@Article{ nieter04, 15592 author = {C. Nieter and J. R. Cary}, 15593 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 15594 journal = {J. Comp. Phys.}, 15595 year = {2004}, 15596 volume = {196}, 15597 pages = {448} 15598} 15599 15600@Article{ synergia06, 15601 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 15602 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 15603 journal = {J. Comp. Phys.}, 15604 year = {2006}, 15605 volume = {211}, 15606 pages = {229-248} 15607} 15608 15609@Unpublished{ stoltz07, 15610 author = {P. H. Stoltz}, 15611 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 15612 year = {2007}, 15613 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 15614 Albuquerque, NM, 2007} 15615} 15616 15617@Misc{ iter:homepage, 15618 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15619 year = {2007}, 15620 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15621 howpublished = {\url{http://www.iter.org}} 15622} 15623 15624@Misc{ epp2010, 15625 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 15626 Council}}, 15627 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 15628 Particle Physics}, 15629 year = {2006}, 15630 howpublished = {The National Academies Press, ISBN: 0309101948} 15631} 15632 15633@Misc{ post-fsp-report, 15634 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 15635 and P.~Colella and S.~C.~Jardin}, 15636 title = {{Report of Fusion Simulation Project Steering Committee}}, 15637 month = aug, 15638 year = {2004}, 15639 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 15640} 15641 15642@Misc{ fsp:workshop2011, 15643 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15644 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15645 month = feb, 15646 year = {2011}, 15647 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 15648} 15649 15650@Book{ hazeltine-meiss-book, 15651 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 15652 title = {Plasma Confinement}, 15653 year = {1991}, 15654 publisher = {Addison-Wesley, Redwood City, CA} 15655} 15656 15657@Article{ falgout05a, 15658 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15659 title = {Conceptual Interfaces in hypre}, 15660 journal = {Future Generation Computer Systems}, 15661 note = {Special issue on PDE software}, 15662 volume = {22}, 15663 year = {2005}, 15664 pages = {239--251} 15665} 15666 15667@Article{ falgout05b, 15668 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15669 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 15670 journal = {ACM Trans. Math. Softw.}, 15671 volume = {31}, 15672 year = {2005}, 15673 pages = {326--350} 15674} 15675 15676@Unpublished{ compass:homepage, 15677 author = {Panagiotis {Spentzouris (PI)}}, 15678 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 15679 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 15680} 15681 15682@Unpublished{ cmsnf:homepage, 15683 author = {{Todd Allen, Director}}, 15684 title = {{Center for Materials Science of Nuclear Fuel}}, 15685 note = {Energy Frontier Research Center, see 15686 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 15687} 15688 15689@Unpublished{ dvi-materials:project, 15690 author = {{L.~C.} {McInnes (PI)}}, 15691 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 15692 note = {{SciDAC}-e project}, 15693 year = {2011} 15694} 15695 15696@Misc{ scidac:homepage, 15697 author = {{DOE Office of Science}}, 15698 title = {{Scientific Discovery through Advanced Computing}}, 15699 year = {2007}, 15700 howpublished = {\url{http://www.scidac.gov}} 15701} 15702 15703@Misc{ corba, 15704 author = {{Object Management Group}}, 15705 year = {2007}, 15706 title = {{Common Object Request Broker Architecture (CORBA)}}, 15707 howpublished = {\url{http://www.corba.org}} 15708} 15709 15710@Article{ uedge, 15711 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 15712 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 15713 Divertor Tokamak}, 15714 journal = {J. Plasma Physics}, 15715 year = {1999}, 15716 volume = {6}, 15717 pages = {1851}, 15718 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 15719} 15720 15721@Article{ bout, 15722 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 15723 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 15724 journal = {J. Plasma Physics}, 15725 year = {2000}, 15726 volume = {7}, 15727 pages = {1951}, 15728 note = {} 15729} 15730 15731@Article{ bout++, 15732 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 15733 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 15734 journal = {Computer Physics Communications}, 15735 year = {2009}, 15736 volume = {180}, 15737 issue = {9}, 15738 pages = {1467 -- 1480}, 15739 note = {} 15740} 15741 15742@Article{ tempest, 15743 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 15744 and G. Kerbel and W.M. Nevins and T. Rognlien}, 15745 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 15746 journal = {Bull. Am. Phys. Soc. }, 15747 year = {2005}, 15748 volume = {50}, 15749 number = {86}, 15750 pages = {CP1}, 15751 note = {} 15752} 15753 15754@Article{ ccahpc, 15755 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 15756 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 15757 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 15758 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 15759 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 15760 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 15761 and Theresa L. Windus and Shujia Zhou}, 15762 title = {A Component Architecture for High-Performance Scientific Computing}, 15763 journal = {Intl. J. High-Perf. Computing Appl.}, 15764 volume = {20}, 15765 pages = {163--202}, 15766 year = {2006}, 15767 note = {ACTS Collection special issue} 15768} 15769 15770@Misc{ cca-forum:homepage, 15771 author = {{Common Component Architecture Forum}}, 15772 note = {\url{http://www.cca-forum.org}}, 15773 year = {2010} 15774} 15775 15776@Misc{ petsc:driven-cavity-example, 15777 title = {{PETSc Driven Cavity Example Code}}, 15778 author = {B. F. {Smith et al.}}, 15779 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 15780} 15781 15782@Misc{ petsc-dm:webpage, 15783 author = {B. F. {Smith et al.}}, 15784 title = {{PETSc DM Webpage}}, 15785 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 15786 year = {2018} 15787} 15788 15789@Misc{ unic-ref, 15790 author = {Giuseppe Palmiotti}, 15791 title = {{UNIC} Neutronics Software}, 15792 note = {Nuclear Engineering Division, Argonne National Laboratory} 15793} 15794 15795% ----------------------------------------------------------------------- 15796% Model coupling refs 15797@Book{ greve-blatter, 15798 author = {Ralf Greve and Heinz Blatter}, 15799 title = {Dynamics of Ice Sheets and Glaciers}, 15800 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 15801 publisher = {Springer}, 15802 year = {2009} 15803} 15804 15805@Misc{ doe-isicles, 15806 key = {ISICLES}, 15807 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 15808 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 15809} 15810 15811@Article{ safta2011tchem, 15812 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 15813 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 15814 journal = {Sandia Report, SAND2011-3282}, 15815 year = {2011} 15816} 15817 15818@Misc{ chemkin-website, 15819 key = {chemkin}, 15820 title = {ANSYS Chemkin-Pro Website}, 15821 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 15822 year = {2017} 15823} 15824 15825@Misc{ mct-website, 15826 key = {MCT}, 15827 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 15828 howpublished = {\url{http://www.mcs.anl.gov/mct}} 15829} 15830 15831@Article{ larson:05, 15832 author = {Jay Larson and Robert Jacob and Everest Ong}, 15833 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 15834 Multi-Physics Parallel Coupled Models}, 15835 journal = {Int. J. High Perf. Comp. App.}, 15836 year = {2005}, 15837 pages = {277--292} 15838} 15839 15840@Article{ dennis2012computational, 15841 title = {Computational performance of ultra-high-resolution capability in the Community 15842 Earth System Model}, 15843 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 15844 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 15845 journal = {International Journal of High Performance Computing Applications}, 15846 volume = {26}, 15847 number = {1}, 15848 pages = {5--16}, 15849 year = {2012}, 15850 publisher = {SAGE Publications} 15851} 15852 15853@InProceedings{ bettge01, 15854 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 15855 year = {2001}, 15856 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 15857 Backroads}, 15858 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15859 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15860 pages = {148 -- 156}, 15861 series = {Lecture Notes in Computer Science}, 15862 volume = {2073}, 15863 publisher = {Springer-Verlag} 15864} 15865 15866@InProceedings{ jacob01, 15867 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 15868 year = {2001}, 15869 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 15870 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15871 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15872 series = {Lecture Notes in Computer Science}, 15873 volume = {2073}, 15874 publisher = {Springer-Verlag} 15875} 15876 15877@Article{ chen2008new, 15878 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 15879 design}, 15880 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 15881 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 15882 journal = {Chinese Science Bulletin}, 15883 volume = {53}, 15884 number = {22}, 15885 pages = {3433--3445}, 15886 year = {2008}, 15887 publisher = {Springer} 15888} 15889 15890@InProceedings{ baum01, 15891 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 15892 and C. Charman}, 15893 year = {2001}, 15894 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 15895 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15896 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15897 series = {Lecture Notes in Computer Science}, 15898 volume = {2073}, 15899 publisher = {Springer-Verlag} 15900} 15901 15902@InProceedings{ lefantzi03, 15903 author = {S. Lefantzi and J. Ray}, 15904 year = {2003}, 15905 title = {A Component-based Scientific Toolkit for Reacting Flows}, 15906 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 15907 volume = {2}, 15908 publisher = {Elsevier} 15909} 15910 15911@Article{ boville98, 15912 author = {B. A. Boville and P. R. Gent}, 15913 title = {The {NCAR} Climate System Model, Version One}, 15914 journal = {Journal of Climate}, 15915 volume = {11}, 15916 year = {1998}, 15917 pages = {1115--1130} 15918} 15919 15920@Misc{ paraschivoiu99, 15921 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 15922 title = {Multi-domain multi-model formulation for compressible flows: Conservative 15923 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 15924 note = {AIAA Paper 99-0784}, 15925 year = {1999} 15926} 15927 15928@Article{ peszynska, 15929 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 15930 title = {Mortar upscaling for multiphysics flow in porous media}, 15931 journal = {Computational Geosciences} 15932} 15933 15934@TechReport{ wheeler00, 15935 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 15936 title = {A distributed computing portal for coupling multi-physics and multiple domains in 15937 porous media}, 15938 institution = {University of Texas at Austin}, 15939 number = {TICAM 00-03}, 15940 year = {2000} 15941} 15942 15943@TechReport{ peszynska00, 15944 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 15945 title = {Multiphysics Coupling of Codes}, 15946 institution = {University of Texas at Austin}, 15947 number = {TICAM 00-02}, 15948 year = {2000} 15949} 15950 15951@Article{ joshaghanijoodatnakshatrala2019, 15952 title = {A stabilized mixed discontinuous Galerkin formulation for double 15953 porosity/permeability model}, 15954 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 15955 journal = {Computer Methods in Applied Mechanics and Engineering}, 15956 volume = {352}, 15957 pages = {508--560}, 15958 year = {2019} 15959} 15960 15961@InProceedings{ cai99, 15962 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 15963 title = {An explicit multi-model compressible flow formulation based on the full potential 15964 equation and the {Euler} equations on {3D} unstructured meshes}, 15965 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 15966 Methods}, 15967 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 15968 year = {1999} 15969} 15970 15971@Article{ he05, 15972 author = {Yun He and Chris H. Q. Ding}, 15973 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 15974 Architectures}, 15975 year = {2005}, 15976 volume = {19}, 15977 pages = {329--240}, 15978 number = {3}, 15979 journal = {Int. Journal of High Performance Computing Applications} 15980} 15981 15982@InProceedings{ uiuc-rocket-center02, 15983 author = {W. A. Dick and M. T. Heath}, 15984 title = {Whole System Simulation of Solid Propellant Rockets}, 15985 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 15986 month = jul, 15987 year = {2002} 15988} 15989 15990@InProceedings{ toth04, 15991 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 15992 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 15993 Oehmke}, 15994 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 15995 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 15996 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 15997 Sun-Earth Connection}, 15998 year = {2004}, 15999 publisher = {Elsevier}, 16000 pages = {383--397} 16001} 16002 16003@Misc{ csdrm:web, 16004 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 16005 Shepherd}, 16006 title = {{Center for Simulation of Dynamic Response of Materials}}, 16007 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 16008} 16009 16010@Misc{ csar:web, 16011 author = {M. {Heath (Director)}}, 16012 title = {{Center for Simulation of Advanced Rockets}}, 16013 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 16014} 16015 16016@Misc{ csafe:web, 16017 author = {D. {Pershing (Director)}}, 16018 title = {{Center for Simulation of Accidental Fires and Explosions}}, 16019 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 16020} 16021 16022@Misc{ cits:web, 16023 author = {P. {Moin (Director)}}, 16024 title = {{Center for Integrated Turbulence Simulations}}, 16025 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 16026} 16027 16028@Misc{ flash:web, 16029 author = {D. {Lamb (Director)}}, 16030 title = {{Center for Integrated Turbulence Simulations}}, 16031 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 16032} 16033 16034@TechReport{ utah-csafe03, 16035 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 16036 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 16037 Problems, Part 1: Algorithm Development}, 16038 institution = {University of Utah, Center for the Simulation of Accidental Fires and 16039 Explosions}, 16040 year = {2003} 16041} 16042 16043@InBook{ shepherd07, 16044 author = {M. Shepherd and E. Seol and B. FrantzDale}, 16045 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 16046 year = {2007}, 16047 booktitle = {CRC Handbook of Dynamic System Modeling}, 16048 publisher = {Wiley}, 16049 pages = {1--41}, 16050 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 16051} 16052 16053@InProceedings{ cactus02, 16054 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 16055 Radke and Edward Seidel and John Shalf}, 16056 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 16057 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 16058 year = {2002}, 16059 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 16060} 16061 16062@Misc{ cactus:homepage, 16063 author = {G. {Allen et al.}}, 16064 title = {{Cactus Web page}}, 16065 howpublished = {\url{http://cactuscode.org}} 16066} 16067 16068@Misc{ open-grid-forum:web, 16069 key = {{Open Grid Forum}}, 16070 title = {{Open Grid Forum}}, 16071 note = {See \url{http://www.ogf.org}} 16072} 16073 16074@Misc{ nox:web, 16075 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 16076 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 16077 note = {See \url{http://software.sandia.gov/nox}} 16078} 16079 16080@Misc{ chombo:web, 16081 author = {P. {Colella (PI)}}, 16082 title = {{Chombo}}, 16083 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 16084} 16085 16086@Article{ lanzkron96, 16087 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 16088 title = {An Analysis of Approximate Nonlinear Elimination}, 16089 journal = {SIAM J. Sci. Comput.}, 16090 volume = {17}, 16091 year = {1996}, 16092 pages = {538--559} 16093} 16094 16095@Article{ jiang95, 16096 author = {J. Jiang and P. Forsyth}, 16097 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 16098 Equations}, 16099 journal = {Computers and Fluids}, 16100 volume = {24}, 16101 pages = {753--770}, 16102 year = {1995} 16103} 16104 16105@Article{ young90, 16106 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 16107 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 16108 journal = {Int. J. Numer. Methods Fluids}, 16109 volume = {11}, 16110 pages = {1075--1095}, 16111 year = {1990} 16112} 16113 16114@Article{ fishwick04, 16115 author = {Paul A. Fishwick}, 16116 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 16117 to Interrelating Model Structures}, 16118 journal = {SCS Trans. on Simulation}, 16119 note = {Special Issue in Grand Challenges in Computer Simulation}, 16120 year = {2004} 16121} 16122 16123@Article{ fishwick03, 16124 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 16125 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 16126 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 16127 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 16128 year = {2003} 16129} 16130 16131@InProceedings{ kirner00, 16132 author = {T. G. Kirner and V. F. Martins}, 16133 title = {Development of an Information Visualization Tool Using Virtual Reality}, 16134 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 16135 year = {2000}, 16136 pages = {604--606} 16137} 16138 16139@InProceedings{ orso03, 16140 author = {A. Orso and J. Jones and M. J. Harrold}, 16141 title = {Visualization of Program-Execution Data for Deployed Software}, 16142 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 16143 year = {2003}, 16144 pages = {67--76} 16145} 16146 16147@Book{ tiller01, 16148 author = {M. Tiller}, 16149 title = {Introduction to Physical System Modeling with Modelica}, 16150 series = {Kluwer International Series inEngineering and Computer Science}, 16151 volume = {615}, 16152 publisher = {Kluwer}, 16153 year = {2001} 16154} 16155 16156@Article{ buck94, 16157 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 16158 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 16159 journal = {Int. Journal of Computer Simulation}, 16160 volume = {4}, 16161 pages = {155--182}, 16162 year = {1994} 16163} 16164 16165@Article{ mu95, 16166 author = {M. Mu and J.R. Rice}, 16167 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 16168 journal = {Comp. Syst. Engr.}, 16169 volume = {6}, 16170 year = {1995}, 16171 pages = {87--95} 16172} 16173 16174@TechReport{ drashansky96, 16175 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 16176 author = {R. Drashansky and A. Joshi and J. R. Rice}, 16177 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 16178 year = {1996} 16179} 16180 16181@Article{ michopoulos05, 16182 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 16183 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 16184 journal = {Journal of Computing and Information Science in Engineering}, 16185 volume = {5}, 16186 issue = {3}, 16187 pages = {198--213}, 16188 year = {2005} 16189} 16190 16191@Article{ dubey09, 16192 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 16193 Multiphysics Simulation Code}, 16194 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 16195 Siegel and K. Weide}, 16196 journal = {Parallel Computing}, 16197 volume = {35}, 16198 issue = {10 -- 11}, 16199 pages = {512 -- 522}, 16200 year = {2009} 16201} 16202 16203@Book{ bottloring95, 16204 author = {Raoul Bott and Loring W. Tu}, 16205 title = {Differential Forms in Algebraic Topology}, 16206 publisher = {Springer}, 16207 year = {1995} 16208} 16209 16210@Book{ kobayashinomizu96, 16211 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 16212 title = {Foundations of Differential Geometry}, 16213 publisher = {Wiley-Interscience}, 16214 year = {1996} 16215} 16216 16217@Article{ hornungkohn02, 16218 author = {Richard D. Hornung and Scott R. Kohn}, 16219 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 16220 journal = {Concurrency and Computation: Practice and Experience}, 16221 volume = {14}, 16222 pages = {347--368}, 16223 year = {2002} 16224} 16225 16226@InProceedings{ concepts06, 16227 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 16228 Gabriel Dos Reis and Andrew Lumsdaine}, 16229 title = {Concepts: Linguistic Support for Generic Programming in C++}, 16230 booktitle = {Proceedings of OOPSLA 2006}, 16231 year = {2006}, 16232 pages = {???--???} 16233} 16234 16235@Book{ hatcher02, 16236 author = {Hatcher, Allen}, 16237 title = {Algebraic Topology}, 16238 publisher = {Cambridge University Press}, 16239 year = {2002} 16240} 16241 16242@Book{ gammahelmjohnsonvlissides95, 16243 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 16244 development, offering timeless and elegant solutions to common problems in 16245 software design. It describes patterns for managing object creation, composing 16246 objects into larger structures, and coordinating control flow between objects. The 16247 book provides numerous examples where using composition rather than inheritance 16248 can improve the reusability and flexibility of code. Note, though, that it's not a 16249 tutorial but a catalog that you can use to find an object-oriented design pattern 16250 that's appropriate for the needs of your particular application--a selection for 16251 virtuoso programmers who appreciate (or require) consistent, well-engineered 16252 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 16253 more valuable than ever! 16254 16255 Use the contents of the CD to create your own design documents and reusable 16256 components. The CD contains: 23 patterns you can cut and paste into your own 16257 design documents; sample code demonstrating pattern implementation; complete 16258 Design Patterns content in standard HTML format, with numerous hyperlinked 16259 cross-references; accessed through a standard web browser; Java-based dynamic 16260 search mechanism, enhancing online search capabilities; graphical user environment, 16261 allowing ease of navigation. 16262 16263 First published in 1995, this landmark work on object-oriented software design 16264 presents a catalog of simple and succinct solutions to common design problems. 16265 Created by four experienced designers, the 23 patterns contained herein have 16266 become an essential resource for anyone developing reusable object-oriented 16267 software. In response to reader demand, the complete text and pattern catalog are 16268 now available on CD-ROM. This electronic version of Design Patterns enables 16269 programmers to install the book directly onto a computer or network for use as an 16270 online reference for creating reusable object-oriented software. 16271 16272 The authors first describe what patterns are and how they can help you in the 16273 design process. They then systematically name, explain, evaluate, and catalog 16274 recurring designs in object-oriented systems. All patterns are compiled from 16275 real-world examples and include code that demonstrates how they may be implemented 16276 in object-oriented programming languages such as C++ and Smalltalk. Readers who 16277 already own the book will want the CD to take advantage of its dynamic search 16278 mechanism and ready-to-install patterns.}}, 16279 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 16280 citeulike-article-id={115158}, 16281 howpublished = {Hardcover}, 16282 isbn = {0201633612}, 16283 keywords = {1995 algorithms architecture book books computer computing design design-pattern 16284 design-patterns design_patterns designpatterns development diplom entwurfsmuster 16285 four gang gof java mathgamespatterns no-tag object object-orientation 16286 object-oriented of oo-patterns oop oriented pattern patterns programming se 16287 software software-development software-engineering software_design 16288 softwareengineering standard}, 16289 month = jan, 16290 publisher = {{Addison-Wesley Professional}}, 16291 title = {Design Patterns}, 16292 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 16293 year = {1995} 16294} 16295 16296@InProceedings{ chaco95, 16297 author = {Bruce Hendrickson and Robert Leland}, 16298 title = {A multilevel algorithm for partitioning graphs}, 16299 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 16300 (CDROM)}, 16301 year = {1995}, 16302 isbn = {0-89791-816-9}, 16303 pages = {28}, 16304 location = {San Diego, California, United States}, 16305 doi = {10.1145/224170.224228}, 16306 publisher = {ACM Press}, 16307 address = {New York} 16308} 16309 16310@Book{ aleksandrov98, 16311 author = {Aleksandrov, Pavel S.}, 16312 title = {Combinatorial Topology}, 16313 publisher = {Dover}, 16314 volume = {3}, 16315 year = {1998} 16316} 16317 16318@Book{ steenrod99, 16319 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 16320 importance in modern physics--such as in gauge theory. This book, a succinct 16321 introduction to the subject by renown mathematician Norman Steenrod, was the first 16322 to present the subject systematically. 16323 16324 It begins with a general introduction to bundles, including such topics as 16325 differentiable manifolds and covering spaces. The author then provides brief 16326 surveys of advanced topics, such as homotopy theory and cohomology theory, before 16327 using them to study further properties of fibre bundles. The result is a classic 16328 and timeless work of great utility that will appeal to serious mathematicians and 16329 theoretical physicists alike. }}, 16330 author = {Steenrod, Norman}, 16331 citeulike-article-id={712999}, 16332 howpublished = {Paperback}, 16333 isbn = {0691005486}, 16334 keywords = {fibre_bundles topology}, 16335 month = apr, 16336 publisher = {{Princeton University Press}}, 16337 title = {The Topology of Fibre Bundles. (PMS-14)}, 16338 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 16339 year = {1999} 16340} 16341 16342@Book{ bredon97, 16343 author = {Bredon, Glen E.}, 16344 title = {Sheaf Theory}, 16345 publisher = {Springer}, 16346 pages = {524}, 16347 series = {Graduate Texts in Mathematics}, 16348 year = {1997} 16349} 16350 16351@TechReport{ tautgesmeyers04, 16352 title = {{MOAB}: A Mesh-Oriented Database}, 16353 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 16354 Ernst}, 16355 institution = {Sandia National Laboratories}, 16356 number = {SAND2004-1592}, 16357 month = apr, 16358 year = {2004} 16359} 16360 16361@Article{ tautges04, 16362 author = {Timothy J. Tautges}, 16363 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 16364 journal = {Engineering With Computers}, 16365 volume = {20}, 16366 pages = {286--293}, 16367 year = {2004} 16368} 16369 16370@InProceedings{ meyers02, 16371 author = {Ray Meyers et. al}, 16372 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 16373 booktitle = {8th International conference on numerical grid generation in computational field 16374 simulations}, 16375 month = jun, 16376 year = {2002} 16377} 16378 16379@InProceedings{ seolshepard05, 16380 author = {E. S. Seol and Mark S. Shephard}, 16381 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 16382 Analysis}, 16383 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 16384 year = {2005} 16385} 16386 16387@Article{ lishephardbeall2005, 16388 title = {3D anisotropic mesh adaptation by mesh modification}, 16389 author = {Xiangrong Li and Mark S Shephard and Mark W Beall}, 16390 journal = {Computer methods in applied mechanics and engineering}, 16391 volume = {194}, 16392 number = {48-49}, 16393 pages = {4915--4950}, 16394 year = {2005}, 16395} 16396 16397@Article{ lushephardtendulkarbeall2014, 16398 title = {Parallel mesh adaptation for high-order finite element methods with curved element geometry}, 16399 author = {Qiukai Lu and Mark S Shephard and Saurabh Tendulkar and Mark W Beall}, 16400 journal = {Engineering with Computers}, 16401 volume = {30}, 16402 pages = {271--286}, 16403 year = {2014}, 16404} 16405 16406@Article{ beallwalshshephard04, 16407 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 16408 title = {A comparison of techniques for geometry access related to mesh generation}, 16409 journal = {Engineering With Computers}, 16410 volume = {20}, 16411 number = {3}, 16412 pages = {210--221}, 16413 year = {2004} 16414} 16415 16416@Article{ careyandersoncarneskirk04, 16417 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 16418 Kirk}, 16419 title = {Some aspects of adaptive grid technology related to boundary and interior 16420 layers}, 16421 journal = {Journal of Computational Applied Mathematics}, 16422 volume = {166}, 16423 number = {1}, 16424 pages = {55--86}, 16425 year = {2004} 16426} 16427 16428@PhDThesis{ gralthesis, 16429 author = {Guntram Berti}, 16430 title = {Generic Software Components for Scientific Computing}, 16431 school = {TU Cottbus}, 16432 year = {2000}, 16433 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 16434} 16435 16436@Article{ whitehead1949, 16437 title = {Combinatorial homotopy. I}, 16438 author = {John HC Whitehead}, 16439 journal = {Bulletin of the American Mathematical Society}, 16440 volume = {55}, 16441 number = {3. P1}, 16442 pages = {213--245}, 16443 year = {1949}, 16444 publisher = {American Mathematical Society} 16445} 16446 16447@Article{ beylkincoifmanrokhlin91, 16448 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 16449 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 16450 journal = {Communications on Pure and Applied Mathematics}, 16451 volume = {44}, 16452 pages = {141--183}, 16453 year = {1991} 16454} 16455 16456@Book{ wesseling92, 16457 author = {Pieter Wesseling}, 16458 title = {An Introduction to Multigrid Methods}, 16459 publisher = {John Wiley and Sons}, 16460 year = {1992} 16461} 16462 16463@Book{ grakakos04, 16464 author = {Loukas Grakakos}, 16465 title = {Classical and Modern Fourier Analysis}, 16466 publisher = {Pearson Education}, 16467 address = {New Jersey}, 16468 year = {2004} 16469} 16470 16471@Misc{ hlib-web-page, 16472 key = {HLib}, 16473 title = {{HLib} {Web} page}, 16474 note = {{\texttt{http://www.hlib.org/}}}, 16475 annote = {Hierarchical matrices for fast integral transform} 16476} 16477 16478@Article{ hackbusch99, 16479 author = {Wolfgang Hackbusch}, 16480 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 16481 Introduction to {$\mathcal H$}-matrices}, 16482 journal = {Computing}, 16483 volume = {62}, 16484 pages = {89--108}, 16485 year = {1999} 16486} 16487 16488@TechReport{ kay1999green, 16489 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 16490 equations}, 16491 author = {Kay, D. and Loghin, D.}, 16492 year = {1999}, 16493 institution = {Oxford University Computing Laboratory}, 16494 number = {99/06} 16495} 16496 16497@Article{ bebendorf2003existence, 16498 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 16499 elliptic operators with {$L^\infty$}-coefficients}, 16500 author = {Bebendorf, M. and Hackbusch, W.}, 16501 journal = {Numerische Mathematik}, 16502 volume = {95}, 16503 number = {1}, 16504 pages = {1--28}, 16505 year = {2003}, 16506 publisher = {Springer} 16507} 16508 16509@Article{ hackbusch2005direct, 16510 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 16511 H$}-matrix approximation}, 16512 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 16513 journal = {Computing and Visualization in Science}, 16514 volume = {8}, 16515 number = {3}, 16516 pages = {179--188}, 16517 year = {2005}, 16518 publisher = {Springer} 16519} 16520 16521@TechReport{ duphof2003, 16522 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 16523 Logg and L. R. Scott}, 16524 title = {The {FE}ni{CS} project}, 16525 institution = {Chalmers Finite Element Center Preprint Series}, 16526 number = {2003--21}, 16527 year = {2003} 16528} 16529 16530@Article{ flame01, 16531 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 16532 Geijn}, 16533 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 16534 journal = {Transactions on Mathematical Software}, 16535 volume = {27}, 16536 number = {4}, 16537 year = {2001}, 16538 pages = {422--455} 16539} 16540 16541@Article{ puschel05, 16542 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 16543 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 16544 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 16545 Nick Rizzolo}, 16546 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 16547 journal = {Proceedings of the IEEE}, 16548 volume = {93}, 16549 number = {2}, 16550 year = {2005}, 16551 note = {special issue on "Program Generation, Optimization, and Adaptation"} 16552} 16553 16554@Article{ kirbylogg06, 16555 author = {Robert C. Kirby and Anders Logg}, 16556 title = {A compiler for variational forms}, 16557 journal = {ACM Transactions on Mathematical Software}, 16558 volume = {32}, 16559 number = {3}, 16560 year = {2006}, 16561 issn = {0098-3500}, 16562 pages = {417--444}, 16563 doi = {10.1145/1163641.1163644}, 16564 publisher = {ACM Press}, 16565 address = {New York, NY} 16566} 16567 16568@Article{ kirbylogg07, 16569 author = {Robert C. Kirby and Anders Logg}, 16570 title = {Efficient compilation of a class of variational forms}, 16571 journal = {ACM Transactions on Mathematical Software}, 16572 volume = {33}, 16573 number = {3}, 16574 year = {2007}, 16575 issn = {0098-3500}, 16576 pages = {17}, 16577 doi = {10.1145/1268769.1268771}, 16578 publisher = {ACM Press}, 16579 address = {New York, NY} 16580} 16581 16582@Article{ bankdupont81, 16583 author = {Randolph Bank and Todd Dupont}, 16584 title = {An optimal order process for solving finite element equations}, 16585 journal = {Mathematics of Computation}, 16586 volume = {36}, 16587 pages = {35--51}, 16588 year = {1981} 16589} 16590 16591@TechReport{ adams00, 16592 author = {Mark F. Adams}, 16593 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 16594 in solid mechanics}, 16595 institution = {UC Berkeley}, 16596 number = {CSD-00-1103}, 16597 year = {2000}, 16598 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 16599} 16600 16601@Article{ bergengradlhuelsemannruede06, 16602 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 16603 title = {A Massively Parallel Multigrid Method for Finite Elements}, 16604 journal = {Computing in Science \& Engineering}, 16605 volume = {8}, 16606 number = {6}, 16607 pages = {56--62}, 16608 year = {2006} 16609} 16610 16611@MastersThesis{ brunethesis08, 16612 author = {Peter R. Brune}, 16613 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 16614 school = {University of Chicago}, 16615 address = {Chicago, IL}, 16616 year = {2008}, 16617 month = feb 16618} 16619 16620@Article{ arnoldwinther02, 16621 author = {Douglas N. Arnold and Ragnar Winther}, 16622 title = {Mixed finite elements for elasticity}, 16623 journal = {Numerische Mathematik}, 16624 volume = {92}, 16625 number = {3}, 16626 month = sep, 16627 year = {2002}, 16628 pages = {401--419}, 16629 doi = {10.1007/s002110100348} 16630} 16631 16632@Article{ arnoldfalkwinther06, 16633 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 16634 title = {Finite element exterior calculus, homological techniques, and applications}, 16635 journal = {Acta Numerica}, 16636 year = {2006}, 16637 volume = {15}, 16638 pages = {1--155}, 16639 publisher = {Cambridge University Press}, 16640 doi = {10.1017/S0962492906210018} 16641} 16642 16643@Article{ kirby04, 16644 author = {Robert C. Kirby}, 16645 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 16646 functions}, 16647 journal = {ACM Transactions on Mathematical Software}, 16648 volume = {30}, 16649 number = {4}, 16650 year = {2004}, 16651 issn = {0098-3500}, 16652 pages = {502--516}, 16653 doi = {10.1145/1039813.1039820}, 16654 publisher = {ACM Press}, 16655 address = {New York, NY} 16656} 16657 16658@Article{ kirby06, 16659 author = {Robert C. Kirby}, 16660 title = {Optimizing {FIAT} with level 3 {BLAS}}, 16661 journal = {ACM Transactions on Mathematical Software}, 16662 volume = {32}, 16663 number = {2}, 16664 year = {2006}, 16665 issn = {0098-3500}, 16666 pages = {223--235}, 16667 doi = {10.1145/1141885.1141889}, 16668 publisher = {ACM Press}, 16669 address = {New York, NY} 16670} 16671 16672@Misc{ bluecrystal08, 16673 author = {{B}lue {C}rystal Cluster}, 16674 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 16675 year = {2008}, 16676 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 16677} 16678 16679@Article{ beylkin95, 16680 author = {Gregory Beylkin}, 16681 title = {On the Fast Fourier Transform of Functions With Singularities}, 16682 journal = {Applied and Computational Harmonic Analysis}, 16683 volume = {2}, 16684 pages = {363--381}, 16685 year = {1995} 16686} 16687 16688@InProceedings{ riehl08, 16689 author = {Jonathan Riehl}, 16690 title = {Implementing the MyFEM Embedded Domain-specific Language}, 16691 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 16692 Development (DSPD'08)}, 16693 address = {Nashville, TN}, 16694 year = {2008} 16695} 16696 16697@Article{ appel85, 16698 author = {Andrew W. Appel}, 16699 date-added = {2008-02-27 12:23:39 +0000}, 16700 date-modified = {2008-02-27 12:24:02 +0000}, 16701 doi = {10.1137/0906008}, 16702 journal = {SIAM Journal on Scientific and Statistical Computing}, 16703 keywords = {treecodes}, 16704 number = {1}, 16705 pages = {85-103}, 16706 publisher = {SIAM}, 16707 title = {An Efficient Program for Many-Body Simulation}, 16708 volume = {6}, 16709 year = {1985} 16710} 16711 16712@Article{ ewald21, 16713 author = {{Ewald}, P.~P.}, 16714 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 16715 journal = {Annalen der Physik}, 16716 year = {1921}, 16717 volume = {369}, 16718 pages = {253-287}, 16719 doi = {10.1002/andp.19213690304}, 16720 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 16721 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16722} 16723 16724@Article{ greengardrokhlin87, 16725 author = {L. Greengard and V. Rokhlin}, 16726 date-added = {2008-02-15 18:43:55 +0000}, 16727 date-modified = {2008-02-26 20:09:11 +0000}, 16728 doi = {10.1016/0021-9991(87)90140-9}, 16729 journal = {J. Comput.\ Phys.}, 16730 keywords = {FMM}, 16731 number = {2}, 16732 pages = {325--348}, 16733 title = {A Fast Algorithm for Particle Simulations}, 16734 url = {citeseer.ist.psu.edu/greengard87fast.html}, 16735 volume = {73}, 16736 year = {1987}, 16737 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 16738} 16739 16740@Article{ greengardrokhlin97, 16741 author = {L. Greengard and V. Rokhlin}, 16742 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 16743 Dimensions}, 16744 journal = {Acta Numerica}, 16745 volume = {6}, 16746 year = {1997}, 16747 pages = {229--269} 16748} 16749 16750@Article{ luchenghuangmccammon06, 16751 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 16752 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 16753 systems}, 16754 journal = {PNAS}, 16755 doi = {10.1073/pnas.0605166103}, 16756 volume = {102}, 16757 number = {51}, 16758 year = {2006}, 16759 pages = {19314--19319} 16760} 16761 16762@Article{ schussnadlereisenberg01, 16763 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 16764 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 16765 from a molecular model}, 16766 journal = {Physical Review E}, 16767 volume = {64}, 16768 number = {3}, 16769 year = {2001} 16770} 16771 16772@Book{ hairerlubichwanner02, 16773 author = {E. Hairer and Ch. Lubich and G. Wanner}, 16774 title = {Geometric Numerical Integration}, 16775 publisher = {Springer-Verlag}, 16776 address = {Berlin Heidelberg}, 16777 year = {2002} 16778} 16779 16780@Article{ holstbakerwang00, 16781 author = {M. Holst and N. Baker and F. Wang}, 16782 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 16783 equation on massively parallel computers}, 16784 journal = {Journal of Computational Chemistry}, 16785 volume = {21}, 16786 year = {2000} 16787} 16788 16789@Book{ hockneyeastwood81, 16790 author = {R. Hockney and J. Eastwood}, 16791 title = {Computer simulation using particles}, 16792 publisher = {McGraw-Hill}, 16793 address = {New York}, 16794 year = {1981} 16795} 16796 16797@Article{ lutydavistironigunsteren94, 16798 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 16799 Gunsteren}, 16800 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 16801 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 16802 journal = {Molecular Simulation}, 16803 volume = {14}, 16804 number = {1}, 16805 year = {1994}, 16806 pages = {11--20} 16807} 16808 16809@Book{ briggshensonmccormick00, 16810 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 16811 title = {A Multigrid Tutorial (2nd ed.)}, 16812 year = {2000}, 16813 isbn = {0-89871-462-1}, 16814 publisher = {Society for Industrial and Applied Mathematics}, 16815 address = {Philadelphia, PA} 16816} 16817 16818@Article{ chartier2003spectral, 16819 title = {Spectral AMGe ($\rho$ AMGe)}, 16820 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 16821 McCormick, S and Ruge, J and Vassilevski, PS}, 16822 journal = {SIAM Journal on Scientific Computing}, 16823 volume = {25}, 16824 number = {1}, 16825 pages = {1--26}, 16826 year = {2003}, 16827 publisher = {SIAM} 16828} 16829 16830@Article{ galvis2010domain, 16831 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 16832 media}, 16833 author = {Galvis, Juan and Efendiev, Yalchin}, 16834 journal = {Multiscale Modeling \& Simulation}, 16835 volume = {8}, 16836 number = {4}, 16837 pages = {1461--1483}, 16838 year = {2010}, 16839 publisher = {SIAM} 16840} 16841 16842@Book{ brennerscott02, 16843 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 16844 title = {The mathematical theory of finite element methods}, 16845 year = {2002}, 16846 isbn = {0-38795-451-1}, 16847 publisher = {Springer}, 16848 pages = {361} 16849} 16850 16851@Book{ trefethenbau97, 16852 author = {Lloyd N. Trefethen and David {Bau, III}}, 16853 title = {Numerical Linear Algebra}, 16854 publisher = {Society for Industrial and Applied Mathematics}, 16855 address = {Philadelphia, PA}, 16856 pages = {xii + 361}, 16857 year = {1997}, 16858 isbn = {0-89871-361-7}, 16859 isbn-13 = {978-0-89871-361-9}, 16860 lccn = {QA184 .T74 1997}, 16861 mrclass = {65-01 (65-02 65Fxx)}, 16862 mrnumber = {MR1444820 (98k:65002)}, 16863 mrreviewer = {Moody T. Chu}, 16864 bibdate = {Wed Jan 07 15:23:19 1998}, 16865 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 16866} 16867 16868@Article{ liptonreagan2014, 16869 title = {Quantum Algorithms via Linear Algebra: A Primer}, 16870 author = {Richard J Lipton and Kenneth W Regan}, 16871 pages = {206}, 16872 isbn = {978-0-26202-839-4}, 16873 year = {2014} 16874} 16875 16876@InProceedings{ rhea08, 16877 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 16878 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 16879 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16880 booktitle = {Proceedings of IEEE/ACM SC '08}, 16881 year = {2008} 16882} 16883 16884@Misc{ bursteddewilcox09, 16885 author = {Carsten Burstedde and Lucas~C. Wilcox}, 16886 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 16887 note = {in preparation} 16888} 16889 16890@Article{ skeeltezcanhardy02, 16891 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 16892 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 16893 journal = {J. Comp. Chem.}, 16894 volume = {23}, 16895 pages = {673--684}, 16896 year = {2002} 16897} 16898 16899@Article{ verschelde99, 16900 author = {Jan Verschelde}, 16901 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 16902 homotopy continuation}, 16903 journal = {ACM Trans. Math. Softw.}, 16904 volume = {25}, 16905 number = {2}, 16906 issn = {0098-3500}, 16907 pages = {251--276}, 16908 doi = {10.1145/317275.317286}, 16909 publisher = {ACM}, 16910 address = {New York, NY}, 16911 year = {1999} 16912} 16913 16914@InProceedings{ sommeseverscheldewampler08, 16915 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 16916 title = {Solving Polynomial Systems Equation by Equation}, 16917 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 16918 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 16919 pages = {133--152}, 16920 publisher = {Springer-Verlag}, 16921 year = {2008} 16922} 16923 16924@Article{ phanthientanner77, 16925 author = {N. Phan-Thien and R.~I. Tanner}, 16926 title = {A new constitutive equation derived from network theory}, 16927 journal = {J. Non-Newt. Fluid Mech.}, 16928 volume = {2}, 16929 pages = {353}, 16930 year = {1977} 16931} 16932 16933@Manual{ sage, 16934 key = {SAGE}, 16935 author = {W.\thinspace{}A. Stein and others}, 16936 organization = {The Sage~Development Team}, 16937 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 16938 note = {{\tt http://www.sagemath.org}}, 16939 year = {2009} 16940} 16941 16942@Misc{ bateshauensteinsommesewampler06, 16943 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 16944 Wampler}, 16945 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 16946 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 16947} 16948 16949@Article{ archer09, 16950 author = {A. J. Archer}, 16951 collaboration = {}, 16952 title = {Dynamical density functional theory for molecular and colloidal fluids: A 16953 microscopic approach to fluid mechanics}, 16954 publisher = {AIP}, 16955 year = {2009}, 16956 journal = {The Journal of Chemical Physics}, 16957 volume = {130}, 16958 number = {1}, 16959 eid = {014509}, 16960 numpages = {8}, 16961 pages = {014509}, 16962 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 16963 transition; statistical distributions; stochastic processes}, 16964 doi = {10.1063/1.3054633} 16965} 16966 16967@Article{ giesekus1966, 16968 author = {Hanswalter Giesekus}, 16969 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 16970 journal = {Rheologica Acta}, 16971 publisher = {Springer Berlin / Heidelberg}, 16972 volume = {5}, 16973 number = {1}, 16974 month = mar, 16975 year = {1966}, 16976 doi = {10.1007/BF01973575}, 16977 pages = {29-35} 16978} 16979 16980@Article{ baaijens98, 16981 author = {F.P. Baaijens}, 16982 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 16983 journal = {Journal of Non-Newtonian Fluid Mechanics}, 16984 volume = {79}, 16985 year = {1998}, 16986 pages = {361--385} 16987} 16988 16989@Book{ joseph90, 16990 author = {D.~D. Joseph}, 16991 title = {Fluid Dynamics of Viscoelastic Liquids}, 16992 publisher = {Springer}, 16993 address = {New York, NY}, 16994 year = {1990} 16995} 16996 16997@Article{ oldroyd50, 16998 author = {J.~G. Oldroyd}, 16999 title = {On the Formulation of Rheological Equations of State}, 17000 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 17001 Sciences}, 17002 volume = {200}, 17003 year = {1950}, 17004 pages = {523--541} 17005} 17006 17007@InProceedings{ bynasungroppthakur04, 17008 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 17009 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 17010 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 17011 year = {2004} 17012} 17013 17014@Book{ pozrikidis07, 17015 author = {C. Pozrikidis}, 17016 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 17017 publisher = {Kluwer (Springer)}, 17018 pages = {675}, 17019 year = {2001}, 17020 isbn = {0792373510} 17021} 17022 17023@Misc{ kritzkeyesfsp07, 17024 author = {A. Kritz and D. Keyes}, 17025 title = {{Fusion Simulation Project Workshop Report}}, 17026 month = jul, 17027 year = {2007}, 17028 note = {Available via 17029 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 17030} 17031 17032@Misc{ dahlburg02, 17033 author = {J. {Dahlburg (Chair)}}, 17034 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 17035 year = {2002}, 17036 note = {Available via 17037 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 17038} 17039 17040@Misc{ brown08, 17041 author = {D. {Brown (Chair)}}, 17042 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 17043 to the Future}}, 17044 year = {2008}, 17045 howpublished = {Office of Science, U.S. Department of Energy}, 17046 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 17047} 17048 17049@Misc{ crosscutting10, 17050 author = {D. Brown and P. {Messina (Chairs)}}, 17051 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 17052 Exascale}}, 17053 year = {2010}, 17054 howpublished = {Office of Science, U.S. Department of Energy}, 17055 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 17056} 17057 17058@Misc{ extreme-scale-solvers-workshop12, 17059 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 17060 L.C. McInnes and E. Ng and S. Wild}, 17061 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 17062 Architectures}, 17063 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 17064 note = {{Washington, DC}, March 8-9, 2012}, 17065 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 17066 year = {2012} 17067} 17068 17069@Misc{ monizrosner09, 17070 author = {{E. Moniz and R. Rosner}}, 17071 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 17072 and Simulation at the Extreme Scale}}, 17073 month = may, 17074 year = {2009}, 17075 note = {See 17076 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 17077} 17078 17079@Misc{ blanford08, 17080 author = {{R. Blandord (Chair)}}, 17081 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 17082 Computing at the Extreme Scale}}, 17083 month = dec, 17084 year = {2008}, 17085 note = {See 17086 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 17087} 17088 17089@Misc{ exascale07, 17090 author = {H. Simon and T. Zacharia and R. Stevens}, 17091 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 17092 year = {2007}, 17093 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 17094} 17095 17096@Misc{ ascrbreakthroughs08, 17097 author = {{Panel on Recent Significant Advancements in Computational Science}}, 17098 title = {Breakthroughs}, 17099 year = {2008}, 17100 note = {See 17101 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 17102} 17103 17104@Misc{ petsc-rd100-2009, 17105 author = {{R\&D Magazine}}, 17106 title = {{PETSc} {R}\&{D} 100 Award}, 17107 year = {2009}, 17108 note = {See 17109 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 17110} 17111 17112@Article{ compass-scidac08, 17113 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 17114 R. Ryne}, 17115 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 17116 Computational Science for Future Accelerators and Accelerator Technologies}, 17117 journal = {J. Phys.: Conf. Ser.}, 17118 volume = {125}, 17119 year = {2008}, 17120 pages = {012001}, 17121 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 17122} 17123 17124@Article{ compass-amundson-scidac08, 17125 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 17126 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 17127 Stoltz}, 17128 journal = {J. Phys.: Conf. Ser.}, 17129 volume = {125}, 17130 year = {2008} 17131} 17132 17133@InProceedings{ muszala09, 17134 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 17135 Simulations}, 17136 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 17137 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 17138 {(CBHPC 2009)}}, 17139 year = {2009} 17140} 17141 17142@Article{ gaston09, 17143 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 17144 Equations}, 17145 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 17146 journal = {Nuclear Engineering and Design}, 17147 volume = {239}, 17148 number = {10}, 17149 year = {2009}, 17150 pages = {1768 -- 1778} 17151} 17152 17153@Article{ gaston09b, 17154 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 17155 Engineering}, 17156 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 17157 and C. Permann and W. Taitano}, 17158 journal = {J. Phys.: Conf. Ser.}, 17159 volume = {180}, 17160 year = {2009}, 17161 pages = {012012} 17162} 17163 17164@Article{ newman09, 17165 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 17166 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 17167 author = {Chris Newman and Glen Hansen and Derek Gaston}, 17168 journal = {Journal of Nuclear Materials}, 17169 volume = {392}, 17170 issue = {1}, 17171 year = {2009}, 17172 pages = {6 -- 15} 17173} 17174 17175@Misc{ www:fenics, 17176 author = {{FE}ni{CS}}, 17177 title = {{FE}ni{CS} Project}, 17178 howpublished = {\url{http://www.fenics.org/}}, 17179 year = {2018} 17180} 17181 17182@InProceedings{ zwart08, 17183 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 17184 Systems}, 17185 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 17186 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 17187 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 17188 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 17189 booktitle = {Proceedings of ICCS 2008}, 17190 year = {2008} 17191} 17192 17193@Article{ klocknerwarburtonbridgehesthaven09, 17194 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 17195 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 17196 journal = {J. Comput. Phys.}, 17197 volume = {228}, 17198 number = {21}, 17199 year = {2009}, 17200 issn = {0021-9991}, 17201 pages = {7863--7882}, 17202 doi = {10.1016/j.jcp.2009.06.041}, 17203 publisher = {Academic Press Professional}, 17204 address = {San Diego, CA} 17205} 17206 17207@PhDThesis{ rankin99, 17208 author = {Rankin, W. T.}, 17209 keywords = {FMM, parallel FMM}, 17210 school = {Department of Electrical and Computer Engineering, Duke University}, 17211 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 17212 year = {1999} 17213} 17214 17215@InProceedings{ warrensalmon93, 17216 abstract = {We report on an efficient adaptive N-body method which we have recently designed 17217 and implemented. The algorithm computes the forces on an arbitrary distribution of 17218 bodies in a time which scales as N log N with the particle number. The accuracy of 17219 the force calculations is analytically bounded, and can be adjusted via a user 17220 defined parameter between a few percent relative accuracy, down to machine 17221 arithmetic accuracy. Instead of using pointers to indicate the topology of the 17222 tree, we identify...}, 17223 address = {New York}, 17224 author = {Warren, Michael S. and Salmon, John K.}, 17225 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 17226 citeulike-article-id={580952}, 17227 keywords = {oct-tree}, 17228 pages = {12--21}, 17229 publisher = {ACM}, 17230 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 17231 year = {1993}, 17232 doi = {10.1145/169627.169640}, 17233 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 17234} 17235 17236@Unpublished{ cruzwccm10, 17237 author = {Felipe A. Cruz}, 17238 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 17239 note = {Presentation at WCCM 2010, Sydney Australia}, 17240 year = {2010} 17241} 17242 17243@Article{ mcguffee06, 17244 author = {S.~R. {McGuffee} and A.~H. Elcock}, 17245 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 17246 of salt, {pH}, point mutations, and protein concentration in simulations of 17247 1000-molecule systems}, 17248 journal = {Journal of the American Chemical Society}, 17249 volume = {128}, 17250 pages = {12098--12110}, 17251 year = {2006} 17252} 17253 17254@Article{ nilsencaihoylandlangtangen10, 17255 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 17256 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 17257 in Python}}, 17258 journal = {ArXiv e-prints}, 17259 archiveprefix = {arXiv}, 17260 eprint = {1002.0705}, 17261 primaryclass = {cs.DC}, 17262 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 17263 - Programming Languages}, 17264 year = {2010}, 17265 month = feb, 17266 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 17267 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 17268} 17269 17270@Misc{ mcinnes:siam09:minisymposium, 17271 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 17272 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 17273 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 17274 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 17275 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 17276 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 17277 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 17278 Austin).} 17279} 17280 17281@Misc{ mcinnes:fsp-summary:feb2011, 17282 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 17283 title = {Solvers and Time Integration Breakout Summary}, 17284 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 17285 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 17286} 17287 17288@Misc{ dvi-materials:siamcse11, 17289 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 17290 Materials}, 17291 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 17292 Smith and L. Wang}, 17293 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 17294 and Engineering, March 3, 2011} 17295} 17296 17297@Misc{ jamroz:cemm10, 17298 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 17299 author = {B. Jamroz and S. Kruger and T. Austin}, 17300 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 17301} 17302 17303@Misc{ kruger:feb4-2011, 17304 title = {personal communication}, 17305 author = {S. Kruger}, 17306 note = {February, 2011} 17307} 17308 17309@Article{ elman1996, 17310 author = {H.C. Elman}, 17311 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 17312 viscosity}, 17313 journal = {SIAM J. Sci. Comput.}, 17314 volume = {20}, 17315 year = {1996}, 17316 pages = {1299--1316} 17317} 17318 17319@Article{ kayloghinwathen2002, 17320 author = {D. Kay and D. Loghin and A. Wathen}, 17321 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 17322 journal = {SIAM J. Sci. Comput.}, 17323 volume = {24}, 17324 year = {2002}, 17325 pages = {237--256} 17326} 17327 17328@Article{ elmanhowleshadidshuttleworthtuminaro2006, 17329 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 17330 title = {Block preconditioners based on approximate commutators}, 17331 journal = {SIAM J. Sci. Comput.}, 17332 volume = {27}, 17333 number = {5}, 17334 year = {2006}, 17335 pages = {1651--1668} 17336} 17337 17338@Article{ braesssarazin1997, 17339 author = {Dietrich Braess and Regina Sarazin}, 17340 title = {An efficient smoother for the {Stokes} problem}, 17341 journal = {Applied Numerical Mathematics}, 17342 volume = {23}, 17343 number = {1}, 17344 year = {1997}, 17345 pages = {3--19}, 17346 doi = {10.1016/S0168-9274(96)00059-1} 17347} 17348 17349@Article{ wright2001large, 17350 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 17351 author = {Wright, T.G. and Trefethen, L.N.}, 17352 journal = {SIAM Journal on Scientific Computing}, 17353 volume = {23}, 17354 pages = {591}, 17355 year = {2001} 17356} 17357 17358@Misc{ wright2002eigtool, 17359 title = {Eig{T}ool}, 17360 author = {Wright, T.G. and Trefethen, LN}, 17361 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 17362 year = {2002} 17363} 17364 17365@Misc{ visit-web-site, 17366 key = {{VisIt}}, 17367 title = {{VisIt web site}}, 17368 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 17369 url = {http://wci.llnl.gov/codes/visit/}, 17370 year = {2011} 17371} 17372 17373@Book{ trefethen1996, 17374 title = {Finite difference and spectral methods for ordinary and partial differential 17375 equations}, 17376 author = {Lloyd Nicholas Trefethen}, 17377 year = {1996}, 17378 publisher = {Cornell University-Department of Computer Science and Center for Applied 17379 Mathematics} 17380} 17381 17382@Book{ trefethen2005spectra, 17383 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 17384 author = {Trefethen, L.N. and Embree, M.}, 17385 year = {2005}, 17386 publisher = {Princeton University Press} 17387} 17388 17389@Article{ gomez2010isogeometric, 17390 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 17391 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 17392 journal = {Computer Methods in Applied Mechanics and Engineering}, 17393 volume = {199}, 17394 number = {25-28}, 17395 pages = {1828--1840}, 17396 issn = {0045-7825}, 17397 year = {2010}, 17398 publisher = {Elsevier} 17399} 17400 17401@Article{ gomez2008isogeometric, 17402 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 17403 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 17404 journal = {Computer Methods in Applied Mechanics and Engineering}, 17405 volume = {197}, 17406 number = {49-50}, 17407 pages = {4333--4352}, 17408 year = {2008}, 17409 publisher = {Elsevier} 17410} 17411 17412@Misc{ fastmath:project, 17413 author = {Lori {Diachin (PI)}}, 17414 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 17415 (FASTMath) Institute}}, 17416 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 17417} 17418 17419@Misc{ exascale-software:proposal, 17420 author = {Peter {Beckman (PI)}}, 17421 title = {{Exascale Software Center}}, 17422 note = {proposal to DOE} 17423} 17424 17425@Misc{ imex:project, 17426 author = {Barry {Smith (PI)}}, 17427 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 17428 Multimodel PDEs}}, 17429 note = {DOE ASCR applied math project} 17430} 17431 17432@Misc{ intel-mic:website, 17433 author = {Intel}, 17434 title = {{Many Integrated Core Architecture}}, 17435 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 17436} 17437 17438@Article{ dudson:2009, 17439 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 17440 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 17441 journal = {Computer Physics Communications}, 17442 volume = {180}, 17443 pages = {1467}, 17444 year = {2009} 17445} 17446 17447@Article{ umansky:2009, 17448 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 17449 title = {{Status and verification of edge plasma turbulence code BOUT}}, 17450 journal = {Computer Physics Communications}, 17451 year = {2009}, 17452 volume = {180}, 17453 pages = {887-903} 17454} 17455 17456@Article{ xu:1998, 17457 author = {X.Q. Xu and R.H. Cohen}, 17458 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 17459 journal = {Computer Physics Communications}, 17460 year = {1998}, 17461 volume = {36}, 17462 number = {1-2}, 17463 pages = {158} 17464} 17465 17466@Article{ tron:1999, 17467 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 17468 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 17469 journal = {SIAM Journal on Optimization}, 17470 volume = {9}, 17471 number = {4}, 17472 pages = {1100-1127}, 17473 year = {1999} 17474} 17475 17476@Article{ stubenamg, 17477 author = {K. St\"{u}ben}, 17478 title = {A review of algebraic multigrid}, 17479 journal = {J. Comput. Appl. Math.}, 17480 volume = {128}, 17481 number = {1-2}, 17482 year = {2001}, 17483 issn = {0377-0427}, 17484 pages = {281--309}, 17485 doi = {10.1016/S0377-0427(00)00516-1}, 17486 publisher = {Elsevier Science Publishers B. V.}, 17487 address = {Amsterdam, The Netherlands, The Netherlands} 17488} 17489 17490@Article{ feuchtermg, 17491 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 17492 title = {Bridging the gap between geometric and algebraic multigrid methods}, 17493 journal = {Computing and visualization in science}, 17494 publisher = {Springer}, 17495 volume = {6}, 17496 number = {1}, 17497 year = {2003}, 17498 pages = {1--13} 17499} 17500 17501@Article{ chowmgsmoothness, 17502 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 17503 only attempts to interpolate in the directions of geometrical smoothness. These 17504 directions are determined by analyzing samples of algebraically smooth error, e. 17505 Neighboring grid points i and j are called smoothly coupled if e i and e j are 17506 consistently nearby in value. In addition, these dierences may be used to dene 17507 interpolation weights. These new ideas may be incorporated into the algebraic 17508 multigrid method. Test results show that the new method can have much lower grid 17509 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 17510 author = {Chow, Edmond}, 17511 citeulike-article-id={7675372}, 17512 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17513 journal = {American Journal of Mathematics}, 17514 keywords = {fem, multigrid}, 17515 pages = {197--215}, 17516 posted-at = {2010-08-17 23:29:51}, 17517 priority = {2}, 17518 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 17519 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17520 volume = {65}, 17521 year = {2001} 17522} 17523 17524@Article{ jonesamge, 17525 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 17526 elements) method based on element agglomeration. In the method, coarse grid 17527 elements are formed by agglomerating fine grid elements. Compatible interpolation 17528 operators are constructed which yield coarse grid basis functions with a minimal 17529 energy property. Heuristics based on interpolation quality measures are used to 17530 guide the agglomeration procedure. The performance of the resulting method is 17531 demonstrated in two-level numerical experiments.}}, 17532 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 17533 citeulike-article-id={8598569}, 17534 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17535 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 17536 journal = {SIAM Journal on Scientific Computing}, 17537 keywords = {amg, fem, multigrid}, 17538 number = {1}, 17539 pages = {109--133}, 17540 posted-at = {2011-01-13 18:05:55}, 17541 priority = {2}, 17542 publisher = {SIAM}, 17543 title = {{AMGE Based on Element Agglomeration}}, 17544 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17545 volume = {23}, 17546 year = {2001} 17547} 17548 17549@Article{ saad1993, 17550 author = {Saad, Youcef}, 17551 doi = {10.1137/0914028}, 17552 issn = {10648275}, 17553 journal = {SIAM Journal on Scientific Computing}, 17554 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 17555 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 17556 precondition-,preconditioned conju-,subject classi cations,variable 17557 preconditioners}, 17558 number = {2}, 17559 pages = {461--469}, 17560 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 17561 volume = {14}, 17562 year = {1993} 17563} 17564 17565@Misc{ path:homepage, 17566 author = {S. Dirkse and M. Ferris and T. Munson}, 17567 title = {{{PATH} {W}eb page}}, 17568 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 17569} 17570 17571@Article{ ketcheson2008, 17572 author = {David I Ketcheson}, 17573 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 17574 Low-Storage Implementations}, 17575 volume = {30}, 17576 journal = {SIAM Journal on Scientific Computing}, 17577 year = {2008}, 17578 pages = {2113--2136} 17579} 17580 17581@Article{ elman2009boundary, 17582 title = {{Boundary conditions in approximate commutator preconditioners for the 17583 Navier-Stokes equations}}, 17584 author = {Elman, H.C. and Tuminaro, R.}, 17585 journal = {Electronic Transactions on Numerical Analysis}, 17586 volume = {35}, 17587 pages = {257--280}, 17588 year = {2009} 17589} 17590 17591@Article{ elman2008tcp, 17592 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 17593 incompressible Navier-Stokes equations}}, 17594 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 17595 R.}, 17596 journal = {Journal of Computational Physics}, 17597 volume = {227}, 17598 number = {1}, 17599 pages = {1790--1808}, 17600 year = {2008}, 17601 publisher = {Academic Press}, 17602 url = {http://chess.cs.umd.edu/~elman/papers/tax.pdf} 17603} 17604 17605@Article{ arioli2013, 17606 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 17607 author = {Arioli, Mario}, 17608 journal = {SIAM Journal on Matrix Analysis and Applications}, 17609 volume = {34}, 17610 number = {2}, 17611 pages = {571--592}, 17612 year = {2013}, 17613 publisher = {SIAM} 17614} 17615 17616@Book{ wesseling2009, 17617 title = {Principles of computational fluid dynamics}, 17618 author = {Wesseling, Pieter}, 17619 volume = {29}, 17620 year = {2009}, 17621 publisher = {Springer Science \& Business Media} 17622} 17623 17624@Article{ silvester2001efficient, 17625 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 17626 incompressible flow}}, 17627 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 17628 journal = {Journal of Computational and Applied Mathematics}, 17629 volume = {128}, 17630 number = {1-2}, 17631 pages = {261--279}, 17632 issn = {0377-0427}, 17633 year = {2001}, 17634 publisher = {Elsevier} 17635} 17636 17637@Article{ elman1999bfbt, 17638 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 17639 viscosity}}, 17640 author = {Elman, H.C.}, 17641 journal = {SIAM Journal on Scientific Computing}, 17642 volume = {20}, 17643 number = {4}, 17644 pages = {1299--1316}, 17645 issn = {1064-8275}, 17646 year = {1999}, 17647 publisher = {Citeseer} 17648} 17649 17650@Article{ elman2006bpb, 17651 title = {{Block preconditioners based on approximate commutators}}, 17652 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 17653 journal = {SIAM Journal on Scientific Computing}, 17654 volume = {27}, 17655 number = {5}, 17656 pages = {1651--1668}, 17657 year = {2006}, 17658 publisher = {Philadelphia, PA: SIAM, c1993-} 17659} 17660 17661@Article{ olshanskii2006analysis, 17662 title = {{Analysis of a Stokes interface problem}}, 17663 author = {Olshanskii, M.A. and Reusken, A.}, 17664 journal = {Numerische Mathematik}, 17665 volume = {103}, 17666 number = {1}, 17667 pages = {129--149}, 17668 issn = {0029-599X}, 17669 year = {2006}, 17670 publisher = {Springer} 17671} 17672 17673@Article{ patankar1972cph, 17674 title = {{A calculation procedure for heat, mass and momentum transfer in 17675 three-dimensional parabolic flows}}, 17676 author = {Patankar, S.V. and Spalding, D.B.}, 17677 journal = {Int. J. Heat Mass Transfer}, 17678 volume = {15}, 17679 pages = {1787--1806}, 17680 year = {1972} 17681} 17682 17683@Article{ rannacher1992simple, 17684 title = {{Simple nonconforming quadrilateral Stokes element}}, 17685 author = {Rannacher, R. and Turek, S.}, 17686 journal = {Numerical Methods for Partial Differential Equations}, 17687 volume = {8}, 17688 number = {2}, 17689 pages = {97--111}, 17690 issn = {1098-2426}, 17691 year = {1992}, 17692 publisher = {Wiley Online Library} 17693} 17694 17695@Article{ rannacher2000finite, 17696 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 17697 author = {Rannacher, R.}, 17698 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 17699 pages = {191}, 17700 isbn = {3764364149}, 17701 year = {2000}, 17702 publisher = {Birkhauser} 17703} 17704 17705@Article{ vanka1986block, 17706 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 17707 variables}}, 17708 author = {Vanka, S.P.}, 17709 journal = {Journal of Computational Physics}, 17710 volume = {65}, 17711 number = {1}, 17712 pages = {138--158}, 17713 issn = {0021-9991}, 17714 year = {1986}, 17715 publisher = {Elsevier} 17716} 17717 17718@Article{ eisenstat1983variational, 17719 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 17720 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 17721 journal = {SIAM Journal on Numerical Analysis}, 17722 volume = {20}, 17723 number = {2}, 17724 pages = {345--357}, 17725 year = {1983}, 17726 publisher = {JSTOR} 17727} 17728 17729@InProceedings{ burstedde2008scalable, 17730 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 17731 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 17732 T. and Wilcox, L.C. and Zhong, S.}, 17733 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 17734 pages = {62}, 17735 year = {2008}, 17736 organization = {IEEE Press} 17737} 17738 17739@Article{ burstedde2009parallel, 17740 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 17741 flow problems}, 17742 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 17743 journal = {Computer Methods in Applied Mechanics and Engineering}, 17744 volume = {198}, 17745 number = {21-26}, 17746 pages = {1691--1700}, 17747 year = {2009}, 17748 publisher = {Elsevier} 17749} 17750 17751@Article{ stadler2010dynamics, 17752 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 17753 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 17754 Ghattas, O.}, 17755 journal = {Science}, 17756 volume = {329}, 17757 number = {5995}, 17758 pages = {1033}, 17759 year = {2010}, 17760 publisher = {American Association for the Advancement of Science} 17761} 17762 17763@Article{ tackley2008modelling, 17764 title = {Modelling compressible mantle convection with large viscosity contrasts in a 17765 three-dimensional spherical shell using the yin-yang grid}, 17766 author = {Tackley, P.J.}, 17767 journal = {Physics of the Earth and Planetary Interiors}, 17768 volume = {171}, 17769 number = {1-4}, 17770 pages = {7--18}, 17771 year = {2008}, 17772 publisher = {Elsevier} 17773} 17774 17775@Article{ moresizhonggurnis96, 17776 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 17777 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 17778 viscosity}, 17779 journal = {Physics of the Earth and Planetary Interiors}, 17780 volume = {97}, 17781 pages = {83-–94}, 17782 year = {1996} 17783} 17784 17785@Article{ moresisolomatov95, 17786 author = {Louis N. Moresi and V. S. Solomatov}, 17787 title = {Numerical investigation of {2D} convection with extremely large viscosity 17788 variations}, 17789 journal = {Physics of Fluids}, 17790 volume = {7}, 17791 number = {9}, 17792 pages = {2154-–2162}, 17793 year = {1995} 17794} 17795 17796@Article{ chenmolnar83, 17797 author = {W.-P. Chen and P. Molnar}, 17798 title = {Focal depths of intra-continental and intraplate earthquakes and their 17799 implications for the thermal and mechanical properties of the lithosphere}, 17800 journal = {Journal of Geophysical Research}, 17801 volume = {88}, 17802 pages = {4183–-4214}, 17803 year = {1983} 17804} 17805 17806@Article{ jackson02, 17807 author = {J. Jackson}, 17808 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 17809 journal = {GSA Today}, 17810 volume = {12}, 17811 pages = {4–-10}, 17812 year = {2002} 17813} 17814 17815@Article{ burovwatts06, 17816 author = {E.B. Burov and A.B. Watts}, 17817 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 17818 brulee?}, 17819 journal = {GSA Today}, 17820 volume = {16}, 17821 pages = {4–-10}, 17822 year = {2006} 17823} 17824 17825@InProceedings{ yang:brent:2002, 17826 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 17827 Parallel Distributed Memory Architectures}, 17828 author = {Laurence T. Yang and Richard Brent}, 17829 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 17830 for Parallel Processing}, 17831 year = {2002}, 17832 publisher = {IEEE} 17833} 17834 17835@Article{ demmel2008communication, 17836 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 17837 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 17838 journal = {Arxiv preprint arXiv:0808.2664}, 17839 year = {2008} 17840} 17841 17842@Article{ demmel09, 17843 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 17844 title = {Communication-optimal Iterative Methods}, 17845 journal = {Journal of Physics: Conf. Series}, 17846 volume = {180}, 17847 year = {2009} 17848} 17849 17850@TechReport{ parms04, 17851 author = {Yousef Saad and Masha Sosonkina}, 17852 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 17853 linear systems user's guide}, 17854 number = {UMSI2004-8}, 17855 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 17856 year = {2004} 17857} 17858 17859@Article{ picard1890, 17860 author = {Emile Picard}, 17861 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 17862 m\'ethode des approximations successives}, 17863 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 17864 volume = {4}, 17865 number = {6}, 17866 pages = {145--210}, 17867 year = {1890}, 17868 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 17869} 17870 17871@Book{ rall1969, 17872 author = {Louis B. Rall}, 17873 title = {Computational solution of nonlinear operator equations}, 17874 publisher = {Krieger Pub Co.}, 17875 pages = {225}, 17876 year = {1969} 17877} 17878 17879@Article{ fletcherreeves1964, 17880 author = {R. Fletcher and C. M. Reeves}, 17881 title = {Function Minimization by Conjugate Gradients}, 17882 journal = {Computer Journal}, 17883 volume = {7}, 17884 pages = {149–-154}, 17885 year = {1964} 17886} 17887 17888@InBook{ mcinnesallanetal06, 17889 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 17890 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 17891 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 17892 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 17893 editor = {A.~M.~Bruaset and A.~Tveito}, 17894 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 17895 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 17896 publisher = {Springer}, 17897 year = {2006}, 17898 number = {51}, 17899 series = {Lecture Notes in Computational Science and Engineering}, 17900 pages = {327--381}, 17901 doi = {10.1016/S0167-8191(02)00191-6} 17902} 17903 17904@Article{ cyrshadidtuminaro12, 17905 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 17906 equations}, 17907 journal = {Journal of Computational Physics}, 17908 volume = {231}, 17909 number = {2}, 17910 pages = {345 - 363}, 17911 year = {2012}, 17912 issn = {0021-9991}, 17913 doi = {10.1016/j.jcp.2011.09.001}, 17914 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 17915} 17916 17917@Article{ keyesmcinneswoodwardetal13, 17918 title = {Multiphysics Simulations: Challenges and Opportunities}, 17919 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 17920 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 17921 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 17922 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 17923 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 17924 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 17925 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 17926 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 17927 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 17928 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 17929 journal = {International Journal of High Performance Computing Applications}, 17930 month = feb, 17931 year = {2013}, 17932 volume = {27}, 17933 number = {1}, 17934 pages = {4--83}, 17935 doi = {10.1177/1094342012468181}, 17936 note = {Special issue}, 17937 abstract = {We consider multiphysics applications from algorithmic and architectural 17938 perspectives, where ``algorithmic'' includes both mathematical analysis and 17939 computational complexity and ``architectural'' includes both software and hardware 17940 environments. Many diverse multiphysics applications can be reduced, en route to 17941 their computational simulation, to a common algebraic coupling paradigm. 17942 Mathematical analysis of multiphysics coupling in this form is not always 17943 practical for realistic applications, but model problems representative of 17944 applications discussed herein can provide insight. A variety of software 17945 frameworks for multiphysics applications have been constructed and refined within 17946 disciplinary communities and executed on leading-edge computer systems. We examine 17947 several of these, expose some commonalities among them, and attempt to extrapolate 17948 best practices to future systems. From our study, we summarize challenges and 17949 forecast opportunities.} 17950} 17951 17952@Misc{ rosner10, 17953 author = {Robert {Rosner (Chair)}}, 17954 title = {{The Opportunities and Challenges of Exascale Computing}}, 17955 year = {2010}, 17956 howpublished = {Office of Science, U.S. Department of Energy}, 17957 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 17958} 17959 17960@Misc{ kogge2008exascale, 17961 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 17962 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 17963 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 17964 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 17965 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 17966 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 17967 howpublished = {DARPA}, 17968 year = {2008}, 17969 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 17970} 17971 17972@Misc{ doegrandchallengeworkshops, 17973 key = {Office of Science, U.S. Department of Energy}, 17974 title = {{Scientific Grand Challenges Workshop Series}}, 17975 howpublished = {Office of Science, U.S. Department of Energy, see 17976 \url{http://extremecomputing.labworks.org/workshops.stm}} 17977} 17978 17979@Misc{ lawrence2011, 17980 key = {Lawrence}, 17981 title = {{Ernest Orlando Lawrence Award Winners}}, 17982 howpublished = {U.S. Department of Energy, {\footnotesize 17983 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 17984 year = {2011} 17985} 17986 17987@Article{ murphy2000npi, 17988 title = {{A note on preconditioning for indefinite linear systems}}, 17989 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 17990 journal = {SIAM Journal on Scientific Computing}, 17991 volume = {21}, 17992 number = {6}, 17993 pages = {1969--1972}, 17994 year = {2000}, 17995 publisher = {Philadelphia, PA: SIAM, c1993-} 17996} 17997 17998@Article{ elman2011bouyancy, 17999 title = {Fast iterative solvers for buoyancy driven flow problems}, 18000 journal = {Journal of Computational Physics}, 18001 volume = {230}, 18002 number = {10}, 18003 pages = {3900 - 3914}, 18004 year = {2011}, 18005 note = {}, 18006 issn = {0021-9991}, 18007 doi = {10.1016/j.jcp.2011.02.014}, 18008 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 18009 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 18010 Adaptivity, Preconditioning, Algebraic multigrid} 18011} 18012 18013@Article{ dongarrabeckman11, 18014 author = {J. Dongarra and P. Beckman and et al.}, 18015 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 18016 journal = {Int. J. High Perf. Comput. Applics.}, 18017 volume = {25}, 18018 year = {2011}, 18019 pages = {3--60} 18020} 18021 18022@Article{ mandel1999energy, 18023 title = {Energy optimization of algebraic multigrid bases}, 18024 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 18025 journal = {Computing}, 18026 volume = {62}, 18027 number = {3}, 18028 pages = {205--228}, 18029 year = {1999}, 18030 publisher = {Springer} 18031} 18032 18033@Article{ vanek1996algebraic, 18034 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 18035 problems}, 18036 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 18037 journal = {Computing}, 18038 volume = {56}, 18039 number = {3}, 18040 pages = {179--196}, 18041 year = {1996}, 18042 publisher = {Springer} 18043} 18044 18045@Article{ vanek2001convergence, 18046 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 18047 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 18048 journal = {Numerische Mathematik}, 18049 volume = {88}, 18050 number = {3}, 18051 pages = {559--579}, 18052 year = {2001}, 18053 publisher = {Springer} 18054} 18055 18056@Article{ brannick2007algebraic, 18057 title = {Algebraic multigrid methods based on compatible relaxation and energy 18058 minimization}, 18059 author = {Brannick, J. and Zikatanov, L.}, 18060 journal = {Domain decomposition methods in science and engineering XVI}, 18061 pages = {15--26}, 18062 year = {2007}, 18063 publisher = {Springer} 18064} 18065 18066@Article{ brannickfalgout2010, 18067 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 18068 author = {James J. Brannick and Robert D. Falgout}, 18069 journal = {SIAM Journal on Scientific Computing}, 18070 volume = {32}, 18071 number = {3}, 18072 pages = {1393--1416}, 18073 url = {http://epubs.siam.org/doi/10.1137/090772216}, 18074 doi = {10.1137/090772216}, 18075 issn = {1064-8275}, 18076 year = {2010} 18077} 18078 18079@Article{ xu2004energy, 18080 title = {On an energy minimizing basis for algebraic multigrid methods}, 18081 author = {Xu, J. and Zikatanov, L.}, 18082 journal = {Computing and Visualization in Science}, 18083 volume = {7}, 18084 number = {3}, 18085 pages = {121--127}, 18086 year = {2004}, 18087 publisher = {Springer} 18088} 18089 18090@Article{ dblp:journals/toms/bakerhlt09, 18091 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 18092 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 18093 journal = {ACM Trans. Math. Softw.}, 18094 volume = {36}, 18095 number = {3}, 18096 year = {2009}, 18097 doi = {10.1145/1527286.1527287}, 18098 bibsource = {DBLP, http://dblp.uni-trier.de} 18099} 18100 18101@Article{ dblp:journals/siamsc/yanggbllhn05, 18102 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 18103 Parry Husbands and Esmond G. Ng}, 18104 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 18105 journal = {SIAM J. Scientific Computing}, 18106 volume = {27}, 18107 number = {3}, 18108 year = {2005}, 18109 pages = {873-892}, 18110 doi = {10.1137/040613767}, 18111 bibsource = {DBLP, http://dblp.uni-trier.de} 18112} 18113 18114@TechReport{ ml-guide, 18115 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 18116 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 18117 institution = {Sandia National Laboratories}, 18118 year = {2006}, 18119 number = {SAND2006-2649} 18120} 18121 18122@Article{ brannick06, 18123 title = {An energy-based AMG coarsening strategy}, 18124 volume = {13}, 18125 doi = {10.1002/nla.480}, 18126 number = {2-3}, 18127 journal = {Numerical Linear Algebra with Applications}, 18128 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 18129 and Ruge, J}, 18130 year = {2006}, 18131 pages = {133--148} 18132} 18133 18134@Article{ olson10, 18135 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 18136 title = {A new perspective on strength measures in algebraic multigrid}, 18137 journal = {Numerical Linear Algebra with Applications}, 18138 volume = {17}, 18139 number = {4}, 18140 pages = {713--733}, 18141 year = {2010}, 18142 publisher = {John Wiley \& Sons, Ltd.}, 18143 issn = {1099-1506}, 18144 doi = {10.1002/nla.669} 18145} 18146 18147@Article{ olson11, 18148 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 18149 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 18150 Minimization}, 18151 journal = {SIAM J. Sci. Comput.}, 18152 issue_date = {April 2011}, 18153 volume = {33}, 18154 issue = {2}, 18155 month = apr, 18156 year = {2011}, 18157 issn = {1064-8275}, 18158 pages = {966--991}, 18159 numpages = {26}, 18160 doi = {10.1137/100803031}, 18161 acmid = {2078825}, 18162 publisher = {Society for Industrial and Applied Mathematics}, 18163 address = {Philadelphia, PA}, 18164 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 18165 aggregation} 18166} 18167 18168@Article{ dorit2011, 18169 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 18170 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 18171 journal = {Multiscale Modeling {\&} Simulation}, 18172 volume = {9}, 18173 number = {1}, 18174 year = {2011}, 18175 pages = {407-423}, 18176 doi = {10.1137/100791142} 18177} 18178 18179@Article{ chen2011algebraic, 18180 title = {Algebraic distance on graphs}, 18181 author = {Chen, Jie and Safro, Ilya}, 18182 journal = {SIAM Journal on Scientific Computing}, 18183 volume = {33}, 18184 number = {6}, 18185 pages = {3468--3490}, 18186 year = {2011}, 18187 publisher = {SIAM} 18188} 18189 18190@InProceedings{ adams04, 18191 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 18192 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 18193 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 18194 half a billion degrees of freedom}, 18195 note = {Gordon Bell Award}, 18196 year = {2004} 18197} 18198 18199@Article{ adams03a, 18200 author = {Adams, M.~F.}, 18201 journal = {Numerical Linear Algebra with Applications}, 18202 number = {2-3}, 18203 pages = {141-153}, 18204 title = {Algebraic multigrid methods for constrained linear systems with applications to 18205 contact problems in solid mechanics}, 18206 volume = {11}, 18207 year = {2004} 18208} 18209 18210@Article{ adams-10a, 18211 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 18212 doi = {10.1016/j.jcp.2010.04.024}, 18213 issn = {0021-9991}, 18214 journal = {Journal of Computational Physics}, 18215 keywords = {Implicit magnetohydrodynamics}, 18216 number = {18}, 18217 pages = {6208 - 6219}, 18218 title = {Toward textbook multigrid efficiency for fully implicit resistive 18219 magnetohydrodynamics}, 18220 volume = {229}, 18221 year = {2010} 18222} 18223 18224@InProceedings{ adams98, 18225 address = {Copper Mountain, CO}, 18226 author = {Adams, M.~F.}, 18227 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 18228 title = {A Parallel Maximal Independent Set Algorithm}, 18229 year = {1998} 18230} 18231 18232@InProceedings{ madaypatera89, 18233 author = {Y. Maday and A. T. Patera}, 18234 title = {Spectral element methods for the {Navier-Stokes} equations}, 18235 editor = {A. K. Noor and J. T. Oden}, 18236 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 18237 pages = {71-–143}, 18238 publisher = {ASME}, 18239 address = {New York, NY}, 18240 year = {1989} 18241} 18242 18243@Article{ mishra2012mlmcfvm, 18244 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 18245 conservation laws in multi-dimensions}, 18246 journal = {Journal of Computational Physics}, 18247 volume = {231}, 18248 number = {8}, 18249 pages = {3365--3388}, 18250 year = {2012}, 18251 issn = {0021-9991}, 18252 doi = {10.1016/j.jcp.2012.01.011}, 18253 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 18254 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 18255 Carlo, Parallelization} 18256} 18257 18258@Article{ barth2011mlmcfe, 18259 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 18260 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 18261 Switzerland}, 18262 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 18263 stochastic coefficients}, 18264 journal = {Numerische Mathematik}, 18265 publisher = {Springer Berlin / Heidelberg}, 18266 issn = {0029-599X}, 18267 keyword = {Mathematics and Statistics}, 18268 pages = {123-161}, 18269 volume = {119}, 18270 issue = {1}, 18271 doi = {10.1007/s00211-011-0377-0}, 18272 year = {2011} 18273} 18274 18275@Article{ nguyen2011hybridizable, 18276 title = {Hybridizable discontinuous {G}alerkin methods}, 18277 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 18278 journal = {Spectral and High Order Methods for Partial Differential Equations}, 18279 pages = {63--84}, 18280 year = {2011}, 18281 publisher = {Springer} 18282} 18283 18284@Misc{ snyder-scidac3:proposal, 18285 author = {Philip {Snyder (PI)}}, 18286 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 18287 note = {proposal to DOE SciDAC3}, 18288 month = oct, 18289 year = {2011} 18290} 18291 18292@Misc{ wirth-scidac3:proposal, 18293 author = {Brian {Wirth (PI)}}, 18294 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 18295 through Leadership Class Computing}}, 18296 note = {proposal to DOE SciDAC3}, 18297 month = oct, 18298 year = {2011} 18299} 18300 18301@Misc{ cary-scidac3:proposal, 18302 author = {John {Cary (PI)}}, 18303 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 18304 Stability (IMMPACTS)}}, 18305 note = {proposal to DOE SciDAC3}, 18306 month = oct, 18307 year = {2011} 18308} 18309 18310@Misc{ vashista-scidac3:proposal, 18311 author = {Priya {Vashista (PI)}}, 18312 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 18313 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 18314 Multi-Petaflops Simulations}}, 18315 note = {proposal to DOE SciDAC3}, 18316 month = mar, 18317 year = {2012} 18318} 18319 18320@Article{ elemental2012, 18321 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 18322 Robert {v}an~{d}e~{G}eijn}, 18323 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 18324 journal = {{ACM} Transactions on Mathematical Software}, 18325 volume = {39}, 18326 number = {2}, 18327 year = {2013} 18328} 18329 18330@Misc{ elemental-web-page, 18331 author = {Jack Poulson}, 18332 title = {Elemental: Distributed memory dense linear algebra}, 18333 howpublished = {\url{http://libelemental.org}}, 18334 url = {http://libelemental.org/}, 18335 year = {2015} 18336} 18337 18338@Book{ scalesreport, 18339 title = {A Science-based Case for Large-scale Simulation}, 18340 editor = {D. E. Keyes}, 18341 publisher = {U.S. Department of Energy}, 18342 year = {2004}, 18343 url = {http://www.pnl.gov/scales} 18344} 18345 18346@InProceedings{ cilk95, 18347 address = {Santa Barbara, California}, 18348 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 18349 Leiserson and Keith H. Randall and Yuli Zhou}, 18350 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 18351 Parallel Programming (PPoPP)}, 18352 day = {19--21}, 18353 month = jul, 18354 pages = {207--216}, 18355 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 18356 year = {1995} 18357} 18358 18359@Misc{ valgrind-web-page, 18360 author = {Julian Seward}, 18361 title = {Valgrind}, 18362 url = {http://valgrind.org/}, 18363 howpublished = {\url{http://valgrind.org/}}, 18364 year = {2012} 18365} 18366 18367@Article{ blas79, 18368 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 18369 title = {Basic linear algebra subprograms for Fortran usage}, 18370 journal = {ACM Transactions on Mathematical Software}, 18371 volume = {5}, 18372 pages = {308--323}, 18373 year = {1979} 18374} 18375 18376@TechReport{ lapack90, 18377 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 18378 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 18379 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 18380 institution = {Computer Science Dept., University of Tennessee}, 18381 number = {CS-90-105}, 18382 month = may, 18383 year = {1990} 18384} 18385 18386@TechReport{ nvidiafermi, 18387 author = {NVIDIA}, 18388 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 18389 institution = {NVIDIA}, 18390 year = {2009} 18391} 18392 18393@Misc{ intelmic, 18394 author = {Many Core Group, Cambridge University}, 18395 title = {Intel Many Integrated Core Architecture}, 18396 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 18397 month = dec, 18398 year = {2010} 18399} 18400 18401@Article{ abusufahkucklawrie81, 18402 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 18403 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 18404 Transformations}, 18405 journal = {IEEE Trans. Comput.}, 18406 volume = {30}, 18407 number = {5}, 18408 pages = {341--356}, 18409 year = {1981} 18410} 18411 18412@InProceedings{ guobikshandifraguelagarzaranpadua08, 18413 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 18414 and Padua, David}, 18415 title = {Programming with tiles}, 18416 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 18417 parallel programming}, 18418 series = {PPoPP '08}, 18419 year = {2008}, 18420 isbn = {978-1-59593-795-7}, 18421 location = {Salt Lake City, UT}, 18422 pages = {111--122}, 18423 numpages = {12}, 18424 doi = {10.1145/1345206.1345225}, 18425 acmid = {1345225}, 18426 publisher = {ACM}, 18427 address = {New York, NY} 18428} 18429 18430@Article{ strout04, 18431 journal = {International Journal of High Performance Computing Applications}, 18432 year = {2004}, 18433 title = {Sparse Tiling for Stationary Iterative Methods}, 18434 month = feb, 18435 publisher = {Sage Publications}, 18436 pages = {95-114}, 18437 volume = {18}, 18438 number = {1}, 18439 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 18440} 18441 18442@Misc{ openclstandard, 18443 author = {Khronos Group}, 18444 title = {{OpenCL} 1.2 Specification}, 18445 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 18446 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 18447 year = {2011} 18448} 18449 18450@Misc{ stlguide, 18451 author = {SGI}, 18452 title = {Standard Template Library Programmer's Guide}, 18453 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 18454 url = {http://www.sgi.com/tech/stl/}, 18455 year = {2011} 18456} 18457 18458@Book{ stepanov09, 18459 author = {Alexander Stepanov and Paul McJones}, 18460 title = {Elements of Programming}, 18461 publisher = {Addison-Wesley}, 18462 isbn = {978-0-321-63537-2}, 18463 year = {2009} 18464} 18465 18466@Article{ bangerthhartmannkanschat2007, 18467 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18468 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 18469 journal = {ACM Trans. Math. Softw.}, 18470 year = {2007}, 18471 volume = {33}, 18472 number = {4}, 18473 pages = {24/1--24/27} 18474} 18475 18476@Misc{ dealii-web-page, 18477 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18478 title = {{deal.II}}, 18479 howpublished = {\url{http://www.dealii.org/}}, 18480 url = {http://www.dealii.org/}, 18481 year = {2012} 18482} 18483 18484@InBook{ siek2012, 18485 title = {The C++0x ``Concepts'' Effort}, 18486 author = {Jeremy G. Siek}, 18487 editor = {Jeremy Gibbons}, 18488 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 18489 UK, March 22-26, 2010, Revised Lectures}, 18490 pages = {175--216}, 18491 isbn = {978-3-642-32202-0}, 18492 doi = {10.1007/978-3-642-32202-0_4}, 18493 url = {http://arxiv.org/abs/1201.0027}, 18494 note = {\url{http://arxiv.org/abs/1201.0027}}, 18495 publisher = {Springer Berlin Heidelberg}, 18496 year = {2012} 18497} 18498 18499@Misc{ sharpclaw, 18500 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 18501 author = {Ketcheson, D. I. and Parsani, M.}, 18502 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18503 PDEs,sharpclaw,software}, 18504 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18505 PDEs,sharpclaw,software}, 18506 title = {{SharpClaw software}}, 18507 year = {2011} 18508} 18509 18510@Book{ leveque2002, 18511 title = {Finite volume methods for hyperbolic problems}, 18512 author = {Randall J LeVeque}, 18513 volume = {31}, 18514 year = {2002} 18515} 18516 18517@Misc{ clawpack45, 18518 note = {\url{http://www.clawpack.org}}, 18519 author = {LeVeque, R. J. and Berger, M. J.}, 18520 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 18521 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 18522 title = {{Clawpack Software version 4.5}}, 18523 url = {www.clawpack.org}, 18524 year = {2011} 18525} 18526 18527@Article{ nilsen2010, 18528 archiveprefix = {arXiv}, 18529 arxivid = {arXiv:1002.0705v1}, 18530 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 18531 eprint = {arXiv:1002.0705v1}, 18532 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 18533 parallelization of scientific codes by a function-centric approach in 18534 Python.pdf:pdf}, 18535 journal = {Computational Science \& Discovery}, 18536 keywords = {parallel,programming,python,software}, 18537 mendeley-tags = {parallel,programming,python,software}, 18538 pages = {015003}, 18539 publisher = {IOP Publishing}, 18540 title = {{Simplifying the parallelization of scientific codes by a function-centric 18541 approach in Python}}, 18542 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 18543 volume = {3}, 18544 year = {2010} 18545} 18546 18547@Book{ langtangen09, 18548 author = {Hans Petter Langtangen}, 18549 title = {Python Scripting for Computational Science}, 18550 publisher = {Springer}, 18551 series = {Texts in Computational Science and Engineering}, 18552 pages = {784}, 18553 isbn = {3540739157}, 18554 year = {2009} 18555} 18556 18557@Book{ numpyguide, 18558 author = {Travis E. Oliphant}, 18559 title = {Guide to {N}umpy}, 18560 publisher = {Trelgol}, 18561 year = {2008} 18562} 18563 18564@Misc{ pycuda, 18565 author = {Andreas Kl\"ockner}, 18566 title = {{PyCUDA}}, 18567 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 18568 year = {2011} 18569} 18570 18571@Misc{ pyopencl, 18572 author = {Andreas Kl\"ockner}, 18573 title = {{PyOpenCL}}, 18574 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 18575 year = {2011} 18576} 18577 18578@Article{ klockner2012, 18579 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 18580 Paul Ivanov and Ahmed Fasih}, 18581 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 18582 generation}, 18583 journal = {Parallel Computing}, 18584 volume = {38}, 18585 number = {3}, 18586 pages = {157--174}, 18587 year = {2012}, 18588 issn = {0167-8191}, 18589 doi = {10.1016/j.parco.2011.09.001} 18590} 18591 18592%%%%%% Matt Stuff %%%%%% 18593@Article{ morrabozdagknepleyrassvesselinov, 18594 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 18595 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 18596 Velimir Vesselinov}, 18597 journal = {Eos}, 18598 volume = {102}, 18599 doi = {10.1029/2021EO159258}, 18600 month = {Jun}, 18601 year = {2021} 18602} 18603 18604@Misc{ knepley:icerm-workshop:2012, 18605 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 18606 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 18607 Models for Large-scale Simulations}, 18608 note = {Workshop sponsored by the Institute for Computational and Experimental Research 18609 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 18610 \url{http://icerm.brown.edu/tw12-1-exascale}}, 18611 year = {2012} 18612} 18613 18614@TechReport{ kirbyknepleyscott04, 18615 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18616 title = {Optimal Evaluation of Finite Element Matrices}, 18617 type = {Technical Report}, 18618 number = {TR-2004-04}, 18619 institution = {University of Chicago}, 18620 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 18621 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 18622 pages = {14}, 18623 month = may, 18624 year = {2004} 18625} 18626 18627@TechReport{ kirbyknepleyscott10, 18628 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18629 title = {Languages and Compilers for Variational Forms}, 18630 type = {Technical Report}, 18631 number = {TR-2010-09}, 18632 institution = {University of Chicago}, 18633 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 18634 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 18635 month = oct, 18636 year = {2010} 18637} 18638 18639@TechReport{ kirbyknepleyscott10b, 18640 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18641 title = {Evaluation of the Action of Finite Element Operators}, 18642 type = {Technical Report}, 18643 number = {TR-2010-08}, 18644 institution = {University of Chicago}, 18645 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 18646 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 18647 month = oct, 18648 year = {2010} 18649} 18650 18651@TechReport{ bruneknepleyscott11, 18652 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18653 title = {Exponential grids in high-dimensional space}, 18654 type = {Technical Report}, 18655 number = {TR-2011-07}, 18656 institution = {University of Chicago}, 18657 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 18658 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 18659 month = dec, 18660 year = {2011} 18661} 18662 18663@TechReport{ zheng11, 18664 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 18665 Zhang and Yaolin Shi}, 18666 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 18667 strongly variable viscosity based on {Matlab} and {CUDA}}, 18668 type = {Research Report}, 18669 number = {UMSI 2011/33}, 18670 institution = {University of Minnesota Supercomputing Institute}, 18671 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 18672 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 18673 month = mar, 18674 year = {2011} 18675} 18676 18677@InProceedings{ zheng2010, 18678 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 18679 Zhang and Yaolin Shi}, 18680 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 18681 booktitle = {Eos Transactions of the AGU}, 18682 organization = {American Geophysical Union}, 18683 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 18684 year = {2010} 18685} 18686 18687@InCollection{ terrelkirbyknepleyscott12, 18688 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 18689 and Garth N. Wells}, 18690 title = {Finite elements for incompressible fluids}, 18691 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18692 booktitle = {Automated solutions of differential equations by the finite element method}, 18693 series = {Lecture Notes in Computational Science and Engineering}, 18694 volume = {84}, 18695 pages = {163--169}, 18696 publisher = {Springer-Verlag}, 18697 year = {2012} 18698} 18699 18700@InCollection{ mardalhaga12, 18701 author = {Kent-Andre Mardal and Joachim Berdal Haga}, 18702 title = {Block preconditioning of systems of PDEs}, 18703 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18704 booktitle = {Automated solutions of differential equations by the finite element method}, 18705 series = {Lecture Notes in Computational Science and Engineering}, 18706 volume = {84}, 18707 pages = {643--655}, 18708 publisher = {Springer-Verlag}, 18709 year = {2012} 18710} 18711 18712@InCollection{ kirbyknepleyloggscottterrel12, 18713 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 18714 Andy R. Terrel}, 18715 title = {Discrete optimization of finite element matrix evaluation}, 18716 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18717 booktitle = {Automated solutions of differential equations by the finite element method}, 18718 series = {Lecture Notes in Computational Science and Engineering}, 18719 volume = {84}, 18720 pages = {385--397}, 18721 publisher = {Springer-Verlag}, 18722 year = {2012} 18723} 18724 18725@InCollection{ kirby12, 18726 author = {Robert C. Kirby}, 18727 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 18728 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18729 booktitle = {Automated solutions of differential equations by the finite element method}, 18730 series = {Lecture Notes in Computational Science and Engineering}, 18731 volume = {84}, 18732 publisher = {Springer-Verlag}, 18733 year = {2012} 18734} 18735 18736@Article{ brownconveryhotesknepleypetropolous1993, 18737 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 18738 Labros Petropolous}, 18739 title = {Closed strings with low harmonics and kinks}, 18740 journal = {Physical Review D}, 18741 volume = {48}, 18742 number = {6}, 18743 year = {1993} 18744} 18745 18746@Article{ minimax1996, 18747 title = {MiniMax: What has been learned thus far}, 18748 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 18749 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 18750 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 18751 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 18752 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 18753 journal = {Nuovo Cimento}, 18754 volume = {19}, 18755 number = {1}, 18756 pages = {1045--1049}, 18757 year = {1996} 18758} 18759 18760@Article{ minimax1997, 18761 author = {Minimax Collaboration}, 18762 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 18763 Production}, 18764 journal = {Physical Review D}, 18765 volume = {55}, 18766 number = {9}, 18767 year = {1997} 18768} 18769 18770@Article{ minimax2000, 18771 author = {Minimax Collaboration}, 18772 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 18773 journal = {Physical Review D}, 18774 volume = {61}, 18775 number = {3}, 18776 year = {2000} 18777} 18778 18779@Article{ kirbyknepleyloggscott05, 18780 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 18781 title = {Optimizing the evaluation of finite element matrices}, 18782 journal = {SIAM Journal on Scientific Computing}, 18783 volume = {27}, 18784 number = {3}, 18785 pages = {741--758}, 18786 year = {2005} 18787} 18788 18789@Article{ bardhanknepleyanitescu2008, 18790 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 18791 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 18792 of Molecular Solvation}, 18793 journal = {Journal of Chemical Physics}, 18794 volume = {130}, 18795 number = {10}, 18796 pages = {104108}, 18797 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 18798 Research}, 18799 doi = {10.1063/1.3081148}, 18800 year = {2008} 18801} 18802 18803%Poster at Biophysical Society Fall Meeting 18804@Article{ bardhanknepley2017, 18805 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18806 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 18807 Hydration-Shell {Poisson}-{Boltzmann} Model}, 18808 journal = {Biophysical Journal}, 18809 volume = {110}, 18810 number = {3}, 18811 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 18812 doi = {10.1016/j.bpj.2015.11.1766}, 18813 year = {2017} 18814} 18815 18816@Article{ tabrizirahimigoossensknepleybardhan2018, 18817 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 18818 Interface Condition (SLIC) Continuum Dielectric Model}, 18819 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 18820 Matthew G. Knepley and Jaydeep P. Bardhan}, 18821 journal = {International Journal of Quantum Chemistry}, 18822 note = {Accepted}, 18823 year = {2018} 18824} 18825 18826@Article{ knepley2010, 18827 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 18828 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 18829 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 18830 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 18831 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 18832 title = {{Reproducible Research: addressing the need for data and code sharing in 18833 computational science}}, 18834 journal = {Computing in Science and Engineering}, 18835 volume = {12}, 18836 number = {5}, 18837 pages = {8--13}, 18838 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 18839 year = {2010} 18840} 18841 18842@Article{ ketchesonahmadiaknepley2011, 18843 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 18844 Hyperbolic PDE Codes}, 18845 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 18846 journal = {SIAM News}, 18847 volume = {44}, 18848 number = {7}, 18849 month = sep, 18850 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 18851 year = {2011} 18852} 18853 18854@Article{ yokotabardhanknepleybarbahamada2011, 18855 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 18856 Tsuyoshi Hamada}, 18857 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 18858 a billion unknowns}, 18859 journal = {Computer Physics Communications}, 18860 volume = {182}, 18861 number = {6}, 18862 pages = {1272--1283}, 18863 year = {2011}, 18864 issn = {0010-4655}, 18865 doi = {10.1016/j.cpc.2011.02.013}, 18866 url = {http://arxiv.org/abs/1007.4591} 18867} 18868 18869@Article{ bardhanknepley2011, 18870 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18871 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 18872 Results for Spherical Inclusions}, 18873 journal = {Journal of Chemical Physics}, 18874 volume = {135}, 18875 number = {12}, 18876 pages = {124107--124117}, 18877 url = {http://arxiv.org/abs/1109.0651}, 18878 note = {\url{http://arxiv.org/abs/1109.0651}}, 18879 year = {2011} 18880} 18881 18882@Article{ bruneknepleyscott2013, 18883 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18884 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 18885 Graded Meshes}, 18886 journal = {SIAM Journal on Scientific Computing}, 18887 url = {http://arxiv.org/abs/1104.0261}, 18888 note = {\url{http://arxiv.org/abs/1104.0261}}, 18889 volume = {35}, 18890 number = {1}, 18891 pages = {A173--A191}, 18892 year = {2013} 18893} 18894 18895@Article{ bardhanknepley2012a, 18896 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18897 title = {Computational science and re-discovery: open-source implementations of 18898 ellipsoidal harmonics for problems in potential theory}, 18899 journal = {Computational Science \& Discovery}, 18900 volume = {5}, 18901 pages = {014006}, 18902 note = {\url{http://arxiv.org/abs/1204.0267}}, 18903 doi = {10.1088/1749-4699/5/1/014006}, 18904 year = {2012} 18905} 18906 18907@Article{ kreienkampetal2013, 18908 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 18909 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 18910 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 18911 contributions of molecular binding}, 18912 journal = {Molecular Based Mathematical Biology}, 18913 volume = {1}, 18914 pages = {124--150}, 18915 doi = {10.2478/mlbmb-2013-0007}, 18916 issn = {2299-3266}, 18917 month = jun, 18918 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 18919 year = {2013} 18920} 18921 18922@Article{ bardhanknepleybrune2015, 18923 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 18924 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 18925 Boundary-Integral Operators}, 18926 journal = {Molecular Based Mathematical Biology}, 18927 volume = {3}, 18928 number = {1}, 18929 pages = {1--22}, 18930 doi = {10.1515/mlbmb-2015-0001}, 18931 year = {2015} 18932} 18933 18934@Article{ bardhanknepley14, 18935 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18936 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 18937 Conditions}, 18938 journal = {Journal of Chemical Physics}, 18939 volume = {141}, 18940 number = {13}, 18941 pages = {131103}, 18942 doi = {10.1063/1.4897324}, 18943 year = {2014} 18944} 18945 18946@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 18947 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 18948 Electrostatics}, 18949 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 18950 Matthew G. Knepley}, 18951 booktitle = {Proceedings of PIERS}, 18952 pages = {1215--1221}, 18953 month = jul, 18954 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 18955 year = {2015} 18956} 18957 18958@Article{ tabriziknepleybardhan2016, 18959 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 18960 condition at the solute-solvent interface}, 18961 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 18962 journal = {Molecular Physics}, 18963 volume = {114}, 18964 number = {16-17}, 18965 pages = {2558--2567}, 18966 doi = {10.1080/00268976.2016.1198503}, 18967 year = {2016} 18968} 18969 18970% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 18971@Article{ tabrizigoossensrahimiknepleybardhan2017, 18972 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 18973 Mixtures Using a Solvation-Layer Interface Condition}, 18974 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 18975 Matthew G. Knepley and Jaydeep P. Bardhan}, 18976 journal = {Journal of Chemical Physics}, 18977 volume = {146}, 18978 number = {9}, 18979 pages = {094103}, 18980 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 18981 eprint = {https://arxiv.org/abs/1611.02150}, 18982 doi = {10.1063/1.4977037}, 18983 note = {PMCID: PMC5336475}, 18984 year = {2017} 18985} 18986 18987@Article{ tabrizigoossenscooperknepleybardhan2017, 18988 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 18989 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 18990 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 18991 Matthew G. Knepley and Jaydeep P. Bardhan}, 18992 number = {6}, 18993 pages = {2897--2914}, 18994 journal = {Journal of Chemical Theory and Computation}, 18995 year = {2017} 18996} 18997 18998@InProceedings{ mcclanahan2011, 18999 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 19000 K and Vuduc, Richard}, 19001 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 19002 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 19003 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 19004 year = {2011} 19005} 19006 19007@Article{ ghyselsashbymeerbergenvanroose2013, 19008 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 19009 title = {Hiding global communication latency in the {GMRES} algorithm on massively 19010 parallel machines}, 19011 journal = {SIAM Journal on Scientific Computing}, 19012 volume = {35}, 19013 number = {1}, 19014 pages = {C48--C71}, 19015 year = {2013} 19016} 19017 19018@Article{ ghyselsvanroose2014, 19019 author = {P. Ghysels and W. Vanroose}, 19020 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 19021 Algorithm}, 19022 journal = {Parallel Computing}, 19023 volume = {40}, 19024 number = {7}, 19025 pages = {224--238}, 19026 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 19027 doi = {10.1016/j.parco.2013.06.001}, 19028 year = {2014} 19029} 19030 19031@InProceedings{ strzodkagoddeke06, 19032 author = {R. Strzodka and D. G\"oddeke}, 19033 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 19034 from Low Precision Components}, 19035 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 19036 Computing Machines}, 19037 note = {FCCM ’06}, 19038 pages = {259--270}, 19039 year = {2006}, 19040 organization = {IEEE Computer Society} 19041} 19042 19043@InCollection{ jacquesnicolasvollaire12, 19044 author = {T. Jacques and L. Nicolas and C. Vollaire}, 19045 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 19046 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 19047 booktitle = {High-Performance Computing and Networking}, 19048 series = {Lecture Notes in Computer Science}, 19049 volume = {1593}, 19050 pages = {1025--1031}, 19051 publisher = {Springer}, 19052 year = {1999} 19053} 19054 19055@InProceedings{ hoeflerlumsdainerehm07, 19056 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 19057 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 19058 for MPI}}, 19059 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 19060 Networking, Storage and Analysis, SC07}, 19061 location = {Reno, NV}, 19062 publisher = {IEEE Computer Society/ACM}, 19063 source = {http://www.unixer.de/~htor/publications/}, 19064 month = nov, 19065 year = {2007} 19066} 19067 19068@InProceedings{ hoeflersiebretlumsdaine10, 19069 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 19070 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 19071 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 19072 Parallel Programming (PPoPP'10)}, 19073 month = jan, 19074 location = {Bangalore, India}, 19075 publisher = {ACM}, 19076 isbn = {978-1-60558-708-0}, 19077 source = {http://www.unixer.de/~htor/publications/}, 19078 pages = {159--168}, 19079 year = {2010} 19080} 19081 19082@Article{ ruppweinbubjungelgrasser15, 19083 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 19084 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 19085 journal = {ACM Transactions on Mathematical Software (TOMS)}, 19086 volume = {43}, 19087 number = {2}, 19088 pages = {11}, 19089 year = {2016}, 19090 publisher = {ACM} 19091} 19092 19093@Article{ bai_hu_reichel_1994, 19094 title = {A {Newton} basis {GMRES} implementation}, 19095 volume = {14}, 19096 url = {}, 19097 number = {}, 19098 journal = {IMA Journal of Numerical Analysis}, 19099 author = {Z. Bai and D. Hu and L. Reichel}, 19100 year = {1994}, 19101 pages = {563--581} 19102} 19103 19104@Article{ chronopoulos_gear_1989, 19105 title = {{S-step} iterative methods for symmetric linear systems}, 19106 volume = {25}, 19107 url = {}, 19108 number = {}, 19109 journal = {Journal of Computational and Applied Mathematics}, 19110 author = {A. T. Chronopoulos and C. W. Gear}, 19111 year = {1989}, 19112 pages = {153--168} 19113} 19114 19115@Article{ chronopoulos_1996, 19116 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 19117 author = {A. T. Chronopoulos and C. D. Swanson}, 19118 journal = {Parallel Computing}, 19119 volume = {22}, 19120 number = {5}, 19121 year = {1996}, 19122 pages = {623--641} 19123} 19124 19125@Article{ chronopoulos_2010, 19126 author = {A. T. Chronopoulos and A. Kucherov}, 19127 title = {Block {S-step} {Krylov} Iterative Methods}, 19128 journal = {Numerical Linear Algebra with Applications}, 19129 volume = {17}, 19130 number = {1}, 19131 pages = {3--15}, 19132 year = {2010} 19133} 19134 19135@Article{ sturler_vorst_1995, 19136 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 19137 distributed memory computers}, 19138 volume = {18}, 19139 url = {}, 19140 number = {}, 19141 journal = {Applied Numerical Mathematics}, 19142 author = {E. De Sturler and H. A. van der Vorst}, 19143 year = {1995}, 19144 pages = {441--459} 19145} 19146 19147@Article{ joubert_carey_1992, 19148 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 19149 I: Theory}, 19150 volume = {44}, 19151 url = {}, 19152 number = {}, 19153 journal = {International journal of computer mathematics}, 19154 author = {W. D. Joubert and G. F. Carey}, 19155 year = {1992}, 19156 pages = {243--267} 19157} 19158 19159@Article{ elman_saadsaylor_1986, 19160 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 19161 of linear equations}, 19162 volume = {7}, 19163 url = {}, 19164 number = {3}, 19165 journal = {SIAM Journal on Scientific and Statistical Computing}, 19166 author = {Howard Elman and Y. Saad and P. E. Saylor}, 19167 year = {1986}, 19168 pages = {840--855} 19169} 19170 19171@Article{ golub95innerand, 19172 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 19173 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 19174 journal = {SIAM J. Numer. Anal}, 19175 year = {1995}, 19176 volume = {35}, 19177 pages = {300--319} 19178} 19179 19180@Article{ golub_varga_1961, 19181 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 19182 and second-order {Richardson} iterative methods, parts {I} and {II}}, 19183 volume = {3}, 19184 url = {}, 19185 number = {}, 19186 journal = {Numer. Math.}, 19187 author = {Gene Golub and R.S. Varga}, 19188 year = {1961}, 19189 pages = {147--168} 19190} 19191 19192@Article{ el_maliki_guenette_fortin_2011, 19193 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 19194 element problems}, 19195 volume = {18}, 19196 doi = {10.1002/nla.757}, 19197 number = {5}, 19198 journal = {Numerical Linear Algebra with Applications}, 19199 author = {A. {El maliki} and R. Guenette and M. Fortin}, 19200 year = {2011}, 19201 pages = {789-803} 19202} 19203 19204@Article{ adavani2008multigrid, 19205 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 19206 Constraints}, 19207 author = {Adavani, S.S. and Biros, G.}, 19208 journal = {SIAM Journal on Scientific Computing}, 19209 volume = {31}, 19210 number = {1}, 19211 pages = {369--397}, 19212 year = {2008}, 19213 publisher = {Society for Industrial and Applied Mathematics} 19214} 19215 19216@Article{ horton1995space, 19217 title = {A space-time multigrid method for parabolic {PDE}s}, 19218 author = {Horton, G. and Vandewalle, S.}, 19219 journal = {SIAM Journal on Scientific Computing}, 19220 volume = {16}, 19221 number = {4}, 19222 pages = {848--864}, 19223 year = {1995} 19224} 19225 19226@Article{ lewis2005model, 19227 title = {Model problems for the multigrid optimization of systems governed by differential 19228 equations}, 19229 author = {Lewis, R.M. and Nash, S.G.}, 19230 journal = {SIAM Journal on Scientific Computing}, 19231 volume = {26}, 19232 number = {6}, 19233 pages = {1811--1837}, 19234 year = {2005}, 19235 publisher = {Philadelphia, PA: SIAM, c1993-} 19236} 19237 19238@Article{ nash2000mgopt, 19239 title = {A multigrid approach to discretized optimization problems}, 19240 author = {Nash, S.G.}, 19241 journal = {Optimization Methods and Software}, 19242 volume = {14}, 19243 number = {1-2}, 19244 pages = {99--116}, 19245 year = {2000}, 19246 publisher = {Taylor \& Francis} 19247} 19248 19249@Article{ borzi2009multigrid, 19250 title = {Multigrid Methods for {PDE} Optimization}, 19251 author = {Borz{\`i}, A. and Schulz, V.}, 19252 journal = {SIAM Review}, 19253 volume = {51}, 19254 pages = {361}, 19255 year = {2009} 19256} 19257 19258@Article{ borzi2005multigrid, 19259 title = {A multigrid scheme for elliptic constrained optimal control problems}, 19260 author = {Borz{\`i}, A. and Kunisch, K.}, 19261 journal = {Computational Optimization and Applications}, 19262 volume = {31}, 19263 number = {3}, 19264 pages = {309--333}, 19265 year = {2005}, 19266 publisher = {Springer} 19267} 19268 19269@Article{ borzi2003multigrid, 19270 title = {Multigrid methods for parabolic distributed optimal control problems}, 19271 author = {Borz{\`i}, A.}, 19272 journal = {Journal of Computational and Applied Mathematics}, 19273 volume = {157}, 19274 number = {2}, 19275 pages = {365--382}, 19276 year = {2003}, 19277 publisher = {Elsevier} 19278} 19279 19280@Article{ ito2002receding, 19281 title = {Receding horizon optimal control for infinite dimensional systems}, 19282 author = {Ito, K. and Kunisch, K.}, 19283 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 19284 volume = {8}, 19285 number = {1}, 19286 pages = {741--760}, 19287 year = {2002}, 19288 publisher = {Cambridge University Press} 19289} 19290 19291@Article{ schulz1998solving, 19292 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 19293 author = {Schulz, V.H.}, 19294 journal = {Computing and Visualization in Science}, 19295 volume = {1}, 19296 number = {2}, 19297 pages = {83--96}, 19298 year = {1998}, 19299 publisher = {Springer} 19300} 19301 19302@Article{ hazra2005aerodynamic, 19303 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 19304 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 19305 journal = {Journal of Computational Physics}, 19306 volume = {204}, 19307 number = {1}, 19308 pages = {46--64}, 19309 year = {2005}, 19310 publisher = {Elsevier} 19311} 19312 19313@Article{ mandel1985multilevel, 19314 title = {On multilevel iterative methods for integral equations of the second kind and 19315 related problems}, 19316 author = {Mandel, J.}, 19317 journal = {Numerische Mathematik}, 19318 volume = {46}, 19319 number = {1}, 19320 pages = {147--157}, 19321 year = {1985}, 19322 publisher = {Springer} 19323} 19324 19325@Article{ king1992multilevel, 19326 title = {Multilevel algorithms for ill-posed problems}, 19327 author = {King, J.T.}, 19328 journal = {Numerische Mathematik}, 19329 volume = {61}, 19330 number = {1}, 19331 pages = {311--334}, 19332 year = {1992}, 19333 publisher = {Springer} 19334} 19335 19336@Article{ kaltenbacher2001regularizing, 19337 title = {On the regularizing properties of a full multigrid method for ill-posed 19338 problems}, 19339 author = {Kaltenbacher, B.}, 19340 journal = {Inverse Problems}, 19341 volume = {17}, 19342 pages = {767}, 19343 year = {2001}, 19344 publisher = {IOP Publishing} 19345} 19346 19347@Article{ kaltenbacher2002multi, 19348 title = {A multi-grid method with a priori and a posteriori level choice for the 19349 regularization of nonlinear ill-posed problems}, 19350 author = {Kaltenbacher, B. and Schicho, J.}, 19351 journal = {Numerische Mathematik}, 19352 volume = {93}, 19353 number = {1}, 19354 pages = {77--107}, 19355 year = {2002}, 19356 publisher = {Springer} 19357} 19358 19359@Article{ burger2006regularizing, 19360 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 19361 author = {Burger, M. and Kaltenbacher, B.}, 19362 journal = {SIAM Journal on Numerical Analysis}, 19363 volume = {44}, 19364 pages = {153}, 19365 year = {2006} 19366} 19367 19368@Article{ draganescu2008optimal, 19369 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 19370 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 19371 journal = {Mathematics of Computation}, 19372 volume = {77}, 19373 number = {264}, 19374 pages = {2001--2038}, 19375 year = {2008} 19376} 19377 19378@Article{ bastian1998additive, 19379 title = {Additive and multiplicative multi-grid---a comparison}, 19380 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 19381 journal = {Computing}, 19382 volume = {60}, 19383 number = {4}, 19384 pages = {345--364}, 19385 year = {1998}, 19386 publisher = {Springer} 19387} 19388 19389@Article{ fournier2001multiplicative, 19390 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 19391 compressible flow computations on unstructured meshes}, 19392 author = {Fournier, L. and Lanteri, S.}, 19393 journal = {Applied Numerical Mathematics}, 19394 volume = {36}, 19395 number = {4}, 19396 pages = {401--426}, 19397 year = {2001}, 19398 publisher = {Elsevier} 19399} 19400 19401@Article{ chow2006survey, 19402 title = {A survey of parallelization techniques for multigrid solvers}, 19403 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 19404 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 19405 Simon, eds}, 19406 volume = {20}, 19407 pages = {179--201}, 19408 year = {2006} 19409} 19410 19411@InBook{ brandt2001multiscale, 19412 title = {Multiscale scientific computation: {R}eview 2001}, 19413 author = {Brandt, A.}, 19414 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 19415 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 19416 series = {Lecture Notes in Computational Science and Engineering}, 19417 year = {2001}, 19418 volume = {20}, 19419 pages = {3--96}, 19420 publisher = {Springer Verlag} 19421} 19422 19423@InCollection{ brandt2003multigrid, 19424 title = {Multigrid solvers and multilevel optimization strategies}, 19425 author = {Brandt, A. and Ron, D.}, 19426 booktitle = {Multilevel Optimization and VLSICAD}, 19427 editors = {J. Cong and J.R. Shinnerl}, 19428 pages = {1--69}, 19429 publisher = {Kluwer Academic Publishers}, 19430 year = {2003} 19431} 19432 19433@InBook{ brandt2009principles, 19434 title = {Principles of systematic upscaling}, 19435 author = {Brandt, A.}, 19436 booktitle = {Bridging the Scales in Science and Engineering}, 19437 editors = {J. Fish}, 19438 publisher = {Oxford University Press}, 19439 pages = {193--215}, 19440 year = {2009} 19441} 19442 19443@Article{ livne2004coarsening, 19444 title = {Coarsening by compatible relaxation}, 19445 author = {Livne, O.E.}, 19446 journal = {Numerical Linear Algebra with Applications}, 19447 volume = {11}, 19448 number = {2-3}, 19449 pages = {205--227}, 19450 year = {2004}, 19451 publisher = {Wiley Online Library} 19452} 19453 19454@InProceedings{ brandt1986stochastic, 19455 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 19456 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 19457 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 19458 Methods, held at Cologne, October 1-4, 1985}, 19459 volume = {1228}, 19460 pages = {65--98}, 19461 year = {1986}, 19462 organization = {Springer} 19463} 19464 19465@Article{ halko2011finding, 19466 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 19467 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 19468 Approximate Matrix Decompositions}, 19469 journal = {SIAM Review}, 19470 volume = {53}, 19471 number = {2}, 19472 year = {2011}, 19473 pages = {217-288}, 19474 doi = {10.1137/090771806} 19475} 19476 19477@InProceedings{ mhdy09, 19478 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 19479 booktitle = {Proceedings of SC09}, 19480 organization = {ACM}, 19481 title = {Minimizing communication in sparse matrix solvers}, 19482 doi = {10.1145/1654059.1654096}, 19483 year = {2009} 19484} 19485 19486@InProceedings{ vanrosendale83, 19487 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 19488 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 19489 author = {J. van Rosendale}, 19490 year = {1983}, 19491 publisher = {IEEE Computer Society} 19492} 19493 19494@PhDThesis{ vuduc95, 19495 title = {Quantitative performance modeling of scientific computations and creating 19496 locality in numerical algorithms}, 19497 author = {R. Vuduc}, 19498 journal = {Massachusetts Institute of Technology}, 19499 school = {Massachusetts Institute of Technology}, 19500 year = {1995} 19501} 19502 19503@Article{ simoncini2003flexible, 19504 title = {Flexible inner-outer {Krylov} subspace methods}, 19505 author = {Simoncini, V. and Szyld, D.B.}, 19506 journal = {SIAM Journal on Numerical Analysis}, 19507 pages = {2219--2239}, 19508 year = {2003}, 19509 publisher = {JSTOR} 19510} 19511 19512@Article{ parks2006recycling, 19513 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 19514 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 19515 journal = {SIAM Journal on Scientific Computing}, 19516 volume = {28}, 19517 number = {5}, 19518 pages = {1651--1674}, 19519 year = {2006}, 19520 publisher = {Society for Industrial and Applied Mathematics} 19521} 19522 19523@Article{ freund2003model, 19524 title = {Model reduction methods based on Krylov subspaces}, 19525 author = {Freund, R.W.}, 19526 journal = {Acta Numerica}, 19527 volume = {12}, 19528 number = {1}, 19529 pages = {267--319}, 19530 year = {2003}, 19531 publisher = {Cambridge Univ Press} 19532} 19533 19534@InBook{ gutknecht2006block, 19535 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 19536 an introduction}, 19537 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 19538 author = {Gutknecht, M.H.}, 19539 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 19540 publisher = {Anamaya Publishers}, 19541 location = {New Delhi}, 19542 pages = {420-447}, 19543 year = {2006} 19544} 19545 19546@Article{ moulton1998black, 19547 title = {The black box multigrid numerical homogenization algorithm}, 19548 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 19549 journal = {Journal of Computational Physics}, 19550 volume = {142}, 19551 number = {1}, 19552 pages = {80--108}, 19553 year = {1998}, 19554 publisher = {Elsevier} 19555} 19556 19557@Article{ neuss2001homogenization, 19558 title = {Homogenization and multigrid}, 19559 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 19560 journal = {Computing}, 19561 volume = {66}, 19562 number = {1}, 19563 pages = {1--26}, 19564 year = {2001}, 19565 publisher = {Springer} 19566} 19567 19568@Article{ bai2002krylov, 19569 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 19570 systems}, 19571 author = {Bai, Z.}, 19572 journal = {Applied Numerical Mathematics}, 19573 volume = {43}, 19574 number = {1}, 19575 pages = {9--44}, 19576 year = {2002}, 19577 publisher = {Elsevier} 19578} 19579 19580@InProceedings{ dong2003piecewise, 19581 title = {Piecewise polynomial nonlinear model reduction}, 19582 author = {Dong, N. and Roychowdhury, J.}, 19583 booktitle = {Design Automation Conference, 2003. Proceedings}, 19584 pages = {484--489}, 19585 year = {2003}, 19586 organization = {IEEE} 19587} 19588 19589@Article{ bond2009stable, 19590 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 19591 approximation and projection}, 19592 author = {Bond, B.N. and Daniel, L.}, 19593 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 19594 volume = {28}, 19595 number = {10}, 19596 pages = {1467--1480}, 19597 year = {2009}, 19598 publisher = {IEEE} 19599} 19600 19601@Article{ xin2000front, 19602 title = {Front Propagation in Heterogeneous Media}, 19603 author = {Xin, J.}, 19604 journal = {SIAM Review}, 19605 volume = {42}, 19606 number = {2}, 19607 pages = {161--230}, 19608 year = {2000}, 19609 publisher = {Society for Industrial and Applied Mathematics} 19610} 19611 19612@Article{ owhadi2011localized, 19613 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 19614 Nonseparated Scales and High Contrast}, 19615 author = {Owhadi, H. and Zhang, L.}, 19616 journal = {Multiscale Modeling and Simulation}, 19617 volume = {9}, 19618 pages = {1373}, 19619 year = {2011} 19620} 19621 19622@Article{ berlyand2010flux, 19623 title = {Flux norm approach to finite dimensional homogenization approximations with 19624 non-separated scales and high contrast}, 19625 author = {Berlyand, L. and Owhadi, H.}, 19626 journal = {Archive for rational mechanics and analysis}, 19627 volume = {198}, 19628 number = {2}, 19629 pages = {677--721}, 19630 year = {2010}, 19631 publisher = {Springer} 19632} 19633 19634@Article{ babuska2011optimal, 19635 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 19636 Application to Multiscale Problems}, 19637 author = {Babuska, I. and Lipton, R.}, 19638 journal = {Multiscale Modeling \& Simulation}, 19639 volume = {9}, 19640 pages = {373}, 19641 year = {2011} 19642} 19643 19644@Article{ boettinger2002phase, 19645 title = {Phase-Field Simulation of Solidification}, 19646 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 19647 journal = {Annual review of materials research}, 19648 volume = {32}, 19649 number = {1}, 19650 pages = {163--194}, 19651 year = {2002}, 19652 publisher = {Annual Reviews} 19653} 19654 19655@Article{ karma1998quantitative, 19656 title = {Quantitative phase-field modeling of dendritic growth in two and three 19657 dimensions}, 19658 author = {Karma, A. and Rappel, W.J.}, 19659 journal = {Physical Review E}, 19660 volume = {57}, 19661 number = {4}, 19662 pages = {4323}, 19663 year = {1998}, 19664 publisher = {APS} 19665} 19666 19667@Article{ chen2002phase, 19668 title = {Phase-field models for microstructure evolution}, 19669 author = {Chen, L.Q.}, 19670 journal = {Annual review of materials research}, 19671 volume = {32}, 19672 number = {1}, 19673 pages = {113--140}, 19674 year = {2002}, 19675 publisher = {Annual Reviews} 19676} 19677 19678@Article{ galbally2010reductionuq, 19679 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 19680 problems}, 19681 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 19682 journal = {International journal for numerical methods in engineering}, 19683 volume = {81}, 19684 number = {12}, 19685 pages = {1581--1608}, 19686 year = {2010}, 19687 publisher = {Wiley Online Library} 19688} 19689 19690@Article{ griebel1995abstract, 19691 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 19692 author = {Griebel, M. and Oswald, P.}, 19693 journal = {Numerische Mathematik}, 19694 volume = {70}, 19695 number = {2}, 19696 pages = {163--180}, 19697 year = {1995}, 19698 publisher = {Springer} 19699} 19700 19701@InProceedings{ voutchkov2006multiobjective, 19702 title = {Multiobjective optimization using surrogates}, 19703 author = {Voutchkov, I. and Keane, A.J.}, 19704 booktitle = {Adaptive Computing in Design and Manufacture}, 19705 pages = {167--175}, 19706 year = {2006}, 19707 publisher = {The MC Escher Company} 19708} 19709 19710@Article{ leary2001constraint, 19711 title = {A constraint mapping approach to the structural optimization of an expensive 19712 model using surrogates}, 19713 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 19714 journal = {Optimization and Engineering}, 19715 volume = {2}, 19716 number = {4}, 19717 pages = {385--398}, 19718 year = {2001}, 19719 publisher = {Springer} 19720} 19721 19722@InProceedings{ legresley2000airfoil, 19723 title = {Airfoil design optimization using reduced order models based on proper orthogonal 19724 decomposition}, 19725 author = {LeGresley, P.A. and Alonso, J.J.}, 19726 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 19727 year = {2000} 19728} 19729 19730@Book{ myers2009response, 19731 title = {Response surface methodology: process and product optimization using designed 19732 experiments}, 19733 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 19734 volume = {705}, 19735 year = {2009}, 19736 publisher = {John Wiley \& Sons} 19737} 19738 19739@Article{ carlberg2012gnat, 19740 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 19741 application to computational fluid dynamics and turbulent flows}, 19742 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 19743 journal = {arXiv}, 19744 volume = {1207.1349}, 19745 year = {2012} 19746} 19747 19748@Article{ biros2008multilevel, 19749 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 19750 author = {Biros, G. and Dogan, G.}, 19751 journal = {Inverse Problems}, 19752 volume = {24}, 19753 pages = {034010}, 19754 year = {2008}, 19755 publisher = {IOP Publishing} 19756} 19757 19758@Article{ rees2010optimal, 19759 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 19760 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 19761 journal = {SIAM Journal on Scientific Computing}, 19762 volume = {32}, 19763 pages = {271}, 19764 year = {2010} 19765} 19766 19767@Article{ rees2010block, 19768 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 19769 author = {Rees, T. and Stoll, M.}, 19770 journal = {Numerical Linear Algebra with Applications}, 19771 volume = {17}, 19772 number = {6}, 19773 pages = {977--996}, 19774 year = {2010}, 19775 publisher = {Wiley Online Library} 19776} 19777 19778@Article{ rees2011preconditioning, 19779 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 19780 Equations}, 19781 author = {Rees, T. and Wathen, A.J.}, 19782 journal = {SIAM Journal on Scientific Computing}, 19783 volume = {33}, 19784 number = {5}, 19785 pages = {2903--2926}, 19786 year = {2011}, 19787 publisher = {Society for Industrial and Applied Mathematics} 19788} 19789 19790@Article{ vogel2007fbicg, 19791 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19792 author = {Vogel,J.A.}, 19793 journal = {Applied Mathematics and Computation}, 19794 volume = {188}, 19795 number = {1}, 19796 pages = {226–-233}, 19797 year = {2007}, 19798 publisher = {Elsevier} 19799} 19800 19801@Unpublished{ leehammond2010, 19802 author = {B. Lee and G.E. Hammond}, 19803 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 19804 Equation}, 19805 key = {multigrid}, 19806 note = {manuscript, 2010} 19807} 19808 19809@Article{ vandeneshop2004inexact, 19810 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 19811 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 19812 journal = {SIAM Journal on Matrix Analysis and Applications}, 19813 volume = {26}, 19814 number = {1}, 19815 pages = {125--153}, 19816 year = {2004} 19817} 19818 19819@Article{ fbicg.fbcgs, 19820 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19821 author = {Judith A. Vogel}, 19822 journal = {Applied Mathematics and Computation}, 19823 volume = {188}, 19824 number = {1}, 19825 pages = {226--233}, 19826 year = {2007} 19827} 19828 19829@Article{ simoncini2003inexact, 19830 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 19831 Computing}, 19832 author = {Valeria Simoncini and Daniel B. Szyld}, 19833 journal = {SIAM Journal on Scientific Computing}, 19834 volume = {25}, 19835 number = {2}, 19836 pages = {454--477}, 19837 year = {2003} 19838} 19839 19840@Article{ fqmr, 19841 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 19842 author = {Daniel B. Szyld and Judith A. Vogel}, 19843 journal = {SIAM Journal on Scientific Computing}, 19844 volume = {23}, 19845 number = {2}, 19846 pages = {363--380}, 19847 year = {2001} 19848} 19849 19850@Article{ ipcg, 19851 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 19852 author = {Gene H. Golub and Qiang Ye}, 19853 journal = {SIAM Journal on Scientific Computing}, 19854 volume = {21}, 19855 number = {4}, 19856 pages = {1305--1320}, 19857 year = {1999} 19858} 19859 19860@Article{ idr.sonneveld, 19861 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 19862 Systems of Linear Equations}, 19863 author = {Peter Sonneveld and Martin B. van Gijzen}, 19864 journal = {SIAM Journal on Scientific Computing}, 19865 volume = {31}, 19866 number = {2}, 19867 pages = {1035--1062}, 19868 year = {2008} 19869} 19870 19871@Article{ flexiblecg, 19872 title = {Flexible Conjugate Gradients}, 19873 author = {Yvan Notay}, 19874 journal = {SIAM Journal on Scientific Computing}, 19875 volume = {22}, 19876 number = {4}, 19877 pages = {1444--1460}, 19878 year = {2000} 19879} 19880 19881@Article{ generalizedcg, 19882 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 19883 Variable-Step Preconditioning}, 19884 author = {O. Axelsson and P. S. Vassilevski}, 19885 journal = {SIAM Journal on Matrix Analysis and Applications}, 19886 volume = {12}, 19887 number = {4}, 19888 pages = {625--644}, 19889 year = {1991} 19890} 19891 19892@Article{ bicg, 19893 title = {{Conjugate Gradient} methods for indefinite systems}, 19894 author = {R. Fletcher}, 19895 journal = {Lecture Notes in Mathematics}, 19896 volume = {506}, 19897 pages = {73--89}, 19898 year = {1976} 19899} 19900 19901@Article{ idr.bcgs, 19902 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 19903 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 19904 journal = {Applied Numerical Mathematics}, 19905 volume = {60}, 19906 pages = {1100--1114}, 19907 year = {2010} 19908} 19909 19910@Article{ idr.bcgsl, 19911 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 19912 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 19913 journal = {SIAM J. Sci. Comput.}, 19914 volume = {32}, 19915 number = {5}, 19916 pages = {2687--2709}, 19917 year = {2010} 19918} 19919 19920@Article{ idr.min.sync, 19921 title = {Minimizing synchronization in {IDR(s)}}, 19922 author = {T.P. Collignon and M.B. van Gijzen}, 19923 journal = {Numerical Linear Algebra with Applications}, 19924 volume = {18}, 19925 number = {5}, 19926 pages = {805--825}, 19927 year = {2011} 19928} 19929 19930@TechReport{ flexible.idr, 19931 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 19932 Sparse Linear Systems}, 19933 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 19934 institution = {Delft University of Technology}, 19935 number = {11-06}, 19936 year = {2011} 19937} 19938 19939@Article{ vangenuchten1980, 19940 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 19941 Soils}, 19942 author = {M. Th. van Genuchten}, 19943 journal = {Soil Science Society of America Journal}, 19944 volume = {44}, 19945 pages = {892--898}, 19946 year = {1980} 19947} 19948 19949@Article{ gmresr94, 19950 title = {{GMRESR}: a family of nested {GMRES} methods}, 19951 author = {H. A. Van der Vorst and C. Vuik}, 19952 journal = {Numerical Linear Algebra with Applications}, 19953 volume = {1}, 19954 number = {4}, 19955 pages = {369--386}, 19956 year = {1994} 19957} 19958 19959@Article{ knepley10, 19960 author = {Matthew G. Knepley}, 19961 title = {Removing the Barrier to Scalability in Parallel FMM}, 19962 journal = {CoRR}, 19963 volume = {abs/1008.2410}, 19964 note = {\url{http://arxiv.org/abs/1008.2410}}, 19965 year = {2010} 19966} 19967 19968@Article{ teng1998, 19969 author = {Shang-Hua Teng}, 19970 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 19971 N-Body Simulation}, 19972 journal = {SIAM J. Sci. Comput.}, 19973 volume = {19}, 19974 number = {2}, 19975 month = mar, 19976 pages = {635--656}, 19977 year = {1998}, 19978 issn = {1064-8275}, 19979 numpages = {22}, 19980 doi = {10.1137/S1064827595288942}, 19981 acmid = {289842}, 19982 issue_date = {March 1998}, 19983 publisher = {Society for Industrial and Applied Mathematics}, 19984 address = {Philadelphia, PA}, 19985 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 19986 parallel processing, partitioning, scientific computing, the fast multipole 19987 method, tree-codes} 19988} 19989 19990@InProceedings{ skinnerkramer05, 19991 author = {David Skinner and William Kramer}, 19992 title = {Understanding the causes of performance variability in HPC workloads}, 19993 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 19994 International}, 19995 organization = {IEEE}, 19996 pages = {137--149}, 19997 year = {2005} 19998} 19999 20000@Article{ notay_2000, 20001 author = {Yvan Notay}, 20002 title = {Flexible {Conjugate Gradients}}, 20003 journal = {SIAM Journal on Scientific Computing}, 20004 volume = {22}, 20005 number = {4}, 20006 year = {2000}, 20007 pages = {1444--1460} 20008} 20009 20010@Article{ bereux1996, 20011 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 20012 computations}, 20013 author = {Fran{\c{c}}ois B{\'e}reux}, 20014 journal = {Computer Methods in Applied Mechanics and Engineering}, 20015 volume = {133}, 20016 number = {1-2}, 20017 pages = {93--124}, 20018 year = {1996} 20019} 20020 20021@Article{ pawlowski2006globalization, 20022 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 20023 fully coupled solution of the {N}avier-{S}tokes equations}, 20024 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 20025 journal = {SIAM Review}, 20026 volume = {48}, 20027 number = {4}, 20028 pages = {700--721}, 20029 year = {2006}, 20030 publisher = {SIAM} 20031} 20032 20033@Article{ roppshadid2009, 20034 title = {Stability of operator splitting methods for systems with indefinite operators: 20035 Advection--diffusion--reaction systems}, 20036 author = {David L Ropp and John N Shadid}, 20037 journal = {Journal of Computational Physics}, 20038 volume = {228}, 20039 number = {9}, 20040 pages = {3508--3516}, 20041 year = {2009} 20042} 20043 20044@Article{ brown1985experiments, 20045 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 20046 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 20047 journal = {SIAM Journal on Scientific and Statistical Computing}, 20048 volume = {6}, 20049 number = {2}, 20050 pages = {297--313}, 20051 year = {1985}, 20052 publisher = {SIAM} 20053} 20054 20055@Article{ bicgsl_1993, 20056 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 20057 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 20058 Spectrum}, 20059 journal = {Electronic Transactions on Numerical Analysis}, 20060 volume = {1}, 20061 year = {1993}, 20062 pages = {11--32} 20063} 20064 20065@Book{ brandt2011revised, 20066 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 20067 Edition}, 20068 author = {Achi Brandt and Oren Livne}, 20069 year = {2011}, 20070 publisher = {SIAM} 20071} 20072 20073@Article{ axelsson1990algebraic, 20074 title = {Algebraic multilevel preconditioning methods, {II}}, 20075 author = {Axelsson, O. and Vassilevski, P.S.}, 20076 journal = {SIAM Journal on Numerical Analysis}, 20077 volume = {27}, 20078 number = {6}, 20079 pages = {1569--1590}, 20080 year = {1990}, 20081 publisher = {SIAM} 20082} 20083 20084@Article{ zulehner2002analysis, 20085 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 20086 author = {Zulehner, W.}, 20087 journal = {Mathematics of computation}, 20088 volume = {71}, 20089 number = {238}, 20090 pages = {479--506}, 20091 year = {2002} 20092} 20093 20094@Article{ pralet2010, 20095 author = {L. Giraud and A. Haidar and S. Pralet}, 20096 title = {Using multiple levels of parallelism to enhance the performance of domain 20097 decomposition solvers}, 20098 journal = {Parallel Computing}, 20099 volume = {36}, 20100 number = {5-6}, 20101 pages = {285--296}, 20102 year = {2010} 20103} 20104 20105@Book{ brennerscottfem, 20106 title = {The Mathematical Theory of Finite Element Methods}, 20107 author = {Susanne C. Brenner and L. Ridgway Scott}, 20108 edition = {3rd Edition}, 20109 series = {Texts in Applied Mathematics}, 20110 year = {2008}, 20111 publisher = {Springer-Verlag} 20112} 20113 20114@Book{ ortega1987iterative, 20115 title = {Iterative solution of nonlinear equations in several variables}, 20116 author = {Ortega, James M and Rheinboldt, Werner C}, 20117 volume = {30}, 20118 publisher = {Society for Industrial and Applied Mathematics}, 20119 year = {1987} 20120} 20121 20122@InBook{ rheinboldtch6, 20123 author = {Werner C. Rheinboldt}, 20124 title = {6. Combinations of Processes}, 20125 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 20126 chapter = {6}, 20127 pages = {59--74}, 20128 doi = {10.1137/1.9781611970012.ch6}, 20129 year = {1998} 20130} 20131 20132@Article{ allgowerbohmerpotrarheinboldt86, 20133 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 20134 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 20135 journal = {SIAM Journal on Numerical Analysis}, 20136 volume = {23}, 20137 number = {1}, 20138 pages = {160-169}, 20139 year = {1986}, 20140 doi = {10.1137/0723011} 20141} 20142 20143@Article{ rheinboldt76, 20144 author = {Werner C. Rheinboldt}, 20145 title = {On measures of ill-conditioning for nonlinear equations}, 20146 journal = {Mathematics of Computation}, 20147 volume = {30}, 20148 number = {133}, 20149 pages = {104--111}, 20150 year = {1976} 20151} 20152 20153@Article{ little61, 20154 author = {John D. C. Little}, 20155 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 20156 journal = {Operations Research}, 20157 volume = {9}, 20158 number = {3}, 20159 pages = {383--387}, 20160 note = {\url{http://www.jstor.org/stable/167570}}, 20161 year = {1961} 20162} 20163 20164@Misc{ top500, 20165 author = {{TOP500 Supercomputer Sites}}, 20166 url = {http://www.top500.org}, 20167 year = {2013} 20168} 20169 20170@Misc{ hassediagram, 20171 author = {Wikipedia}, 20172 title = {Hasse Diagram}, 20173 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 20174 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 20175 year = {2015} 20176} 20177 20178@Misc{ groupoid, 20179 author = {Wikipedia}, 20180 title = {Groupoid}, 20181 url = {https://en.wikipedia.org/wiki/Groupoid}, 20182 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 20183 year = {2015} 20184} 20185 20186@Misc{ cwcomplex, 20187 author = {Wikipedia}, 20188 title = {{CW} complex}, 20189 url = {http://en.wikipedia.org/wiki/CW_complex}, 20190 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 20191 year = {2015} 20192} 20193 20194@Misc{ linearalgebra, 20195 author = {Wikipedia}, 20196 title = {Linear Algebra}, 20197 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 20198 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 20199 year = {2015} 20200} 20201 20202@Misc{ amdahlslaw, 20203 author = {Wikipedia}, 20204 title = {Amdahl's Law}, 20205 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 20206 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 20207 year = {2015} 20208} 20209 20210@Misc{ gustafsonslaw, 20211 author = {Wikipedia}, 20212 title = {Gustafson's Law}, 20213 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 20214 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 20215 year = {2015} 20216} 20217 20218@InProceedings{ amdahl1967, 20219 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 20220 Capabilities}, 20221 author = {Gene M. Amdahl}, 20222 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 20223 series = {AFIPS '67 (Spring)}, 20224 location = {Atlantic City, New Jersey}, 20225 pages = {483--485}, 20226 numpages = {3}, 20227 doi = {10.1145/1465482.1465560}, 20228 acmid = {1465560}, 20229 publisher = {ACM}, 20230 address = {New York, NY, USA}, 20231 year = {1967} 20232} 20233 20234@Article{ gustafson1988, 20235 title = {Reevaluating {Amdahl}'s Law}, 20236 author = {Gustafson, John L.}, 20237 journal = {Communications of the ACM}, 20238 volume = {31}, 20239 number = {5}, 20240 month = may, 20241 issn = {0001-0782}, 20242 pages = {532--533}, 20243 doi = {10.1145/42411.42415}, 20244 acmid = {42415}, 20245 year = {1988} 20246} 20247 20248@Book{ eijkhout2014, 20249 title = {Introduction to High Performance Scientific Computing}, 20250 author = {Victor Eijkhout}, 20251 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 20252 publisher = {TACC}, 20253 year = {2014} 20254} 20255 20256@Article{ korelc2002multilanguage, 20257 title = {Multi-language and multi-environment generation of nonlinear finite element 20258 codes}, 20259 author = {Korelc, J.}, 20260 journal = {Engineering with Computers}, 20261 volume = {18}, 20262 number = {4}, 20263 pages = {312--327}, 20264 year = {2002}, 20265 publisher = {Springer} 20266} 20267 20268@TechReport{ taylor2011feap, 20269 title = {{FEAP}: A Finite Element Analysis Program}, 20270 subtitle = {Version 8.3 User Manual}, 20271 author = {R. L. Taylor}, 20272 year = {2011}, 20273 institution = {University of California, Berkeley} 20274} 20275 20276@Article{ bergeraftosmismurman2005, 20277 title = {Analysis of slope limiters on irregular grids}, 20278 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 20279 journal = {AIAA paper}, 20280 volume = {490}, 20281 pages = {2005}, 20282 year = {2005} 20283} 20284 20285@InProceedings{ ferreirabridgesbrightwell08, 20286 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 20287 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 20288 Noise Injection}, 20289 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 20290 series = {SC '08}, 20291 year = {2008}, 20292 isbn = {978-1-4244-2835-9}, 20293 location = {Austin, Texas}, 20294 pages = {19:1--19:12}, 20295 articleno = {19}, 20296 numpages = {12}, 20297 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 20298 acmid = {1413390}, 20299 publisher = {IEEE Press}, 20300 address = {Piscataway, NJ} 20301} 20302 20303@Article{ banach22, 20304 author = {Stefan Banach}, 20305 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 20306 \'equations int\'egrales}, 20307 journal = {Fund. Math.}, 20308 volume = {3}, 20309 pages = {133--181}, 20310 year = {1922} 20311} 20312 20313@Article{ bangerthbursteddeheisterkronbichler2012, 20314 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 20315 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 20316 Element Codes}, 20317 journal = {ACM Trans. Math. Softw.}, 20318 issue_date = {December 2011}, 20319 volume = {38}, 20320 number = {2}, 20321 month = jan, 20322 year = {2012}, 20323 issn = {0098-3500}, 20324 pages = {14:1--14:28}, 20325 articleno = {14}, 20326 numpages = {28}, 20327 doi = {10.1145/2049673.2049678}, 20328 acmid = {2049678}, 20329 publisher = {ACM}, 20330 address = {New York, NY, USA}, 20331 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 20332 design} 20333} 20334 20335@Article{ eisenstatwalker1994, 20336 author = {Stanley Eisenstat and Homer Walker}, 20337 title = {Globally Convergent Inexact {N}ewton Methods}, 20338 journal = {SIAM Journal on Optimization}, 20339 volume = {4}, 20340 number = {2}, 20341 pages = {393--422}, 20342 year = {1994}, 20343 doi = {10.1137/0804022} 20344} 20345 20346@Book{ blumcuckershubsmale98, 20347 title = {Complexity and Real Computation}, 20348 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 20349 year = {1998}, 20350 publisher = {Springer} 20351} 20352 20353@Article{ caili2011, 20354 author = {Cai, X.-C. and Li, X.}, 20355 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 20356 Elimination for Problems with High Local Nonlinearity}, 20357 journal = {SIAM Journal on Scientific Computing}, 20358 volume = {33}, 20359 number = {2}, 20360 pages = {746-762}, 20361 year = {2011}, 20362 doi = {10.1137/080736272} 20363} 20364 20365@Article{ cai2009, 20366 author = {X.-C. Cai}, 20367 title = { Nonlinear overlapping domain decomposition methods}, 20368 journal = {Lecture Notes in Computational Science}, 20369 volume = {70}, 20370 pages = {217-224}, 20371 year = {2009} 20372} 20373 20374@Article{ lanzkronrosewilkes1996, 20375 title = {An analysis of approximate nonlinear elimination}, 20376 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 20377 journal = {SIAM Journal on Scientific Computing}, 20378 volume = {17}, 20379 number = {2}, 20380 pages = {538--559}, 20381 year = {1996}, 20382 publisher = {SIAM} 20383} 20384 20385@TechReport{ gropp1993sowing, 20386 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 20387 author = {Gropp, W}, 20388 year = {1995}, 20389 number = {ANL/MCS-TM-208}, 20390 institution = {Argonne National Laboratory} 20391} 20392 20393@TechReport{ gropp1993sowing2, 20394 title = {Users Manual for doctext: Producing Documentation from Source Code}, 20395 author = {Gropp, W}, 20396 year = {1995}, 20397 number = {ANL/MCS-TM-206}, 20398 institution = {Argonne National Laboratory} 20399} 20400 20401@TechReport{ gropp1993simplified, 20402 title = {Simplified Linear Equation Solvers users manual}, 20403 author = {Gropp, W and Smith, B}, 20404 year = {1993}, 20405 number = {ANL--93/8}, 20406 institution = {Argonne National Laboratory} 20407} 20408 20409@Misc{ simplifiedbsd, 20410 author = {{University of California, Berkeley}}, 20411 title = {Simplified {Berkeley} Software Distribution License}, 20412 note = {see 20413 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 20414} 20415 20416@Book{ chaconstraub14, 20417 author = {Scott Chacon and Ben Straub}, 20418 title = {Pro Git}, 20419 publisher = {Apress}, 20420 year = {2014}, 20421 pages = {456}, 20422 note = {Available online at \url{http://git-scm.com/book/}} 20423} 20424 20425@Misc{ bitbucket, 20426 author = {Atlassian}, 20427 title = {Bitbucket}, 20428 note = {Platform available from \url{http://bitbucket.org}} 20429} 20430 20431@Misc{ gitworkflows, 20432 author = {GitWorkflows}, 20433 note = {Available at 20434 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 20435} 20436 20437@Misc{ figshare, 20438 author = {FigShare}, 20439 note = {Available at \url{http://palgrave.figshare.com/}} 20440} 20441 20442@InProceedings{ beazley1996swig, 20443 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 20444 {C++}}, 20445 author = {Beazley, David M}, 20446 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 20447 pages = {129--139}, 20448 year = {1996} 20449} 20450 20451@Misc{ softwareproductivityworkshopreport14, 20452 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 20453 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 20454 title = {Software Productivity for Extreme-Scale Science}, 20455 note = {Report on DOE Workshop, January 13-14, 2014}, 20456 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 20457 year = {2014} 20458} 20459 20460@Misc{ softwareproductivitywhitepaper13, 20461 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 20462 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 20463 Tang}, 20464 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 20465 Capability of Extreme-Scale Computing}, 20466 note = {whitepaper submitted to DOE, available via 20467 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 20468 year = {2013} 20469} 20470 20471@Misc{ ideas:project, 20472 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 20473 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 20474 howpublished = {\url{http://ideas-productivity.org}}, 20475 year = {2015} 20476} 20477 20478@TechReport{ keyesmcinneswoodwardetal2012, 20479 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 20480 and B. Sheehan}, 20481 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 20482 institution = {Argonne National Laboratory}, 20483 number = {ANL/MCS-TM-330}, 20484 month = oct, 20485 year = {2012} 20486} 20487 20488@Misc{ sawsfs-web-page, 20489 author = {Surtai Han and Barry Smith and Hong Zhang}, 20490 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 20491 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 20492 year = {2015} 20493} 20494 20495@Misc{ sawshk-web-page, 20496 author = {Surtai Han and Barry Smith and Hong Zhang}, 20497 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 20498 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 20499 year = {2015} 20500} 20501 20502@Misc{ sawsnestk-web-page, 20503 author = {Surtai Han and Barry Smith and Hong Zhang}, 20504 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 20505 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 20506 year = {2015} 20507} 20508 20509@Misc{ m2acs:project, 20510 author = {M. {Anitescu et al.}}, 20511 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 20512 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 20513 year = {2015} 20514} 20515 20516@Misc{ hssmn13, 20517 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 20518 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 20519 Developing Mathematical Libraries and Simulation Codes}, 20520 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 20521 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 20522 year = {2013} 20523} 20524 20525@Misc{ atpesc:website, 20526 key = {{Argonne Training Program for Extreme-Scale Computing}}, 20527 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 20528 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 20529 year = {2018} 20530} 20531 20532@Article{ barraultmadaynguyenpatera2004, 20533 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 20534 title = {An empirical interpolation method: application to efficient reduced-basis 20535 discretization of partial differential equations}, 20536 journal = {Comptes Rendus Mathematique}, 20537 volume = {339}, 20538 number = {9}, 20539 pages = {667--672}, 20540 year = {2004}, 20541 issn = {1631-073X}, 20542 doi = {10.1016/j.crma.2004.08.006} 20543} 20544 20545@Article{ simongogotsi08, 20546 title = {Materials for electrochemical capacitors}, 20547 author = {Patrice Simon and Yury Gogotsi}, 20548 journal = {Nature Materials}, 20549 volume = {7}, 20550 number = {11}, 20551 pages = {845--854}, 20552 year = {2008}, 20553 doi = {10.1038/nmat2297} 20554} 20555 20556@Article{ vladsinghrollandmelinteajayangohy14, 20557 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 20558 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 20559 Gohy}, 20560 journal = {Scientific Reports}, 20561 volume = {4}, 20562 year = {2014}, 20563 doi = {10.1038/srep04315} 20564} 20565 20566@Article{ lichengshashurinkeidar12, 20567 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 20568 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 20569 journal = {Graphene}, 20570 volume = {1}, 20571 number = {1}, 20572 pages = {1--13}, 20573 year = {2012}, 20574 doi = {10.4236/graphene.2012.11001} 20575} 20576 20577@Article{ miller07, 20578 title = {A Brief History of Supercapacitors}, 20579 author = {John R. Miller}, 20580 journal = {Battery and Energy Storage Technology}, 20581 pages = {61--78}, 20582 year = {2007} 20583} 20584 20585@Book{ deshpande14, 20586 title = {Ultracapacitors: Future of Energy Storage}, 20587 author = {R. P. Deshpande}, 20588 publisher = {McGraw Hill Education}, 20589 isbn = {978-9339214050}, 20590 pages = {452}, 20591 year = {2014} 20592} 20593 20594@Article{ hojowboggs10, 20595 title = {Historical introduction to capacitor technology}, 20596 author = {J. Ho and T.R. Jow and S. Boggs}, 20597 journal = {IEEE Electrical Insulation Magazine}, 20598 month = jan, 20599 volume = {26}, 20600 number = {1}, 20601 pages = {20--25}, 20602 year = {2010}, 20603 doi = {10.1109/MEI.2010.5383924}, 20604 issn = {0883-7554} 20605} 20606 20607@Article{ gillespie14, 20608 title = {A review of steric interactions of ions: Why some theories succeed and others 20609 fail to acount for ion size}, 20610 author = {Dirk Gillespie}, 20611 journal = {Microfluidics and Nanofluidics}, 20612 volume = {18}, 20613 number = {5-6}, 20614 pages = {717--738}, 20615 year = {2015} 20616} 20617 20618@Article{ gillespievaliskoboda05, 20619 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 20620 title = {Density functional theory of the electrical double layer: the RFD functional}, 20621 journal = {J. Phys.: Condens. Matter}, 20622 volume = {17}, 20623 pages = {6609--6626}, 20624 year = {2005} 20625} 20626 20627@Article{ valiskobodagillespie07, 20628 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 20629 title = {Selective adsorption of ions with different diameter and valence at 20630 highly-charged interfaces}, 20631 journal = {J. Phys. Chem. C}, 20632 volume = {111}, 20633 pages = {15575--15585}, 20634 year = {2007} 20635} 20636 20637@Article{ gillespie08, 20638 author = {Dirk Gillespie}, 20639 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 20640 case study}, 20641 journal = {Biophys. J.}, 20642 volume = {94}, 20643 pages = {1169--1184}, 20644 year = {2008} 20645} 20646 20647@Article{ liwuwang15, 20648 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 20649 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 20650 journal = {Biophysical Journal}, 20651 volume = {94}, 20652 number = {3}, 20653 pages = {737--746}, 20654 doi = {10.1529/biophysj.107.112508}, 20655 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 20656 year = {2015} 20657} 20658 20659@Article{ gillespie12, 20660 title = {High energy conversion efficiency in nanofluidic channels}, 20661 author = {Dirk Gillespie}, 20662 journal = {Nano Letters}, 20663 volume = {12}, 20664 pages = {1410--1416}, 20665 year = {2012} 20666} 20667 20668@Article{ dieterich79, 20669 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 20670 author = {James H. Dieterich}, 20671 journal = {Journal of Geophysical Research: Solid Earth}, 20672 volume = {84}, 20673 number = {B5}, 20674 pages = {2161--2168}, 20675 year = {1979}, 20676 publisher = {Wiley Online Library} 20677} 20678 20679@Article{ bodakovacsgillespiekristof14, 20680 title = {Selective transport through a model calcium channel studied by Local Equilibrium 20681 Monte Carlo simulations coupled to the Nernst--Planck equation}, 20682 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 20683 Krist{\'o}f}, 20684 journal = {Journal of Molecular Liquids}, 20685 volume = {189}, 20686 pages = {100--112}, 20687 year = {2014}, 20688 publisher = {Elsevier} 20689} 20690 20691@Article{ brandt05, 20692 title = {Multiscale solvers and systematic upscaling in computational physics}, 20693 author = {Brandt, A}, 20694 journal = {Computer Physics Communications}, 20695 volume = {169}, 20696 number = {1}, 20697 pages = {438--441}, 20698 year = {2005}, 20699 publisher = {Elsevier} 20700} 20701 20702@Article{ rosenfeld89, 20703 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 20704 density-functional theory of freezing}, 20705 author = {Yaakov Rosenfeld}, 20706 journal = {Physical review letters}, 20707 volume = {63}, 20708 number = {9}, 20709 pages = {980}, 20710 year = {1989}, 20711 publisher = {APS} 20712} 20713 20714@Article{ schindlermitchellmccabecummingslevan13, 20715 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 20716 Approach}, 20717 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 20718 M Douglas LeVan}, 20719 journal = {The Journal of Physical Chemistry C}, 20720 volume = {117}, 20721 number = {41}, 20722 pages = {21337--21350}, 20723 year = {2013}, 20724 publisher = {ACS Publications} 20725} 20726 20727@Misc{ tramonto, 20728 author = {Laura Frink and et. al.}, 20729 title = {TRAMONTO 3.0 web site}, 20730 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 20731 year = {2014} 20732} 20733 20734@InCollection{ zhongyuenmoresiknepley15, 20735 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 20736 title = {Numerical Methods for Mantle Convection}, 20737 booktitle = {Treatise on Geophysics}, 20738 publisher = {Elsevier}, 20739 volume = {7}, 20740 editor = {Gerald Schubert}, 20741 edition = {second}, 20742 year = {2015} 20743} 20744 20745@Article{ richarson1911, 20746 author = {Lewis Fry Richardson}, 20747 title = {The approximate arithmetical solution by finite differences of physical problems 20748 including differential equations, with an application to the stresses in a masonry 20749 dam}, 20750 journal = {Philosophical Transactions of the Royal Society A}, 20751 volume = {210}, 20752 number = {459--470}, 20753 pages = {307--357}, 20754 doi = {10.1098/rsta.1911.0009}, 20755 year = {1911} 20756} 20757 20758@Article{ kirkwood34, 20759 author = {John G. Kirkwood}, 20760 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 20761 Application to Zwitterions}, 20762 journal = {The Journal of Chemical Physics}, 20763 volume = {2}, 20764 number = {7}, 20765 year = {1934} 20766} 20767 20768@TechReport{ schoof1994exodus, 20769 title = {{EXODUS II}: a finite element data model}, 20770 author = {Larry A Schoof and Victor R Yarberry}, 20771 institution = {Sandia National Laboratories}, 20772 number = {SAND92-2137}, 20773 address = {Albuquerque, NM}, 20774 year = {1994} 20775} 20776 20777@Misc{ poirier1998cgns, 20778 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 20779 and Fancis Y Enomoto}, 20780 title = {The CGNS system}, 20781 note = {AIAA Paper 98-3007}, 20782 year = {1998} 20783} 20784 20785@Article{ deyobarashephard2001, 20786 title = {Towards curvilinear meshing in 3D: the case of quadratic simplices}, 20787 author = {Saikat Dey and Robert M O'Bara and Mark S Shephard}, 20788 journal = {Computer-Aided Design}, 20789 volume = {33}, 20790 number = {3}, 20791 pages = {199--209}, 20792 year = {2001}, 20793} 20794 20795@InProceedings{ gomezhaimesgalbraith2022, 20796 title = {On Analysis Driven Shape Design Using B-Splines}, 20797 author = {Marlena Gomez and Robert Haimes and Marshall C Galbraith}, 20798 booktitle = {AIAA SciTech 2022 Forum}, 20799 pages = {1736}, 20800 year = {2022} 20801} 20802 20803@InProceedings{ cloughoberaizakrajsek2019, 20804 title = {Automated Wing Internal Structure Placement Guided by Finite Element Analysis}, 20805 author = {Justin L Clough and Assad A Oberai and Andrew J Zakrajsek}, 20806 booktitle = {AIAA Aviation 2019 Forum}, 20807 pages = {3369}, 20808 year = {2019} 20809} 20810 20811@InProceedings{ joegandhidannenhofferdalir2019, 20812 title = {Rapid generation of parametric aircraft structural models}, 20813 author = {John Joe and Viraj Gandhi and John Dannenhoffer and Hamid Dalir}, 20814 booktitle = {AIAA SciTech 2019 Forum}, 20815 pages = {2229}, 20816 year = {2019} 20817} 20818 20819@InProceedings{ haimesdannenhoffer2013, 20820 title = {The engineering sketch pad: A solid-modeling, feature-based, web-enabled system for building parametric geometry}, 20821 author = {Robert Haimes and John Dannenhoffer}, 20822 booktitle = {21st AIAA Computational Fluid Dynamics Conference}, 20823 pages = {3073}, 20824 year = {2013} 20825} 20826 20827@Article{ geuzaine2009gmsh, 20828 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 20829 facilities}, 20830 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 20831 journal = {International Journal for Numerical Methods in Engineering}, 20832 volume = {79}, 20833 number = {11}, 20834 pages = {1309--1331}, 20835 year = {2009}, 20836 publisher = {Wiley Online Library} 20837} 20838 20839@Article{ si2015, 20840 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 20841 author = {Hang Si}, 20842 journal = {ACM Trans. on Mathematical Software}, 20843 volume = {41}, 20844 number = {2}, 20845 month = feb, 20846 doi = {10.1145/2629697}, 20847 year = {2015} 20848} 20849 20850@TechReport{ blackerbohnhoffedwards1994, 20851 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 20852 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 20853 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 20854 year = {1994} 20855} 20856 20857@Article{ bjorck1994, 20858 title = {Numerics of Gram-Schmidt orthogonalization}, 20859 author = {{\AA}ke Bj{\"o}rck}, 20860 journal = {Linear Algebra and Its Applications}, 20861 volume = {197}, 20862 pages = {297--316}, 20863 year = {1994}, 20864 publisher = {Elsevier} 20865} 20866 20867@PhDThesis{ yood05, 20868 author = {Charles Nelson Yood}, 20869 title = {Argonne National Laboratory and the Emergence of Computer and Computational 20870 Science, 1946--1992}, 20871 school = {The Pennsylvania State University}, 20872 month = aug, 20873 year = {2005} 20874} 20875 20876@Article{ fearnleysander79, 20877 title = {Hermann Grassmann and the Creation of Linear Algebra}, 20878 author = {Desmond Fearnley-Sander}, 20879 journal = {The American Mathematical Monthly}, 20880 volume = {86}, 20881 pages = {809--817}, 20882 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 20883 year = {1979} 20884} 20885 20886@InCollection{ knepley2012, 20887 author = {Matthew G. Knepley}, 20888 title = {Programming Languages for Scientific Computing}, 20889 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20890 publisher = {Springer}, 20891 year = {2012}, 20892 editor = {Bj\"orn Engquist}, 20893 doi = {10.1007/978-3-540-70529-1}, 20894 url = {http://arxiv.org/abs/1209.1711} 20895} 20896 20897@InBook{ knepley2015, 20898 title = {Programming Languages for Scientific Computing}, 20899 author = {Matthew G. Knepley}, 20900 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20901 editor = {Bj{\"o}rn Engquist}, 20902 publisher = {Springer Berlin Heidelberg}, 20903 address = {Berlin, Heidelberg}, 20904 pages = {1173--1181}, 20905 isbn = {978-3-540-70529-1}, 20906 doi = {10.1007/978-3-540-70529-1_250}, 20907 year = {2015} 20908} 20909 20910@Book{ hughes2000, 20911 author = {Thomas J. R. Hughes}, 20912 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 20913 series = {Dover Civil and Mechanical Engineering}, 20914 pages = {704}, 20915 year = {2000}, 20916 isbn = {978-0486411811}, 20917 publisher = {Dover} 20918} 20919 20920@Article{ roache2002, 20921 title = {Code verification by the method of manufactured solutions}, 20922 author = {Patrick J. Roache}, 20923 journal = {Journal of Fluids Engineering}, 20924 volume = {124}, 20925 number = {1}, 20926 pages = {4--10}, 20927 year = {2002}, 20928 publisher = {American Society of Mechanical Engineers} 20929} 20930 20931@InCollection{ rokosgorman13, 20932 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 20933 author = {Georgios Rokos and Gerard Gorman}, 20934 booktitle = {Facing the Multicore-Challenge III}, 20935 series = {Lecture Notes in Computer Science}, 20936 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 20937 publisher = {Springer Berlin Heidelberg}, 20938 volume = {7686}, 20939 pages = {143-144}, 20940 doi = {10.1007/978-3-642-35893-7_22}, 20941 isbn = {978-3-642-35892-0}, 20942 year = {2013} 20943} 20944 20945@Misc{ hdf5:homepage, 20946 author = {{The HDF Group}}, 20947 title = {The {HDF5} Homepage}, 20948 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 20949 year = {2015} 20950} 20951 20952@Misc{ paraview:homepage, 20953 author = {Kitware}, 20954 title = {The {ParaView} Homepage}, 20955 howpublished = {\url{http://www.paraview.org/}}, 20956 year = {2015} 20957} 20958 20959@Misc{ xdmf:homepage, 20960 author = {Kitware}, 20961 title = {The Extensible Data Model and Format ({XDMF})}, 20962 howpublished = {\url{http://www.xdmf.org/}}, 20963 year = {2015} 20964} 20965 20966@Article{ cullerkarp1993, 20967 title = {LogP: Towards a realistic model of parallel computation}, 20968 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 20969 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 20970 journal = {SIGPLAN Notices}, 20971 volume = {28}, 20972 number = {7}, 20973 pages = {1--12}, 20974 year = {1993}, 20975 publisher = {ACM} 20976} 20977 20978@Article{ aggarwalvitter1988, 20979 title = {The input/output complexity of sorting and related problems}, 20980 author = {Alok Aggarwal and Jeffrey Vitter}, 20981 journal = {Communications of the ACM}, 20982 volume = {31}, 20983 number = {9}, 20984 pages = {1116--1127}, 20985 year = {1988}, 20986 publisher = {ACM} 20987} 20988 20989@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 20990 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 20991 Chandramowlishwaran and Richard Vuduc}, 20992 title = {Balance principles for algorithm-architecture co-design}, 20993 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 20994 month = may, 20995 address = {Berkeley, CA, USA}, 20996 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 20997 year = {2011} 20998} 20999 21000@Article{ williamswatermanpatterson2009, 21001 title = {Roofline: an insightful visual performance model for multicore architectures}, 21002 author = {Samuel Williams and Andrew Waterman and David Patterson}, 21003 journal = {Communications of the ACM}, 21004 volume = {52}, 21005 number = {4}, 21006 pages = {65--76}, 21007 year = {2009}, 21008 publisher = {ACM} 21009} 21010 21011@Misc{ roofline-web-page, 21012 author = {Samuel Williams and {et. al.}}, 21013 title = {{R}oofline {P}erformance {M}odel}, 21014 key = {Roofline}, 21015 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 21016 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 21017} 21018 21019@Misc{ roofline-talk2008, 21020 author = {Samuel Williams and David Patterson}, 21021 title = {{R}oofline {P}erformance {M}odel}, 21022 key = {Roofline}, 21023 year = {2008}, 21024 note = {ParLab Summer Retreat}, 21025 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 21026 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 21027} 21028 21029@Article{ lee2006, 21030 title = {The problem with threads}, 21031 author = {Edward A Lee}, 21032 journal = {Computer}, 21033 volume = {39}, 21034 number = {5}, 21035 pages = {33--42}, 21036 year = {2006}, 21037 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 21038 publisher = {IEEE Computer Society Press} 21039} 21040 21041@Article{ hoefler2012, 21042 title = {{Optimization principles for collective neighborhood communications}}, 21043 author = {Torsten Hoefler and Timo Schneider}, 21044 journal = {International Conference for High Performance Computing, Networking, Storage and 21045 Analysis, SC}, 21046 doi = {10.1109/SC.2012.86}, 21047 isbn = {9781467308069}, 21048 issn = {21674329}, 21049 year = {2012} 21050} 21051 21052@Book{ grahamknuthpatashnik1989, 21053 title = {Concrete Mathematics}, 21054 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 21055 publisher = {Addison-Wesley}, 21056 year = {1989} 21057} 21058 21059@Book{ jackson1962, 21060 title = {Classical Electrodynamics}, 21061 author = {John David Jackson}, 21062 publisher = {John Wiley \& Sons}, 21063 year = {1962} 21064} 21065 21066@Article{ leveque2013, 21067 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 21068 author = {Randall J. LeVeque}, 21069 journal = {SIAM News}, 21070 volume = {46}, 21071 number = {3}, 21072 month = apr, 21073 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 21074 year = {2013} 21075} 21076 21077@InProceedings{ wang2014, 21078 title = {Fjos: Practical, predictable, and efficient system support for fork/join 21079 parallelism}, 21080 author = {Qi Wang and Gabriel Parmer}, 21081 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 21082 20th}, 21083 pages = {25--36}, 21084 year = {2014}, 21085 organization = {IEEE} 21086} 21087 21088@Article{ fangsaad2009, 21089 author = {Haw-ren Fang and Yousef Saad}, 21090 title = {Two classes of multisecant methods for nonlinear acceleration}, 21091 journal = {Numerical Linear Algebra with Applications}, 21092 volume = {16}, 21093 number = {3}, 21094 pages = {197--221}, 21095 year = {2009}, 21096 doi = {10.1002/nla.617} 21097} 21098 21099@Misc{ hpcchallenge, 21100 title = {HPC Challenge}, 21101 author = {Jack Dongarra and Piotr Luszczek and others}, 21102 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 21103 year = {2015} 21104} 21105 21106@InProceedings{ hoeflerschneiderlumsdaine2008, 21107 title = {Accurately measuring collective operations at massive scale}, 21108 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 21109 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 21110 Processing (IPDPS)}, 21111 pages = {1--8}, 21112 year = {2008}, 21113 doi = {10.1109/IPDPS.2008.4536494}, 21114 organization = {IEEE} 21115} 21116 21117@Book{ potraptak1984, 21118 title = {Nondiscrete Induction and Iterative Processes}, 21119 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 21120 series = {Research Notes in Mathematics}, 21121 year = {1984}, 21122 publisher = {Pitman} 21123} 21124 21125@Book{ pilz1977, 21126 title = {Near-rings: the theory and its applications}, 21127 author = {G{\"u}nter Pilz}, 21128 year = {1977}, 21129 publisher = {New York} 21130} 21131 21132@Article{ birkenjameson2009, 21133 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 21134 author = {Philipp Birken and Antony Jameson}, 21135 journal = {International Journal for Numerical Methods in Fluids}, 21136 volume = {62}, 21137 number = {5}, 21138 pages = {565--573}, 21139 publisher = {John Wiley \& Sons, Ltd.}, 21140 doi = {10.1002/fld.2030}, 21141 issn = {1097-0363}, 21142 year = {2010} 21143} 21144 21145@Article{ anderson1965, 21146 title = {Iterative procedures for nonlinear integral equations}, 21147 author = {Donald G Anderson}, 21148 journal = {Journal of the ACM (JACM)}, 21149 volume = {12}, 21150 number = {4}, 21151 pages = {547--560}, 21152 year = {1965}, 21153 publisher = {ACM} 21154} 21155 21156@Article{ ptak1966, 21157 title = {Some metric aspects of the open mapping and closed graph theorems}, 21158 author = {Vlastimil Pt{\'a}k}, 21159 journal = {Mathematische Annalen}, 21160 volume = {163}, 21161 number = {2}, 21162 pages = {95--104}, 21163 year = {1966}, 21164 publisher = {Springer} 21165} 21166 21167@Article{ ptak1974, 21168 title = {A quantitative refinement of the closed graph theorem}, 21169 author = {Vlastimil Pt{\'a}k}, 21170 journal = {Czechoslovak Mathematical Journal}, 21171 volume = {24}, 21172 number = {3}, 21173 pages = {503--506}, 21174 year = {1974}, 21175 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 21176} 21177 21178@Article{ ptak1975, 21179 title = {The rate of convergence of {Newton's} process}, 21180 author = {Vlastimil Pt{\'a}k}, 21181 journal = {Numerische Mathematik}, 21182 volume = {25}, 21183 number = {3}, 21184 pages = {279--285}, 21185 year = {1975}, 21186 publisher = {Springer} 21187} 21188 21189@Article{ ptak1976, 21190 title = {Nondiscrete mathematical induction and iterative existence proofs}, 21191 author = {Vlastimil Pt{\'a}k}, 21192 journal = {Linear algebra and its applications}, 21193 volume = {13}, 21194 number = {3}, 21195 pages = {223--238}, 21196 year = {1976}, 21197 publisher = {Elsevier} 21198} 21199 21200@Article{ ptak1977, 21201 title = {What should be a rate of convergence?}, 21202 author = {Vlastimil Pt{\'a}k}, 21203 journal = {RAIRO-Analyse num{\'e}rique}, 21204 volume = {11}, 21205 number = {3}, 21206 pages = {279--286}, 21207 year = {1977} 21208} 21209 21210@Article{ potraptak1980, 21211 title = {Sharp error bounds for {Newton's} process}, 21212 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 21213 journal = {Numerische Mathematik}, 21214 volume = {34}, 21215 number = {1}, 21216 pages = {63--72}, 21217 year = {1980}, 21218 publisher = {Springer} 21219} 21220 21221@Article{ liesen2014, 21222 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 21223 author = {J{\"o}rg Liesen}, 21224 journal = {IMA Journal of Numerical Analysis}, 21225 doi = {10.1093/imanum/drv037}, 21226 archiveprefix = {arXiv}, 21227 eprint = {1405.2683}, 21228 primaryclass = {math-na}, 21229 year = {2015} 21230} 21231 21232@Book{ traub1964, 21233 title = {Iterative Methods for the Solution of Equations}, 21234 author = {Joseph F Traub}, 21235 year = {1964}, 21236 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 21237} 21238 21239@InProceedings{ shalfvecpar2010, 21240 title = {Exascale Computing Technology Challenges}, 21241 author = {John Shalf and Sudip Dosanjh and John Morrison}, 21242 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 21243 pages = {1–-25}, 21244 year = {2010} 21245} 21246 21247@Article{ frechet1907, 21248 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 21249 author = {Maurice Ren\'e Fr\'echet}, 21250 journal = {C. R. Acad. Sci. Paris}, 21251 volume = {144}, 21252 pages = {1414--1416}, 21253 year = {1907} 21254} 21255 21256@Article{ riesz1907, 21257 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 21258 author = {Frigyes Riesz}, 21259 journal = {C. R. Acad. Sci. Paris}, 21260 volume = {144}, 21261 pages = {1409--1411}, 21262 year = {1907} 21263} 21264 21265@Article{ riesz1909, 21266 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 21267 author = {Frigyes Riesz}, 21268 journal = {C. R. Acad. Sci. Paris}, 21269 volume = {149}, 21270 pages = {974--977}, 21271 year = {1909} 21272} 21273 21274@Misc{ rieszmarkovkakutanirepresentationtheorem, 21275 author = {Wikipedia}, 21276 title = {Riesz-Markov-Kakutani Representation Theorem}, 21277 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 21278 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 21279 year = {2015} 21280} 21281 21282@Article{ markov1938, 21283 title = {On mean values and exterior densities}, 21284 author = {Andrey Markov}, 21285 journal = {Rec. Math. Moscou}, 21286 volume = {4}, 21287 pages = {165--190}, 21288 year = {1938} 21289} 21290 21291@Article{ kakutani1941, 21292 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 21293 space of continuous functions.)}, 21294 author = {Shizuo Kakutani}, 21295 journal = {Ann. of Math.}, 21296 volume = {2}, 21297 number = {42}, 21298 pages = {994--1024}, 21299 doi = {10.2307/1968778}, 21300 year = {1941} 21301} 21302 21303@Article{ michoskimeyersonisaacwaelbroeck2014, 21304 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 21305 tokamaks}, 21306 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 21307 journal = {Journal of Computational Physics}, 21308 volume = {274}, 21309 pages = {898--919}, 21310 year = {2014}, 21311 publisher = {Elsevier} 21312} 21313 21314@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 21315 title = {Extreme-scale AMR}, 21316 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 21317 Stadler and Tim Warburton and Lucas Wilcox}, 21318 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 21319 Computing, Networking, Storage and Analysis}, 21320 pages = {1--12}, 21321 year = {2010}, 21322 organization = {IEEE Computer Society}, 21323 doi = {10.1109/SC.2010.25} 21324} 21325 21326@InProceedings{ isaacbursteddeghattas2012, 21327 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 21328 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 21329 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 21330 International}, 21331 pages = {426--437}, 21332 year = {2012}, 21333 organization = {IEEE}, 21334 doi = {10.1109/IPDPS.2012.47} 21335} 21336 21337@Article{ isaacpetrastadlerghattas2015, 21338 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 21339 through inference to prediction for large-scale problems, with application to flow 21340 of the {Antarctic} ice sheet}, 21341 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 21342 journal = {Journal of Computational Physics}, 21343 volume = {296}, 21344 pages = {348--368}, 21345 year = {2015}, 21346 publisher = {Elsevier}, 21347 doi = {10.1016/j.jcp.2015.04.047} 21348} 21349 21350@Article{ isaacbursteddewilcoxghattas2015, 21351 title = {Recursive Algorithms for Distributed Forests of Octrees}, 21352 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 21353 journal = {SIAM Journal on Scientific Computing}, 21354 volume = {37}, 21355 number = {5}, 21356 pages = {C497-C531}, 21357 eprint = {1406.0089}, 21358 eprinttype = {arXiv}, 21359 year = {2015}, 21360 doi = {10.1137/140970963} 21361} 21362 21363@Article{ isaacstadlerghattas2015, 21364 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 21365 elements on nonconforming and anisotropic meshes, with application to ice sheet 21366 dynamics}, 21367 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 21368 journal = {SIAM Journal on Scientific Computing}, 21369 number = {6}, 21370 pages = {804--833}, 21371 volume = {37}, 21372 year = {2015}, 21373 doi = {10.1137/140974407} 21374} 21375 21376@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 21377 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 21378 earth's mantle}, 21379 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 21380 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 21381 Alessandro Curioni and Omar Ghattas}, 21382 booktitle = {Proceedings of the International Conference for High Performance Computing, 21383 Networking, Storage and Analysis}, 21384 pages = {5}, 21385 year = {2015}, 21386 organization = {ACM}, 21387 doi = {10.1145/2807591.2807675} 21388} 21389 21390@Article{ bunchhopcroft1974, 21391 title = {Triangular factorization and inversion by fast matrix multiplication}, 21392 author = {James R Bunch and John E Hopcroft}, 21393 journal = {Mathematics of Computation}, 21394 volume = {28}, 21395 number = {125}, 21396 pages = {231--236}, 21397 doi = {10.2307/2005828}, 21398 year = {1974} 21399} 21400 21401@Article{ nemirovsky1991, 21402 title = {On optimality of Krylov's information when solving linear operator equations}, 21403 author = {A.S Nemirovsky}, 21404 journal = {Journal of Complexity}, 21405 volume = {7}, 21406 number = {2}, 21407 pages = {121--130}, 21408 doi = {10.1016/0885-064X(91)90001-E}, 21409 year = {1991} 21410} 21411 21412@Misc{siamcseprize, 21413 author = {{PETSc Team}}, 21414 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21415 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21416 url = {https://www.siam.org/prizes/sponsored/cse.php}, 21417 year = {2015} 21418} 21419 21420@Article{ rathgeber2017, 21421 title = {Firedrake: automating the finite element method by composing abstractions}, 21422 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 21423 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 21424 Graham R and Kelly, Paul HJ}, 21425 archiveprefix = {arXiv}, 21426 journal = {ACM Transaction on Mathematical Software}, 21427 eprint = {1501.01809}, 21428 volume = {43}, 21429 issue = {3}, 21430 number = {24}, 21431 year = {2017}, 21432 url = {http://arxiv.org/abs/1501.01809} 21433} 21434 21435@Article{ kirby2006b, 21436 title = {Topological optimization of the evaluation of finite element matrices}, 21437 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 21438 journal = {SIAM Journal on Scientific Computing}, 21439 volume = {28}, 21440 number = {1}, 21441 pages = {224--240}, 21442 year = {2006}, 21443 publisher = {SIAM} 21444} 21445 21446@Article{ luporini2015, 21447 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 21448 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 21449 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 21450 Assembly}, 21451 journal = {ACM Trans. Archit. Code Optim.}, 21452 issue_date = {January 2015}, 21453 volume = {11}, 21454 number = {4}, 21455 month = jan, 21456 year = {2015}, 21457 issn = {1544-3566}, 21458 pages = {57:1--57:25}, 21459 articleno = {57}, 21460 numpages = {25}, 21461 doi = {10.1145/2687415}, 21462 acmid = {2687415}, 21463 publisher = {ACM}, 21464 address = {New York, NY, USA}, 21465 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 21466 optimizations} 21467} 21468 21469@Article{ markall2012, 21470 title = {Finite element assembly strategies on multi- and many-core architectures}, 21471 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 21472 C. D. and Sherwin, S. J.}, 21473 journal = {International Journal for Numerical Methods in Fluids}, 21474 year = {2013}, 21475 volume = {71}, 21476 pages = {80--97}, 21477 doi = {10.1002/fld.3648} 21478} 21479 21480@Article{ markall2010, 21481 title = {Towards generating optimised finite element solvers for GPUs from high-level 21482 specifications}, 21483 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 21484 journal = {Procedia Computer Science}, 21485 volume = {1}, 21486 number = {1}, 21487 pages = {1815--1823}, 21488 year = {2010}, 21489 note = {{ICCS} 2010}, 21490 doi = {10.1016/j.procs.2010.04.203} 21491} 21492 21493@Article{ longkirbywaanders2010, 21494 title = {Unified embedded parallel finite element computations via software-based 21495 Fr{\'e}chet differentiation}, 21496 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 21497 journal = {SIAM Journal on Scientific Computing}, 21498 volume = {32}, 21499 number = {6}, 21500 pages = {3323--3351}, 21501 year = {2010}, 21502 publisher = {SIAM} 21503} 21504 21505@Article{ kirby2010, 21506 title = {From functional analysis to iterative methods}, 21507 author = {Robert C Kirby}, 21508 journal = {SIAM review}, 21509 volume = {52}, 21510 number = {2}, 21511 pages = {269--293}, 21512 year = {2010}, 21513 publisher = {SIAM} 21514} 21515 21516@Article{ kirby2014, 21517 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 21518 author = {Robert C Kirby}, 21519 journal = {SIAM Journal on Scientific Computing}, 21520 volume = {36}, 21521 number = {2}, 21522 pages = {A846--A868}, 21523 year = {2014}, 21524 publisher = {SIAM} 21525} 21526 21527@Article{ kirby2011, 21528 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 21529 author = {Robert C Kirby}, 21530 journal = {Numerische Mathematik}, 21531 volume = {117}, 21532 number = {4}, 21533 pages = {631--652}, 21534 year = {2011}, 21535 publisher = {Springer} 21536} 21537 21538@Article{ arnoldfalkwinther2006, 21539 title = {Finite element exterior calculus, homological techniques, and applications}, 21540 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 21541 journal = {Acta numerica}, 21542 volume = {15}, 21543 pages = {1--155}, 21544 year = {2006}, 21545 publisher = {Cambridge Univ Press} 21546} 21547 21548@Article{ arnoldlogg2014, 21549 title = {Periodic table of the finite elements}, 21550 author = {Douglas Arnold and Anders Logg}, 21551 month = nov, 21552 journal = {SIAM News}, 21553 year = {2014} 21554} 21555 21556@Article{ janssonhoffmanjansson2012, 21557 title = {Framework for massively parallel adaptive finite element computational fluid 21558 dynamics on tetrahedral meshes}, 21559 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 21560 journal = {SIAM Journal on Scientific Computing}, 21561 volume = {34}, 21562 number = {1}, 21563 pages = {C24--C41}, 21564 year = {2012}, 21565 publisher = {SIAM} 21566} 21567 21568@Article{ rogneshamcottermcrae2013, 21569 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 21570 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 21571 journal = {Geoscientific Model Development}, 21572 volume = {6}, 21573 number = {6}, 21574 pages = {2099--2119}, 21575 year = {2013}, 21576 publisher = {Copernicus GmbH} 21577} 21578 21579@Book{ loggmardalwells2012, 21580 title = {Automated solution of differential equations by the finite element method: The 21581 {FEniCS} book}, 21582 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 21583 volume = {84}, 21584 year = {2012}, 21585 publisher = {Springer Science \& Business Media} 21586} 21587 21588@Article{ cotterkirby2014, 21589 title = {Mixed finite elements for global tide models}, 21590 author = {Colin J Cotter and Robert C Kirby}, 21591 archiveprefix = {arXiv}, 21592 journal = {Submitted}, 21593 eprint = {1410.0045}, 21594 year = {2014}, 21595 url = {http://arxiv.org/abs/1410.0045} 21596} 21597 21598@Article{ kirbykieu2015, 21599 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 21600 author = {Robert C Kirby and Thinh Tri Kieu}, 21601 journal = {Numerische Mathematik}, 21602 volume = {130}, 21603 number = {2}, 21604 pages = {257--291}, 21605 year = {2015}, 21606 publisher = {Springer} 21607} 21608 21609@Article{ brennankirby2015, 21610 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 21611 model}, 21612 author = {Brian Brennan and Robert C Kirby}, 21613 journal = {Submitted to Computers and Mathematics with Applications}, 21614 year = {2015} 21615} 21616 21617@Article{ howlekirbydillon2013, 21618 title = {Block preconditioners for coupled physics problems}, 21619 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 21620 journal = {SIAM Journal on Scientific Computing}, 21621 volume = {35}, 21622 number = {5}, 21623 pages = {S368--S385}, 21624 year = {2013}, 21625 publisher = {SIAM} 21626} 21627 21628@Book{ malekstrakos2014, 21629 title = {Preconditioning and the conjugate gradient method in the context of solving 21630 PDEs}, 21631 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 21632 volume = {1}, 21633 year = {2014}, 21634 publisher = {SIAM} 21635} 21636 21637@Article{ desturler1995, 21638 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 21639 distributed memory computers}, 21640 author = {E. de Sturler and H.A. van der Vorst}, 21641 journal = {Applied Numerical Mathematics}, 21642 volume = {18}, 21643 number = {4}, 21644 pages = {441--459}, 21645 year = {1995}, 21646 doi = {10.1016/0168-9274(95)00079-A} 21647} 21648 21649@Article{ velicmaymoresi2009, 21650 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 21651 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 21652 journal = {Journal of Mathematical Modelling and Algorithms}, 21653 volume = {8}, 21654 number = {3}, 21655 pages = {343--355}, 21656 year = {2009}, 21657 publisher = {Springer} 21658} 21659 21660@Article{ may2012, 21661 title = {Volume reconstruction of point cloud data sets derived from computational 21662 geodynamic simulations}, 21663 author = {May, DA}, 21664 journal = {Geochemistry, Geophysics, Geosystems}, 21665 volume = {13}, 21666 number = {5}, 21667 year = {2012}, 21668 publisher = {Wiley Online Library} 21669} 21670 21671@Article{ quenettehodkinson2010, 21672 title = {StgDomain--scalable parallel domain software components for particle-in-cell 21673 finite element methods}, 21674 author = {Quenette, Steve and Hodkinson, Luke}, 21675 journal = {Concurrency and Computation: Practice and Experience}, 21676 volume = {22}, 21677 number = {12}, 21678 pages = {1593--1603}, 21679 year = {2010}, 21680 publisher = {Wiley Online Library} 21681} 21682 21683@Book{ velic2005, 21684 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 21685 author = {Velic, Mirko}, 21686 year = {2005}, 21687 publisher = {Monash University} 21688} 21689 21690@Article{ velicknepleymay2016, 21691 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 21692 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 21693 note = {in preparation}, 21694 year = {2016} 21695} 21696 21697@Article{ traubwozniakowski1979, 21698 title = {Convergence and complexity of Newton iteration for operator equations}, 21699 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 21700 journal = {Journal of the ACM (JACM)}, 21701 volume = {26}, 21702 number = {2}, 21703 pages = {250--258}, 21704 year = {1979}, 21705 publisher = {ACM} 21706} 21707 21708@Article{ sterck2013, 21709 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 21710 author = {Hans De Sterck}, 21711 journal = {Numerical Linear Algebra with Applications}, 21712 volume = {20}, 21713 number = {3}, 21714 pages = {453--471}, 21715 year = {2013} 21716} 21717 21718@Article{ sterckwinlaw2015, 21719 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 21720 tensor approximation}, 21721 author = {Hans De Sterck and Manda Winlaw}, 21722 journal = {Numerical Linear Algebra with Applications}, 21723 volume = {22}, 21724 number = {3}, 21725 pages = {410--432}, 21726 year = {2015} 21727} 21728 21729@Article{ sterckhowse2015, 21730 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 21731 approximate {Tucker} tensor decompositions}, 21732 author = {Hans De Sterck and Alexander Howse}, 21733 journal = {SIAM Journal on Scientific Computing}, 21734 note = {submitted}, 21735 year = {2015} 21736} 21737 21738@Book{ ladevezesimmonds1999, 21739 title = {Nonlinear computational structural mechanics: {N}ew approaches and 21740 non-incremental methods of calculation}, 21741 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 21742 series = {{M}echanical {E}ngineering {S}eries}, 21743 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 21744 isbn = {9780387985947}, 21745 lccn = {98029990}, 21746 year = {1999}, 21747 publisher = {Springer} 21748} 21749 21750@InProceedings{ walkerwoodwardyang2010, 21751 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 21752 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 21753 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 21754 year = {2010} 21755} 21756 21757@Article{ lottwalkerwoodwardyang2012, 21758 title = {An accelerated {P}icard method for nonlinear systems related to variably 21759 saturated flow}, 21760 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 21761 journal = {Advances in Water Resources}, 21762 volume = {38}, 21763 number = {0}, 21764 pages = {92--101}, 21765 doi = {10.1016/j.advwatres.2011.12.013}, 21766 year = {2012} 21767} 21768 21769@TechReport{ mohrrude1998, 21770 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 21771 author = {Marcus Mohr and Ulrich R\"ude}, 21772 type = {Technical Report}, 21773 number = {394}, 21774 institution = {University of Augsburg}, 21775 year = {1998} 21776} 21777 21778@InProceedings{ mohr2000, 21779 title = {Low Communication Parallel Multigrid}, 21780 author = {Mohr, Marcus}, 21781 booktitle = {Euro-Par 2000 Parallel Processing}, 21782 pages = {806--814}, 21783 year = {2000}, 21784 organization = {Springer} 21785} 21786 21787@Article{ brandtdiskin1994, 21788 title = {Multigrid solvers on decomposed domains}, 21789 author = {Achi Brandt and Boris Diskin}, 21790 journal = {Contemporary Mathematics}, 21791 volume = {157}, 21792 year = {1994}, 21793 publisher = {AMERICAN MATHEMATICAL SOCIETY} 21794} 21795 21796@InProceedings{ prabhuetal2011, 21797 title = {A Survey of the Practice of Computational Science}, 21798 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 21799 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 21800 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 21801 David I.}, 21802 booktitle = {State of the Practice Reports}, 21803 series = {SC '11}, 21804 year = {2011}, 21805 isbn = {978-1-4503-1139-7}, 21806 location = {Seattle, Washington}, 21807 pages = {19:1--19:12}, 21808 articleno = {19}, 21809 numpages = {12}, 21810 doi = {10.1145/2063348.2063374}, 21811 acmid = {2063374}, 21812 publisher = {ACM}, 21813 address = {New York, NY, USA} 21814} 21815 21816@PhDThesis{ dinarthesis1979, 21817 title = {Fast methods for the numerical solution of boundary value problems}, 21818 author = {N. Dinar}, 21819 school = {Weizmann Institute of Science}, 21820 year = {1979} 21821} 21822 21823@Article{ thomasdiskinbrandt2001, 21824 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 21825 high Reynolds number wakes and boundary layers}, 21826 author = {James L Thomas and Boris Diskin and Achi Brandt}, 21827 journal = {Computers \& fluids}, 21828 volume = {30}, 21829 number = {7}, 21830 pages = {853--874}, 21831 year = {2001}, 21832 publisher = {Elsevier} 21833} 21834 21835@Article{ greenbaumptakstrakos1996, 21836 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 21837 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 21838 journal = {SIAM Journal on Matrix Analysis and Applications}, 21839 volume = {17}, 21840 number = {3}, 21841 pages = {465--469}, 21842 year = {1996}, 21843 publisher = {SIAM} 21844} 21845 21846@Article{ nangiapatankarbhalla2019, 21847 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 21848 density ratio multiphase flows}, 21849 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 21850 journal = {Journal of Computational Physics}, 21851 volume = {398}, 21852 pages = {108804}, 21853 year = {2019} 21854} 21855 21856@Article{ bhallanangiadafnakisbraccomattiazzo2019, 21857 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 21858 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 21859 library}, 21860 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 21861 Bracco and Giuliana Mattiazzo}, 21862 journal = {Applied Ocean Research}, 21863 note = {In press}, 21864 year = {2019} 21865} 21866 21867@Article{ bhallagriffithpatankardonev2013, 21868 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 21869 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 21870 Alexander Donev}, 21871 journal = {Journal of Chemical Physics}, 21872 volume = {139}, 21873 number = {21}, 21874 pages = {214112}, 21875 year = {2013} 21876} 21877 21878@Article{ bhallabalegriffithpatankar2014, 21879 title = {Fully resolved immersed electrohydrodynamics for particle motion, 21880 electrolocation, and self-propulsion}, 21881 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 21882 Patankar}, 21883 journal = {Journal of Computational Physics}, 21884 volume = {256}, 21885 pages = {88--108}, 21886 year = {2014} 21887} 21888 21889@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 21890 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 21891 multiblob approach}, 21892 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 21893 and Boyce E. Griffith and Alexander Donev}, 21894 journal = {Communications in Applied Mathematics and Computational Science}, 21895 volume = {11}, 21896 number = {2}, 21897 pages = {217--296}, 21898 year = {2016} 21899} 21900 21901@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 21902 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 21903 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 21904 P.J. Kahrilas and Neelesh A. Patankar}, 21905 journal = {Journal of Computational Physics}, 21906 volume = {298}, 21907 pages = {446--465}, 21908 year = {2015} 21909} 21910 21911@Article{ balenevelnbhallamaciverpatankar2015, 21912 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 21913 and vertebrates}, 21914 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 21915 A. Patankar}, 21916 journal = {PLoS Biology}, 21917 volume = {13}, 21918 number = {4}, 21919 pages = {1--22}, 21920 year = {2015} 21921} 21922 21923@Article{ balehaobhallapatankar2014, 21924 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 21925 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 21926 journal = {Proceedings of the National Academy of Sciences}, 21927 volume = {111}, 21928 number = {21}, 21929 pages = {7517--7521}, 21930 year = {2014} 21931} 21932 21933@Article{ bhallabalegriffithpatankar2013, 21934 title = {A unified mathematical framework and an adaptive numerical method for 21935 fluid--structure interaction with rigid, deforming, and elastic bodies}, 21936 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 21937 Patankar}, 21938 journal = {Journal of Computational Physics}, 21939 volume = {250}, 21940 pages = {446--476}, 21941 year = {2013}, 21942 publisher = {Elsevier} 21943} 21944 21945@Article{ takeikatz2013, 21946 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 21947 Governing equations and linearized analysis}, 21948 author = {Yasuko Takei and Richard F. Katz}, 21949 journal = {Journal of Fluid Mechanics}, 21950 volume = {734}, 21951 issn = {1469-7645}, 21952 pages = {424--455}, 21953 numpages = {32}, 21954 doi = {10.1017/jfm.2013.482}, 21955 month = nov, 21956 year = {2013} 21957} 21958 21959@Misc{ stewart2011, 21960 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 21961 author = {G. W. Stewart}, 21962 note = {Translated with commentary by G. W. Stewart}, 21963 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 21964 year = {2011} 21965} 21966 21967@Article{ douglisnirenberg1955, 21968 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 21969 author = {Avron Douglis and Louis Nirenberg}, 21970 journal = {Communications on Pure and Applied Mathematics}, 21971 volume = {8}, 21972 pages = {503--538}, 21973 year = {1955} 21974} 21975 21976@Article{ gorelickgalunsharonbasribrandt2006, 21977 title = {Shape Representation and Classification Using the Poisson Equation}, 21978 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 21979 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 21980 volume = {28}, 21981 number = {12}, 21982 pages = {1991--2005}, 21983 year = {2006} 21984} 21985 21986@Article{ salsbury2006, 21987 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 21988 solvation energies}, 21989 author = {Freddie R. Salsbury Jr.}, 21990 journal = {Molecular Physics}, 21991 volume = {104}, 21992 number = {08}, 21993 pages = {1299--1309}, 21994 year = {2006} 21995} 21996 21997@Article{ sigalov2006, 21998 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 21999 approximation}, 22000 author = {G. Sigalov and A. Fenley and A. Onufriev}, 22001 journal = {Journal of Chemical Physics}, 22002 volume = {124}, 22003 number = {124902}, 22004 year = {2006} 22005} 22006 22007@Article{ dennard1974, 22008 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 22009 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 22010 Andre R LeBlanc}, 22011 journal = {IEEE Journal of Solid-State Circuits}, 22012 volume = {9}, 22013 number = {5}, 22014 pages = {256--268}, 22015 year = {1974} 22016} 22017 22018@Article{ zeegeijn2015, 22019 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 22020 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 22021 journal = {ACM Transactions on Mathematical Software}, 22022 volume = {41}, 22023 number = {3}, 22024 pages = {14:1--14:33}, 22025 month = jun, 22026 year = {2015}, 22027 issue_date = {jun}, 22028 doi = {10.1145/2764454} 22029} 22030 22031@Article{ campbell1976, 22032 title = {Assessing the Impact of Planned Social Change}, 22033 author = {Donald T. Campbell}, 22034 journal = {Occasional Paper Series, The Public Affairs Center}, 22035 number = {8}, 22036 publisher = {Dartmouth College}, 22037 year = {1976} 22038} 22039 22040@Article{ smaldinomcelreath2016, 22041 title = {The natural selection of bad science}, 22042 author = {Paul E. Smaldino and Richard McElreath}, 22043 journal = {Royal Society Open Science}, 22044 volume = {3}, 22045 number = {9}, 22046 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 22047 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 22048 doi = {10.1098/rsos.160384}, 22049 year = {2016}, 22050 publisher = {The Royal Society} 22051} 22052 22053@Article{ harlowwelch1965, 22054 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 22055 free surface}, 22056 author = {Francis H Harlow and J Eddie Welch}, 22057 journal = {Physics of fluids}, 22058 volume = {8}, 22059 number = {12}, 22060 pages = {2182--2189}, 22061 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 22062 year = {1965} 22063} 22064 22065@Article{ diskinthomasmineck2005, 22066 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 22067 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 22068 journal = {SIAM Journal on Scientific Computing}, 22069 volume = {27}, 22070 number = {1}, 22071 pages = {108--129}, 22072 doi = {10.1137/030601521}, 22073 issn = {1064-8275}, 22074 year = {2005} 22075} 22076 22077@TechReport{ scott2012, 22078 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 22079 Computer Science}, 22080 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 22081 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 22082 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 22083 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 22084 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 22085 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 22086 Yuen}, 22087 institution = {University of Chicago}, 22088 number = {2012-02}, 22089 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 22090 year = {2012} 22091} 22092 22093@Article{ roth2010, 22094 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 22095 author = {Roland Roth}, 22096 journal = {J. Phys. Cond. Mat.}, 22097 volume = {22}, 22098 pages = {063102}, 22099 year = {2010} 22100} 22101 22102@Article{ wu2008, 22103 title = {Density functional theory for liquid structure and thermodynamics}, 22104 author = {J. Z. Wu}, 22105 journal = {Struct. Bond.}, 22106 doi = {10.1007/430_2008_3}, 22107 year = {2008} 22108} 22109 22110@Article{ goel2008, 22111 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 22112 by {Monte Carlo} simulations and density functional theory}, 22113 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 22114 journal = {J. Chem. Phys.}, 22115 volume = {129}, 22116 pages = {154707}, 22117 year = {2008} 22118} 22119 22120@Article{ marchxiaoyubiros2015, 22121 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 22122 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 22123 journal = {SIAM Journal on Scientific Computing (to appear)}, 22124 year = {2015} 22125} 22126 22127@InProceedings{ yangduraiswamigumerovdavis2003, 22128 title = {Improved fast gauss transform and efficient kernel density estimation}, 22129 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 22130 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 22131 pages = {664--671}, 22132 year = {2003}, 22133 organization = {IEEE} 22134} 22135 22136@Article{ fornberglarssonflyer2011, 22137 title = {Stable computations with Gaussian radial basis functions}, 22138 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 22139 journal = {SIAM Journal on Scientific Computing}, 22140 volume = {33}, 22141 number = {2}, 22142 pages = {869--892}, 22143 year = {2011}, 22144 publisher = {SIAM} 22145} 22146 22147@InProceedings{ srinivasanqiduraiswami2010, 22148 title = {GPUML: Graphical processors for speeding up kernel machines}, 22149 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 22150 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 22151 Implementations, and Applications}, 22152 year = {2010} 22153} 22154 22155@Article{ jadamecbillen2010, 22156 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 22157 a slab edge}, 22158 author = {Margarete A Jadamec and Magali I Billen}, 22159 journal = {Nature}, 22160 volume = {465}, 22161 number = {7296}, 22162 pages = {338--341}, 22163 year = {2010} 22164} 22165 22166@Article{ jadamecbillen2012, 22167 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 22168 numerical models of the Alaska slab edge}, 22169 author = {Margarete A Jadamec and Magali I Billen}, 22170 journal = {Journal of Geophysical Research: Solid Earth}, 22171 volume = {117}, 22172 number = {B2}, 22173 year = {2012} 22174} 22175 22176@Article{ jadamec2015, 22177 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 22178 author = {Margarete A Jadamec}, 22179 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 22180 volume = {211}, 22181 pages = {135}, 22182 year = {2015} 22183} 22184 22185@Article{ durancejadamecfalloonnicholls2012, 22186 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 22187 olivine-hosted melt inclusions and geochemical modelling with insights from 22188 geodynamic models}, 22189 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 22190 journal = {Australian Journal of Earth Sciences}, 22191 volume = {59}, 22192 number = {6}, 22193 pages = {913--931}, 22194 year = {2012} 22195} 22196 22197@Article{ sharplesmoresijadamecrevote2015, 22198 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 22199 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 22200 journal = {Journal of Geophysical Research: Solid Earth}, 22201 volume = {120}, 22202 number = {6}, 22203 pages = {4379--4404}, 22204 year = {2015} 22205} 22206 22207@Article{ hayniejadamec2017, 22208 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 22209 geodynamic models}, 22210 author = {Kirstie L Haynie and Margarete A Jadamec}, 22211 journal = {Tectonics}, 22212 note = {in review}, 22213 year = {2017} 22214} 22215 22216@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 22217 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 22218 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 22219 Lithgow-Bertelloni and Wenbo Xu}, 22220 journal = {Geophysical Journal International}, 22221 volume = {179}, 22222 number = {2}, 22223 pages = {1169--1185}, 22224 year = {2009} 22225} 22226 22227@Article{ zhong2006, 22228 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 22229 plume excess temperature, and upper mantle temperature}, 22230 author = {Shijie Zhong}, 22231 journal = {Journal of Geophysical Research: Solid Earth}, 22232 volume = {111}, 22233 number = {B4}, 22234 year = {2006} 22235} 22236 22237@Article{ billenhirth2007, 22238 title = {Rheologic controls on slab dynamics}, 22239 author = {Magali I Billen and Greg Hirth}, 22240 journal = {Geochemistry, Geophysics, Geosystems}, 22241 volume = {8}, 22242 number = {8}, 22243 year = {2007} 22244} 22245 22246@Article{ hirthkohlstedt2003, 22247 title = {Rheology of the upper mantle and the mantle wedge: A view from the 22248 experimentalists}, 22249 author = {Greg Hirth and David Kohlstedt}, 22250 journal = {Inside the subduction Factory}, 22251 pages = {83--105}, 22252 year = {2003} 22253} 22254 22255@Article{ longsilver2008, 22256 title = {The subduction zone flow field from seismic anisotropy: A global view}, 22257 author = {Maureen D Long and Paul G Silver}, 22258 journal = {science}, 22259 volume = {319}, 22260 number = {5861}, 22261 pages = {315--318}, 22262 year = {2008} 22263} 22264 22265@Article{ karatowu1993, 22266 title = {Rheology of the upper mantle: A synthesis}, 22267 author = {Shun-ichiro Karato and Patrick Wu}, 22268 journal = {Science}, 22269 volume = {260}, 22270 number = {5109}, 22271 pages = {771--778}, 22272 year = {1993} 22273} 22274 22275@Article{ long2013mantle, 22276 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 22277 for wedge processes}, 22278 author = {Long, Maureen D and Wirth, Erin A}, 22279 journal = {Journal of Geophysical Research: Solid Earth}, 22280 volume = {118}, 22281 number = {2}, 22282 pages = {583--606}, 22283 year = {2013}, 22284 publisher = {Wiley Online Library} 22285} 22286 22287@Article{ hoernle2008arc, 22288 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 22289 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 22290 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 22291 Alvarado, Guillermo and Protti, Marino and others}, 22292 journal = {Nature}, 22293 volume = {451}, 22294 number = {7182}, 22295 pages = {1094--1097}, 22296 year = {2008}, 22297 publisher = {Nature Publishing Group} 22298} 22299 22300@Article{ savage1999, 22301 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 22302 splitting?}, 22303 author = {MK Savage}, 22304 journal = {Reviews of Geophysics}, 22305 volume = {37}, 22306 number = {1}, 22307 pages = {65--106}, 22308 year = {1999} 22309} 22310 22311@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 22312 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 22313 of airborne contaminants}, 22314 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 22315 Omar Ghattas and Bart Van Bloemen Waanders}, 22316 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 22317 pages = {43}, 22318 year = {2005}, 22319 organization = {IEEE Computer Society} 22320} 22321 22322@Article{ draganescusoane2013, 22323 title = {Multigrid solution of a distributed optimal control problem constrained by the 22324 {Stokes} equations}, 22325 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 22326 journal = {Applied Mathematics and Computation}, 22327 volume = {219}, 22328 number = {10}, 22329 pages = {5622--5634}, 22330 year = {2013} 22331} 22332 22333@Article{ zhonggurnis1995, 22334 title = {Mantle convection with plates and mobile, faulted plate margins}, 22335 author = {Shijie Zhong and Michael Gurnis}, 22336 journal = {Science}, 22337 volume = {267}, 22338 number = {5199}, 22339 pages = {838}, 22340 year = {1995} 22341} 22342 22343@Article{ studerbobinchahidmousavicandesdahan2012, 22344 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 22345 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 22346 and Emmanuel Candes and Maxime Dahan}, 22347 journal = {Proceedings of the National Academy of Sciences}, 22348 volume = {109}, 22349 number = {26}, 22350 pages = {E1679--E1687}, 22351 year = {2012} 22352} 22353 22354@Article{ borsukhigdonstowreckhow2001, 22355 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 22356 matter loading in estuaries and coastal zones}, 22357 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 22358 journal = {Ecological Modelling}, 22359 volume = {143}, 22360 number = {3}, 22361 pages = {165--181}, 22362 year = {2001} 22363} 22364 22365@Article{ liebermanwillcox2012, 22366 title = {Goal-oriented inference: Approach, linear theory, and application to advection 22367 diffusion}, 22368 author = {Chad Lieberman and Karen Willcox}, 22369 journal = {SIAM Journal on Scientific Computing}, 22370 volume = {34}, 22371 number = {4}, 22372 pages = {A1880--A1904}, 22373 year = {2012} 22374} 22375 22376@Article{ chaillatbiros2012, 22377 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 22378 frequencies and multiple sources for the scalar {Helmholtz} equation}, 22379 author = {St{\'e}phanie Chaillat and George Biros}, 22380 journal = {Journal of Computational Physics}, 22381 volume = {231}, 22382 number = {12}, 22383 pages = {4403--4421}, 22384 year = {2012} 22385} 22386 22387@Article{ farhattezaurdjellouli2002, 22388 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 22389 problems by a regularized {Newton} method}, 22390 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 22391 journal = {Inverse problems}, 22392 volume = {18}, 22393 number = {5}, 22394 pages = {1229}, 22395 year = {2002} 22396} 22397 22398@Article{ orozcoghattas1992, 22399 title = {Massively parallel aerodynamic shape optimization}, 22400 author = {Orozco, Carlos E and Ghattas, ON}, 22401 journal = {Computing Systems in Engineering}, 22402 volume = {3}, 22403 number = {1-4}, 22404 pages = {311--320}, 22405 year = {1992} 22406} 22407 22408@Article{ reutheralonsorimlingerjameson1999, 22409 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 22410 adjoint formulation on distributed memory parallel computers}, 22411 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 22412 journal = {Computers \& fluids}, 22413 volume = {28}, 22414 number = {4}, 22415 pages = {675--700}, 22416 year = {1999} 22417} 22418 22419@Article{ rudistadlerghattas2016, 22420 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 22421 Heterogeneous Viscosity}, 22422 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 22423 journal = {ArXiv e-prints}, 22424 archiveprefix = {arXiv}, 22425 primaryclass = {math.NA}, 22426 eprint = {1607.03936}, 22427 month = jul, 22428 year = {2016} 22429} 22430 22431@Article{ borzikunisch2006, 22432 title = {A globalization strategy for the multigrid solution of elliptic optimal control 22433 problems}, 22434 author = {Borzi, A and Kunisch, K}, 22435 journal = {Optimisation Methods and Software}, 22436 volume = {21}, 22437 number = {3}, 22438 pages = {445--459}, 22439 year = {2006} 22440} 22441 22442@Article{ nash2000, 22443 title = {A multigrid approach to discretized optimization problems}, 22444 author = {Stephen G Nash}, 22445 journal = {Optimization Methods and Software}, 22446 volume = {14}, 22447 number = {1-2}, 22448 pages = {99--116}, 22449 year = {2000} 22450} 22451 22452@Article{ jameson1983, 22453 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 22454 method}, 22455 author = {Antony Jameson}, 22456 journal = {Applied mathematics and computation}, 22457 volume = {13}, 22458 number = {3-4}, 22459 pages = {327--355}, 22460 year = {1983} 22461} 22462 22463@Article{ billen2008, 22464 title = {Modeling the dynamics of subducting slabs}, 22465 author = {Magali I Billen}, 22466 journal = {Annu. Rev. Earth Planet. Sci.}, 22467 volume = {36}, 22468 pages = {325--356}, 22469 year = {2008} 22470} 22471 22472@Article{ gerya2011, 22473 title = {Future directions in subduction modeling}, 22474 author = {Taras Gerya}, 22475 journal = {Journal of Geodynamics}, 22476 volume = {52}, 22477 number = {5}, 22478 pages = {344--378}, 22479 year = {2011} 22480} 22481 22482@Article{ tackley2000, 22483 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 22484 theory}, 22485 author = {Paul J Tackley}, 22486 journal = {Science}, 22487 volume = {288}, 22488 number = {5473}, 22489 pages = {2002--2007}, 22490 year = {2000} 22491} 22492 22493@Article{ caseydewey1984, 22494 title = {Initiation of subduction zones along transform and accreting plate boundaries, 22495 triple-junction evolution, and forearc spreading centres—implications for 22496 ophiolitic geology and obduction}, 22497 author = {JF Casey and JF Dewey}, 22498 journal = {Geological Society, London, Special Publications}, 22499 volume = {13}, 22500 number = {1}, 22501 pages = {269--290}, 22502 year = {1984} 22503} 22504 22505@Article{ doughertyclayton2014, 22506 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 22507 in the {South Cocos} plate}, 22508 author = {Sara L Dougherty and Robert W Clayton}, 22509 journal = {Journal of Geophysical Research: Solid Earth}, 22510 volume = {119}, 22511 number = {4}, 22512 pages = {3424--3447}, 22513 year = {2014} 22514} 22515 22516@Article{ syracusemaceiraprietozhangammon2016, 22517 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 22518 velocity from the joint inversion of seismic and gravity data}, 22519 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 22520 Charles J Ammon}, 22521 journal = {Earth and Planetary Science Letters}, 22522 volume = {444}, 22523 pages = {139--149}, 22524 year = {2016} 22525} 22526 22527@Article{ bowergurnisflament2015, 22528 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 22529 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 22530 journal = {Physics of the Earth and Planetary Interiors}, 22531 volume = {238}, 22532 pages = {8--22}, 22533 year = {2015} 22534} 22535 22536@Book{ ciarlet1976, 22537 title = {Numerical analysis of the finite element method}, 22538 author = {Philippe G Ciarlet}, 22539 volume = {59}, 22540 year = {1976}, 22541 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 22542} 22543 22544@InProceedings{ liumellorcrummey2013, 22545 title = {A data-centric profiler for parallel programs}, 22546 author = {Xu Liu and John Mellor-Crummey}, 22547 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 22548 Storage and Analysis (SC)}, 22549 pages = {1--12}, 22550 year = {2013}, 22551 organization = {IEEE} 22552} 22553 22554@InCollection{ ernstgander2012, 22555 title = {Why it is difficult to solve Helmholtz problems with classical iterative 22556 methods}, 22557 author = {Oliver G Ernst and Martin J Gander}, 22558 booktitle = {Numerical analysis of multiscale problems}, 22559 pages = {325--363}, 22560 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 22561 year = {2012} 22562} 22563 22564@Article{ warburtonkarniadakis1999, 22565 title = {A discontinuous {G}alerkin method for the viscous {MHD} equations}, 22566 author = {Timothy C Warburton and George E Karniadakis}, 22567 journal = {Journal of Computational Physics}, 22568 volume = {152}, 22569 number = {2}, 22570 pages = {608--641}, 22571 year = {1999} 22572} 22573 22574@Article{ salahsoulaimanihabashi2001, 22575 title = {A finite element method for magnetohydrodynamics}, 22576 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 22577 journal = {Computer Methods in Applied Mechanics and Engineering}, 22578 volume = {43}, 22579 number = {190}, 22580 pages = {5867--5892}, 22581 year = {2001} 22582} 22583 22584@Article{ nesliturktezersezgin2005, 22585 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 22586 author = {Ali I Nesliturk and M Tezer-Sezgin}, 22587 journal = {Computer methods in applied mechanics and engineering}, 22588 volume = {194}, 22589 number = {9}, 22590 pages = {1201--1224}, 22591 year = {2005} 22592} 22593 22594@Article{ strakschellart2016, 22595 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 22596 Upwellings: Insights from Analog Models}, 22597 author = {Vincent Strak and Wouter P Schellart}, 22598 journal = {Journal of Geophysical Research: Solid Earth}, 22599 year = {2016} 22600} 22601 22602@InBook{ kirbyloggrognesterrel2012, 22603 title = {Common and unusual finite elements}, 22604 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 22605 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22606 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22607 {FEniCS} Book}, 22608 publisher = {Springer Berlin Heidelberg}, 22609 address = {Berlin, Heidelberg}, 22610 pages = {95--119}, 22611 isbn = {978-3-642-23099-8}, 22612 doi = {10.1007/978-3-642-23099-8_3}, 22613 year = {2012} 22614} 22615 22616@InBook{ kirbymardal2012, 22617 author = {Robert C. Kirby and Kent-Andre Mardal}, 22618 title = {Constructing general reference finite elements}, 22619 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22620 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22621 {FEniCS} Book}, 22622 publisher = {Springer Berlin Heidelberg}, 22623 address = {Berlin, Heidelberg}, 22624 pages = {121--132}, 22625 isbn = {978-3-642-23099-8}, 22626 doi = {10.1007/978-3-642-23099-8_4}, 22627 year = {2012} 22628} 22629 22630@Book{ wriggers2008, 22631 title = {Nonlinear finite element methods}, 22632 author = {Peter Wriggers}, 22633 publisher = {Springer Science \& Business Media}, 22634 year = {2008} 22635} 22636 22637@Book{ zienkiewicztaylor1977, 22638 title = {The finite element method}, 22639 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 22640 publisher = {McGraw-hill London}, 22641 volume = {3}, 22642 year = {1977} 22643} 22644 22645@Article{ rogneskirbylogg2009, 22646 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 22647 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 22648 journal = {SIAM Journal on Scientific Computing}, 22649 volume = {31}, 22650 number = {6}, 22651 pages = {4130--4151}, 22652 year = {2009} 22653} 22654 22655@Book{ kelley03, 22656 title = {Solving nonlinear equations with Newton's method}, 22657 author = {Carl T. Kelley}, 22658 publisher = {SIAM}, 22659 year = {2003} 22660} 22661 22662@Article{ turing1937, 22663 title = {The Chemical Basis of Morphogenesis}, 22664 author = {A. M. Turing}, 22665 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 22666 volume = {237}, 22667 number = {641}, 22668 pages = {37--72}, 22669 doi = {10.1098/rstb.1952.0012}, 22670 issn = {0080-4622}, 22671 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 22672 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 22673 year = {1952} 22674} 22675 22676@Article{ fabienknepleymillsriviere2017, 22677 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 22678 multigrid method}, 22679 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 22680 Rivi\`ere}, 22681 journal = {SIAM Journal on Scientific Computing}, 22682 url = {https://arxiv.org/abs/1705.09907}, 22683 volume = {41}, 22684 number = {2}, 22685 pages = {C73--C96}, 22686 doi = {10.1137/17M1128903}, 22687 year = {2018} 22688} 22689 22690@Article{ fabienknepleyriviere2018, 22691 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 22692 porous media}, 22693 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 22694 journal = {International Journal for Numerical Methods in Engineering}, 22695 volume = {116}, 22696 number = {3}, 22697 pages = {161--177}, 22698 doi = {10.1002/nme.5919}, 22699 year = {2018} 22700} 22701 22702@Article{ fabienknepleyriviere2020, 22703 title = {A high order hybridizable discontinuous Galerkin method for incompressible 22704 miscible displacement in heterogeneous media}, 22705 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22706 journal = {Results in Applied Mathematics}, 22707 url = {https://arxiv.org/abs/1809.00747}, 22708 volume = {8}, 22709 pages = {100089}, 22710 doi = {10.1016/j.rinam.2019.100089}, 22711 year = {2020} 22712} 22713 22714@Article{ fabienknepleyriviere2019b, 22715 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 22716 second order elliptic problems}, 22717 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22718 journal = {Journal of Numerical Mathematics}, 22719 volume = {28}, 22720 number = {3}, 22721 pages = {161--174}, 22722 doi = {10.1515/jnma-2019-0027}, 22723 year = {2019} 22724} 22725 22726@Article{ fabien2019, 22727 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 22728 Elasticity}, 22729 author = {Maurice S. Fabien}, 22730 journal = {Communications in Computational Physics}, 22731 volume = {27}, 22732 number = {2}, 22733 pages = {513--545}, 22734 issn = {1991-7120}, 22735 doi = {10.4208/cicp.OA-2018-0235}, 22736 year = {2019} 22737} 22738 22739@Unpublished{ awanoufabienguzmanstern2020, 22740 title = {Hybridization and postprocessing in finite element exterior calculus}, 22741 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 22742 eprint = {2008.00149}, 22743 note = {preprint}, 22744 primaryclass = {math.NA}, 22745 year = {2020} 22746} 22747 22748@Article{ fabienguzmanneilanzytoon2022, 22749 title = {Low-order divergence-free approximations for the Stokes problem on Worsey--Farin and Powell--Sabin splits}, 22750 author = {Maurice Fabien and Johnny Guzm{\'a}n and Michael Neilan and Ahmed Zytoon}, 22751 journal = {Computer Methods in Applied Mechanics and Engineering}, 22752 volume = {390}, 22753 pages = {114444}, 22754 year = {2022}, 22755} 22756 22757@Article{ chaabanegiraultrivierethompson2018, 22758 title = {A stable enriched {G}alerkin element for the {S}tokes problem}, 22759 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 22760 journal = {Applied Numerical Mathematics}, 22761 volume = {132}, 22762 pages = {1--21}, 22763 issn = {0168-9274}, 22764 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 22765 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 22766 year = {2018} 22767} 22768 22769@Article{ thompsonriviereknepley2018, 22770 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 22771 Resuscitation In The Small Intestine}, 22772 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 22773 journal = {Mathematical Medicine and Biology}, 22774 volume = {36}, 22775 number = {4}, 22776 pages = {513--548}, 22777 doi = {10.1093/imammb/dqz00}, 22778 year = {2019} 22779} 22780 22781@Article{ kevrekidisthompsongoriely2020, 22782 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 22783 Diseases}, 22784 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 22785 journal = {Physics Letters A}, 22786 volume = {384}, 22787 number = {36}, 22788 pages = {126935}, 22789 year = {2020} 22790} 22791 22792@Article{ mardalrognesthompson2021, 22793 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 22794 {Stokes-Biot} Stability Revisited}, 22795 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 22796 journal = {BIT Numerical Mathematics}, 22797 pages = {1--36}, 22798 year = {2021} 22799} 22800 22801@Article{ piersantileethompsonmardalrognes2021, 22802 title = {Parameter robust preconditioning by congruence for multiple-network 22803 poroelasticity}, 22804 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 22805 Rognes, Marie E}, 22806 journal = {SIAM Journal on Scientific Computing}, 22807 volume = {43}, 22808 number = {4}, 22809 pages = {B984--B1007}, 22810 year = {2021}, 22811 publisher = {SIAM} 22812} 22813 22814@Article{ walkerknepleyaagaardwilliams2023, 22815 title = {Multiphysics Modeling in {PyLith}: Poroelasticity}, 22816 author = {Robert L. Walker and Matthew G. Knepley and Brad T. Aagaard and Charles A. Williams}, 22817 journal = {Geophysical Journal International}, 22818 volume = {235}, 22819 number = {3}, 22820 pages = {2442--2475}, 22821 doi = {10.1093/gji/ggad370}, 22822 year = {2023} 22823} 22824 22825@InProceedings{ actorfuentesriviere2020b, 22826 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 22827 Level Set Equation and Deep Learning for Image Segmentation}, 22828 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22829 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 22830 year = {2020} 22831} 22832 22833@Article{ actorfuentesriviere2020, 22834 title = {Robust Regularized Networks in the Presence of Noise}, 22835 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22836 journal = {Medical Image Analysis}, 22837 note = {In revision}, 22838 year = {2020} 22839} 22840 22841@Book{ byerly1893, 22842 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 22843 ellipsoidal harmonics, with applications to problems in mathematical physics}, 22844 author = {William Elwood Byerly}, 22845 publisher = {Dover}, 22846 year = {1893} 22847} 22848 22849@Book{ hobson1931, 22850 title = {The theory of spherical and ellipsoidal harmonics}, 22851 author = {Ernest William Hobson}, 22852 year = {1931}, 22853 publisher = {CUP Archive} 22854} 22855 22856@Book{ dassios2012, 22857 title = {Ellipsoidal harmonics: theory and applications}, 22858 author = {George Dassios}, 22859 volume = {146}, 22860 year = {2012}, 22861 publisher = {Cambridge University Press} 22862} 22863 22864@Book{ miller1977, 22865 title = {Symmetry and separation of variables}, 22866 author = {Miller, Jr, Willard}, 22867 year = {1977}, 22868 address = {Reading, MA}, 22869 publisher = {Addison-Wesley Publishing Co., Inc.} 22870} 22871 22872@TechReport{ epanet-users-manual, 22873 author = {Lewis A. Rossman}, 22874 title = {{EPANET 2} Users Manual}, 22875 institution = {Water Supply and Water Resources Division, National Risk Management Research 22876 Laboratory, Cincinnati, OH 45268}, 22877 year = {2000} 22878} 22879 22880@Article{ klocknerbarnettgreengardoneil2013, 22881 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 22882 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 22883 O'Neil}, 22884 journal = {Journal of Computational Physics}, 22885 volume = {252}, 22886 pages = {332--349}, 22887 year = {2013} 22888} 22889 22890@Article{ turcksinkronbichlerbangerth2016, 22891 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 22892 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 22893 journal = {ACM Transactions on Mathematical Software)}, 22894 volume = {43}, 22895 number = {1}, 22896 pages = {2}, 22897 year = {2016} 22898} 22899 22900@Article{ vitushkin1954, 22901 title = {On {Hilbert's} thirteenth problem}, 22902 author = {A. G. Vitushkin}, 22903 journal = {Dokl. Akad. Nauk SSSR}, 22904 volume = {95}, 22905 pages = {701--704}, 22906 year = {1954} 22907} 22908 22909@Article{ kolmogorov1957, 22910 title = {On the representation of continuous functions of several variables as 22911 superpositions of continuous functions of one variable and addition}, 22912 author = {Andrei N. Kolmogorov}, 22913 journal = {Dokl. Akad. Nauk SSSR}, 22914 pages = {953--956}, 22915 volume = {114:5}, 22916 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 22917 year = {1957} 22918} 22919 22920@Article{ fridman1967, 22921 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 22922 Theorem}}, 22923 author = {B. L. Fridman}, 22924 journal = {Dokl. Akad. Nauk SSR}, 22925 volume = {177:5}, 22926 pages = {1019--1022}, 22927 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 22928 year = {1967} 22929} 22930 22931@Article{ sprecher1972, 22932 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 22933 author = {David Sprecher}, 22934 journal = {Journal of Mathematical Analysis and Applications}, 22935 volume = {38}, 22936 pages = {208--213}, 22937 year = {1972} 22938} 22939 22940@Article{ diaconisshahshahani1984, 22941 title = {On nonlinear functions of linear combinations}, 22942 author = {Persi Diaconis and Mehrdad Shahshahani}, 22943 journal = {SIAM Journal on Scientific and Statistical Computing}, 22944 volume = {5}, 22945 number = {1}, 22946 pages = {175--191}, 22947 year = {1984}, 22948 publisher = {SIAM} 22949} 22950 22951@InProceedings{ hechtnielsen1987, 22952 title = {Kolmogorov's mapping neural network existence theorem}, 22953 author = {R. Hecht-Nielsen}, 22954 booktitle = {Proceedings of the International Conference on Neural Networks}, 22955 volume = {III}, 22956 pages = {11--14}, 22957 publisher = {IEEE Press}, 22958 year = {1987} 22959} 22960 22961@InProceedings{ hechtnielsen1989, 22962 title = {Theory of the back-propagation neural network}, 22963 author = {R. Hecht-Nielsen}, 22964 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 22965 volume = {I}, 22966 pages = {593--608}, 22967 publisher = {IEEE Press}, 22968 year = {1989} 22969} 22970 22971@Article{ girosipoggio1989, 22972 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 22973 author = {Federico Girosi and Tomaso Poggio}, 22974 journal = {Neural Computation}, 22975 volume = {1}, 22976 number = {4}, 22977 pages = {465--469}, 22978 year = {1989}, 22979 publisher = {MIT Press} 22980} 22981 22982@InBook{ koppen2002, 22983 title = {On the Training of a Kolmogorov Network}, 22984 author = {Mario K\"oppen}, 22985 pages = {474--9}, 22986 publisher = {ICANN 2002, LNCS 2415}, 22987 year = {2002} 22988} 22989 22990@PhDThesis{ bryant2008, 22991 title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in 22992 applications with low and high dimensional data}, 22993 author = {Donald W Bryant}, 22994 school = {University of Central Florida}, 22995 year = {2008} 22996} 22997 22998@InCollection{ griebel2006, 22999 title = {Sparse Grids for Higher Dimensional Problems}, 23000 author = {Michael Griebel}, 23001 booktitle = {Foundations of Computational Mathematics}, 23002 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 23003 publisher = {Cambridge University Press}, 23004 pages = {106--161}, 23005 doi = {10.1017/CBO9780511721571.004}, 23006 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 23007 month = jun, 23008 day = {29}, 23009 year = {2006} 23010} 23011 23012@Article{ braungriebel2009, 23013 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 23014 author = {Jurgen Bra\"un and Michael Griebel}, 23015 journal = {Constructive Approximation}, 23016 pages = {653--675}, 23017 volume = {30}, 23018 year = {2009} 23019} 23020 23021@InProceedings{ lenifougerolletruchetet2009, 23022 title = {Kolmogorov superposition theorem and its application to wavelet image 23023 decompositions}, 23024 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 23025 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 23026 of the SPIE}, 23027 pages = {724804--724804}, 23028 doi = {10.1117/12.805916}, 23029 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 23030 year = {2009} 23031} 23032 23033@Article{ oseledets2011, 23034 title = {Tensor-train decomposition}, 23035 author = {Ivan V Oseledets}, 23036 journal = {SIAM Journal on Scientific Computing}, 23037 volume = {33}, 23038 number = {5}, 23039 pages = {2295--2317}, 23040 year = {2011} 23041} 23042 23043@PhDThesis{ liu2015, 23044 title = {Kolmogorov superposition theorem and its applications}, 23045 author = {Xing Liu}, 23046 school = {Imperial College London}, 23047 year = {2015} 23048} 23049 23050@Article{ lecunbengiohinton2015, 23051 title = {Deep learning}, 23052 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 23053 journal = {Nature}, 23054 volume = {521}, 23055 number = {7553}, 23056 pages = {436--444}, 23057 year = {2015} 23058} 23059 23060@Book{ trefethen2013, 23061 title = {Approximation theory and approximation practice}, 23062 author = {Lloyd N Trefethen}, 23063 publisher = {SIAM}, 23064 year = {2013} 23065} 23066 23067@Article{ butlergrahammattiswalsh2017, 23068 title = {A measure-theoretic interpretation of sample based numerical integration with 23069 applications to inverse and prediction problems under uncertainty}, 23070 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 23071 journal = {SIAM Journal on Scientific Computing}, 23072 volume = {39}, 23073 number = {5}, 23074 pages = {A2072--A2098}, 23075 year = {2017} 23076} 23077 23078@Article{ logg2009, 23079 title = {Efficient representation of computational meshes}, 23080 author = {Anders Logg}, 23081 journal = {International Journal of Computational Science and Engineering}, 23082 volume = {4}, 23083 number = {4}, 23084 pages = {283--295}, 23085 year = {2009} 23086} 23087 23088@Article{ agelekandersonbangerthbarth2017, 23089 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 23090 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 23091 journal = {ACM Transactions on Mathematical Software (TOMS)}, 23092 volume = {44}, 23093 number = {1}, 23094 pages = {5}, 23095 year = {2017} 23096} 23097 23098@Article{ actorknepley2018, 23099 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 23100 Superposition Theorem}}, 23101 author = {Jonas Actor and Matthew G. Knepley}, 23102 eprint = {1712.08286}, 23103 archiveprefix = {arXiv}, 23104 primaryclass = {math.na}, 23105 note = {\url{http://arxiv.org/abs/1712.08286}}, 23106 year = {2018} 23107} 23108 23109@Book{ driscollhaletrefethen2014, 23110 title = {Chebfun guide}, 23111 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 23112 publisher = {Pafnuty Publications, Oxford}, 23113 year = {2014} 23114} 23115 23116@Article{ johntobiska2000, 23117 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 23118 solution of the incompressible Navier-Stokes equations}, 23119 author = {Volker John and Lutz Tobiska}, 23120 journal = {International Journal for Numerical Methods in Fluids}, 23121 volume = {33}, 23122 number = {4}, 23123 pages = {453--473}, 23124 year = {2000} 23125} 23126 23127@Article{ vanka1986, 23128 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 23129 author = {S. P. Vanka}, 23130 journal = {Computer Methods in Applied Mechanics and Engineering}, 23131 volume = {59}, 23132 number = {1}, 23133 pages = {29--48}, 23134 year = {1986} 23135} 23136 23137@Article{ bartelgunther2018, 23138 author = {Andreas Bartel and Michael G\"unther}, 23139 title = {{PDAEs} in refined electrical network modeling}, 23140 journal = {SIAM Review}, 23141 volume = {60}, 23142 number = {1}, 23143 pages = {56--91}, 23144 doi = {10.1137/17M1113643}, 23145 year = {2018} 23146} 23147 23148@Article{ matpower, 23149 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 23150 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 23151 systems research and education}, 23152 journal = {IEEE Transactions on Power Systems}, 23153 volume = {26}, 23154 number = {1}, 23155 pages = {12--19}, 23156 year = {2011}, 23157 doi = {10.1109/TPWRS.2010.2051168} 23158} 23159 23160@Article{ betrieyan2018, 23161 author = {G. Betrie and E. Yan}, 23162 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 23163 Energy and Water Nexus}, 23164 journal = {Applied Energy, Submitted}, 23165 volume = {}, 23166 number = {}, 23167 pages = {}, 23168 doi = {}, 23169 year = {2018} 23170} 23171 23172@Article{ faeth2012, 23173 author = {P. Faeth}, 23174 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 23175 journal = {Environment: Science and Policy for Sustainable Development}, 23176 volume = {54(1)}, 23177 number = {1}, 23178 pages = {4--19}, 23179 year = {2012}, 23180 doi = {10.1080/00139157.2012.639595} 23181} 23182 23183@InProceedings{ hagberg2008, 23184 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 23185 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 23186 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 23187 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 23188 year = {2008}, 23189 pages = {11--15} 23190} 23191 23192@Misc{ simulink-web-page, 23193 author = {Mathworks}, 23194 title = {{SIMULINK} web page}, 23195 note = {\url{https://www.mathworks.com/products/simulink.html}}, 23196 year = {2017} 23197} 23198 23199@Misc{ labview-web-page, 23200 author = {National Instruments}, 23201 title = {{LabVIEW} web page}, 23202 note = {\url{http://www.ni.com/labview/}}, 23203 key = {labview}, 23204 year = {2017} 23205} 23206 23207@Misc{ modelica-web-page, 23208 author = {Modelica Association}, 23209 title = {Modelica web page}, 23210 note = {\url{https://www.modelica.org/}}, 23211 year = {2017} 23212} 23213 23214@InProceedings{ yangsc16, 23215 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 23216 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 23217 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 23218 Computing, Networking, Storage and Analysis}, 23219 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 23220 Dynamics}, 23221 note = {Gordon Bell Award}, 23222 year = {2016} 23223} 23224 23225@InProceedings{ bekassc15, 23226 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 23227 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 23228 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 23229 Computing, Networking, Storage and Analysis}, 23230 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 23231 Earth's Mantle}, 23232 note = {Gordon Bell Award}, 23233 year = {2015} 23234} 23235 23236@Misc{ improving-software-whitepaper2017, 23237 author = {M. Heroux and L.C. McInnes}, 23238 title = {Improving and accelerating scientific discovery through better software}, 23239 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 23240 doi = {10.6084/m9.figshare.5339692}, 23241 year = {2017} 23242} 23243 23244@Misc{ doe:40thanniversarycollection, 23245 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 23246 changed the face of science}, 23247 key = {Department of Energy, Office of Science}, 23248 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 23249 year = {2017} 23250} 23251 23252@Misc{ siam:fellowsprogram, 23253 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 23254 key = {SIAM}, 23255 howpublished = {\url{http://www.siam.org/prizes/fellows}} 23256} 23257 23258@Misc{ r-and-d100:awards2009, 23259 title = {{R\&D100 Award Winners 2009}}, 23260 key = {{R\&D100 Award Winners 2009}}, 23261 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 23262} 23263 23264@Misc{ xsdk:website, 23265 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 23266 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 23267 howpublished = {\url{https://xsdk.info}} 23268} 23269 23270@Misc{ xsdk-community-installation-policies2017, 23271 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 23272 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 23273 note = {version 0.3, November 7, 2017}, 23274 doi = {10.6084/m9.figshare.4495133}, 23275 year = {2017} 23276} 23277 23278@Misc{ xsdk-community-package-policies2017, 23279 title = {{xSDK} Community Package Policies}, 23280 author = {B. Smith and R. Bartlett and {xSDK developers}}, 23281 note = {version 0.3, November 7, 2017}, 23282 doi = {10.6084/m9.figshare.4495136}, 23283 year = {2017} 23284} 23285 23286@Misc{ ideas-what-are-interoperable-libraries, 23287 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 23288 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 23289 Ulrike Yang and {all xSDK developers}}, 23290 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 23291 \url{https://ideas-productivity.org/resources/howtos/}}, 23292 year = {2016} 23293} 23294 23295@Misc{ ideas-productivity:website, 23296 title = {{IDEAS Scientific Software Productivity Project}}, 23297 key = {IDEAS Scientific Software Productivity Project}, 23298 howpublished = {\url{https://ideas-productivity.org}} 23299} 23300 23301@Misc{ ecp:website, 23302 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 23303 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 23304 note = {\url{https://exascaleproject.org}}, 23305 year = {2018} 23306} 23307 23308@Misc{ siam-cse-jan2018, 23309 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 23310 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 23311 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 23312 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 23313 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 23314 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 23315 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 23316 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 23317 title = {Research and Education in Computational Science and Engineering}, 23318 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 23319 Review}}, 23320 year = {2018} 23321} 23322 23323@Misc{ doe-appliedmathpimeeting2017, 23324 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 23325 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 23326 Willcox and Steven Lee}, 23327 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 23328 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 23329 year = {2017} 23330} 23331 23332@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 23333 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 23334 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 23335 Sciences}}, 23336 note = {available via 23337 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 23338 year = {2015} 23339} 23340 23341@Misc{ sisc-specialissueintro, 23342 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 23343 Software'} and {'Big Data in CSE'}}, 23344 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 23345 month = nov, 23346 year = {2016}, 23347 journal = {SIAM J. Sci. Comput.}, 23348 doi = {10.1137/16N974188} 23349} 23350 23351@Article{ xsdk-foundations2017, 23352 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 23353 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 23354 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 23355 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 23356 journal = {Supercomputing Frontiers and Innovations}, 23357 month = feb, 23358 year = {2017}, 23359 note = {available via \url{https://arxiv.org/abs/1702.08425}} 23360} 23361 23362@Misc{ openfoam:website, 23363 title = {{OpenFOAM}}, 23364 author = {OpenFOAM Team}, 23365 key = {OpenFOAM}, 23366 howpublished = {\url{https://openfoam.com}} 23367} 23368 23369@Misc{ mfem:website, 23370 title = {{MFEM}}, 23371 author = {Tzanio Kolev and MFEM Team}, 23372 key = {MFEM}, 23373 howpublished = {\url{https://mfem.org}} 23374} 23375 23376@Misc{ deal.ii:website, 23377 title = {{{deal.II}: An open-source finite element library}}, 23378 author = {Wolfgang Bangerth and Deal.II Team}, 23379 howpublished = {\url{http://www.dealii.org}}, 23380 year = {2018} 23381} 23382 23383@Misc{ ibamr:website, 23384 title = {{{IBAMR}: Immersed Boundary Method Adaptive Mesh Refinement Software Infrastructure}}, 23385 author = {Boyce Griffith and IBAMR Team}, 23386 howpublished = {\url{https://ibamr.github.io/}}, 23387 year = {2023} 23388} 23389 23390@Misc{ fission-gas-scidac:website, 23391 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 23392 author = {A. David {Andersson (PI)}}, 23393 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 23394 year = {2018} 23395} 23396 23397@Misc{ tokamak-disruption-scidac:project, 23398 title = {{Tokamak Disruption Simulation}}, 23399 author = {Xianzhu {Tang (PI)}}, 23400 howpublished = {SciDAC project}, 23401 year = {2018} 23402} 23403 23404@InProceedings{ duplyakin2018memory, 23405 title = {Evaluating Active Learning with Cost and Memory Awareness}, 23406 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 23407 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 23408 pages = {214--223}, 23409 year = {2018}, 23410 organization = {IEEE}, 23411 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 23412} 23413 23414@InProceedings{ duplyakin2016active, 23415 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 23416 title = {Active Learning in Performance Analysis}, 23417 booktitle = {Proceedings of the IEEE Cluster Conference}, 23418 year = {2016}, 23419 month = sep, 23420 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 23421 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 23422} 23423 23424@Misc{ xgc1:website, 23425 title = {{XGC1 project website}}, 23426 author = {C. S. Chang and others}, 23427 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 23428 year = {2018} 23429} 23430 23431@Misc{ wdmapp-bhattacharjee-ecp:website, 23432 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 23433 Plasmas}}, 23434 author = {A. Bhattacharjee and others}, 23435 note = {ECP application project}, 23436 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 23437 year = {2018} 23438} 23439 23440@Misc{ subsurface-steefel-ecp:website, 23441 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 23442 and Mechanics}}, 23443 note = {ECP application project}, 23444 author = {C. Steefel and others}, 23445 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 23446 year = {2018} 23447} 23448 23449@Article{ chombo-crunch:2014, 23450 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 23451 with Carbon Sequestration}, 23452 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 23453 journal = {Computing in Science and Engineering}, 23454 volume = {16}, 23455 issue = {6}, 23456 year = {2014}, 23457 pages = {22--31}, 23458 doi = {10.1109/MCSE.2014.77} 23459} 23460 23461@Article{ courantfriedrichslewy1967, 23462 title = {On the partial difference equations of mathematical physics}, 23463 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 23464 journal = {IBM journal of Research and Development}, 23465 volume = {11}, 23466 number = {2}, 23467 pages = {215--234}, 23468 year = {1967}, 23469 publisher = {IBM} 23470} 23471 23472@Article{ erway2017solving, 23473 title = {On solving large-scale limited-memory quasi-Newton equations}, 23474 author = {Erway, Jennifer B and Marcia, Roummel F}, 23475 journal = {Linear Algebra and its Applications}, 23476 volume = {515}, 23477 pages = {196--225}, 23478 year = {2017}, 23479 publisher = {Elsevier} 23480} 23481 23482@Article{ griewank2012broyden, 23483 title = {Broyden updating, the good and the bad!}, 23484 author = {Griewank, Andreas}, 23485 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 23486 pages = {301--315}, 23487 year = {2012} 23488} 23489 23490@Book{ tarantola2005, 23491 title = {Inverse problem theory and methods for model parameter estimation}, 23492 author = {Albert Tarantola}, 23493 volume = {89}, 23494 year = {2005}, 23495 publisher = {SIAM} 23496} 23497 23498@Article{ rutkaikristof2010, 23499 title = {Dynamic Monte Carlo simulation in mixtures}, 23500 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 23501 journal = {The Journal of Chemical Physics}, 23502 volume = {132}, 23503 number = {10}, 23504 pages = {104107}, 23505 year = {2010}, 23506 publisher = {AIP} 23507} 23508 23509@Book{ vogel2002, 23510 title = {Computational methods for inverse problems}, 23511 author = {Curtis R Vogel}, 23512 volume = {23}, 23513 year = {2002}, 23514 publisher = {SIAM} 23515} 23516 23517@Article{ malqvistpeterseim2014, 23518 title = {Localization of elliptic multiscale problems}, 23519 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 23520 journal = {Mathematics of Computation}, 23521 volume = {83}, 23522 number = {290}, 23523 pages = {2583--2603}, 23524 year = {2014} 23525} 23526 23527@Article{ brandtbrannickkahllivshits2011, 23528 title = {Bootstrap {AMG}}, 23529 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 23530 journal = {SIAM Journal on Scientific Computing}, 23531 volume = {33}, 23532 number = {2}, 23533 pages = {612--632}, 23534 year = {2011} 23535} 23536 23537@InProceedings{ barralalauzet2014, 23538 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 23539 moving mesh strategy}, 23540 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 23541 booktitle = {44th AIAA Fluid Dynamics Conference}, 23542 pages = {2773}, 23543 year = {2014} 23544} 23545 23546@InProceedings{ barralalauzetloseille2015, 23547 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 23548 problems involving moving geometries}, 23549 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 23550 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 23551 pages = {2039}, 23552 year = {2015} 23553} 23554 23555@Article{ barralolivieralauzet2017, 23556 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 23557 problems with body-fitted moving geometries}, 23558 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 23559 journal = {Journal of Computational Physics}, 23560 volume = {331}, 23561 pages = {157--187}, 23562 year = {2017} 23563} 23564 23565@Article{ ibanezbarralkrakosloseillemichalpark2017, 23566 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 23567 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 23568 Michal and Mike Park}, 23569 journal = {Procedia engineering}, 23570 volume = {203}, 23571 pages = {154--166}, 23572 year = {2017} 23573} 23574 23575@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 23576 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 23577 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 23578 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 23579 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 23580 pages = {1103}, 23581 year = {2018} 23582} 23583 23584@InProceedings{ barralangeloudiskramergormanpiggott2018, 23585 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 23586 modelling}, 23587 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 23588 and Matthew D Piggott}, 23589 booktitle = {EGU General Assembly Conference Abstracts}, 23590 volume = {20}, 23591 pages = {19168}, 23592 year = {2018} 23593} 23594 23595@Article{ principe2009, 23596 title = {{Mathematical models for thermally coupled low speed flows}}, 23597 author = {Javier Principe and Ramon Codina}, 23598 journal = {Advances in Theoretical and Applied Mechanics}, 23599 volume = {2}, 23600 number = {1-4}, 23601 pages = {93--112}, 23602 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 23603 year = {2009} 23604} 23605 23606@Book{ vandervorst2003, 23607 title = {Iterative {K}rylov Methods for Large Linear Systems}, 23608 author = {van der Vorst, H.}, 23609 isbn = {9780521818285}, 23610 publisher = {Cambridge University Press}, 23611 year = {2003} 23612} 23613 23614@Book{ peres2006, 23615 author = {Asher Peres}, 23616 title = {Quantum theory: concepts and methods}, 23617 volume = {57}, 23618 publisher = {Springer Science \& Business Media}, 23619 year = {2006} 23620} 23621 23622@Book{ kuttler2012, 23623 title = {Linear algebra: theory and applications}, 23624 author = {Kenneth Kuttler}, 23625 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 23626 year = {2012} 23627} 23628 23629@Book{ elman_silvester_wathen_2014, 23630 place = {Oxford}, 23631 title = {Finite elements and fast iterative solvers: with applications in incompressible 23632 fluid dynamics}, 23633 publisher = {Oxford University Press}, 23634 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 23635 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 23636 year = {2014} 23637} 23638 23639@Article{ alametal2007, 23640 title = {An evaluation of the ORNL Cray XT3}, 23641 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 23642 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 23643 journal = {International Journal of High Performance Computing Applications}, 23644 volume = {22}, 23645 number = {1}, 23646 pages = {52--80}, 23647 doi = {10.1177/1094342007085019}, 23648 year = {2007} 23649} 23650 23651@Article{ plazacarey2000, 23652 title = {Local refinement of simplicial grids based on the skeleton}, 23653 author = {Plaza, A. and Carey, Graham F.}, 23654 journal = {Applied Numerical Mathematics}, 23655 doi = {10.1016/S0168-9274(99)00022-7}, 23656 issn = {01689274}, 23657 volume = {32}, 23658 number = {2}, 23659 pages = {195--218}, 23660 year = {2000} 23661} 23662 23663@Article{ carsonstrakos2020, 23664 title = {On the cost of iterative computations}, 23665 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 23666 journal = {Phil. Trans. R. Soc. A}, 23667 volume = {378}, 23668 number = {20190050}, 23669 doi = {10.1098/rsta.2019.0050}, 23670 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 23671 year = {2020} 23672} 23673 23674@Article{ schoberl1999, 23675 title = {Multigrid methods for a parameter dependent problem in primal variables}, 23676 author = {Joachim Sch{\"o}berl}, 23677 journal = {Numerische Mathematik}, 23678 volume = {84}, 23679 number = {1}, 23680 pages = {97--119}, 23681 year = {1999} 23682} 23683 23684@Article{ wuleexuzikatanov2008, 23685 title = {Convergence analysis on iterative methods for semidefinite systems}, 23686 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 23687 journal = {Journal of Computational Mathematics}, 23688 pages = {797--815}, 23689 year = {2008} 23690} 23691 23692@Article{ maierrannacher2016, 23693 title = {Duality-based adaptivity in finite element discretization of heterogeneous 23694 multiscale problems}, 23695 author = {Maier, Matthias and Rannacher, Rolf}, 23696 journal = {Journal of Numerical Mathematics}, 23697 volume = {24}, 23698 number = {3}, 23699 pages = {167--187}, 23700 year = {2016} 23701} 23702 23703@Article{ maierrannacher2018, 23704 title = {A duality-based optimization approach for model adaptivity in heterogeneous 23705 multiscale problems}, 23706 author = {Maier, Matthias and Rannacher, Rolf}, 23707 journal = {Multiscale Modeling \& Simulation}, 23708 volume = {16}, 23709 number = {1}, 23710 pages = {412--428}, 23711 year = {2018} 23712} 23713 23714@Article{ margetismaierluskin2017, 23715 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 23716 metamaterial sheet}, 23717 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 23718 journal = {Studies in Applied Mathematics}, 23719 volume = {139}, 23720 number = {4}, 23721 pages = {599--625}, 23722 year = {2017} 23723} 23724 23725@Article{ maiermargetisluskin2017b, 23726 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 23727 approximation and validation}, 23728 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 23729 journal = {Journal of Computational Physics}, 23730 volume = {339}, 23731 pages = {126--145}, 23732 year = {2017} 23733} 23734 23735@Article{ maiermargetisluskin2018, 23736 title = {Generation of surface plasmon-polaritons by edge effects}, 23737 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 23738 journal = {Communications in Mathematical Sciences}, 23739 volume = {16}, 23740 number = {1}, 23741 pages = {77--95}, 23742 url = {http://arxiv.org/abs/1702.00848}, 23743 year = {2018} 23744} 23745 23746@Article{ maiermattheakiskaxirasluskinmargetis2018, 23747 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 23748 metamaterials}, 23749 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23750 Mitchell and Margetis, Dionisios}, 23751 journal = {Physical Review B}, 23752 volume = {97}, 23753 number = {3}, 23754 pages = {035307}, 23755 year = {2018} 23756} 23757 23758@Article{ maiermattheakiskaxirasluskinmargetis2019, 23759 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 23760 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23761 Mitchell and Margetis, Dionisios}, 23762 journal = {Proceedings of the Royal Society A}, 23763 volume = {475}, 23764 number = {2230}, 23765 pages = {20190220}, 23766 year = {2019} 23767} 23768 23769@Article{ maiermargetisluskin2020, 23770 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 23771 two scales}, 23772 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 23773 journal = {Physical Review B}, 23774 volume = {102}, 23775 number = {7}, 23776 pages = {075308}, 23777 year = {2020} 23778} 23779 23780@Article{ margetismaierstauberlowluskin2020, 23781 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 23782 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 23783 Luskin, Mitchell}, 23784 journal = {Journal of Physics A: Mathematical and Theoretical}, 23785 volume = {53}, 23786 number = {5}, 23787 pages = {055201}, 23788 year = {2020} 23789} 23790 23791@Article{ maiermargetismellet2020, 23792 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 23793 structures}, 23794 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 23795 journal = {Journal of Computational and Applied Mathematics}, 23796 volume = {377}, 23797 pages = {112909}, 23798 year = {2020} 23799} 23800 23801@Article{ maierkronbichler2021, 23802 title = {Efficient parallel 3D computation of the compressible Euler equations with an 23803 invariant-domain preserving second-order finite-element scheme}, 23804 author = {Maier, Matthias and Kronbichler, Martin}, 23805 journal = {ACM Transactions on Parallel Computing}, 23806 volume = {8}, 23807 number = {3}, 23808 pages = {1--30}, 23809 year = {2021} 23810} 23811 23812@Article{ guermondmaierpopovtomas2021, 23813 title = {Second-order invariant domain preserving approximation of the compressible 23814 Navier--Stokes equations}, 23815 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 23816 journal = {Computer Methods in Applied Mechanics and Engineering}, 23817 volume = {375}, 23818 pages = {113608}, 23819 year = {2021} 23820} 23821 23822@Article{ liliptonmaier2021, 23823 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 23824 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 23825 eprint = {2009.12166}, 23826 archiveprefix = {arXiv}, 23827 primaryclass = {phys.optics}, 23828 year = {2021} 23829} 23830 23831@Article{ songmaierluskin2020, 23832 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 23833 gradient-index graphene waveguides}, 23834 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23835 journal = {Journal of Computational Physics}, 23836 volume = {423}, 23837 pages = {109871}, 23838 year = {2020} 23839} 23840 23841@Article{ songmaierluskin2019, 23842 title = {Adaptive finite element simulations of waveguide configurations involving 23843 parallel 2D material sheets}, 23844 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23845 journal = {Computer Methods in Applied Mechanics and Engineering}, 23846 volume = {351}, 23847 pages = {20--34}, 23848 year = {2019} 23849} 23850 23851% 23852% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 23853% 23854% 23855@Unpublished{ rob1, 23856 author = {Rob Kunz}, 23857 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 23858 State University}, 23859 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 23860 sponsors = {U.S. Navy, NRC}, 23861 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 23862 simulations, including lake warming by power plants}, 23863 dates = {Oct 3 and 4, 2002}, 23864 email = {rfk@wt.arl.psu.edu} 23865} 23866 23867@Unpublished{ au1, 23868 author = {Feng Wang and William Appelbe}, 23869 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 23870 url = {http://www.vpac.org}, 23871 sponsors = { }, 23872 note = {Using PETSc for a Variety of Geophysical Simulations}, 23873 dates = {Nov 22, 2002} 23874} 23875 23876@Unpublished{ carl1, 23877 author = {Carl Sovinec}, 23878 institution = {Applied Physics, University of Wisconsin}, 23879 url = {http://nimrodteam.org}, 23880 sponsors = {DOE Office of Fusion Research}, 23881 note = {Investigating using PETSc for NIMROD}, 23882 dates = {Nov 21, 2002}, 23883 email = {sovinec@engr.wisc.edu} 23884} 23885 23886@Unpublished{ au1b, 23887 author = {Pablo Carrica and Robert Wilson}, 23888 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 23889 url = {http://}, 23890 sponsors = {Office of Naval Research}, 23891 note = {Using PETSc for a hydrodynamics of ships and submarines}, 23892 dates = {Sept, 2002}, 23893 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 23894} 23895 23896% ------------------- TAO References ---------------------- 23897@Article{ benson:2001:csp, 23898 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 23899 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 23900 journal = {{ACM} Transactions on Mathematical Software}, 23901 volume = {27}, 23902 number = {3}, 23903 month = sep, 23904 year = {2001}, 23905 pages = {361--376} 23906} 23907 23908@TechReport{ tao-user-ref-2000, 23909 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 23910 title = {{TAO} Users Manual}, 23911 year = {2000}, 23912 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23913 number = {ANL/MCS-TM-242}, 23914 note = {See \url{http://www.mcs.anl.gov/tao}} 23915} 23916 23917% ------------------- Optimization References ---------------------- 23918@Book{ optguide93, 23919 title = {Optimization Software Guide}, 23920 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 23921 publisher = {SIAM Publications}, 23922 address = {Philadelphia}, 23923 year = {1993} 23924} 23925 23926@InProceedings{ more84, 23927 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 23928 Hillstrom}, 23929 title = {The {MINPACK} Project}, 23930 booktitle = {Sources and Development of Mathematical Software}, 23931 editor = {Wayne R. Cowell}, 23932 year = {1984}, 23933 pages = {88--111} 23934} 23935 23936@Article{ steihaug:83, 23937 author = {Trond Steihaug}, 23938 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 23939 journal = {SIAM J. Numer. Anal.}, 23940 volume = {20}, 23941 year = {1983}, 23942 pages = {626--637}, 23943 key = {steihaug92 ! trust_region} 23944} 23945 23946@TechReport{ minpack2test, 23947 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 23948 title = {The {MINPACK-2} Test Problem Collection}, 23949 institution = {Argonne National Laboratory}, 23950 year = {1991}, 23951 number = {ANL/MCS-TM-150}, 23952 key = {more91 ! MINPACK-2} 23953} 23954 23955@TechReport{ hohmann:94, 23956 author = {Andreas Hohmann}, 23957 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 23958 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 23959 year = {1994}, 23960 number = {SC-94-4}, 23961 key = {Hohmann94} 23962} 23963 23964@TechReport{ meza:94, 23965 author = {Juan C. Meza}, 23966 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 23967 institution = {Sandia National Laboratory}, 23968 year = {1994}, 23969 number = {SAND94-8225}, 23970 key = {Meza94} 23971} 23972 23973@Book{ dennis:83, 23974 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 23975 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 23976 publisher = {Prentice-Hall, Inc.}, 23977 address = {Englewood Cliffs, NJ}, 23978 year = {1983} 23979} 23980 23981@TechReport{ more:92, 23982 author = {Jorge J. Mor\'{e} and David Thuente}, 23983 title = {Line search algorithms with guaranteed sufficient decrease}, 23984 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23985 year = {1992}, 23986 number = {MCS-P330-1092} 23987} 23988 23989@Article{ more-toraldo, 23990 author = {Jorge J. Mor\'e and G. Toraldo}, 23991 journal = {SIOPT}, 23992 pages = {93--113}, 23993 title = {On the solution of large quadratic programming problems with bound constraints}, 23994 volume = {1}, 23995 year = {1991} 23996} 23997 23998@Article{ byrd:1995:lma, 23999 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 24000 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 24001 journal = {SIAM Journal on Scientific Computing}, 24002 volume = {16}, 24003 number = {5}, 24004 pages = {1190--1208}, 24005 month = sep, 24006 year = {1995}, 24007 coden = {SJOCE3}, 24008 issn = {1064-8275 (print), 1095-7197 (electronic)}, 24009 mrclass = {90C30 (65K05)}, 24010 mrnumber = {96e:90039}, 24011 mrreviewer = {Henry Wolkowicz}, 24012 bibdate = {Fri Dec 4 16:17:35 MST 1998} 24013} 24014 24015@Article{ lin_c3, 24016 author = {C.-J. Lin and J. J. Mor\'e}, 24017 title = {Newton's method for large bound-constrained optimization problems}, 24018 year = {1999}, 24019 journal = {SIOPT}, 24020 volume = {9(4)}, 24021 pages = {1100--1127}, 24022 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 24023} 24024 24025@TechReport{ dolan2, 24026 author = {E. Dolan and J. J. Mor\'{e}}, 24027 title = {Benchmarking Optimization Software with Performance Profiles}, 24028 year = {2001}, 24029 month = jan, 24030 number = {ANL/MCS-P861-1200}, 24031 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 24032 address = {Argonne, IL}, 24033 url = {http://www.mcs.anl.gov/~more/cops/} 24034} 24035 24036@InProceedings{ owlqn, 24037 author = {Galen Andrew and Jianfeng Gao}, 24038 title = {Scalable training of L1-regularized log-linear models}, 24039 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 24040 pages = {33--40}, 24041 year = {2007} 24042} 24043 24044@Article{ bmrm, 24045 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 24046 title = {Bundle methods for regularized risk minimization}, 24047 year = {2010}, 24048 journal = {Journal of Machine Learning Research}, 24049 volume = {11}, 24050 pages = {311--365} 24051} 24052 24053% ------------------- Component Software References ---------------------- 24054@InProceedings{ cca99, 24055 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 24056 McInnes and S. Parker and B. Smolinski}, 24057 title = {Toward a Common Component Architecture for High-Performance Scientific 24058 Computing}, 24059 booktitle = {Proceedings of {High Performance Distributed Computing}}, 24060 pages = {115--124}, 24061 year = {1999}, 24062 note = {See \url{http://cca-forum.org}} 24063} 24064 24065@Book{ szyperski98, 24066 author = {Clemens Szyperski}, 24067 title = {Component Software: Beyond Object-Oriented Programming}, 24068 publisher = {ACM Press}, 24069 address = {New York}, 24070 year = {1998} 24071} 24072 24073@Article{ broy98, 24074 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 24075 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 24076 Stal and Clemens Szyperski}, 24077 title = {What Characterizes a (Software) Component?}, 24078 journal = {Software -- Concepts and Tools}, 24079 publisher = {Springer-Verlag}, 24080 year = {1998}, 24081 volume = {19}, 24082 pages = {49--56} 24083} 24084 24085@Article{ componentware:94, 24086 author = {Jon Udell}, 24087 title = {Componentware}, 24088 journal = {Byte}, 24089 volume = {may}, 24090 pages = {46--56}, 24091 year = {1994}, 24092 key = {Udell94 ! componentware} 24093} 24094 24095@Misc{ cca-web-page, 24096 author = {{Common Component Architecture Forum}}, 24097 note = {See \url{http://cca-forum.org}} 24098} 24099 24100% --------------- References for Tools Used by TAO Developers ----------------- 24101 24102% 24103% tohtml: Used to generate on-line TAO users manual and manual pages 24104% 24105@TechReport{ tohtml, 24106 author = {William Gropp}, 24107 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 24108 institution = {Argonne National Laboratory}, 24109 number = {ANL/MCS-TM-00}, 24110 month = jan, 24111 year = {1995}, 24112 key = {tohtml} 24113} 24114 24115% 24116% doctext: Used to generate tex version of TAO manual pages 24117% 24118@TechReport{ doctext, 24119 author = {William Gropp}, 24120 title = {Users Manual for doctext: Producing documentation from {C} source code}, 24121 institution = {Argonne National Laboratory}, 24122 number = {ANL/MCS-TM-00}, 24123 month = jan, 24124 year = {1995}, 24125 key = {doctext} 24126} 24127 24128% 24129% bfort: Used to generate TAO Fortran interface 24130% 24131@TechReport{ bfort, 24132 author = {William Gropp}, 24133 title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, 24134 institution = {Argonne National Laboratory}, 24135 number = {ANL/MCS-TM-208}, 24136 month = mar, 24137 year = {1995}, 24138 key = {doctext} 24139} 24140 24141% ------------------------- PETSc References ------------------------------ 24142@InProceedings{ petsc, 24143 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 24144 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 24145 Libraries}, 24146 booktitle = {Modern Software Tools in Scientific Computing}, 24147 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 24148 publisher = {Birkhauser Press}, 24149 pages = {163--202}, 24150 year = {1997} 24151} 24152 24153% ------------------------- Misc Other References ------------------------------ 24154@Misc{ indeps-web-page, 24155 title = {{InDEPS} {W}eb page}, 24156 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 24157 author = {et al. Robert Armstrong}, 24158 institution = {Sandia National Laboratory}, 24159 key = {{InDEPS} {W}eb page} 24160} 24161 24162@Misc{ pooma, 24163 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 24164 chitectures}, 24165 year = {1996}, 24166 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 24167 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 24168} 24169 24170@Misc{ isis++-web-page, 24171 title = {{ISIS++} {W}eb Page}, 24172 note = {See \url{http://ca.sandia.gov/isis}}, 24173 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 24174 institution = {Sandia National Laboratories} 24175} 24176 24177@Misc{ trilinos-web-page, 24178 title = {{Trilinos} {W}eb Page}, 24179 note = {See 24180 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 24181 author = {Mike Heroux et al.}, 24182 institution = {Sandia National Laboratories} 24183} 24184 24185@Misc{ alice-web-page, 24186 title = {{ALICE} {W}eb page}, 24187 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 24188 Argonne National Laboratory}, 24189 key = {{ALICE} {W}eb page} 24190} 24191 24192@Misc{ autodiff-webpage, 24193 author = {{Computational Differentiation Project}}, 24194 note = {See \url{http://www.mcs.anl.gov/autodiff}} 24195} 24196 24197@Misc{ coool-home-page, 24198 author = {Lydia Deng and Wences Gouveia and John Scales}, 24199 title = {{The CWP Object-Oriented Optimization Library}}, 24200 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 24201} 24202 24203@Misc{ rice-inversion-home-page, 24204 author = {Mark S. Gokenbach and William W. Symes}, 24205 title = {{The Hilbert Class Library}}, 24206 note = {See \url{http://www.trip.caam.rice.edu/}} 24207} 24208 24209@Misc{ opt++-home-page, 24210 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 24211 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 24212} 24213 24214@Article{ gockenbach:1999:ccl, 24215 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 24216 title = {C++ Classes for Linking Optimization with Complex Simulations}, 24217 journal = {{ACM} Transactions on Mathematical Software}, 24218 volume = {25}, 24219 number = {2}, 24220 month = jun, 24221 year = {1999}, 24222 pages = {191-212}, 24223 abstract = {The object-oriented programming paradigm can be used to overcome the 24224 incompatibilities between off-the-shelf optimization software and application 24225 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 24226 objects arising in optimization problems, such as vectors, linear operators, and 24227 so forth, as C++ classes, making it possible to write optimization code in a 24228 natural fashion, while allowing application software such as simulators to use the 24229 most convenient data structures and programming style. In spite of the poor 24230 reputation C++ has for runtime performance, the use of mixed-language programming 24231 allows performance equal to that achieved by standard Fortran packages, as 24232 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 24233 accepted = {April 1999}, 24234 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 24235} 24236 24237@Misc{ neos-guide, 24238 author = {{The Optimization Software Guide}}, 24239 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 24240} 24241 24242@Article{ boyd, 24243 title = {Distributed optimization and statistical learning via the alternating direction 24244 method of multipliers}, 24245 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 24246 Jonathan and others}, 24247 journal = {Foundations and Trends{\textregistered} in Machine learning}, 24248 volume = {3}, 24249 number = {1}, 24250 pages = {1-122}, 24251 year = {2011}, 24252 publisher = {Now Publishers, Inc.} 24253} 24254 24255@Misc{ :alertsys, 24256 title = {page{ALERT}}, 24257 organization = {Alert Systems, Inc}, 24258 address = {Madison, Wisconsin}, 24259 note = {http://www.alertsys.com/} 24260} 24261 24262@Manual{ :cmfortran, 24263 title = {{CM} {F}ortran Language Reference Manual}, 24264 organization = {Thinking Machines Corporation}, 24265 year = {1994}, 24266 address = {Cambridge, MA} 24267} 24268 24269@Manual{ :cmmd, 24270 title = {{CMMD} Reference Manual, Version 3.0}, 24271 organization = {Thinking Machines Corporation}, 24272 year = {1993}, 24273 address = {Cambridge, MA} 24274} 24275 24276@Manual{ :cmssl, 24277 title = {{CMSSL} for {CM} {F}ortran}, 24278 volume = {I}, 24279 organization = {Thinking Machines Corporation}, 24280 year = {1994}, 24281 address = {Cambridge, MA} 24282} 24283 24284@Misc{ :condor, 24285 author = {M. Livny}, 24286 title = {{PI}, The {Condor} Project, High Throughput Computing}, 24287 howpublished = {www.cs.wisc.edu/condor} 24288} 24289 24290@Manual{ :connection, 24291 title = {Connection Machine {CM}--5 Technical Summary}, 24292 organization = {Thinking Machines Corporation}, 24293 year = {1993}, 24294 address = {Cambridge, MA} 24295} 24296 24297@Manual{ :cplex, 24298 title = {{CPLEX} Optimizer}, 24299 organization = {ILOG CPLEX Division}, 24300 address = {889 Alder Avenue, Incline Village, Nevada}, 24301 note = {http://www.cplex.com/} 24302} 24303 24304@Manual{ :cplextm, 24305 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 24306 (Version 2.0)}, 24307 organization = {CPLEX Optimization Inc.}, 24308 year = {1992}, 24309 address = {Incline Village, Nevada} 24310} 24311 24312@Misc{ :fatcop, 24313 author = {M. C. Ferris}, 24314 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 24315 Solver}, 24316 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 24317} 24318 24319@Misc{ :metaneos, 24320 author = {S. J. Wright}, 24321 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 24322 howpublished = {www-unix.mcs.anl.gov/metaneos} 24323} 24324 24325@InCollection{ gropp.more:optimization, 24326 author = {W. Gropp and J. J. Mor\'e}, 24327 title = {Optimization environments and the {NEOS} Server}, 24328 booktitle = {Approximation Theory and Optimization}, 24329 pages = {167--182}, 24330 publisher = {Cambridge University Press}, 24331 year = {1997}, 24332 editor = {M. D. Buhmann and A. Iserles} 24333} 24334 24335@Article{ czyzyk.mesnier.ea:neos, 24336 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 24337 title = {The {NEOS} Server}, 24338 journal = {IEEE Journal on Computational Science and Engineering}, 24339 volume = {5}, 24340 year = {1998}, 24341 pages = {68--75} 24342} 24343 24344@Book{ :osl, 24345 title = {Handbook for {IBM OSL}}, 24346 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 24347 year = {1994}, 24348 publisher = {Boyd and Fraser}, 24349 address = {Danvers, Massachusetts} 24350} 24351 24352@Manual{ :pro-matlab, 24353 title = {{PRO}--{MATLAB} User's Guide}, 24354 organization = {The MathWorks, Inc.}, 24355 year = {1989}, 24356 address = {21 Eliot Street, South Natick, MA 01760} 24357} 24358 24359@Misc{ :prostate, 24360 key = {Biomedical}, 24361 title = {Biomedical Business International Newsletter}, 24362 howpublished = {pp. 72--75}, 24363 year = {1996} 24364} 24365 24366@Misc{ :sipcase, 24367 key = {Natural}, 24368 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 24369 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 24370} 24371 24372@Book{ aarts.korst:simulated, 24373 author = {E. Aarts and J. Korst}, 24374 title = {Simulated Annealing and Boltzman Machines}, 24375 year = {1990}, 24376 publisher = {John Wiley \& Sons}, 24377 address = {Chichester} 24378} 24379 24380@TechReport{ aarts.laarhoven.ea:local-search-based, 24381 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 24382 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 24383 institution = {Centre for Quantitative Methods}, 24384 year = {1991}, 24385 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 24386 number = {106}, 24387 type = {CQM-Not} 24388} 24389 24390@Article{ aashtiani.magnanti:equilibria, 24391 author = {H. Z. Aashtiani and T. L. Magnanti}, 24392 title = {Equilibria on a congested transportation network}, 24393 journal = {SIAM Journal on Algebraic and Discrete Methods}, 24394 volume = {2}, 24395 year = {1981}, 24396 pages = {213--226} 24397} 24398 24399@Article{ ablow.brigham:analog, 24400 author = {C. M. Ablow and G. Brigham}, 24401 title = {An Analog Solution of Programming Problems}, 24402 journal = {Operations Research}, 24403 year = {1955}, 24404 volume = {3}, 24405 pages = {388--394} 24406} 24407 24408@Article{ achuthan.grabowski.ea:optimal, 24409 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 24410 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 24411 journal = {Opsearch}, 24412 year = {1981}, 24413 volume = {18}, 24414 pages = {117--138} 24415} 24416 24417@Book{ adelman.robinson:income, 24418 author = {I. Adelman and S. Robinson}, 24419 title = {Income Distribution Policy in Developing Countries}, 24420 publisher = {Stanford University Press}, 24421 year = {1978}, 24422 address = {Stanford, California} 24423} 24424 24425@Article{ adler.resende.ea:implementation, 24426 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 24427 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 24428 journal = {Mathematical Programming}, 24429 year = {1989}, 24430 volume = {44}, 24431 pages = {297--336} 24432} 24433 24434@TechReport{ aeberhard.coomans.ea:comparison, 24435 author = {S. Aeberhard and D. Coomans and O. de Vel}, 24436 title = {Comparison of Classifiers in High Dimensional Settings}, 24437 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 24438 University of North Queensland}, 24439 year = {1992}, 24440 number = {92-02}, 24441 type = {Technical Report} 24442} 24443 24444@Article{ aganagic.cottle:constructive, 24445 author = {M. Aganagi\'{c} and R. W. Cottle}, 24446 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 24447 Minors}, 24448 journal = {Mathematical Programming}, 24449 year = {1987}, 24450 volume = {37}, 24451 pages = {223--231} 24452} 24453 24454@TechReport{ aganagic:iterative, 24455 author = {M. Aganagi\'{c}}, 24456 title = {Iterative Methods for the Linear Complementarity Problem}, 24457 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 24458 University}, 24459 year = {1978}, 24460 type = {SOL}, 24461 number = {78-10}, 24462 address = {Stanford, California} 24463} 24464 24465@Book{ ahlfors:complex, 24466 author = {L. V. Ahlfors}, 24467 title = {Complex Analysis}, 24468 publisher = {McGraw--Hill Book Company}, 24469 address = {New York}, 24470 series = {International Series in Pure and Applied Mathematics}, 24471 edition = {Second}, 24472 year = {1966} 24473} 24474 24475@Article{ ahn:solution, 24476 author = {B--H. Ahn}, 24477 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 24478 journal = {Journal of Optimization Theory and Applications}, 24479 year = {1981}, 24480 volume = {33}, 24481 pages = {175--185} 24482} 24483 24484@Article{ al-fahed.stavroulakis.ea:hard, 24485 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24486 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 24487 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 24488 volume = {71}, 24489 year = {1991}, 24490 pages = {257--265} 24491} 24492 24493@Article{ al-fahed.stavroulakis.ea:linear, 24494 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24495 title = {A linear complementarity approach to the frictionless gripper}, 24496 journal = {International Journal of Robotic Research}, 24497 volume = {11}, 24498 year = {1992}, 24499 pages = {112--122} 24500} 24501 24502@Article{ al-khayyal.falk:jointly, 24503 author = {F. A. Al--Khayyal and J. E. Falk}, 24504 title = {Jointly Constrained Biconvex Programming}, 24505 journal = {Mathematics of Operations Research}, 24506 year = {1983}, 24507 volume = {8}, 24508 pages = {273--286} 24509} 24510 24511@Article{ al-khayyal.kyparisis:finite, 24512 author = {F. A. Al--Khayyal and J. Kyparisis}, 24513 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 24514 Inequalities}, 24515 journal = {Journal of Optimization Theory and Applications}, 24516 year = {1991}, 24517 volume = {70}, 24518 pages = {319--332} 24519} 24520 24521@PhDThesis{ al-khayyal:biconvex, 24522 author = {F. A. Al--Khayyal}, 24523 title = {Biconvex Programming and Biconcave Minimization}, 24524 year = {1977}, 24525 school = {The George Washington University} 24526} 24527 24528@Article{ alart.curnier:mixed, 24529 author = {P. Alart and A. Curnier}, 24530 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 24531 solution methods}, 24532 journal = {Computer Methods in Applied Mechanics and Engineering}, 24533 volume = {92}, 24534 year = {1991}, 24535 pages = {353--375} 24536} 24537 24538@Misc{ alexander.kellog.ea:piecewise, 24539 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 24540 title = {Piecewise smooth continuation}, 24541 howpublished = {Manuscript}, 24542 year = {1979} 24543} 24544 24545@InCollection{ alexander.li.ea:piecewise, 24546 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 24547 title = {Piecewise smooth homotopies}, 24548 booktitle = {Homotopy Methods and Global Convergence}, 24549 pages = {1--14}, 24550 publisher = {Plenum Press}, 24551 year = {1983}, 24552 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 24553 address = {New York} 24554} 24555 24556@InCollection{ alexander:topological, 24557 author = {J.~C. Alexander}, 24558 title = {The topological theory of an embedding method}, 24559 booktitle = {Continuation Methods}, 24560 pages = {37--68}, 24561 publisher = {Academic Press}, 24562 year = {1978}, 24563 editor = {H. Wacker}, 24564 address = {New York} 24565} 24566 24567@Book{ allen:probability, 24568 author = {A. O. Allen}, 24569 title = {Probability, Statistics and Queueing Theory}, 24570 publisher = {Academic Press}, 24571 year = {1990}, 24572 address = {London}, 24573 edition = {Second} 24574} 24575 24576@Book{ allgower.georg:numerical, 24577 author = {E. L. Allgower and K. Georg}, 24578 title = {Numerical Continuation Methods, An Introduction}, 24579 publisher = {Springer-Verlag}, 24580 year = {1990}, 24581 address = {Berlin} 24582} 24583 24584@InProceedings{ allgower.georg:predictor-corrector, 24585 crossref = {bachem.grotschel.ea:mathematical}, 24586 author = {E. L. Allgower and K. Georg}, 24587 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 24588 Zero Points of Nonlinear Mappings}, 24589 pages = {15--56} 24590} 24591 24592@Article{ aluffi-pentini.parisi.ea:algorithm, 24593 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 24594 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 24595 Algorithm}, 24596 journal = {ACM Transactions on Mathematical Software}, 24597 year = {1988}, 24598 volume = {14}, 24599 pages = {366--380} 24600} 24601 24602@Article{ anandalingam.friesz:hierarchical, 24603 author = {G. Anandalingam and T. L. Friesz}, 24604 title = {Hierarchical Optimization: An Introduction}, 24605 journal = {Annals of Operations Research}, 24606 year = {1992}, 24607 volume = {34}, 24608 pages = {1--11} 24609} 24610 24611@Article{ anandalingam.white:solution, 24612 author = {G. Anandalingam and D. J. White}, 24613 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 24614 Functions}, 24615 journal = {IEEE Transactions on Automatic Control}, 24616 year = {1990}, 24617 volume = {35}, 24618 number = {10}, 24619 pages = {1170--1173} 24620} 24621 24622@Article{ andersen.andersen:presolving, 24623 author = {E. Andersen and K. Andersen}, 24624 title = {Presolving in Linear Programming}, 24625 year = {1995}, 24626 journal = {Mathematical Programming}, 24627 volume = {71}, 24628 pages = {221--245} 24629} 24630 24631@InProceedings{ andersen.ye:homogeneous, 24632 author = {E. Andersen and Y. Ye}, 24633 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 24634 Equality Constraints}, 24635 crossref = {ferris.pang:complementarity}, 24636 pages = {1--11} 24637} 24638 24639@Book{ anderson.bai.ea:lapack, 24640 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 24641 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 24642 Sorensen}, 24643 title = {{LAPACK} User's Guide}, 24644 publisher = {SIAM}, 24645 year = {1995}, 24646 address = {Philadelphia, Pennsylvania}, 24647 edition = {Second} 24648} 24649 24650@Article{ anderson.ferris:direct, 24651 author = {E. J. Anderson and M. C. Ferris}, 24652 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 24653 year = {2001}, 24654 journal = {SIAM Journal on Optimization, forthcoming}, 24655 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 24656 key = {55} 24657} 24658 24659@InProceedings{ anderson.ferris:genetic, 24660 author = {E. J. Anderson and M. C. Ferris}, 24661 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 24662 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 24663 Waterloo, Ontario, Canada, May 28--30}, 24664 publisher = {University of Waterloo Press}, 24665 key = {14}, 24666 year = {1990} 24667} 24668 24669@Article{ anderson.ferris:genetic*1, 24670 author = {E. J. Anderson and M. C. Ferris}, 24671 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 24672 Problem}, 24673 journal = {ORSA Journal on Computing}, 24674 year = {1994}, 24675 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 24676 volume = {6}, 24677 pages = {161--173}, 24678 key = {22} 24679} 24680 24681@InProceedings{ anderson.ferris:parallel, 24682 author = {E. J. Anderson and M. C. Ferris}, 24683 title = {Parallel Genetic Algorithms in Optimization}, 24684 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 24685 Computing, Chicago, Illinois, December 11-13}, 24686 year = {1989}, 24687 key = {12} 24688} 24689 24690@Unpublished{ anderson.lewis:primal, 24691 author = {E. J. Anderson and A. S. Lewis}, 24692 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24693 note = {In preparation} 24694} 24695 24696@Book{ anderson.nash:linear, 24697 author = {E. J. Anderson and P. Nash}, 24698 title = {Linear Programming in Infinite--Dimensional Spaces}, 24699 year = {1987}, 24700 publisher = {John Wiley \& Sons}, 24701 address = {Chichester} 24702} 24703 24704@InProceedings{ anderson:primal, 24705 author = {E. J. Anderson}, 24706 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24707 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 24708 Programming, Cambridge, September 1984}, 24709 year = {1985}, 24710 editor = {E. J. Anderson and A. B. Philpott}, 24711 publisher = {Springer-Verlag}, 24712 address = {Berlin} 24713} 24714 24715@Article{ andradottir:method, 24716 author = {S. Andrad\'{o}ttir}, 24717 title = {A Method of Discrete Stochastic Optimization}, 24718 journal = {Management Science}, 24719 year = {1995}, 24720 volume = {41}, 24721 pages = {1946--1961} 24722} 24723 24724@Article{ andradottir:global, 24725 author = {S. Andrad\'{o}ttir}, 24726 title = {A Global Search Method for Discrete Stochastic Optimization}, 24727 journal = {SIAM Journal on Optimization}, 24728 year = {1996}, 24729 volume = {6}, 24730 pages = {513--530} 24731} 24732 24733@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 24734 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 24735 title = {An infeasible--interior--point predictor--corrector algorithm for the 24736 {P}$_x$--geometric {LCP}}, 24737 institution = {Department of Mathematics, The University of Iowa}, 24738 address = {Iowa City, Iowa}, 24739 year = {1994}, 24740 number = {62}, 24741 type = {Reports on Computational Mathematics} 24742} 24743 24744@TechReport{ anitescu.potra:formulating, 24745 author = {M. Anitescu and F. A. Potra}, 24746 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 24747 Linear Complementarity Problems}, 24748 institution = {Department of Mathematics, The University of Iowa}, 24749 year = {1996}, 24750 type = {Report}, 24751 number = {93}, 24752 address = {Iowa City, Iowa} 24753} 24754 24755@Article{ anstreicher.lee.ea:crashing, 24756 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 24757 title = {Crashing a Maximum-Weight Complementarity Basis}, 24758 journal = {Mathematical Programming}, 24759 year = {1992}, 24760 volume = {54}, 24761 pages = {281--294} 24762} 24763 24764@Article{ anstreicher:combined, 24765 author = {K. M. Anstreicher}, 24766 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 24767 programming}, 24768 journal = {Mathematical Programming}, 24769 year = {1991}, 24770 volume = {52}, 24771 pages = {429--440} 24772} 24773 24774@Article{ anstreicher:combined*1, 24775 author = {K. M. Anstreicher}, 24776 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 24777 journal = {Mathematical Programming}, 24778 year = {1989}, 24779 volume = {43}, 24780 pages = {209--223} 24781} 24782 24783@InCollection{ arbenz.gander.ea:remote, 24784 author = {P. Arbenz and W. Gander and M. Oettli}, 24785 title = {The Remote Computational System}, 24786 booktitle = {High-Performance Computation and Networks}, 24787 publisher = {Springer-Verlag}, 24788 year = {1996}, 24789 volume = {1067}, 24790 series = {Lecture Notes in Computer Science}, 24791 pages = {662--667} 24792} 24793 24794@InCollection{ arcus:comsoal, 24795 author = {A. L. Arcus}, 24796 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 24797 booktitle = {Readings in Production and Operations Management}, 24798 year = {1966}, 24799 editor = {E. S. Buffa}, 24800 publisher = {John Wiley \& Sons}, 24801 address = {New York} 24802} 24803 24804@TechReport{ arioli.chan.ea:computing, 24805 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 24806 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 24807 Optimization Calculations}, 24808 institution = {CERFACS}, 24809 year = {1993}, 24810 number = {TR/PA/93/34} 24811} 24812 24813@Article{ armijo:minimization, 24814 author = {L. Armijo}, 24815 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 24816 Derivatives}, 24817 journal = {Pacific Journal of Mathematics}, 24818 year = {1966}, 24819 volume = {16}, 24820 pages = {1--3} 24821} 24822 24823@Article{ arrow.debreu:existence, 24824 author = {K. Arrow and G. Debreu}, 24825 title = {Existence of Equilibrium for a Competitive Economy}, 24826 journal = {Econometrica}, 24827 year = {1954}, 24828 volume = {22}, 24829 pages = {265--290} 24830} 24831 24832@InCollection{ arrow.solow:gradient, 24833 author = {K. J. Arrow and R. M. Solow}, 24834 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 24835 booktitle = {Studies in Linear and Nonlinear Programming}, 24836 year = {1958}, 24837 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 24838 publisher = {Stanford University Press}, 24839 address = {Stanford, California}, 24840 pages = {166--176} 24841} 24842 24843@Book{ aubin.ekeland:nonlinear, 24844 author = {J.-P. Aubin and I. Ekeland}, 24845 title = {Applied nonlinear analysis}, 24846 publisher = {John Wiley \& Sons}, 24847 address = {New York}, 24848 year = {1984} 24849} 24850 24851@Article{ auchmuty:variational, 24852 author = {G. Auchmuty}, 24853 title = {Variational Principles for Variational Inequalities}, 24854 journal = {Numerical Functional Analysis and Optimization}, 24855 year = {1989}, 24856 volume = {10}, 24857 pages = {863--874} 24858} 24859 24860@Book{ auerbach.kotlikoff:dynamic, 24861 author = {A. J. Auerbach and L. J. Kotlikoff}, 24862 title = {Dynamic Fiscal Policy}, 24863 publisher = {Cambridge University Press}, 24864 address = {Cambridge, England}, 24865 year = {1987} 24866} 24867 24868@InProceedings{ ault.deutsch.ea:interpolating, 24869 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 24870 title = {Interpolating Subspaces in Approximation Theory}, 24871 booktitle = {Approximation Theory}, 24872 year = {1970}, 24873 editor = {A. Talbot}, 24874 publisher = {Academic Press}, 24875 address = {London} 24876} 24877 24878@Article{ auslender.crouzeix:global, 24879 author = {A. A. Auslender and J.--P. Crouzeix}, 24880 title = {Global Regularity Theorems}, 24881 journal = {Mathematics of Operations Research}, 24882 year = {1988}, 24883 volume = {13}, 24884 pages = {243--253} 24885} 24886 24887@Article{ auslender.haddou:interior-proximal, 24888 author = {A. Auslender and M. Haddou}, 24889 title = {An interior-proximal method for convex linearly constrained problems and its 24890 extension to variational inequalities}, 24891 year = {1995}, 24892 journal = {Mathematical Programming}, 24893 pages = {77--100}, 24894 volume = {71} 24895} 24896 24897@Article{ auslender:convergence, 24898 author = {A. Auslender}, 24899 title = {Convergence of stationary sequences for variational inequalities with maximal 24900 monotone operators}, 24901 journal = {Applied Mathematics and Optimization}, 24902 volume = {28}, 24903 year = {1993}, 24904 pages = {161--172} 24905} 24906 24907@Book{ auslender:optimization, 24908 author = {A. Auslender}, 24909 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 24910 year = {1976}, 24911 publisher = {Masson}, 24912 address = {Paris} 24913} 24914 24915@TechReport{ averick.carter.ea:minpack-2, 24916 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 24917 title = {The {MINPACK-2} Test Problem Collection}, 24918 institution = {Argonne National Laboratory}, 24919 year = {1992}, 24920 address = {Argonne, Illinois}, 24921 number = {MCS-P153-0692} 24922} 24923 24924@TechReport{ axline.billups.ea:guidelines, 24925 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 24926 title = {Guidelines for Software Security ({U})}, 24927 institution = {SNL}, 24928 year = {1989}, 24929 month = oct, 24930 address = {Albuquerque, New Mexico}, 24931 number = {SAND88-2955} 24932} 24933 24934@Article{ ayres.walter:greenhouse, 24935 author = {R. U. Ayres and J. Walter}, 24936 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 24937 journal = {Environmental and Resource Economics}, 24938 year = {1991}, 24939 volume = {1}, 24940 pages = {237--270} 24941} 24942 24943@PhDThesis{ bagley:behaviour, 24944 author = {J. D. Bagley}, 24945 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 24946 Algorithms}, 24947 year = {1967}, 24948 school = {University of Michigan} 24949} 24950 24951@Article{ bain.stewart:application, 24952 author = {R. S. Bain and W. E. Stewart}, 24953 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 24954 Algebraic Equation Systems}, 24955 journal = {Computers in Chemical Engineering}, 24956 year = {1991}, 24957 volume = {15}, 24958 pages = {203--208} 24959} 24960 24961@Article{ baker.lasdon:successive, 24962 author = {T. E. Baker and L. S. Lasdon}, 24963 title = {Successive Linear Programming at {E}xxon}, 24964 journal = {Management Science}, 24965 year = {1985}, 24966 volume = {31}, 24967 pages = {264--274} 24968} 24969 24970@InProceedings{ baker:reducing, 24971 crossref = {grefenstette:genetic}, 24972 author = {J. E. Baker}, 24973 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 24974 pages = {14--21} 24975} 24976 24977@Article{ balas.zemel:algorithm, 24978 author = {E. Balas and E. Zemel}, 24979 title = {An Algorithm for Large Zero--One Knapsack Problems}, 24980 journal = {Operations Research}, 24981 year = {1980}, 24982 volume = {28}, 24983 pages = {1132--1154} 24984} 24985 24986@Book{ ballard.fullerton.ea:general, 24987 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 24988 title = {A General Equilibrium Model for Tax Policy Evaluation}, 24989 publisher = {The University of Chicago Press}, 24990 year = {1985}, 24991 series = {National Bureau of Economic Research Monograph} 24992} 24993 24994@InProceedings{ balog.angelos.ea:dose, 24995 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 24996 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 24997 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 24998 Radiation Therapy, Salt Lake City}, 24999 year = {1997}, 25000 editor = {D. D. Leavitt and G. Starkshall}, 25001 publisher = {Medical Physics Publishing}, 25002 address = {St. Louis, Missouri}, 25003 pages = {323--326} 25004} 25005 25006@Article{ baraff:fast, 25007 author = {D. Baraff}, 25008 title = {Fast contact force computation for nonpenetrating rigid bodies}, 25009 journal = {Computer Graphics (Proceedings SIGRAPH)}, 25010 year = {1994}, 25011 pages = {23--34}, 25012 volume = {28} 25013} 25014 25015@Article{ baraff:issues, 25016 author = {D. Baraff}, 25017 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 25018 journal = {Algorithmica}, 25019 volume = {10}, 25020 year = {1993}, 25021 pages = {292--352} 25022} 25023 25024@Book{ barrett.berry.ea:templates, 25025 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 25026 Methods}, 25027 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 25028 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 25029 year = {1994}, 25030 publisher = {SIAM}, 25031 address = {Philadelphia, Pennsylvania} 25032} 25033 25034@Article{ bard:algorithm, 25035 author = {J. F. Bard}, 25036 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 25037 journal = {Mathematics of Operations Research}, 25038 year = {1983}, 25039 volume = {8}, 25040 pages = {260--272} 25041} 25042 25043@Article{ bard:convex, 25044 author = {J. F. Bard}, 25045 title = {Convex Two-Level Optimization}, 25046 journal = {Mathematical Programming}, 25047 year = {1988}, 25048 volume = {40}, 25049 pages = {15--27} 25050} 25051 25052@InCollection{ bard:eclectic, 25053 author = {Y. Bard}, 25054 title = {An Eclectic Approach to Nonlinear Programming}, 25055 booktitle = {Optimization}, 25056 publisher = {University of Queensland Press}, 25057 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 25058 year = {1972}, 25059 address = {St. Lucia, Queensland, Australia}, 25060 pages = {116--128} 25061} 25062 25063@Article{ barnes:variation, 25064 author = {E. R. Barnes}, 25065 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 25066 journal = {Mathematical Programming}, 25067 year = {1986}, 25068 volume = {36}, 25069 pages = {174--182} 25070} 25071 25072@Article{ bartels.golub:simplex, 25073 author = {R. H. Bartels and G. H. Golub}, 25074 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 25075 journal = {Communications of the Asociation for Computing Machinery}, 25076 year = {1969}, 25077 volume = {12}, 25078 pages = {266--268} 25079} 25080 25081@Article{ barton.ivey:nelder, 25082 author = {R. Barton and J. S. Ivey}, 25083 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 25084 journal = {Management Science}, 25085 year = {1996}, 25086 volume = {42}, 25087 number = {7}, 25088 pages = {954--973} 25089} 25090 25091@Article{ battiti:first-, 25092 author = {R. Battiti}, 25093 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 25094 {N}ewton's Method}, 25095 journal = {Neural Computation}, 25096 year = {1992}, 25097 volume = {4}, 25098 pages = {141--166} 25099} 25100 25101@Article{ baudet:asynchronous, 25102 author = {G. M. Baudet}, 25103 title = {Asynchronous iterative methods for multiprocesors}, 25104 journal = {Journal of the Association for Computing Machinery}, 25105 year = {1978}, 25106 volume = {25}, 25107 pages = {226--244} 25108} 25109 25110@InProceedings{ baum.haussler:what, 25111 author = {E. B. Baum and D. Haussler}, 25112 title = {What Size Net Gives Valid Generalization}, 25113 booktitle = {Advances in Neural Information Processing Systems I}, 25114 year = {1989}, 25115 editor = {D. S. Touretzky}, 25116 publisher = {Morgan Kaufmann}, 25117 address = {San Mateo, California}, 25118 pages = {81--90} 25119} 25120 25121@Misc{ baum:private, 25122 author = {E. B. Baum}, 25123 title = {Private Communication}, 25124 year = {1992}, 25125 address = {NEC Research Institute, Princeton, New Jersey} 25126} 25127 25128@Book{ bazaraa.sherali.ea:nonlinear, 25129 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 25130 title = {Nonlinear Programming}, 25131 edition = {Second}, 25132 publisher = {John Wiley and Sons}, 25133 address = {New York}, 25134 year = {1993} 25135} 25136 25137@Book{ bazaraa.shetty:nonlinear, 25138 author = {M. S. Bazaraa and C. M. Shetty}, 25139 title = {Nonlinear Programming: Theory and Algorithms}, 25140 publisher = {John Wiley \& Sons}, 25141 year = {1979}, 25142 address = {New York, New York} 25143} 25144 25145@Article{ beale:cycling, 25146 author = {E. M. L. Beale}, 25147 title = {Cycling in the Dual Simplex Method}, 25148 journal = {Naval Research Logistics Quarterly}, 25149 year = {1955}, 25150 volume = {2}, 25151 pages = {103--107} 25152} 25153 25154@InProceedings{ becker.cun:improving, 25155 author = {S. Becker and Y. le Cun}, 25156 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 25157 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 25158 year = {1988}, 25159 editor = {D. S. Touretzky}, 25160 publisher = {Morgan Kaufmann}, 25161 address = {San Mateo, California}, 25162 pages = {29--37} 25163} 25164 25165@Book{ ben-israel.ben-tal.ea:optimality, 25166 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 25167 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 25168 year = {1981}, 25169 publisher = {John Wiley \& Sons}, 25170 address = {New York} 25171} 25172 25173@Article{ ben-israel:newton-raphson, 25174 author = {A. Ben--Israel}, 25175 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 25176 journal = {Journal of Mathematical Analysis and its Applications}, 25177 year = {1966}, 25178 volume = {15}, 25179 pages = {243--252} 25180} 25181 25182@Article{ ben-tal.melman.ea:curved, 25183 author = {A. Ben--Tal and A. Melman and J. Zowe}, 25184 title = {Curved Search Methods for Unconstrained Optimization}, 25185 journal = {Optimization}, 25186 year = {1990}, 25187 volume = {21}, 25188 pages = {669--695}, 25189 publisher = {John Wiley \& Sons}, 25190 address = {New York} 25191} 25192 25193@InProceedings{ bennett.ferris.ea:genetic, 25194 crossref = {belew.booker:fourth}, 25195 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 25196 title = {A Genetic Algorithm for Database Query Optimization}, 25197 pages = {400--407}, 25198 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 25199 key = {19} 25200} 25201 25202@Article{ bennett.mangasarian:bilinear, 25203 author = {K. P. Bennett and O. L. Mangasarian}, 25204 title = {Bilinear Separation of Two Sets in n-Space}, 25205 journal = {Computational Optimization and Applications}, 25206 year = {1993}, 25207 volume = {2}, 25208 pages = {207--227} 25209} 25210 25211@Article{ bennett.mangasarian:multicategory, 25212 author = {K. P. Bennett and O. L. Mangasarian}, 25213 title = {Multicategory Separation via Linear Programming}, 25214 journal = {Optimization Methods and Software}, 25215 year = {1993}, 25216 volume = {3}, 25217 pages = {27--39} 25218} 25219 25220@InProceedings{ bennett.mangasarian:neural, 25221 author = {K. P. Bennett and O. L. Mangasarian}, 25222 title = {Neural Network Training via Linear Programming}, 25223 booktitle = {Advances in Optimization and Parallel Computing}, 25224 year = {1992}, 25225 editor = {P. M. Pardalos}, 25226 publisher = {North Holland}, 25227 address = {Amsterdam}, 25228 pages = {56--67} 25229} 25230 25231@Article{ bennett.mangasarian:robust, 25232 author = {K. P. Bennett and O. L. Mangasarian}, 25233 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 25234 journal = {Optimization Methods and Software}, 25235 year = {1992}, 25236 volume = {1}, 25237 pages = {23--34} 25238} 25239 25240@Article{ bennett.mangasarian:serial, 25241 author = {K. P. Bennett and O. L. Mangasarian}, 25242 title = {Serial and Parallel Multicategory Separation}, 25243 journal = {SIAM Journal on Optimization}, 25244 year = {1994}, 25245 volume = {4}, 25246 pages = {722--734} 25247} 25248 25249@TechReport{ bennett.wu.ea:support, 25250 author = {K. P. Bennett and D. Wu and L. Auslender}, 25251 title = {On Support Vector Decision Trees for Database Marketing}, 25252 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 25253 year = {1998}, 25254 optkey = {}, 25255 opttype = {RPI Math Report}, 25256 optnumber = {98-100}, 25257 optaddress = {Troy, New York}, 25258 optmonth = {}, 25259 optnote = {}, 25260 optannote = {} 25261} 25262 25263@InProceedings{ bennett:decision, 25264 author = {K. P. Bennett}, 25265 title = {Decision Tree Construction Via Linear Programming}, 25266 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 25267 Society Conference}, 25268 year = {1992}, 25269 editor = {M. Evans}, 25270 address = {Utica, Illinois}, 25271 pages = {97--101} 25272} 25273 25274@Book{ berge.ghouila-houri:programming, 25275 author = {C. Berge and A. Ghouila-Houri}, 25276 title = {Programming, Games and Transportation Networks}, 25277 year = {1965}, 25278 publisher = {John Wiley \& Sons}, 25279 address = {New York} 25280} 25281 25282@Book{ berge:topological, 25283 author = {C. Berge}, 25284 title = {Topological Spaces}, 25285 year = {1963}, 25286 publisher = {McMillan}, 25287 address = {New York} 25288} 25289 25290@TechReport{ berkelaar.jansen.ea:basis, 25291 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 25292 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 25293 Complementarity Problems}, 25294 institution = {Department of Econometrics and Operations Research}, 25295 year = {1996}, 25296 address = {Erasmus University, Rotterdam, The Netherlands} 25297} 25298 25299@Article{ bertsekas.baz:distributed, 25300 author = {D. P. Bertsekas and D. El Baz}, 25301 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 25302 journal = {SIAM Journal on Control and Optimization}, 25303 year = {1987}, 25304 volume = {25}, 25305 pages = {74--85} 25306} 25307 25308@Article{ bertsekas.gafni:projection, 25309 author = {D. P. Bertsekas and E. M. Gafni}, 25310 title = {Projection Methods for Variational Inequalities with Application to the Traffic 25311 Assignment Problem}, 25312 journal = {Mathematical Programming Study}, 25313 year = {1982}, 25314 volume = {17}, 25315 pages = {139--159} 25316} 25317 25318@Article{ bertsekas.hossein.ea:relaxation, 25319 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 25320 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 25321 journal = {SIAM Journal on Control and Optimization}, 25322 year = {1987}, 25323 volume = {25}, 25324 pages = {1219--1243} 25325} 25326 25327@Unpublished{ bertsekas.tseng:partial, 25328 author = {D. P. Bertsekas and P. Tseng}, 25329 title = {Partial Proximal Minimization for Convex Programming}, 25330 year = {1991}, 25331 note = {Manuscript} 25332} 25333 25334@Article{ bertsekas.tsitsiklis:analysis, 25335 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25336 title = {An Analysis of Stochastic Shortest Path Problems}, 25337 journal = {Mathematics of Operations Research}, 25338 year = {1991}, 25339 volume = {16}, 25340 pages = {580--595} 25341} 25342 25343@Book{ bertsekas.tsitsiklis:parallel, 25344 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25345 title = {Parallel and Distributed Computation: Numerical Methods}, 25346 publisher = {Prentice-Hall, Inc}, 25347 year = {1989}, 25348 address = {Englewood Cliffs, New Jersey} 25349} 25350 25351@Book{ bertsekas:constrained, 25352 author = {D. P. Bertsekas}, 25353 title = {Constrained Optimization and Lagrange Multiplier Methods}, 25354 year = {1982}, 25355 publisher = {Academic Press}, 25356 address = {New York} 25357} 25358 25359@Book{ bertsekas:dynamic, 25360 author = {D. P. Bertsekas}, 25361 title = {Dynamic Programming and Optimal Control}, 25362 publisher = {Athena Scientific}, 25363 year = {1995}, 25364 address = {Belmont MA} 25365} 25366 25367@Article{ bertsekas:enlarging, 25368 author = {D. P. Bertsekas}, 25369 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 25370 Optimization}, 25371 journal = {Journal of Optimization Theory and Applications}, 25372 year = {1982}, 25373 volume = {36}, 25374 pages = {221--252} 25375} 25376 25377@Article{ bertsekas:goldstein-levitin-poljak, 25378 author = {D. P. Bertsekas}, 25379 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 25380 journal = {IEEE Transactions on Automatic Control}, 25381 year = {1976}, 25382 volume = {AC-21}, 25383 pages = {174--184} 25384} 25385 25386@Article{ bertsekas:multiplier, 25387 author = {D. P. Bertsekas}, 25388 title = {Multiplier Methods: {A} Survey}, 25389 journal = {Automatica}, 25390 year = {1976}, 25391 volume = {12}, 25392 pages = {133--145} 25393} 25394 25395@Article{ bertsekas:necessary, 25396 author = {D. P. Bertsekas}, 25397 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 25398 journal = {Mathematical Programming}, 25399 year = {1975}, 25400 volume = {9}, 25401 pages = {87--99} 25402} 25403 25404@Book{ bertsekas:nonlinear, 25405 author = {D. P. Bertsekas}, 25406 title = {Nonlinear Programming}, 25407 publisher = {Athena Scientific}, 25408 year = {1995}, 25409 address = {Belmont, Massachusetts} 25410} 25411 25412@Article{ bertsekas:projected, 25413 author = {Dimitri P. Bertsekas}, 25414 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 25415 journal = {SIAM Journal on Control and Optimization}, 25416 year = {1982}, 25417 volume = {20}, 25418 pages = {221--246} 25419} 25420 25421@Article{ billups.dirkse.ea:comparison, 25422 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 25423 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 25424 journal = {Computational Optimization and Applications}, 25425 year = {1997}, 25426 pages = {3--25}, 25427 volume = {7}, 25428 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 25429 key = {51} 25430} 25431 25432@Article{ billups.ferris:convergence, 25433 author = {S. C. Billups and M. C. Ferris}, 25434 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 25435 Starting Points}, 25436 journal = {SIAM Journal on Optimization}, 25437 year = {1996}, 25438 volume = {6}, 25439 pages = {316--325}, 25440 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 25441 key = {34} 25442} 25443 25444@TechReport{ billups.ferris:convergence*1, 25445 author = {S. C. Billups and M. C. Ferris}, 25446 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 25447 Points}, 25448 institution = {Computer Sciences Department, University of Wisconsin}, 25449 year = {1993}, 25450 address = {Madison, Wisconsin}, 25451 number = {1180}, 25452 note = {Revised version in SIAM Journal on Optimization.} 25453} 25454 25455@Article{ billups.ferris:qpcomp, 25456 author = {S. C. Billups and M. C. Ferris}, 25457 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 25458 year = {1997}, 25459 journal = {Mathematical Programming}, 25460 pages = {533--562}, 25461 volume = {76}, 25462 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 25463 key = {47} 25464} 25465 25466@Article{ billups.ferris:solutions, 25467 author = {S. C. Billups and M. C. Ferris}, 25468 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 25469 journal = {Mathematics of Operations Research}, 25470 volume = {24}, 25471 pages = {219--236}, 25472 year = {1999}, 25473 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 25474 key = {42}, 25475 institution = {Computer Sciences Department, University of Wisconsin}, 25476 address = {Madison, Wisconsin}, 25477 type = {Mathematical Programming Technical Report}, 25478 number = {94--15} 25479} 25480 25481@TechReport{ billups.murata.ea:users, 25482 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 25483 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 25484 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 25485 institution = {SNL}, 25486 year = {1994}, 25487 month = jan, 25488 address = {Albuquerque, New Mexico}, 25489 number = {SAND91--1482} 25490} 25491 25492@TechReport{ billups.speight.ea:nonmonotone, 25493 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 25494 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 25495 Problems}, 25496 institution = {Department of Mathematics, University of Colorado}, 25497 year = {1999}, 25498 address = {Denver, Colorado} 25499} 25500 25501@PhDThesis{ billups:algorithms, 25502 author = {S. C. Billups}, 25503 title = {Algorithms for Complementarity Problems and Generalized Equations}, 25504 school = {University of Wisconsin--Madison}, 25505 year = {1995}, 25506 address = {Madison, Wisconsin}, 25507 month = aug 25508} 25509 25510@MastersThesis{ billups:augmented, 25511 author = {S. C. Billups}, 25512 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 25513 school = {Virginia Tech}, 25514 year = {1985}, 25515 address = {Blacksburg, Virginia} 25516} 25517 25518@TechReport{ billups:homotopy, 25519 author = {S. C. Billups}, 25520 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 25521 institution = {Department of Mathematics, University of Colorado}, 25522 year = {1998}, 25523 address = {Denver, Colorado} 25524} 25525 25526@Article{ billups:improving, 25527 author = {S. C. Billups}, 25528 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 25529 Proximal Perturbations}, 25530 year = {2000}, 25531 journal = {Mathematical Programming}, 25532 volume = {87}, 25533 pages = {153--176} 25534} 25535 25536@Book{ birge.louveaux:introduction, 25537 author = {J. R. Birge and R. Louveaux}, 25538 title = {Introduction to Stochastic Programming}, 25539 publisher = {Springer}, 25540 address = {New York}, 25541 year = {1997} 25542} 25543 25544@TechReport{ bischof.carle.ea:adifor, 25545 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 25546 title = {{ADIFOR} 2.0 User's Guide}, 25547 institution = {Argonne National Laboratory}, 25548 year = {1995}, 25549 address = {Argonne, Illinois}, 25550 number = {ANL/MCS--TM--192}, 25551 type = {Mathematics and Computer Science Division Report} 25552} 25553 25554@Book{ bisschop.entriken:aimms, 25555 author = {J. Bisschop and R. Entriken}, 25556 title = {{AIMMS} -- The Modeling System}, 25557 year = {1993}, 25558 publisher = {Paragon Decision Technology}, 25559 address = {Haarlem, The Netherlands} 25560} 25561 25562@Article{ bisschop.meeraus:development, 25563 author = {J. Bisschop and A. Meeraus}, 25564 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 25565 Environment}, 25566 journal = {Mathematical Programming Study}, 25567 year = {1982}, 25568 volume = {20}, 25569 pages = {1--29} 25570} 25571 25572@Misc{ bixby.ceria.ea:miplib, 25573 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 25574 title = {{MIPLIB} 3.0}, 25575 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 25576} 25577 25578@InProceedings{ bjorkman.klarbring.ea:sequential, 25579 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 25580 Sj{\"{o}}din}, 25581 title = {Sequential quadratic programming for non-linear elastic contact problems}, 25582 editor = {J. Herskovits}, 25583 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 25584 Systems}, 25585 volume = {2}, 25586 year = {1993}, 25587 pages = {301--308} 25588} 25589 25590@Article{ bjorkman:path, 25591 author = {G. Bj{\"o}rkman}, 25592 title = {Path Following and Critical Points for Contact Problems}, 25593 journal = {Computational Mechanics}, 25594 volume = {10}, 25595 pages = {231--246}, 25596 year = {1992} 25597} 25598 25599@Article{ bjorkman:solution, 25600 author = {G. Bj{\"o}rkman}, 25601 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 25602 of Linear Complementarity Problems}, 25603 journal = {International Journal for Numerical Methods in Engineering}, 25604 volume = {31}, 25605 pages = {1553--1566}, 25606 year = {1991} 25607} 25608 25609@Article{ bland:pivot, 25610 author = {R. G. Bland}, 25611 title = {New Pivot Rules for the Simplex Method}, 25612 journal = {Mathematics of Operations Research}, 25613 year = {1977}, 25614 volume = {2}, 25615 pages = {103--107} 25616} 25617 25618@Article{ block.levin:boundedness, 25619 author = {H. D. Block and S. A. Levin}, 25620 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 25621 Inequalities}, 25622 journal = {Proceedings of the American Mathematical Society}, 25623 year = {1970}, 25624 volume = {26}, 25625 pages = {229--235} 25626} 25627 25628@Book{ bloomer:power, 25629 author = {J. Bloomer}, 25630 title = {Power Programming with {RPC}}, 25631 publisher = {O'Reilly and Associates, Inc.}, 25632 address = {Sebastopol, CA}, 25633 year = {1992} 25634} 25635 25636@InProceedings{ blum.rivest:training, 25637 author = {A. Blum and R. L. Rivest}, 25638 title = {Training a 3-Node Neural Network is {NP}-Complete}, 25639 booktitle = {Advances in Neural Information Processing Systems I}, 25640 year = {1989}, 25641 editor = {D. S. Touretzky}, 25642 publisher = {Morgan Kaufmann}, 25643 address = {San Mateo, California}, 25644 pages = {494--501} 25645} 25646 25647@InProceedings{ boehringer.ferris.ea:exemptions, 25648 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 25649 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 25650 from a General Equilibrium Model for Six {EU} Countries}, 25651 key = {49}, 25652 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 25653 year = {1995} 25654} 25655 25656@Article{ boender.kan:bayesian, 25657 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 25658 title = {Bayesian Stopping Rules for Global Optimization}, 25659 journal = {Mathematical Programming}, 25660 year = {1987}, 25661 volume = {37}, 25662 pages = {59--80} 25663} 25664 25665@Article{ boggs:convergence, 25666 author = {P. T. Boggs}, 25667 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 25668 Problems}, 25669 journal = {Mathematics of Computation}, 25670 year = {1976}, 25671 volume = {30}, 25672 pages = {512--522} 25673} 25674 25675@InProceedings{ bolzon.cochetti.ea:computing, 25676 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 25677 title = {On computing all solutions in decohesion}, 25678 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 25679 International Congress of Theoretical and Applied Mechanics}, 25680 year = {1996}, 25681 address = {Kyoto} 25682} 25683 25684@InProceedings{ bolzon.maier.ea:holonomic, 25685 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25686 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 25687 study of mathematical programming approaches}, 25688 booktitle = {Fracture Mechanics of Concrete Structures}, 25689 editor = {F. H. Wittmann}, 25690 series = {Second International Conference on Fracture Mechanics of Concrete Structures 25691 (FRAMCOS 2)}, 25692 year = {1995}, 25693 publisher = {Aedificatio Publishers}, 25694 pages = {885--898} 25695} 25696 25697@InProceedings{ bolzon.maier.ea:holonomic*1, 25698 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25699 title = {On holonomic structural analysis as a complementarity problem}, 25700 booktitle = {APCOM96, Seoul}, 25701 year = {1996} 25702} 25703 25704@Article{ bolzon.maier.ea:multiplicity, 25705 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25706 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 25707 journal = {Computational Mechanics}, 25708 year = {1997}, 25709 volume = {19}, 25710 pages = {511--516} 25711} 25712 25713@Article{ bongartz.conn.ea:cute, 25714 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 25715 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 25716 year = {1995}, 25717 journal = {{ACM} Transactions on Mathematical Software}, 25718 volume = {21}, 25719 pages = {123--160} 25720} 25721 25722@Article{ boppana:eigenvalues, 25723 author = {R. Boppana}, 25724 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 25725 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 25726 pages = {280--285}, 25727 year = {1987} 25728} 25729 25730@Article{ bortfeld.kahler.ea:x-ray, 25731 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 25732 title = {{X}-ray field compensation with multileaf collimators}, 25733 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25734 year = {1994}, 25735 volume = {28}, 25736 number = {3}, 25737 pages = {723--730} 25738} 25739 25740@Article{ bortfeld.schlegel:optimization, 25741 author = {T. Bortfeld and W. Schlegel}, 25742 title = {Optimization of beam orientations in radiation therapy: some theoretical 25743 considerations}, 25744 journal = {Physics in Medicine and Biology}, 25745 year = {1993}, 25746 volume = {38}, 25747 number = {2}, 25748 pages = {291--304} 25749} 25750 25751@Article{ borwein:stability, 25752 author = {J. M. Borwein}, 25753 title = {Stability and regular points of inequality systems}, 25754 journal = {Journal of Optimization Theory and Applications}, 25755 year = {1986}, 25756 volume = {48}, 25757 pages = {9--52} 25758} 25759 25760@Article{ boyer:present, 25761 author = {A. L. Boyer}, 25762 title = {Present and Future Developments in Radiotherapy Treatment Units}, 25763 journal = {Seminars in Radiation Oncology}, 25764 year = {1995}, 25765 volume = {5}, 25766 number = {2}, 25767 pages = {146--155} 25768} 25769 25770@Article{ bracken.mcgill:mathematical, 25771 author = {J. Bracken and J. T. McGill}, 25772 title = {Mathematical programs with optimization problems in the constraints}, 25773 journal = {Operations Research}, 25774 volume = {21}, 25775 year = {1973}, 25776 pages = {37--44} 25777} 25778 25779@Article{ bradley.fayyad.ea:mathematical, 25780 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 25781 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 25782 journal = {INFORMS Journal on Computing}, 25783 year = {1999}, 25784 volume = {11}, 25785 pages = {217--238} 25786} 25787 25788@TechReport{ bradley.mangasarian.ea:clustering, 25789 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25790 title = {Clustering via Concave Minimization}, 25791 institution = {Computer Sciences Department, University of Wisconsin}, 25792 year = {1996}, 25793 type = {Mathematical Programming Technical Report}, 25794 number = {96-03}, 25795 address = {Madison, Wisconsin} 25796} 25797 25798@TechReport{ bradley.mangasarian.ea:feature, 25799 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25800 title = {Feature Selection via Mathematical Programming}, 25801 institution = {Computer Sciences Department, University of Wisconsin}, 25802 year = {1995}, 25803 type = {Mathematical Programming Technical Report}, 25804 number = {95-21}, 25805 address = {Madison, Wisconsin} 25806} 25807 25808@Article{ bradley.mangasarian:massive, 25809 author = {P. S. Bradley and O. L. Mangasarian}, 25810 title = {Massive Data Discrimination via Linear Support Vector Machines}, 25811 year = {2000}, 25812 journal = {Optimization Methods and Software}, 25813 volume = {13}, 25814 pages = {1-10} 25815} 25816 25817@PhDThesis{ brady:condition, 25818 author = {L. Brady}, 25819 title = {Condition Constants for Solutions of Convex Inequalities}, 25820 year = {1988}, 25821 address = {Madison, Wisconsin}, 25822 school = {Computer Sciences Department, University of Wisconsin} 25823} 25824 25825@Article{ braess:uber, 25826 author = {D. Braess}, 25827 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 25828 journal = {Unternehmensforschung}, 25829 year = {1968}, 25830 volume = {12}, 25831 pages = {258--268} 25832} 25833 25834@Article{ brahme:optimization, 25835 author = {A. Brahme}, 25836 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 25837 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25838 year = {1993}, 25839 volume = {25}, 25840 pages = {373--375} 25841} 25842 25843@Article{ brahme:stationary, 25844 author = {A. Brahme}, 25845 title = {Optimization of stationary and moving beam radiation therapy techniques}, 25846 journal = {Radiother. Oncol.}, 25847 year = {1988}, 25848 volume = {12}, 25849 pages = {129--140} 25850} 25851 25852@InCollection{ brahme:treatment, 25853 author = {A. Brahme}, 25854 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 25855 booktitle = {Radiation Therapy Physics}, 25856 publisher = {Springer-Verlag}, 25857 year = {1995}, 25858 editor = {A. R. Smith}, 25859 address = {Berlin}, 25860 pages = {209--246} 25861} 25862 25863@TechReport{ branch:getting, 25864 author = {M. A. Branch}, 25865 title = {Getting {CUTE} with {M}atlab}, 25866 institution = {Cornell University}, 25867 year = {1994}, 25868 type = {Cornell Theory Center Report}, 25869 number = {CTC94TR194}, 25870 address = {Ithaca, New York} 25871} 25872 25873@Article{ brearley.mitra.ea:analysis, 25874 author = {A. Brearley and G. Mitra and H. Williams}, 25875 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 25876 Algorithm}, 25877 journal = {Mathematical Programming}, 25878 year = {1975}, 25879 volume = {8}, 25880 pages = {54--83} 25881} 25882 25883@Article{ bredensteiner.bennett:feature, 25884 author = {E. Bredensteiner and K. Bennett}, 25885 title = {Feature Minimization within Decision Trees}, 25886 journal = {Computational Optimization and Applications}, 25887 year = {1998}, 25888 volume = {10}, 25889 pages = {111--126} 25890} 25891 25892@Article{ bregman:relaxation, 25893 author = {L. M. Bregman}, 25894 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 25895 Application to the Solution of Problems in Convex Programming}, 25896 journal = {USSR Computational Mathematics and Mathematical Physics}, 25897 year = {1967}, 25898 volume = {7}, 25899 pages = {200--217} 25900} 25901 25902@Book{ brenner.hall:making, 25903 author = {D. J. Brenner and E. J. Hall}, 25904 title = {Making the Radiation Therapy Decision}, 25905 publisher = {Contemporary Books}, 25906 year = {1996}, 25907 address = {Chicago, IL} 25908} 25909 25910@Book{ brent:algorithms, 25911 author = {R. P. Brent}, 25912 title = {Algorithms for Minimization without Derivatives}, 25913 publisher = {Prentice-Hall, Inc}, 25914 year = {1973}, 25915 address = {Englewood Cliffs, New Jersey} 25916} 25917 25918@Article{ brewster.mohan.ea:three, 25919 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 25920 title = {Three dimensional conformal treatment planning with multileaf collimators}, 25921 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25922 year = {1995}, 25923 volume = {33}, 25924 number = {5}, 25925 pages = {1081--1089} 25926} 25927 25928@Article{ brezis.lions:produits, 25929 author = {H. Br\'{e}zis and P.--L. Lions}, 25930 title = {Produits Infinis de Resolvantes}, 25931 journal = {Israel Journal of Mathematics}, 25932 year = {1978}, 25933 volume = {29}, 25934 pages = {329--345} 25935} 25936 25937@Book{ brezis:operateurs, 25938 author = {H. Br\'{e}zis}, 25939 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 25940 Espaces de Hilbert}, 25941 publisher = {North-Holland}, 25942 address = {Amsterdam}, 25943 year = {1973} 25944} 25945 25946@Book{ brooke.kendrick.ea:gams, 25947 author = {A. Brooke and D. Kendrick and A. Meeraus}, 25948 title = {{GAMS}: {A} User's Guide}, 25949 year = {1988}, 25950 publisher = {The Scientific Press}, 25951 address = {South San Francisco, CA} 25952} 25953 25954@Article{ brown.demarzo.ea:computing, 25955 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 25956 title = {Computing Equilibria when Asset Markets Are Incomplete}, 25957 journal = {Econometrica}, 25958 year = {1996}, 25959 volume = {64}, 25960 pages = {1--28} 25961} 25962 25963@Article{ bruck:iterative, 25964 author = {R. E. Bruck}, 25965 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 25966 in {H}ilbert Space}, 25967 journal = {Bulletin of the American Mathematical Society}, 25968 year = {1975}, 25969 volume = {81}, 25970 pages = {890--892} 25971} 25972 25973@Article{ bunch.parlett:direct, 25974 author = {J. R. Bunch and B. N. Parlett}, 25975 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 25976 journal = {SIAM Journal on Numerical Analysis}, 25977 year = {1971}, 25978 volume = {8}, 25979 pages = {639--655} 25980} 25981 25982@Article{ burachik.iusem.ea:enlargement, 25983 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 25984 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 25985 year = {1997}, 25986 journal = {Set-Valued Analysis, forthcoming} 25987} 25988 25989@TechReport{ burachik.iusem:generalized, 25990 author = {R. S. Burachik and A. N. Iusem}, 25991 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 25992 Problem}, 25993 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 25994 year = {1995}, 25995 type = {Working Paper}, 25996 address = {Rio de Janeiro} 25997} 25998 25999@Article{ burachik.iusem:generalized*1, 26000 author = {R. S. Burachik and A. N. Iusem}, 26001 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 26002 {A} {H}ilbert Space}, 26003 year = {1998}, 26004 journal = {SIAM Journal on Optimization}, 26005 volume = {8}, 26006 pages = {197--216} 26007} 26008 26009@Article{ burdakov:globally, 26010 author = {O. P. Burdakov}, 26011 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 26012 of Nonlinear Equations}, 26013 journal = {Soviet Mathematics Doklady}, 26014 year = {1980}, 26015 volume = {22}, 26016 pages = {376--379} 26017} 26018 26019@Article{ burges:tutorial, 26020 author = {C. J. C. Burges}, 26021 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 26022 journal = {Data Mining and Knowledge Discovery}, 26023 volume = {2}, 26024 number = {2}, 26025 pages = {121-167}, 26026 year = {1998} 26027} 26028 26029@Article{ burke.ferris.ea:clarke, 26030 author = {J. V. Burke and M. C. Ferris and M. Qian}, 26031 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 26032 journal = {Journal of Mathematical Analysis and its Applications}, 26033 year = {1992}, 26034 volume = {166}, 26035 pages = {199--213}, 26036 key = {16} 26037} 26038 26039@Unpublished{ burke.ferris.ea:least, 26040 author = {J. V. Burke and M. C. Ferris and L. Qi}, 26041 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 26042 year = {1994}, 26043 month = mar, 26044 note = {Manuscript}, 26045 key = {999} 26046} 26047 26048@Article{ burke.ferris:characterization, 26049 author = {J. V. Burke and M. C. Ferris}, 26050 title = {Characterization of Solution Sets of Convex Programs}, 26051 journal = {Operations Research Letters}, 26052 year = {1991}, 26053 volume = {10}, 26054 pages = {57--60}, 26055 key = {10} 26056} 26057 26058@Article{ burke.ferris:gauss-newton, 26059 author = {J. V. Burke and M. C. Ferris}, 26060 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 26061 journal = {Mathematical Programming}, 26062 year = {1995}, 26063 volume = {71}, 26064 pages = {179--194}, 26065 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 26066 key = {32} 26067} 26068 26069@Article{ burke.ferris:weak, 26070 author = {J. V. Burke and M. C. Ferris}, 26071 title = {Weak Sharp Minima in Mathematical Programming}, 26072 journal = {SIAM Journal on Control and Optimization}, 26073 year = {1993}, 26074 volume = {31}, 26075 pages = {1340--1359}, 26076 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 26077 key = {23} 26078} 26079 26080@Article{ burke.more.ea:convergence, 26081 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 26082 title = {Convergence Properties of Trust Region Methods for Linear and Convex 26083 Constraints}, 26084 journal = {Mathematical Programming}, 26085 year = {1990}, 26086 volume = {47}, 26087 pages = {305--336} 26088} 26089 26090@Article{ burke.more:exposing, 26091 author = {J. V. Burke and J. J. Mor\'{e}}, 26092 title = {Exposing Constraints}, 26093 journal = {SIAM Journal on Optimization}, 26094 year = {1994}, 26095 volume = {4}, 26096 pages = {573--595} 26097} 26098 26099@Article{ burke.more:identification, 26100 author = {J. V. Burke and J. J. Mor\'{e}}, 26101 title = {On the Identification of Active Constraints}, 26102 journal = {SIAM Journal on Numerical Analysis}, 26103 year = {1988}, 26104 volume = {25}, 26105 pages = {1197--1211} 26106} 26107 26108@Article{ burke.poliquin:optimality, 26109 author = {J. V. Burke and R. A. Poliquin}, 26110 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 26111 journal = {Mathematical Programming}, 26112 year = {1992}, 26113 volume = {57}, 26114 pages = {103--120} 26115} 26116 26117@Article{ burke.tseng:unified, 26118 author = {J. V. Burke and P. Tseng}, 26119 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 26120 journal = {SIAM Journal on Optimization}, 26121 year = {1996}, 26122 volume = {6}, 26123 pages = {265--282} 26124} 26125 26126@Article{ burke.xu:global, 26127 author = {J. V. Burke and S. Xu}, 26128 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 26129 Linear Complementarity Problems}, 26130 year = {1998}, 26131 journal = {Mathematics of Operations Research}, 26132 volume = {23}, 26133 pages = {719--735} 26134} 26135 26136@TechReport{ burke:algorithms, 26137 author = {J. V. Burke}, 26138 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 26139 Inequalities that have both Global and Quadratic Convergence Properties}, 26140 institution = {Argonne National Laboratory}, 26141 year = {1985}, 26142 address = {Argonne, Illinois}, 26143 number = {ANL/MCS--TM--54}, 26144 type = {Mathematics and Computer Science Division Report} 26145} 26146 26147@Article{ burke:descent, 26148 author = {J. V. Burke}, 26149 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 26150 journal = {Mathematical Programming}, 26151 year = {1985}, 26152 volume = {33}, 26153 pages = {260--279} 26154} 26155 26156@Article{ burke:exact, 26157 author = {J. V. Burke}, 26158 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 26159 journal = {SIAM Journal on Control and Optimization}, 26160 year = {1991}, 26161 volume = {29}, 26162 pages = {968--998} 26163} 26164 26165@Article{ burke:identification, 26166 author = {J. V. Burke}, 26167 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 26168 journal = {SIAM Journal on Numerical Analysis}, 26169 year = {1990}, 26170 volume = {27}, 26171 pages = {1081--1102} 26172} 26173 26174@Article{ burke:robust, 26175 author = {J. V. Burke}, 26176 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 26177 journal = {SIAM Journal on Optimization}, 26178 year = {1992}, 26179 volume = {2}, 26180 pages = {325--347} 26181} 26182 26183@Article{ burke:second, 26184 author = {J. V. Burke}, 26185 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 26186 journal = {Mathematical Programming}, 26187 year = {1987}, 26188 volume = {38}, 26189 pages = {287--302} 26190} 26191 26192@Article{ burke:sequential, 26193 author = {J. V. Burke}, 26194 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 26195 Programs}, 26196 journal = {Journal of Mathematical Analysis and its Applications}, 26197 year = {1989}, 26198 volume = {139}, 26199 pages = {319--351} 26200} 26201 26202@Article{ burman.kutcher.ea:fitting, 26203 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 26204 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 26205 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26206 year = {1991}, 26207 optvolume = {21}, 26208 optpages = {123-135} 26209} 26210 26211@TechReport{ busovaca:handling, 26212 author = {S. Busovaca}, 26213 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 26214 institution = {University of Waterloo}, 26215 year = {1985}, 26216 address = {Ontario}, 26217 number = {CS85 34}, 26218 type = {Technical Report} 26219} 26220 26221@Article{ butler.martin:method, 26222 author = {T. Butler and A. V. Martin}, 26223 title = {On a Method of {C}ourant for Minimizing Functionals}, 26224 journal = {Journal of Mathematical Physics}, 26225 year = {1962}, 26226 volume = {41}, 26227 pages = {291--299} 26228} 26229 26230@Article{ calamai.more:projected, 26231 author = {P. H. Calamai and J. J. Mor\'{e}}, 26232 title = {Projected Gradient Methods for Linearly Constrained Problems}, 26233 journal = {Mathematical Programming}, 26234 year = {1987}, 26235 volume = {39}, 26236 pages = {93--116} 26237} 26238 26239@Article{ cao.ferris:genetic, 26240 author = {M. Cao and M. C. Ferris}, 26241 title = {Genetic Algorithms in Optimization}, 26242 journal = {Journal of Undergraduate Mathematics and its Applications}, 26243 year = {1991}, 26244 volume = {12}, 26245 pages = {81--90}, 26246 key = {17} 26247} 26248 26249@Article{ cao.ferris:interior, 26250 author = {M. Cao and M. C. Ferris}, 26251 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 26252 journal = {Journal of Optimization Theory and Applications}, 26253 year = {1994}, 26254 volume = {83}, 26255 pages = {269--283}, 26256 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 26257 key = {28} 26258} 26259 26260@Article{ cao.ferris:lineality, 26261 author = {M. Cao and M. C. Ferris}, 26262 title = {Lineality Removal for Copositive--Plus Normal Maps}, 26263 year = {1995}, 26264 volume = {2}, 26265 pages = {1--10}, 26266 journal = {Communications on Applied Nonlinear Analysis}, 26267 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 26268 key = {38} 26269} 26270 26271@Article{ cao.ferris:pc, 26272 author = {M. Cao and M. C. Ferris}, 26273 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 26274 journal = {Linear Algebra and Its Applications}, 26275 year = {1996}, 26276 volume = {246}, 26277 pages = {299--312}, 26278 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 26279 key = {37} 26280} 26281 26282@Article{ cao.ferris:pivotal, 26283 author = {M. Cao and M. C. Ferris}, 26284 title = {A Pivotal Method for Affine Variational Inequalities}, 26285 journal = {Mathematics of Operations Research}, 26286 year = {1996}, 26287 volume = {21}, 26288 pages = {44--64}, 26289 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 26290 key = {29} 26291} 26292 26293@PhDThesis{ cao:piecewise, 26294 author = {M. Cao}, 26295 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 26296 school = {Computer Sciences Department, University of Wisconsin}, 26297 year = {1994}, 26298 address = {Madison, Wisconsin}, 26299 note = {Technical Report 1210} 26300} 26301 26302@Article{ caroe.schultz:dual, 26303 author = {C. C. Car{\o}e and R. Schultz}, 26304 title = {Dual Decomposition in Stochastic Integer Programming}, 26305 journal = {Operations Research Letters}, 26306 volume = {24}, 26307 pages = {37-45}, 26308 year = {1999} 26309} 26310 26311@Article{ carol.targovnik.ea:initial, 26312 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 26313 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 26314 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 26315 conformal radiation therapy system}, 26316 journal = {Stereotactic and Functional Neurosurgery}, 26317 year = {1996}, 26318 volume = {66}, 26319 pages = {30--34} 26320} 26321 26322@Article{ carolan.hill.ea:empirical, 26323 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 26324 Wichmann}, 26325 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 26326 Applications}, 26327 journal = {Operations Research}, 26328 year = {1990}, 26329 volume = {38}, 26330 pages = {240--248} 26331} 26332 26333@Article{ carroll:created, 26334 author = {C. W. Carroll}, 26335 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 26336 Systems}, 26337 journal = {Operations Research}, 26338 year = {1961}, 26339 volume = {9}, 26340 pages = {169--184} 26341} 26342 26343@PhDThesis{ carroll:operations, 26344 author = {C. W. Carroll}, 26345 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 26346 Process}, 26347 year = {1959}, 26348 address = {Appleton, Wisconsin}, 26349 school = {Institute of Paper Chemistry} 26350} 26351 26352@TechReport{ casanova.dongarra:netsolve, 26353 author = {H. Casanova and J. Dongarra}, 26354 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 26355 institution = {University of Tennessee}, 26356 year = {1996}, 26357 type = {Technical Report} 26358} 26359 26360@TechReport{ cavalier.soyster:computational, 26361 author = {T. M. Cavalier and A. L. Soyster}, 26362 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 26363 institution = {Pennsylvania State University}, 26364 year = {1985}, 26365 address = {Pennsylvania}, 26366 number = {85-105}, 26367 type = {ISME Working Paper} 26368} 26369 26370@TechReport{ censor.iusem.ea:interior-point, 26371 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 26372 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 26373 Problem with Paramonotone Operators}, 26374 institution = {University of Haifa}, 26375 year = {1994}, 26376 type = {Working Paper} 26377} 26378 26379@Article{ censor.lent:iterative, 26380 author = {Y. Censor and A. Lent}, 26381 title = {An Iterative Row-Action Method for Interval Convex Programming}, 26382 journal = {Journal of Optimization Theory and Applications}, 26383 year = {1981}, 26384 volume = {34}, 26385 pages = {275--291} 26386} 26387 26388@InCollection{ censor.pierro.ea:iterative, 26389 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 26390 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 26391 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 26392 XXIV}, 26393 publisher = {Banach Center}, 26394 year = {1987}, 26395 editor = {A. J. Wakulicz}, 26396 address = {Warsaw, Poland} 26397} 26398 26399@Article{ censor.segman:block-iterative, 26400 author = {Y. Censor and J. Segman}, 26401 title = {On Block-Iterative Entropy Maximization}, 26402 journal = {Journal of Information and Optimization Science}, 26403 year = {1987}, 26404 volume = {8}, 26405 pages = {275--291} 26406} 26407 26408@Article{ censor.zenios:proximal, 26409 author = {Y. Censor and S. A. Zenios}, 26410 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 26411 journal = {Journal of Optimization Theory and Applications}, 26412 year = {1992}, 26413 volume = {73}, 26414 pages = {451--464} 26415} 26416 26417@Article{ censor:parallel, 26418 author = {Yair Censor}, 26419 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 26420 Therapy}, 26421 journal = {Mathematical Programming}, 26422 year = {1988}, 26423 volume = {42}, 26424 pages = {307--325} 26425} 26426 26427@Article{ censor:row-action, 26428 author = {Yair Censor}, 26429 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 26430 journal = {SIAM Review}, 26431 year = {1981}, 26432 volume = {23}, 26433 pages = {444--466} 26434} 26435 26436@Article{ chajakis.zenios:synchronous, 26437 author = {E. D. Chajakis and S. A. Zenios}, 26438 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 26439 Nonlinear Network Optimization}, 26440 journal = {Parallel Computing}, 26441 year = {1990}, 26442 note = {To appear} 26443} 26444 26445@Article{ chamberlain.powell.ea:watchdog, 26446 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 26447 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 26448 Optimization}, 26449 journal = {Mathematical Programming Study}, 26450 year = {1982}, 26451 volume = {16}, 26452 pages = {1--17} 26453} 26454 26455@Article{ chan.pang:generalized, 26456 author = {D. Chan and J. S. Pang}, 26457 title = {The Generalized Quasi-Variational Inequality Problem}, 26458 journal = {Mathematics of Operations Research}, 26459 volume = {7}, 26460 pages = {211--222}, 26461 year = {1982} 26462} 26463 26464@Article{ charalambous:nonlinear, 26465 author = {C. Charalambous}, 26466 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 26467 journal = {Mathematical Programming}, 26468 year = {1977}, 26469 volume = {12}, 26470 pages = {195--225} 26471} 26472 26473@Article{ charnes.cooper.ea:duality, 26474 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 26475 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 26476 journal = {Proceedings of the National Academy of Sciences of the United States}, 26477 year = {1962}, 26478 pages = {783--786} 26479} 26480 26481@Book{ charnes.cooper.ea:introduction, 26482 author = {A. Charnes and W. W. Cooper and A. Henderson}, 26483 title = {An Introduction to Linear Programming}, 26484 year = {1953}, 26485 publisher = {John Wiley \& Sons}, 26486 address = {New York} 26487} 26488 26489@TechReport{ charnes.semple:practical, 26490 author = {A. Charnes and J. Semple}, 26491 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 26492 institution = {CCS}, 26493 year = {1991}, 26494 address = {Austin, Texas}, 26495 number = {663}, 26496 type = {Research Report} 26497} 26498 26499@InProceedings{ charnes:fundamental, 26500 author = {A. Charnes}, 26501 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 26502 booktitle = {Computer and Information Sciences}, 26503 year = {1964}, 26504 editor = {J. T. Lou and R. H. Wilcox}, 26505 publisher = {Spartan Books}, 26506 address = {Washington, D.C.}, 26507 pages = {67--74} 26508} 26509 26510@TechReport{ chen.chen.ea:penalized, 26511 author = {B. Chen and X. Chen and C. Kanzow}, 26512 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 26513 Numerical Results}, 26514 institution = {Institute of Applied Mathematics, University of Hamburg}, 26515 year = {1997}, 26516 type = {Preprint}, 26517 number = {126}, 26518 address = {Hamburg, Germany} 26519} 26520 26521@Article{ chen.chen:global, 26522 author = {B. Chen and X. Chen}, 26523 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 26524 ${R}_0$ {NCP} or Monotone {NCP}}, 26525 journal = {SIAM Journal on Optimization}, 26526 year = {1999}, 26527 volume = {9}, 26528 pages = {624--645} 26529} 26530 26531@Article{ chen.ferris.ea:fatcop, 26532 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 26533 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 26534 Solver}, 26535 journal = {Annals of Operations Research, forthcoming}, 26536 year = {2000}, 26537 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 26538 key = {89}, 26539 type = {Data Mining Institute Technical Report}, 26540 institution = {Computer Sciences Department, University of Wisconsin}, 26541 address = {Madison, Wisconsin}, 26542 number = {99-11} 26543} 26544 26545@TechReport{ chen.ferris:fatcop, 26546 author = {Q. Chen and M. C. Ferris}, 26547 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 26548 type = {Mathematical Programming Technical Report}, 26549 institution = {Computer Sciences Department, University of Wisconsin}, 26550 address = {Madison, Wisconsin}, 26551 year = {1999}, 26552 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 26553 number = {99-05}, 26554 key = {81}, 26555 annote = {Submitted to {\em SIOPT}} 26556} 26557 26558@Article{ chen.florian:nonlinear, 26559 author = {Y. Chen and M. Florian}, 26560 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 26561 Optimality Conditions}, 26562 journal = {Optimization}, 26563 year = {1995}, 26564 volume = {32}, 26565 pages = {193--209} 26566} 26567 26568@TechReport{ chen.florian:o-d, 26569 author = {Y. Chen and M. Florian}, 26570 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 26571 optimality conditions}, 26572 type = {Publication}, 26573 number = {CRT-94-56}, 26574 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 26575 address = {Montr\'eal, Canada}, 26576 year = {1994} 26577} 26578 26579@Article{ chen.harker:continuation, 26580 author = {B. Chen and P. T. Harker}, 26581 title = {A Continuation Method for Monotone Variational Inequalities}, 26582 journal = {Mathematical Programming}, 26583 volume = {69}, 26584 pages = {237--253}, 26585 year = {1995} 26586} 26587 26588@Article{ chen.harker:non-interior, 26589 author = {B. Chen and P. T. Harker}, 26590 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 26591 journal = {SIAM Journal on Matrix Analysis and Applications}, 26592 year = {1993}, 26593 volume = {14}, 26594 pages = {1168--1190} 26595} 26596 26597@Article{ chen.harker:smooth, 26598 author = {B. Chen and P. T. Harker}, 26599 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 26600 journal = {SIAM Journal on Optimization}, 26601 year = {1997}, 26602 volume = {7}, 26603 pages = {403--420} 26604} 26605 26606@Article{ chen.mangasarian:class, 26607 author = {Chunhui Chen and O. L. Mangasarian}, 26608 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 26609 journal = {Computational Optimization and Applications}, 26610 year = {1996}, 26611 volume = {5}, 26612 pages = {97--138} 26613} 26614 26615@Article{ chen.mangasarian:smoothing, 26616 author = {Chunhui Chen and O. L. Mangasarian}, 26617 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 26618 journal = {Mathematical Programming}, 26619 year = {1995}, 26620 volume = {78}, 26621 pages = {51--70} 26622} 26623 26624@Article{ chen.nashed.ea:convergence, 26625 author = {X. Chen and Z. Nashed and L. Qi}, 26626 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 26627 using Adaptive Outer Inverses}, 26628 year = {1997}, 26629 journal = {SIAM Journal on Optimization}, 26630 volume = {7}, 26631 pages = {445--462} 26632} 26633 26634@Article{ chen.qi.ea:global, 26635 author = {X. Chen and L. Qi and D. Sun}, 26636 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 26637 Application to General Box Constrained Variational Inequalities}, 26638 year = {1998}, 26639 journal = {Mathematics of Computation}, 26640 volume = {67}, 26641 pages = {519--540} 26642} 26643 26644@Article{ chen.teboulle:convergence, 26645 author = {G. Chen and M. Teboulle}, 26646 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 26647 Functions}, 26648 journal = {SIAM Journal on Optimization}, 26649 year = {1993}, 26650 volume = {3}, 26651 pages = {538--543} 26652} 26653 26654@Article{ chen.ye:homotopy-smoothing, 26655 author = {X.~Chen and Y.~Ye}, 26656 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 26657 year = {1999}, 26658 journal = {SIAM Journal on Control and Optimization}, 26659 volume = {37}, 26660 pages = {589--616} 26661} 26662 26663@PhDThesis{ chen:forward-backward, 26664 author = {G. H.--G. Chen}, 26665 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 26666 school = {University of Washington}, 26667 year = {1994} 26668} 26669 26670@PhDThesis{ chen:smoothing, 26671 author = {Chunhui Chen}, 26672 title = {Smoothing Methods in Mathematical Programming}, 26673 school = {Computer Sciences Department, University of Wisconsin}, 26674 year = {1995}, 26675 address = {Madison, Wisconsin}, 26676 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26677 annote = {Mathematical Programming Technical Report 95-12} 26678} 26679 26680@Book{ cheney:introduction, 26681 author = {E. W. Cheney}, 26682 title = {Introduction to Approximation Theory}, 26683 year = {1966}, 26684 publisher = {McGraw--Hill}, 26685 address = {New York} 26686} 26687 26688@Article{ cho.kuterdem.ea:spherical, 26689 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 26690 title = {A spherical dose model for radiosurgery treatment planning}, 26691 journal = {Physics in Medicine and Biology}, 26692 year = {1998}, 26693 volume = {43}, 26694 pages = {3145--3148} 26695} 26696 26697@Article{ cho.lee.ea:optimization, 26698 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 26699 title = {Optimization of intensity modulated beams with volume constraints using two 26700 methods: cost function minimization and projection onto convex sets}, 26701 journal = {Medical Physics}, 26702 year = {1998}, 26703 volume = {25}, 26704 number = {4}, 26705 pages = {435--443} 26706} 26707 26708@Article{ choi.desarbo.ea:product, 26709 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 26710 title = {Product Positioning Under Price Competition}, 26711 journal = {Management Science}, 26712 year = {1990}, 26713 volume = {36}, 26714 pages = {175--199} 26715} 26716 26717@Article{ chow.mallet-parret.ea:finding, 26718 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 26719 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 26720 One}, 26721 journal = {Mathematics of Computing}, 26722 year = {1978}, 26723 volume = {32}, 26724 pages = {887--899} 26725} 26726 26727@Article{ christopherson:mathematical, 26728 author = {D. G. Christopherson}, 26729 title = {A new mathematical method for the solution of film lubrication problems}, 26730 journal = {Proceedings of the Institute of Mechanical Engineers}, 26731 volume = {146}, 26732 year = {1941}, 26733 pages = {126--135} 26734} 26735 26736@TechReport{ chun.lee.ea:implementation, 26737 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 26738 title = {An Implementation of the Bundle Decomposition Algorithm}, 26739 institution = {Department of Industrial Engineering, University of Wisconsin}, 26740 year = {1991}, 26741 address = {Madison, Wisconsin}, 26742 number = {91-6} 26743} 26744 26745@Article{ chung:np-completeness, 26746 author = {S.--J. Chung}, 26747 title = {{NP}-Completeness of the Linear Complementarity Problem}, 26748 journal = {Journal of Optimization Theory and Applications}, 26749 volume = {60}, 26750 year = {1989}, 26751 pages = {393--399} 26752} 26753 26754@Book{ chvatal:linear, 26755 author = {V. Chv\'atal}, 26756 title = {Linear Programming}, 26757 year = {1983}, 26758 publisher = {W. H. Freeman and Company}, 26759 address = {New York} 26760} 26761 26762@Book{ ciarlet:finite, 26763 author = {P. G. Ciarlet}, 26764 title = {The Finite Element Method for Elliptic Problems}, 26765 year = {1978}, 26766 publisher = {North-Holland}, 26767 address = {New York} 26768} 26769 26770@Article{ cinquini.contro:optimal, 26771 author = {C. Cinquini and R. Contro}, 26772 title = {Optimal design of beams discretized by elastic plastic finite element}, 26773 journal = {Computers \& Structures}, 26774 volume = {20}, 26775 year = {1985}, 26776 pages = {475--585} 26777} 26778 26779@Book{ clarke:optimization, 26780 author = {F. H. Clarke}, 26781 title = {Optimization and Nonsmooth Analysis}, 26782 year = {1983}, 26783 publisher = {John Wiley \& Sons}, 26784 address = {New York} 26785} 26786 26787@InProceedings{ cleveland.smith:genetic, 26788 crossref = {schaeffer:third}, 26789 author = {G. A. Cleveland and S. F. Smith}, 26790 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 26791 pages = {160--169} 26792} 26793 26794@Book{ cochran:sampling, 26795 author = {W. Cochran}, 26796 title = {Sampling Techniques}, 26797 publisher = {Wiley}, 26798 year = {1977}, 26799 address = {New York}, 26800 edition = {Third} 26801} 26802 26803@Article{ coleman.conn:nonlinear, 26804 author = {T. F. Coleman and A. R. Conn}, 26805 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 26806 journal = {Mathematical Programming}, 26807 year = {1982}, 26808 volume = {24}, 26809 pages = {123--136} 26810} 26811 26812@Article{ coleman.conn:nonlinear*1, 26813 author = {T. F. Coleman and A. R. Conn}, 26814 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 26815 journal = {Mathematical Programming}, 26816 year = {1982}, 26817 volume = {24}, 26818 pages = {137--161} 26819} 26820 26821@TechReport{ coleman.liu:interior, 26822 author = {T. F. Coleman and J. Liu}, 26823 title = {An interior newton method for quadratic programming}, 26824 institution = {Dept. of Computer Science, Cornell University}, 26825 year = {1993}, 26826 number = {TR 93-1388}, 26827 address = {Ithaca, NY}, 26828 month = oct 26829} 26830 26831@Article{ coleman.more:estimation, 26832 author = {T. F. Coleman and J. J. Mor\'{e}}, 26833 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 26834 journal = {SIAM Journal on Numerical Analysis}, 26835 year = {1983}, 26836 volume = {20}, 26837 pages = {187--209} 26838} 26839 26840@Manual{ coleman.verma:admat, 26841 author = {T. F. Coleman and A. Verma}, 26842 title = {{ADMAT} User Guide}, 26843 year = {2000} 26844} 26845 26846@TechReport{ colville:comparative, 26847 author = {A. R. Colville}, 26848 title = {A Comparative Study on Nonlinear Programming Codes}, 26849 institution = {IBM New York Scientific Center}, 26850 year = {1968}, 26851 month = jun, 26852 number = {320--2949}, 26853 type = {Technical Report} 26854} 26855 26856@Article{ comi.maier:extremum, 26857 author = {C. Comi and G. Maier}, 26858 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 26859 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 26860 journal = {European Journal Mechanics A/Solids}, 26861 volume = {9}, 26862 year = {1990}, 26863 pages = {563--585} 26864} 26865 26866@Misc{ condon.dahl.ea:implementing, 26867 author = {T. Condon and H. Dahl and S. Devarajan}, 26868 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 26869 Model}, 26870 year = {1987}, 26871 howpublished = {{DRD} Discussion Paper 290}, 26872 note = {The World Bank, Washington DC} 26873} 26874 26875@Book{ conn.gould.ea:lancelot, 26876 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26877 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 26878 (Release {A})}, 26879 year = {1992}, 26880 publisher = {Springer Verlag}, 26881 address = {Heidelberg, Berlin}, 26882 series = {Springer Series in Computational Mathematics}, 26883 number = {17} 26884} 26885 26886@Article{ conn.gould.ea:numerical, 26887 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26888 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 26889 Nonlinear Optimization}, 26890 journal = {Mathematical Programming}, 26891 year = {1996}, 26892 volume = {75}, 26893 pages = {73--110} 26894} 26895 26896@Book{ cgt, 26897 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26898 title = {Trust-Region Methods}, 26899 year = {2000}, 26900 publisher = {SIAM}, 26901 address = {Philadelphia, Pennsylvania} 26902} 26903 26904@InCollection{ conn.toint:algorithm, 26905 author = {A. R. Conn and Ph. L. Toint}, 26906 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 26907 Optimization}, 26908 booktitle = {Nonlinear Optimization and Applications}, 26909 editor = {G. Di Pillo and F. Giannessi}, 26910 year = {1996}, 26911 publisher = {Plenum Press}, 26912 address = {New York} 26913} 26914 26915@Article{ conry.seireg:mathematical, 26916 author = {T. F. Conry and A. Seireg}, 26917 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 26918 journal = {{ASME} Transactions Journal of Applied Mechanics}, 26919 volume = {93}, 26920 year = {1971}, 26921 pages = {387--392} 26922} 26923 26924@Article{ cook.gerards.ea:sensitivity, 26925 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 26926 title = {Sensitivity Results in Integer Linear Programming}, 26927 journal = {Mathematical Programming}, 26928 year = {1986}, 26929 volume = {34}, 26930 pages = {251--264} 26931} 26932 26933@Article{ cook:taxonomy, 26934 author = {S. A. Cook}, 26935 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 26936 journal = {Information and Control}, 26937 year = {1985}, 26938 volume = {64}, 26939 pages = {2--22} 26940} 26941 26942@Article{ cooper:gradient, 26943 author = {R. E. M. Cooper}, 26944 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 26945 journal = {Radiology}, 26946 year = {1978}, 26947 volume = {128}, 26948 pages = {235--243} 26949} 26950 26951@Article{ cormack:problem, 26952 author = {A. M. Cormack}, 26953 title = {A problem in roatation therapy with x-rays}, 26954 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26955 year = {1987}, 26956 volume = {13}, 26957 pages = {623--630} 26958} 26959 26960@Article{ cormack:problem*1, 26961 author = {A. M. Cormack}, 26962 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 26963 symmetry}, 26964 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26965 year = {1987}, 26966 volume = {13}, 26967 pages = {1921--1925} 26968} 26969 26970@Article{ cottle.dantzig:complementary, 26971 author = {R. W. Cottle and G. B. Dantzig}, 26972 title = {Complementary Pivot Theory of Mathematical Programming}, 26973 journal = {Linear Algebra and Its Applications}, 26974 year = {1968}, 26975 volume = {1}, 26976 pages = {103--125} 26977} 26978 26979@Article{ cottle.dantzig:generalization, 26980 author = {R. W. Cottle and G. B. Dantzig}, 26981 title = {A Generalization of the Linear Complementarity Problem}, 26982 journal = {Journal of Combinatorial Theory}, 26983 year = {1970}, 26984 volume = {8}, 26985 pages = {79--90} 26986} 26987 26988@Book{ cottle.giannessi.ea:variational, 26989 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 26990 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 26991 year = {1980}, 26992 publisher = {John Wiley \& Sons}, 26993 address = {New York} 26994} 26995 26996@InCollection{ cottle.goheen:special, 26997 author = {R. W. Cottle and M. S. Goheen}, 26998 title = {A Special Class of Large Quadratic Programs}, 26999 pages = {361--390}, 27000 crossref = {mangasarian.meyer.ea:nonlinear*3} 27001} 27002 27003@Article{ cottle.golub.ea:solution, 27004 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 27005 title = {On the Solution of Large Structured Complementarity Problems: The Block 27006 Partitioned Case}, 27007 journal = {Applied Mathematics and Optimization}, 27008 year = {1978}, 27009 volume = {4}, 27010 pages = {347--363} 27011} 27012 27013@Book{ cottle.pang.ea:linear, 27014 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 27015 title = {The Linear Complementarity Problem}, 27016 year = {1992}, 27017 publisher = {Academic Press}, 27018 address = {Boston} 27019} 27020 27021@Article{ cottle.pang.ea:sufficient, 27022 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 27023 title = {Sufficient Matrices and the Linear Complementarity Problem}, 27024 journal = {Linear Algebra and Its Applications}, 27025 year = {1989}, 27026 volume = {114/115}, 27027 pages = {231--249} 27028} 27029 27030@PhDThesis{ cottle:nonlinear, 27031 author = {R. W. Cottle}, 27032 title = {Nonlinear programs with positively bounded {J}acobians}, 27033 school = {Department of Mathematics, University of California}, 27034 year = {1964}, 27035 address = {Berkeley, California} 27036} 27037 27038@Article{ cottle:nonlinear*1, 27039 author = {R. W. Cottle}, 27040 title = {Nonlinear programs with positively bounded {J}acobians}, 27041 journal = {Journal of the Society for Industrial and Applied Mathematics}, 27042 volume = {14}, 27043 year = {1966}, 27044 pages = {147--158} 27045} 27046 27047@InCollection{ cottle:principal, 27048 author = {R. W. Cottle}, 27049 title = {The principal pivoting method of quadratic programming}, 27050 booktitle = {Mathematics of the Decision Sciences, Part 1}, 27051 publisher = {American Mathematical Society}, 27052 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 27053 address = {Providence, Rhode Island}, 27054 year = {1968}, 27055 pages = {144--162} 27056} 27057 27058@Unpublished{ courant:calculus, 27059 author = {R. Courant}, 27060 title = {Calculus of Variations and Supplementary Notes and Exercises}, 27061 year = {1956}, 27062 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 27063 New York University} 27064} 27065 27066@Article{ courant:variational, 27067 author = {R. Courant}, 27068 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 27069 journal = {Bulletin of the American Mathematical Society}, 27070 year = {1943}, 27071 volume = {49}, 27072 pages = {1--23} 27073} 27074 27075@Book{ cristianini.shawe-taylor:introduction, 27076 author = {N. Cristianini and J. Shawe-Taylor}, 27077 title = {An Introduction to Support Vector Machines}, 27078 publisher = {Cambridge University Press}, 27079 address = {Cambridge}, 27080 year = {2000} 27081} 27082 27083@Article{ cromme:strong, 27084 author = {L. Cromme}, 27085 title = {Strong Uniqueness}, 27086 journal = {Numerische Mathematik}, 27087 year = {1978}, 27088 volume = {29}, 27089 pages = {179--193} 27090} 27091 27092@Article{ crowder.johnson.ea:solving, 27093 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 27094 title = {Solving Large Scale Zero-One Linear Programming Problems}, 27095 journal = {Operations Research}, 27096 year = {1983}, 27097 volume = {31}, 27098 pages = {803--834} 27099} 27100 27101@Article{ cryer.dempster:equivalence, 27102 author = {C. W. Cryer and M. A. H. Dempster}, 27103 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 27104 Lattice {H}ilbert Spaces}, 27105 journal = {SIAM Journal on Control and Optimization}, 27106 year = {1980}, 27107 volume = {18}, 27108 pages = {76--89} 27109} 27110 27111@Article{ cryer:method, 27112 author = {C. W. Cryer}, 27113 title = {The method of {C}hristopherson for solving free boundary problems for infinite 27114 journal bearings by means of finite differences}, 27115 journal = {Mathematics of Computation}, 27116 volume = {25}, 27117 year = {1971}, 27118 pages = {435--553} 27119} 27120 27121@Article{ cryer:solution, 27122 author = {C. W. Cryer}, 27123 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 27124 journal = {SIAM Journal on Control and Optimization}, 27125 year = {1971}, 27126 volume = {9}, 27127 pages = {385--392} 27128} 27129 27130@Article{ cryer:solution*1, 27131 author = {C. W. Cryer}, 27132 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 27133 journal = {SIAM Journal on Control}, 27134 year = {1971}, 27135 volume = {9}, 27136 pages = {385--392} 27137} 27138 27139@Manual{ culler:split-c, 27140 author = {D. Culler}, 27141 title = {The Split--{C} Programming Language}, 27142 organization = {Computer Science Department, University of California, Berkeley} 27143} 27144 27145@InProceedings{ cun.denker.ea:optimal, 27146 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 27147 title = {Optimal Brain Damage}, 27148 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 27149 year = {1990}, 27150 editor = {D. S. Touretzky}, 27151 publisher = {Morgan Kaufmann}, 27152 address = {San Mateo, California}, 27153 pages = {598--605} 27154} 27155 27156@TechReport{ czyzyk.mehrotra.ea:pcx, 27157 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 27158 title = {{PCx} Users Guide}, 27159 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 27160 University}, 27161 year = {1996}, 27162 type = {Technical Report}, 27163 number = {OTC 96/01} 27164} 27165 27166@TechReport{ czyzyk.mesnier.ea:network-enabled, 27167 address = {Argonne, Illinois}, 27168 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 27169 institution = {Argonne National Laboratory}, 27170 number = {MCS-P615-0996}, 27171 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 27172 type = {Preprint}, 27173 year = {1996} 27174} 27175 27176@Article{ czyzyk.wisniewski.ea:optimization, 27177 title = {Optimization Case Studies in the {NEOS} Guide}, 27178 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 27179 journal = {SIAM Review}, 27180 volume = {41}, 27181 pages = {148--163}, 27182 year = {1999} 27183} 27184 27185@Article{ dai.laan.ea:simplicial, 27186 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 27187 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 27188 Polyhedron}, 27189 journal = {SIAM Journal on Optimization}, 27190 year = {1991}, 27191 volume = {1}, 27192 pages = {151--165} 27193} 27194 27195@Article{ dai.talman:linear, 27196 author = {Y. Dai and D. Talman}, 27197 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 27198 journal = {Mathematics of Operations Research}, 27199 year = {1993}, 27200 pages = {635--644} 27201} 27202 27203@Book{ daniel:approximate, 27204 author = {J. W. Daniel}, 27205 title = {The approximate minimization of functionals}, 27206 year = {1971}, 27207 publisher = {Prentice-Hall, Inc}, 27208 address = {Englewood Cliffs, New Jersey} 27209} 27210 27211@Article{ danskin:theory, 27212 author = {J. M. Danskin}, 27213 title = {The Theory of Min--Max, with Applications}, 27214 journal = {SIAM Journal on Applied Mathematics}, 27215 year = {1964}, 27216 volume = {14}, 27217 pages = {641--664} 27218} 27219 27220@Book{ danskin:theory*1, 27221 author = {J. M. Danskin}, 27222 title = {The Theory of Min--Max}, 27223 year = {1967}, 27224 publisher = {Springer-Verlag}, 27225 address = {New York} 27226} 27227 27228@InCollection{ dantzig.cottle:positive, 27229 author = {G. B. Dantzig and R. W. Cottle}, 27230 title = {Positive (semi-)definite programming}, 27231 booktitle = {Nonlinear Programming}, 27232 publisher = {North-Holland}, 27233 editor = {J. Abadie}, 27234 address = {Amsterdam}, 27235 year = {1967}, 27236 pages = {55--73} 27237} 27238 27239@Article{ dantzig.manne:complementarity, 27240 author = {G. B. Dantzig and A. S. Manne}, 27241 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 27242 Proportions}, 27243 journal = {Journal of Economic Theory}, 27244 year = {1974}, 27245 volume = {9}, 27246 pages = {312--323} 27247} 27248 27249@Article{ dantzig.wolfe:decomposition, 27250 author = {G. B. Dantzig and P. Wolfe}, 27251 title = {Decomposition Principle for Linear Programs}, 27252 journal = {Operations Research}, 27253 year = {1960}, 27254 volume = {8}, 27255 pages = {101--111} 27256} 27257 27258@Book{ dantzig:linear, 27259 author = {G. B. Dantzig}, 27260 title = {Linear Programming and Extensions}, 27261 year = {1963}, 27262 publisher = {Princeton University Press}, 27263 address = {Princeton, New Jersey} 27264} 27265 27266@Manual{ dash:xpress-mp, 27267 title = {{XPRESS-MP} User Guide}, 27268 organization = {Dash Associates}, 27269 address = {Blisworth House, Blisworth, Northants, UK}, 27270 note = {http://www.dashopt.com/} 27271} 27272 27273@Book{ davis:handbook, 27274 author = {L. D. Davis}, 27275 title = {The Handbook of Genetic Algorithms}, 27276 year = {1990}, 27277 publisher = {Van Nostrand Reinhold} 27278} 27279 27280@TechReport{ davis:users, 27281 author = {T. A. Davis}, 27282 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 27283 type = {{Technical Report}}, 27284 year = {1993}, 27285 institution = {Computer and Information Sciences Department, University of Florida}, 27286 address = {Gainesville, Florida} 27287} 27288 27289@TechReport{ dax:computation, 27290 author = {A. Dax}, 27291 title = {The Computation of Descent Directions at Degenerate Points}, 27292 institution = {Hydrological Service of Israel}, 27293 year = {1985}, 27294 type = {Technical Report} 27295} 27296 27297@Article{ dax:note, 27298 author = {A. Dax}, 27299 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 27300 Problem}, 27301 journal = {Mathematical Programming}, 27302 year = {1986}, 27303 volume = {36}, 27304 pages = {72--80} 27305} 27306 27307@Article{ deasy:multiple, 27308 author = {J. O. Deasy}, 27309 title = {Multiple local minima in radiotherapy optimization problems with dose volume 27310 constraints}, 27311 journal = {Medical Physics}, 27312 year = {1997}, 27313 optvolume = {24}, 27314 optnumber = {7}, 27315 optpages = {1157-1161} 27316} 27317 27318@Article{ deboor.ron:computational, 27319 author = {C. {deBoor} and A. Ron}, 27320 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 27321 journal = {Mathematics of Computation}, 27322 year = {1992}, 27323 volume = {58}, 27324 pages = {705--727} 27325} 27326 27327@Article{ debremaecker.ferris.ea:compressional, 27328 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 27329 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 27330 Problems}, 27331 year = {2000}, 27332 key = {82}, 27333 journal = {Engineering Fracture Mechanics}, 27334 volume = {66}, 27335 pages = {287--303} 27336} 27337 27338@Article{ debremaecker.ferris:comparison, 27339 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 27340 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 27341 year = {2000}, 27342 key = {90}, 27343 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 27344 journal = {Engineering Fracture Mechanics}, 27345 volume = {66}, 27346 pages = {601--605}, 27347 institution = {Computer Sciences Department, University of Wisconsin}, 27348 address = {Madison, Wisconsin}, 27349 number = {00-01} 27350} 27351 27352@Article{ dedonato.maier:mathematical, 27353 author = {O. {De~Donato} and G. Maier}, 27354 title = {Mathematical programming methods for the inelastic analysis of reinforced 27355 concrete frames allowing for limited rotation capacity}, 27356 journal = {International Journal for Numerical Methods in Engineering}, 27357 volume = {4}, 27358 year = {1972}, 27359 pages = {307--329} 27360} 27361 27362@Book{ deimling:nonlinear, 27363 author = {K. Deimling}, 27364 title = {Nonlinear Functional Analysis}, 27365 publisher = {Springer-Verlag}, 27366 year = {1985} 27367} 27368 27369@PhDThesis{ dejong:analysis, 27370 author = {K. A. De~Jong}, 27371 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 27372 year = {1975}, 27373 school = {University of Michigan}, 27374 note = {Dissertation Abstracts International 36(10), 5140B} 27375} 27376 27377@Article{ deleone.mangasarian.ea:multi-sweep, 27378 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 27379 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 27380 Linear Complementarity Problem}, 27381 journal = {Annals of Operations Research}, 27382 year = {1990}, 27383 volume = {22}, 27384 pages = {43--54} 27385} 27386 27387@InCollection{ deleone.mangasarian:serial, 27388 author = {R. {De~Leone} and O. L. Mangasarian}, 27389 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 27390 {L}agrangian Successive Overrelaxation}, 27391 booktitle = {Optimization, Parallel Processing and Applications}, 27392 publisher = {Springer-Verlag}, 27393 year = {1988}, 27394 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 27395 volume = {304}, 27396 series = {Lecture Notes in Economics and Mathematical Systems}, 27397 pages = {103--124}, 27398 address = {Berlin} 27399} 27400 27401@TechReport{ deluca.facchinei.ea:combining, 27402 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27403 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 27404 Complementarity Problems: Theory and Numerical Results}, 27405 type = {Preprint}, 27406 institution = {Institute of Applied Mathematics, University of Hamburg}, 27407 year = {1996} 27408} 27409 27410@TechReport{ deluca.facchinei.ea:general, 27411 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27412 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 27413 Numerical Results}, 27414 type = {Preprint}, 27415 institution = {Institute of Applied Mathematics, University of Hamburg}, 27416 year = {1997} 27417} 27418 27419@Article{ deluca.facchinei.ea:semismooth, 27420 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27421 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 27422 Problems}, 27423 journal = {Mathematical Programming}, 27424 volume = {75}, 27425 pages = {407--439}, 27426 year = {1996} 27427} 27428 27429@Article{ deluca.facchinei.ea:theoretical, 27430 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27431 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 27432 Complementarity Problems}, 27433 year = {1999}, 27434 journal = {Computational Optimization and Applications, forthcoming} 27435} 27436 27437@Article{ demarzo.eaves:computing, 27438 author = {P. M. DeMarzo and B. C. Eaves}, 27439 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 27440 journal = {Journal of Mathematical Economics}, 27441 year = {1996}, 27442 volume = {26}, 27443 pages = {479--497} 27444} 27445 27446@Article{ dembo.steihaug:truncated, 27447 author = {R. S. Dembo and T. Steihaug}, 27448 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 27449 Optimization}, 27450 journal = {Mathematical Programming}, 27451 year = {1983}, 27452 volume = {26}, 27453 pages = {190--212} 27454} 27455 27456@Article{ dembo:performance, 27457 author = {R. S. Dembo}, 27458 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 27459 journal = {Mathematical Programming Study}, 27460 year = {1986}, 27461 volume = {26}, 27462 pages = {245--248} 27463} 27464 27465@Article{ demoor.vandenberghe.ea:generalized, 27466 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 27467 title = {The generalized linear complementarity problem and an algorithm to find all its 27468 solutions}, 27469 journal = {Mathematical Programming}, 27470 volume = {57}, 27471 year = {1992}, 27472 pages = {415--426} 27473} 27474 27475@Book{ demyanov.vasilev:nondifferentiable, 27476 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 27477 title = {Nondifferentiable Optimization}, 27478 publisher = {Optimization Software, Inc.}, 27479 year = {1985}, 27480 address = {New York} 27481} 27482 27483@Article{ dennis.torczon:direct, 27484 author = {J. E. Dennis and V. Torczon}, 27485 title = {Direct Search Methods on Parallel Machines}, 27486 journal = {SIAM Journal on Optimization}, 27487 year = {1991}, 27488 volume = {1}, 27489 pages = {448--474} 27490} 27491 27492@TechReport{ depierro.iusem:convergence, 27493 author = {A. R. {De~Pierro} and A. N. Iusem}, 27494 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 27495 Linear Complementarity Problems}, 27496 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 27497 year = {1990}, 27498 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 27499} 27500 27501@Article{ depierro.iusem:relaxed, 27502 author = {A. R. {De~Pierro} and A. N. Iusem}, 27503 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 27504 journal = {Journal of Optimization Theory and Applications}, 27505 year = {1986}, 27506 volume = {51}, 27507 pages = {421--440} 27508} 27509 27510@Book{ dervis.melo.ea:general, 27511 author = {K. Dervis and J. de Melo and S. Robinson}, 27512 title = {General Equilibrium Models of Development Policy}, 27513 publisher = {Cambridge University Press}, 27514 year = {1982}, 27515 address = {Cambridge, England} 27516} 27517 27518@Article{ deschutter.demoor:minimal, 27519 author = {B. {De~Schutter} and B. {De~Moor}}, 27520 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 27521 Problem}, 27522 journal = {Systems \& Control Letters}, 27523 year = {1995}, 27524 pages = {103--111} 27525} 27526 27527@Article{ desilets.golden.ea:predicting, 27528 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 27529 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 27530 journal = {Computers \& Operations Research}, 27531 year = {1992}, 27532 volume = {19}, 27533 pages = {277--285} 27534} 27535 27536@PhDThesis{ desilva:sensitivity, 27537 author = {A. H. DeSilva}, 27538 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 27539 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 27540 Production}, 27541 school = {George Washington University}, 27542 address = {Washington, D.C.}, 27543 year = {1978} 27544} 27545 27546@TechReport{ dijkstra:cooperating, 27547 author = {E. W. Dijkstra}, 27548 title = {Cooperating Sequential Processes}, 27549 institution = {Technological University}, 27550 year = {1965}, 27551 address = {Eindhoven, The Netherlands}, 27552 number = {EWD--123}, 27553 type = {Technical Report} 27554} 27555 27556@Article{ dikin:iterative, 27557 author = {I. I. Dikin}, 27558 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 27559 journal = {Soviet Mathematics Doklady}, 27560 year = {1967}, 27561 volume = {8}, 27562 pages = {674--675} 27563} 27564 27565@InCollection{ dipillo.grippo.ea:class, 27566 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 27567 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 27568 booktitle = {System Modelling and Optimization}, 27569 year = {1981}, 27570 editor = {R. F. Drenick and F. Kozin}, 27571 publisher = {Springer-Verlag}, 27572 address = {Berlin} 27573} 27574 27575@Article{ dipillo.grippo:augmented, 27576 author = {G. Di~Pillo and L. Grippo}, 27577 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 27578 Problems}, 27579 journal = {Journal of Optimization Theory and Applications}, 27580 year = {1982}, 27581 volume = {36}, 27582 pages = {495--519} 27583} 27584 27585@Article{ dipillo.grippo:class, 27586 author = {G. Di~Pillo and L. Grippo}, 27587 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 27588 journal = {SIAM Journal on Control and Optimization}, 27589 year = {1979}, 27590 volume = {17}, 27591 pages = {618--628} 27592} 27593 27594@Article{ dipillo.grippo:continuously, 27595 author = {G. Di~Pillo and L. Grippo}, 27596 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 27597 Problems with Inequality Constraints}, 27598 journal = {SIAM Journal on Control and Optimization}, 27599 year = {1985}, 27600 volume = {23}, 27601 pages = {72--84} 27602} 27603 27604@Article{ dipillo.grippo:exact, 27605 author = {G. Di~Pillo and L. Grippo}, 27606 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 27607 Programming Problems}, 27608 journal = {Mathematical Programming}, 27609 year = {1986}, 27610 volume = {36}, 27611 pages = {1--18} 27612} 27613 27614@TechReport{ dirkse.ferris.ea:gams, 27615 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 27616 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 27617 institution = {Computer Sciences Department, University of Wisconsin}, 27618 year = {1994}, 27619 address = {Madison, Wisconsin}, 27620 number = {94-07}, 27621 type = {Mathematical Programming Technical Report}, 27622 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 27623 key = {25} 27624} 27625 27626@InProceedings{ dirkse.ferris:crash, 27627 crossref = {ferris.pang:complementarity}, 27628 author = {S. P. Dirkse and M. C. Ferris}, 27629 title = {Crash Techniques for Large-Scale Complementarity Problems}, 27630 pages = {40--61}, 27631 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 27632 key = {52} 27633} 27634 27635@Article{ dirkse.ferris:mcplib, 27636 author = {S. P. Dirkse and M. C. Ferris}, 27637 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 27638 journal = {Optimization Methods and Software}, 27639 pages = {319--345}, 27640 volume = {5}, 27641 year = {1995}, 27642 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 27643 key = {36} 27644} 27645 27646@InCollection{ dirkse.ferris:modeling, 27647 author = {S. P. Dirkse and M. C. Ferris}, 27648 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 27649 year = {1999}, 27650 pages = {127--148}, 27651 editor = {M. Fukushima and L. Qi}, 27652 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 27653 publisher = {Kluwer Academic Publishers}, 27654 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 27655 key = {62} 27656} 27657 27658@Article{ dirkse.ferris:path, 27659 author = {S. P. Dirkse and M. C. Ferris}, 27660 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 27661 Complementarity Problems}, 27662 journal = {Optimization Methods and Software}, 27663 pages = {123--156}, 27664 volume = {5}, 27665 year = {1995}, 27666 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 27667 key = {33} 27668} 27669 27670@Article{ dirkse.ferris:pathsearch, 27671 author = {S. P. Dirkse and M. C. Ferris}, 27672 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 27673 journal = {Annals of Operations Research}, 27674 vol = {68}, 27675 year = {1996}, 27676 pages = {211--232}, 27677 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 27678 key = {39} 27679} 27680 27681@InCollection{ dirkse.ferris:traffic, 27682 author = {S. P. Dirkse and M. C. Ferris}, 27683 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 27684 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 27685 Management}, 27686 publisher = {Springer-Verlag}, 27687 year = {1998}, 27688 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 27689 series = {NATO ASI Series F}, 27690 volume = {166}, 27691 pages = {136--163}, 27692 key = {61}, 27693 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 27694} 27695 27696@PhDThesis{ dirkse:robust, 27697 author = {S. P. Dirkse}, 27698 title = {Robust Solution of Mixed Complementarity Problems}, 27699 school = {Computer Sciences Department, University of Wisconsin}, 27700 year = {1994}, 27701 address = {Madison, Wisconsin}, 27702 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 27703 annote = {Mathematical Programming Technical Report 94-12} 27704} 27705 27706@TechReport{ dixon.mills:neural, 27707 author = {L. C. Dixon and D. J. Mills}, 27708 title = {Neural Nets for Massively Parallel Optimisation}, 27709 institution = {Hatfield Polytechnic}, 27710 year = {1992}, 27711 address = {Hatfield, Hertforshire, England}, 27712 number = {Numerical Optimisation Centre Technical Report No. 259} 27713} 27714 27715@Article{ dontchev:local, 27716 author = {A. L. Dontchev}, 27717 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 27718 journal = {C.R. Acad. Sci. Paris Series I}, 27719 year = {1996}, 27720 volume = {332}, 27721 pages = {327--331} 27722} 27723 27724@Article{ douglas.rachford:numerical, 27725 author = {J. Douglas and H. H. Rachford}, 27726 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 27727 Variables}, 27728 journal = {Transactions of the American Mathematical Society}, 27729 year = {1956}, 27730 volume = {82}, 27731 pages = {421--439} 27732} 27733 27734@Article{ drud:conopt, 27735 author = {A. Drud}, 27736 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 27737 Problems}, 27738 journal = {Mathematical Programming}, 27739 year = {1985}, 27740 volume = {31}, 27741 pages = {153--191} 27742} 27743 27744@Article{ dsouza.meyer.ea:mixed, 27745 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27746 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27747 Optimization}, 27748 journal = {Medical Physics}, 27749 year = {1999}, 27750 key = {85}, 27751 volume = {26}, 27752 number = {6}, 27753 pages = {1099} 27754} 27755 27756@TechReport{ dsouza.meyer.ea:mixed*1, 27757 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27758 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27759 Optimization}, 27760 year = {1999}, 27761 key = {87}, 27762 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 27763 institution = {Computer Sciences Department, University of Wisconsin}, 27764 address = {Madison, Wisconsin}, 27765 number = {99-08}, 27766 type = {Mathematical Programming Technical Report}, 27767 annote = {Submitted to } 27768} 27769 27770@Article{ dsouza.meyer.ea:iterative, 27771 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 27772 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 27773 Brachytherapy Treatment Optimization}, 27774 year = {2000}, 27775 key = {96}, 27776 journal = {Physics and Medicine in Biology, forthcoming} 27777} 27778 27779@Article{ du.yu.ea:multileaf, 27780 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 27781 G. Gustafson and A. Martinez and J. W. Wong}, 27782 title = {A multileaf collimator field prescription preparation system for conventional 27783 radiotherapy}, 27784 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27785 year = {1994}, 27786 volume = {30}, 27787 number = {3}, 27788 pages = {707--714} 27789} 27790 27791@Article{ duda.fossum:pattern, 27792 author = {R. O. Duda and H. Fossum}, 27793 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 27794 Discriminant Functions}, 27795 journal = {IEEE Transactions on Electronic Computers}, 27796 year = {1966}, 27797 volume = {15}, 27798 pages = {220--232} 27799} 27800 27801@Book{ duda.hart:pattern, 27802 author = {R. O. Duda and P. E. Hart}, 27803 title = {Pattern Classification and Scene Analysis}, 27804 year = {1973}, 27805 publisher = {John Wiley \& Sons}, 27806 address = {New York} 27807} 27808 27809@Book{ duff.erisman.ea:direct, 27810 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 27811 title = {Direct Methods for Sparse Matrices}, 27812 publisher = {Oxford University Press}, 27813 year = {1986}, 27814 address = {Oxford, England} 27815} 27816 27817@InCollection{ duffin:infinite, 27818 author = {R. J. Duffin}, 27819 title = {Infinite Programs}, 27820 booktitle = {Linear Inequalities and Related Systems}, 27821 year = {1975}, 27822 editor = {H. W. Kuhn and A. W. Tucker}, 27823 publisher = {Princeton University Press}, 27824 address = {Princeton, New Jersey}, 27825 pages = {157--170} 27826} 27827 27828@Article{ dunn.sachs:effect, 27829 author = {J. C. Dunn and E. Sachs}, 27830 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 27831 journal = {Applied Mathematics and Optimization}, 27832 year = {1983}, 27833 volume = {10}, 27834 pages = {143--157} 27835} 27836 27837@Article{ dunn:convergence, 27838 author = {J. C. Dunn}, 27839 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 27840 journal = {Journal of Optimization Theory and Applications}, 27841 year = {1987}, 27842 volume = {55}, 27843 pages = {203--216} 27844} 27845 27846@Article{ dunn:global, 27847 author = {J. C. Dunn}, 27848 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 27849 Gradient Processes}, 27850 journal = {SIAM Journal on Control and Optimization}, 27851 year = {1981}, 27852 volume = {19}, 27853 pages = {368--400} 27854} 27855 27856@Article{ dunn:rates, 27857 author = {J. C. Dunn}, 27858 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 27859 Nonsingular Extremals}, 27860 journal = {SIAM Journal on Control and Optimization}, 27861 year = {1979}, 27862 volume = {17}, 27863 pages = {187--211} 27864} 27865 27866@Article{ dupuis.simha:sampling, 27867 author = {P. Dupuis and R. Simha}, 27868 title = {On Sampling-Controlled Stochastic Approximation}, 27869 journal = {{IEEE} Transactions on Automatic Control}, 27870 year = {1991}, 27871 volume = {36}, 27872 pages = {915--924} 27873} 27874 27875@TechReport{ eager.ferris.ea:models, 27876 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27877 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 27878 institution = {Computer Sciences Department, University of Wisconsin}, 27879 year = {1999}, 27880 type = {Technical Report}, 27881 number = {1402}, 27882 address = {Madison, Wisconsin}, 27883 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 27884 key = {84} 27885} 27886 27887@InProceedings{ eager.ferris.ea:optimized, 27888 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27889 title = {Optimized Regional Caching for On-Demand Data Delivery}, 27890 year = {1999}, 27891 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 27892 volume = {3654}, 27893 address = {Bellingham, Washington}, 27894 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 27895 key = {69}, 27896 pages = {301--316}, 27897 annote = {18 percent acceptance rate} 27898} 27899 27900@Article{ eager.ferris.ea:optimized*1, 27901 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27902 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 27903 journal = {Performance Evaluation}, 27904 year = {2000}, 27905 key = {72}, 27906 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 27907 volume = {42}, 27908 pages = {163--185} 27909} 27910 27911@InProceedings{ eager.vernon:dynamic, 27912 author = {D. L. Eager and M. K. Vernon}, 27913 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 27914 year = {1998}, 27915 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 27916 ({MIS '98})}, 27917 pages = {18--32}, 27918 address = {Istanbul, Turkey} 27919} 27920 27921@Article{ eaves.lemke:equivalence, 27922 author = {B. C. Eaves and C. E. Lemke}, 27923 title = {Equivalence of {LCP} and {PLS}}, 27924 journal = {Mathematics of Operations Research}, 27925 year = {1981}, 27926 volume = {6}, 27927 pages = {475--484} 27928} 27929 27930@Article{ eaves.rothblum:relationships, 27931 author = {B. C. Eaves and U. G. Rothblum}, 27932 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 27933 journal = {Linear Algebra and Its Applications}, 27934 year = {1990}, 27935 volume = {132}, 27936 pages = {1--63} 27937} 27938 27939@Article{ eaves:basic, 27940 author = {B. C. Eaves}, 27941 title = {On the Basic Theorem of Complementarity}, 27942 journal = {Mathematical Programming}, 27943 year = {1971}, 27944 volume = {1}, 27945 pages = {68--87} 27946} 27947 27948@Article{ eaves:computing, 27949 author = {B. C. Eaves}, 27950 title = {Computing Stationary Points}, 27951 journal = {Mathematical Programming Study}, 27952 year = {1978}, 27953 volume = {7}, 27954 pages = {1--14} 27955} 27956 27957@InCollection{ eaves:computing*1, 27958 author = {B. C. Eaves}, 27959 title = {Computing Stationary Points, Again}, 27960 pages = {391--405}, 27961 crossref = {mangasarian.meyer.ea:nonlinear*3} 27962} 27963 27964@Article{ eaves:homotopies, 27965 author = {B. C. Eaves}, 27966 title = {Homotopies for Computation of Fixed Points}, 27967 journal = {Mathematical Programming}, 27968 year = {1972}, 27969 volume = {3}, 27970 pages = {1--22} 27971} 27972 27973@Article{ eaves:linear, 27974 author = {B. C. Eaves}, 27975 title = {The Linear Complementarity Problem}, 27976 journal = {Management Science}, 27977 year = {1971}, 27978 volume = {17}, 27979 pages = {612--634} 27980} 27981 27982@Article{ eaves:quadratic, 27983 author = {B. C. Eaves}, 27984 title = {On Quadratic Programming}, 27985 journal = {Management Science}, 27986 year = {1971}, 27987 volume = {17}, 27988 pages = {698--711} 27989} 27990 27991@InProceedings{ eaves:short, 27992 author = {B. C. Eaves}, 27993 title = {A Short Course in Solving Equations with {PL} Homotopies}, 27994 booktitle = {Nonlinear Programming}, 27995 organization = {American Mathematical Society}, 27996 year = {1976}, 27997 editor = {R. W. Cottle and C. E. Lemke}, 27998 publisher = {SIAM--AMS Proceedings}, 27999 address = {Providence, RI}, 28000 pages = {73--143} 28001} 28002 28003@InCollection{ ebiefung.kostreva:global, 28004 author = {A. A. Ebiefung and M. M. Kostreva}, 28005 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 28006 Class of Polynomial Complementarity Problems}, 28007 editors = {C. Floudas and P. Pardalos}, 28008 booktitle = {Recent Advances in Global Optimization}, 28009 publisher = {Princeton University Press}, 28010 pages = {102--124}, 28011 year = {1991} 28012} 28013 28014@TechReport{ ebiefung.kostreva:z-matrices, 28015 author = {A. A. Ebiefung and M. M. Kostreva}, 28016 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 28017 institution = {Department of Mathematical Sciences, Clemson University}, 28018 year = {1991}, 28019 number = {608}, 28020 address = {Clemson, South Carolina} 28021} 28022 28023@TechReport{ eckstein.bertsekas:alternating, 28024 author = {J. Eckstein and D. P. Bertsekas}, 28025 title = {An Alternating Direction Method for Linear Programming}, 28026 institution = {Harvard Business School}, 28027 year = {1990}, 28028 type = {Working Paper}, 28029 number = {90-063}, 28030 address = {Boston, MA} 28031} 28032 28033@Article{ eckstein.bertsekas:douglas-rachford, 28034 author = {J. Eckstein and D. P. Bertsekas}, 28035 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 28036 Maximal Monotone Operators}, 28037 journal = {Mathematical Programming}, 28038 year = {1992}, 28039 pages = {293--318}, 28040 volume = {55} 28041} 28042 28043@Article{ eckstein.bertsekas:douglas-rachford*1, 28044 author = {J. Eckstein and D. P. Bertsekas}, 28045 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 28046 for Maximal Monotone Operators}, 28047 journal = {Mathematical Programming}, 28048 year = {1991}, 28049 note = {To appear} 28050} 28051 28052@TechReport{ eckstein.ferris:operator, 28053 author = {J. Eckstein and M. C. Ferris}, 28054 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 28055 institution = {Thinking Machines Corporation}, 28056 year = {1992}, 28057 address = {Cambridge, MA 02142}, 28058 number = {239}, 28059 type = {TMC}, 28060 key = {26} 28061} 28062 28063@Article{ eckstein.ferris:operator*1, 28064 author = {J. Eckstein and M. C. Ferris}, 28065 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 28066 Parallel Application to Optimal Control}, 28067 volume = {10}, 28068 pages = {218--235}, 28069 year = {1998}, 28070 journal = {INFORMS Journal on Computing}, 28071 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 28072 key = {44} 28073} 28074 28075@Article{ eckstein.ferris:smooth, 28076 author = {J. Eckstein and M. C. Ferris}, 28077 title = {Smooth Methods of Multipliers for Complementarity Problems}, 28078 key = {58}, 28079 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 28080 year = {1999}, 28081 journal = {Mathematical Programming}, 28082 volume = {86}, 28083 pages = {65--90} 28084} 28085 28086@InProceedings{ eckstein.hart.ea:resource, 28087 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 28088 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 28089 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 28090 year = {1997}, 28091 note = {www.cs.sandia.gov/ISUG97} 28092} 28093 28094@Article{ eckstein:alternating, 28095 author = {J. Eckstein}, 28096 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 28097 CM-2}}, 28098 journal = {ORSA Journal on Computing}, 28099 year = {to appear} 28100} 28101 28102@Article{ eckstein:approximate, 28103 author = {J. Eckstein}, 28104 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 28105 year = {1998}, 28106 journal = {Mathematical Programming}, 28107 volume = {83}, 28108 pages = {113--124} 28109} 28110 28111@Article{ eckstein:communication, 28112 author = {J. Eckstein}, 28113 title = {How Much Communication Does Parallel Branch and Bound Need}, 28114 journal = {{INFORMS} Journal on Computing}, 28115 volume = {9}, 28116 year = {1997}, 28117 pages = {15--29} 28118} 28119 28120@Article{ eckstein:distributed, 28121 author = {J. Eckstein}, 28122 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 28123 Integer Programming on the {CM}-5}, 28124 journal = {Computational Optimization and Applications}, 28125 volume = {7}, 28126 pages = {199--220}, 28127 year = {1997} 28128} 28129 28130@TechReport{ eckstein:lions-mercier, 28131 author = {J. Eckstein}, 28132 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 28133 as instances of the Proximal Point Algorithm}, 28134 institution = {MIT}, 28135 year = {1988}, 28136 address = {Cambridge, Massachusetts}, 28137 number = {LIDS-P-1769} 28138} 28139 28140@Article{ eckstein:nonlinear, 28141 author = {J. Eckstein}, 28142 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 28143 to Convex Programming}, 28144 journal = {Mathematics of Operations Research}, 28145 year = {1993}, 28146 pages = {202--226}, 28147 volume = {18} 28148} 28149 28150@Article{ eckstein:parallel, 28151 author = {J. Eckstein}, 28152 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 28153 {CM}-5}, 28154 journal = {SIAM Journal on Optimization}, 28155 volume = {4}, 28156 pages = {794--814}, 28157 year = {1994} 28158} 28159 28160@TechReport{ eckstein:smooth, 28161 author = {J. Eckstein}, 28162 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 28163 institution = {Rutgers Center for Operations Research, Rutgers University}, 28164 address = {New Brunswick, New Jersey}, 28165 year = {1996}, 28166 type = {Research Report}, 28167 number = {27-96} 28168} 28169 28170@PhDThesis{ eckstein:splitting, 28171 author = {J. Eckstein}, 28172 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 28173 Optimization}, 28174 school = {Massachusetts Institute of Technology}, 28175 year = {1989}, 28176 address = {Cambridge, MA}, 28177 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 28178} 28179 28180@Article{ eglese:simulated, 28181 author = {R. W. Eglese}, 28182 title = {Simulated Annealing: {A} Tool for Operational Research}, 28183 journal = {European Journal of Operations Research}, 28184 year = {1990}, 28185 volume = {46}, 28186 pages = {271--281} 28187} 28188 28189@Book{ ekeland.temam:convex, 28190 author = {I. Ekeland and R. Temam}, 28191 title = {Convex Analysis and Variational Problems}, 28192 year = {1976}, 28193 publisher = {North--Holland}, 28194 address = {Amsterdam} 28195} 28196 28197@Article{ ekeland:variational, 28198 author = {I. Ekeland}, 28199 title = {On the Variational Principle}, 28200 journal = {Journal of Mathematical Analysis and Applications}, 28201 year = {1974}, 28202 volume = {47}, 28203 pages = {324--353} 28204} 28205 28206@TechReport{ el-bakry.tapia.ea:formulation, 28207 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 28208 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 28209 for nonlinear programming}, 28210 type = {{Technical Report TR92-40}}, 28211 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 28212 year = {1992} 28213} 28214 28215@Article{ eldersveld.saunders:block, 28216 author = {S. K. Eldersveld and M. A. Saunders}, 28217 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 28218 journal = {SIAM Journal on Matrix Analysis and Applications}, 28219 year = {1992}, 28220 volume = {13}, 28221 pages = {191--201} 28222} 28223 28224@Article{ elster.neumaier:grid, 28225 author = {C. Elster and A. Neumaier}, 28226 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 28227 journal = {{IMA} Journal of Numerical Analysis}, 28228 year = {1995}, 28229 volume = {15}, 28230 pages = {585--608} 28231} 28232 28233@Article{ epema.livny.ea:worldwide, 28234 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 28235 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 28236 journal = {Journal on Future Generations of Computer Systems}, 28237 year = {1996}, 28238 volume = {12}, 28239 pages = {53--65} 28240} 28241 28242@Book{ ermoliev.editors:numerical, 28243 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 28244 title = {Numerical Techniques for Stochastic Optimization Problems}, 28245 year = {1988}, 28246 publisher = {Springer-Verlag}, 28247 address = {Berlin} 28248} 28249 28250@TechReport{ evett.spiehler:rule, 28251 author = {I. W. Evett and E. J. Spiehler}, 28252 title = {Rule Induction in Forensic Science}, 28253 institution = {Central Research Establishment, Home Office Forensic Science Service}, 28254 year = {1987}, 28255 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 28256 type = {Technical Report} 28257} 28258 28259@Article{ evtushenko.purtov:sufficient, 28260 author = {Y. G. Evtushenko and V. A. Purtov}, 28261 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 28262 journal = {Soviet Mathematics Doklady}, 28263 year = {1984}, 28264 volume = {30}, 28265 pages = {313--316} 28266} 28267 28268@Article{ facchinei.fischer.ea:regularity, 28269 author = {F. Facchinei and A. Fischer and C. Kanzow}, 28270 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 28271 journal = {SIAM Journal on Optimization}, 28272 year = {1998}, 28273 volume = {8}, 28274 pages = {850--869} 28275} 28276 28277@Article{ facchinei.fischer.ea:semismooth, 28278 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 28279 Constraints}, 28280 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 28281 journal = {Complementarity and Variational Problems: State of the Art}, 28282 volume = {92}, 28283 pages = {76}, 28284 year = {1997} 28285} 28286 28287@TechReport{ facchinei.fischer.ea:simply, 28288 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 28289 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 28290 Variational Inequalities}, 28291 institution = {University of Hamburg}, 28292 year = {1996} 28293} 28294 28295@Article{ facchinei.jiang.ea:smoothing, 28296 author = {F. Facchinei and H. Jiang and L. Qi}, 28297 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 28298 year = {1999}, 28299 journal = {Mathematical Programming}, 28300 volume = {85}, 28301 pages = {107--134} 28302} 28303 28304@Article{ facchinei.kanzow:nonsmooth, 28305 author = {F. Facchinei and C. Kanzow}, 28306 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 28307 Complementarity Problems}, 28308 year = {1997}, 28309 journal = {Mathematical Programming}, 28310 volume = {76}, 28311 pages = {493--512} 28312} 28313 28314@Article{ facchinei.kanzow:unconstrained, 28315 author = {F. Facchinei and C. Kanzow}, 28316 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 28317 {L}agrangian}, 28318 year = {1997}, 28319 journal = {Journal of Optimization Theory and Applications}, 28320 volume = {92}, 28321 pages = {99--115} 28322} 28323 28324@TechReport{ facchinei.pang:total, 28325 author = {F. Facchinei and J. S. Pang}, 28326 title = {Total stability of variational inequalities}, 28327 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 28328 year = {1988}, 28329 type = {Manuscript}, 28330 address = {Roma, Italy} 28331} 28332 28333@Article{ facchinei.soares:merit, 28334 author = {F. Facchinei and J. Soares}, 28335 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 28336 Algorithm}, 28337 journal = {SIAM Journal on Optimization}, 28338 year = {1997}, 28339 volume = {7}, 28340 pages = {225--247} 28341} 28342 28343@InCollection{ facchinei.soares:testing, 28344 author = {F. Facchinei and J. Soares}, 28345 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 28346 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 28347 publisher = {Plenum Press}, 28348 address = {New York}, 28349 editor = {F. Giannessi and A. Maugeri}, 28350 year = {1995}, 28351 pages = {69--83} 28352} 28353 28354@InProceedings{ fahlman.lebiere:cascade-correlation, 28355 author = {S. E. Fahlman and C. Lebiere}, 28356 title = {The cascade-correlation learning architecture}, 28357 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 28358 year = {1990}, 28359 editor = {D. S. Touretzky}, 28360 publisher = {Morgan Kaufmann}, 28361 address = {San Mateo, California}, 28362 pages = {524--532} 28363} 28364 28365@InProceedings{ fang.geiser.ea:software, 28366 author = {G. Fang and B. Geiser and T. R. Mackie}, 28367 title = {Software system for {UW}/{GE} tomotherapy prototype}, 28368 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 28369 Radiation Therapy, Salt Lake City}, 28370 year = {1997}, 28371 editor = {D. D. Leavitt and G. Starkshall}, 28372 publisher = {Medical Physics Publishing}, 28373 address = {St. Louis, Missouri}, 28374 pages = {332--334} 28375} 28376 28377@Book{ fang.puthenpura:linear, 28378 author = {S.--C. Fang and S. Puthenpura}, 28379 title = {Linear Optimization and Extensions}, 28380 year = {1993}, 28381 publisher = {Prentice-Hall, Inc}, 28382 address = {Englewood Cliffs, New Jersey} 28383} 28384 28385@Article{ fayard.plateau:algorithm, 28386 author = {D. Fayard and G. Plateau}, 28387 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 28388 journal = {Computing}, 28389 year = {1982}, 28390 volume = {28}, 28391 pages = {269--287} 28392} 28393 28394@Book{ feller:introduction, 28395 author = {W. Feller}, 28396 title = {An Introduction to Probability Theory and its Applications}, 28397 publisher = {John Wiley \& Sons}, 28398 year = {1968}, 28399 address = {New York} 28400} 28401 28402@Article{ ferris.fourer.ea:expressing, 28403 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 28404 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 28405 journal = {SIAM Journal on Optimization}, 28406 volume = {9}, 28407 pages = {991--1009}, 28408 year = {1999}, 28409 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 28410 key = {65}, 28411 institution = {Computer Sciences Department, University of Wisconsin}, 28412 address = {Madison, Wisconsin}, 28413 number = {98-02}, 28414 type = {Mathematical Programming Technical Report} 28415} 28416 28417@TechReport{ ferris.horn:nlp2mcp, 28418 author = {M. C. Ferris and J. D. Horn}, 28419 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 28420 problems}, 28421 year = {1998}, 28422 institution = {Computer Sciences Department, University of Wisconsin}, 28423 note = {In preparation} 28424} 28425 28426@Article{ ferris.horn:partitioning, 28427 author = {M. C. Ferris and J. D. Horn}, 28428 title = {Partitioning Mathematical Programs for Parallel Solution}, 28429 year = {1998}, 28430 volume = {80}, 28431 pages = {35--62}, 28432 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 28433 journal = {Mathematical Programming}, 28434 key = {40} 28435} 28436 28437@Article{ ferris.kanzow.ea:feasible, 28438 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 28439 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 28440 year = {1999}, 28441 journal = {Mathematical Programming}, 28442 volume = {86}, 28443 pages = {475--497}, 28444 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 28445 key = {67} 28446} 28447 28448@InCollection{ ferris.kanzow:complementarity, 28449 author = {M. C. Ferris and C. Kanzow}, 28450 title = {Complementarity and Related Problems: {A} Survey}, 28451 booktitle = {Handbook of Applied Optimization, forthcoming}, 28452 key = {74}, 28453 publisher = {Oxford University Press}, 28454 year = {2000}, 28455 editor = {P. M. Pardalos and M. G. C. Resende}, 28456 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 28457 institution = {Computer Sciences Department, University of Wisconsin}, 28458 address = {Madison, Wisconsin}, 28459 number = {98-17}, 28460 type = {Mathematical Programming Technical Report} 28461} 28462 28463@Article{ ferris.lucidi.ea:nonmonotone, 28464 author = {M. C. Ferris and S. Lucidi and M. Roma}, 28465 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 28466 journal = {Computational Optimization and Applications}, 28467 volume = {6}, 28468 pages = {117--136}, 28469 year = {1996}, 28470 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 28471 key = {43} 28472} 28473 28474@TechReport{ ferris.lucidi:globally, 28475 author = {M. C. Ferris and S. Lucidi}, 28476 title = {Globally Convergent Methods for Nonlinear Equations}, 28477 institution = {Computer Sciences Department, University of Wisconsin}, 28478 year = {1991}, 28479 address = {Madison, Wisconsin}, 28480 number = {1030}, 28481 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 28482 key = {21} 28483} 28484 28485@Article{ ferris.lucidi:nonmonotone, 28486 author = {M. C. Ferris and S. Lucidi}, 28487 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 28488 journal = {Journal of Optimization Theory and Applications}, 28489 year = {1994}, 28490 volume = {81}, 28491 pages = {53--71}, 28492 key = {30} 28493} 28494 28495@Article{ ferris.mangasarian:breast, 28496 author = {M. C. Ferris and O. L. Mangasarian}, 28497 title = {Breast Cancer Diagnosis via Linear Programming}, 28498 key = {50}, 28499 journal = {{IEEE} Computational Science and Engineering}, 28500 year = {1995}, 28501 volume = {2}, 28502 pages = {70--71} 28503} 28504 28505@Article{ ferris.mangasarian:error, 28506 author = {M. C. Ferris and O. L. Mangasarian}, 28507 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 28508 Inequalities}, 28509 journal = {Annals of Operations Research}, 28510 year = {1993}, 28511 volume = {47}, 28512 pages = {293--305}, 28513 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 28514 key = {24} 28515} 28516 28517@Article{ ferris.mangasarian:finite, 28518 author = {M. C. Ferris and O. L. Mangasarian}, 28519 title = {Finite Perturbation of Convex Programs}, 28520 journal = {Applied Mathematics and Optimization}, 28521 year = {1991}, 28522 volume = {23}, 28523 pages = {263--273}, 28524 key = {08} 28525} 28526 28527@Book{ ferris.mangasarian:linear, 28528 author = {M. C. Ferris and O. L. Mangasarian}, 28529 title = {Linear Programming via {MATLAB}}, 28530 publisher = {in preparation}, 28531 year = {1995}, 28532 address = {Madison, Wisconsin} 28533} 28534 28535@Article{ ferris.mangasarian:minimum, 28536 author = {M. C. Ferris and O. L. Mangasarian}, 28537 title = {Minimum Principle Sufficiency}, 28538 journal = {Mathematical Programming}, 28539 year = {1992}, 28540 volume = {57}, 28541 pages = {1--14}, 28542 key = {11} 28543} 28544 28545@Article{ ferris.mangasarian:parallel, 28546 author = {M. C. Ferris and O. L. Mangasarian}, 28547 title = {Parallel Constraint Distribution}, 28548 journal = {SIAM Journal on Optimization}, 28549 year = {1991}, 28550 volume = {1}, 28551 pages = {487--500}, 28552 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 28553 key = {18} 28554} 28555 28556@Article{ ferris.mangasarian:parallel*1, 28557 author = {M. C. Ferris and O. L. Mangasarian}, 28558 title = {Parallel Variable Distribution}, 28559 journal = {SIAM Journal on Optimization}, 28560 year = {1994}, 28561 volume = {4}, 28562 pages = {815--832}, 28563 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 28564 key = {31} 28565} 28566 28567@Article{ ferris.meeraus.ea:computing, 28568 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 28569 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 28570 journal = {Optimization Methods and Software}, 28571 year = {1999}, 28572 volume = {10}, 28573 pages = {669--685}, 28574 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 28575 key = {45} 28576} 28577 28578@Article{ ferris.mesnier.ea:neos, 28579 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 28580 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 28581 {I}nternet}, 28582 year = {2000}, 28583 journal = {{ACM} Transactions on Mathematical Software}, 28584 key = {54}, 28585 volume = {26}, 28586 pages = {1--18}, 28587 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 28588 institution = {Computer Sciences Department, University of Wisconsin}, 28589 address = {Madison, Wisconsin}, 28590 number = {96-08}, 28591 type = {Mathematical Programming Technical Report}, 28592 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 28593 Argonne National Laboratory}, 28594 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 28595 1996} 28596} 28597 28598@InCollection{ ferris.meyer:models, 28599 author = {M. C. Ferris and R. R. Meyer}, 28600 title = {Models and Solution for On-Demand Data Delivery Problems}, 28601 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 28602 key = {80}, 28603 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 28604 Problems}, 28605 editor = {P. M. Pardalos}, 28606 series = {Nonconvex Optimization and its Applications}, 28607 volume = {42}, 28608 address = {Dordrect}, 28609 year = {2000}, 28610 pages = {175--188}, 28611 publisher = {Kluwer}, 28612 type = {Mathematical Programming Technical Report}, 28613 institution = {Computer Sciences Department, University of Wisconsin}, 28614 number = {99-04} 28615} 28616 28617@InProceedings{ ferris.munson.ea:homotopy, 28618 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 28619 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 28620 booktitle = {Numerical Analysis 1999}, 28621 key = {88}, 28622 year = {2000}, 28623 editor = {D. F. Griffiths and G. A. Watson}, 28624 series = {Research Notes in Mathematics}, 28625 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 28626 address = {London}, 28627 pages = {143--167}, 28628 publisher = {Chapman and Hall}, 28629 institution = {Computer Sciences Department, University of Wisconsin}, 28630 number = {99-09}, 28631 type = {Mathematical Programming Technical Report} 28632} 28633 28634@TechReport{ ferris.munson.ea:practical, 28635 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 28636 title = {A Practical Approach to Sample-Path Simulation Optimization}, 28637 type = {Data Mining Institute Technical Report}, 28638 institution = {Computer Sciences Department, University of Wisconsin}, 28639 address = {Madison, Wisconsin}, 28640 year = {2000}, 28641 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 28642 number = {00-03}, 28643 key = {92}, 28644 annote = {To appear in WSC 2000} 28645} 28646 28647@InCollection{ ferris.munson:case, 28648 author = {M. C. Ferris and T. S. Munson}, 28649 title = {Case Studies in Complementarity: Improving Model Formulation}, 28650 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 28651 key = {73}, 28652 pages = {79--98}, 28653 publisher = {Springer Verlag}, 28654 year = {1999}, 28655 editor = {M. Th\'{e}ra and R. Tichatschke}, 28656 number = {477}, 28657 series = {Lecture Notes in Economics and Mathematical Systems}, 28658 address = {Berlin}, 28659 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 28660 type = {Mathematical Programming Technical Report}, 28661 institution = {Computer Sciences Department, University of Wisconsin} 28662} 28663 28664@Article{ ferris.munson:complementarity, 28665 author = {M. C. Ferris and T. S. Munson}, 28666 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 28667 year = {2000}, 28668 volume = {24}, 28669 pages = {165--188}, 28670 journal = {Journal of Economic Dynamics and Control}, 28671 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 28672 key = {70}, 28673 type = {Mathematical Programming Technical Report}, 28674 institution = {Computer Sciences Department, University of Wisconsin}, 28675 address = {Madison, Wisconsin}, 28676 number = {98-12} 28677} 28678 28679@Misc{ ferris.munson:condor, 28680 author = {M. C. Ferris and T. S. Munson}, 28681 title = {Condor Modeling Language Interface}, 28682 organization = {Computer Sciences Department, University of Wisconsin}, 28683 address = {Madison, Wisconsin}, 28684 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 28685} 28686 28687@Manual{ ferris.munson:gams, 28688 author = {M. C. Ferris and T. S. Munson}, 28689 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 28690 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 28691} 28692 28693@Article{ ferris.munson:interfaces, 28694 author = {M. C. Ferris and T. S. Munson}, 28695 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 28696 journal = {Computational Optimization and Applications}, 28697 volume = {12}, 28698 pages = {207--227}, 28699 year = {1999}, 28700 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 28701 key = {63}, 28702 institution = {Computer Sciences Department, University of Wisconsin}, 28703 address = {Madison, Wisconsin}, 28704 number = {97-12}, 28705 type = {Mathematical Programming Technical Report} 28706} 28707 28708@TechReport{ ferris.munson:interior, 28709 author = {M. C. Ferris and T. S. Munson}, 28710 title = {Interior Point Methods for Massive Support Vector Machines}, 28711 institution = {Computer Sciences Department, University of Wisconsin}, 28712 year = {2000}, 28713 key = {94}, 28714 type = {Data Mining Institute Technical Report}, 28715 number = {00-05}, 28716 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 28717 address = {Madison, Wisconsin}, 28718 annote = {Submitted to SIOPT} 28719} 28720 28721@Article{ ferris.munson:linear, 28722 author = {M. C. Ferris and T. S. Munson}, 28723 title = {Linear Programming for Emergency Broadcast Systems}, 28724 year = {1999}, 28725 journal = {{SIAG/OPT} Newsletter}, 28726 volume = {10}, 28727 pages = {6--8}, 28728 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 28729 key = {76}, 28730 type = {Mathematical Programming Technical Report}, 28731 institution = {Computer Sciences Department, University of Wisconsin}, 28732 address = {Madison, Wisconsin}, 28733 number = {98-20} 28734} 28735 28736@Article{ ferris.munson:modeling, 28737 author = {M. C. Ferris and T. S. Munson}, 28738 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 28739 year = {2000}, 28740 journal = {Mathematical Programming}, 28741 volume = {88}, 28742 pages = {487--506}, 28743 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 28744 key = {71}, 28745 type = {Mathematical Programming Technical Report}, 28746 institution = {Computer Sciences Department, University of Wisconsin}, 28747 address = {Madison, Wisconsin}, 28748 number = {98-13} 28749} 28750 28751@TechReport{ ferris.munson:preprocessing, 28752 author = {M. C. Ferris and T. S. Munson}, 28753 title = {Preprocessing Complementarity Problems}, 28754 type = {Mathematical Programming Technical Report}, 28755 institution = {Computer Sciences Department, University of Wisconsin}, 28756 address = {Madison, Wisconsin}, 28757 year = {1999}, 28758 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 28759 number = {99-07}, 28760 key = {86}, 28761 annote = {Submitted to ICCP 99} 28762} 28763 28764@TechReport{ ferris.munson:semismooth, 28765 author = {M. C. Ferris and T. S. Munson}, 28766 title = {Semismooth Support Vector Machines}, 28767 institution = {Computer Sciences Department, University of Wisconsin}, 28768 year = {2000}, 28769 key = {97}, 28770 type = {Data Mining Institute Technical Report}, 28771 number = {00-09}, 28772 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 28773 address = {Madison, Wisconsin}, 28774 annote = {Submitted to Math Prog B} 28775} 28776 28777@Article{ ferris.pang:engineering, 28778 author = {M. C. Ferris and J. S. Pang}, 28779 title = {Engineering and Economic Applications of Complementarity Problems}, 28780 year = {1997}, 28781 journal = {SIAM Review}, 28782 volume = {39}, 28783 pages = {669--713}, 28784 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 28785 key = {46} 28786} 28787 28788@Article{ ferris.pang:nondegenerate, 28789 author = {M. C. Ferris and J. S. Pang}, 28790 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 28791 journal = {SIAM Journal on Control and Optimization}, 28792 year = {1996}, 28793 volume = {34}, 28794 pages = {244--263}, 28795 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 28796 key = {35} 28797} 28798 28799@Article{ ferris.philpott:affine, 28800 author = {M. C. Ferris and A. B. Philpott}, 28801 title = {On Affine Scaling and Semi--Infinite Programming}, 28802 journal = {Mathematical Programming}, 28803 year = {1992}, 28804 volume = {56}, 28805 pages = {361--364}, 28806 key = {15} 28807} 28808 28809@Article{ ferris.philpott:interior, 28810 author = {M. C. Ferris and A. B. Philpott}, 28811 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 28812 journal = {Mathematical Programming}, 28813 year = {1989}, 28814 volume = {43}, 28815 pages = {257--276}, 28816 key = {04} 28817} 28818 28819@Article{ ferris.philpott:performance, 28820 author = {M. C. Ferris and A. B. Philpott}, 28821 title = {On the Performance of {K}armarkar's Algorithm}, 28822 journal = {Journal of the Operational Research Society}, 28823 year = {1988}, 28824 volume = {39}, 28825 pages = {257--270}, 28826 key = {03} 28827} 28828 28829@InCollection{ ferris.ralph:projected, 28830 author = {M. C. Ferris and D. Ralph}, 28831 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 28832 Maps}, 28833 booktitle = {Recent Advances in Nonsmooth Optimization}, 28834 publisher = {World Scientific Publishers}, 28835 year = {1995}, 28836 pages = {57--87}, 28837 editor = {D. Du and L. Qi and R. Womersley}, 28838 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 28839 key = {41} 28840} 28841 28842@Article{ ferris.ruszczynski:robust, 28843 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 28844 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 28845 year = {2000}, 28846 journal = {Networks}, 28847 volume = {35}, 28848 pages = {181--194}, 28849 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 28850 key = {60} 28851} 28852 28853@InCollection{ ferris.rutherford:accessing, 28854 author = {M. C. Ferris and T. F. Rutherford}, 28855 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 28856 booktitle = {Nonlinear Optimization and Applications}, 28857 key = {48}, 28858 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 28859 editor = {G. Di Pillo and F. Giannessi}, 28860 year = {1996}, 28861 pages = {141--153}, 28862 publisher = {Plenum Press}, 28863 address = {New York} 28864} 28865 28866@InCollection{ ferris.shepard:optimizing, 28867 author = {M. C. Ferris and D. M. Shepard}, 28868 title = {Optimization of Gamma Knife Radiosurgery}, 28869 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 28870 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 28871 publisher = {AMS}, 28872 year = {2000}, 28873 optseries = {DIMACS}, 28874 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 28875 key = {91}, 28876 type = {Data Mining Institute Technical Report}, 28877 institution = {Computer Sciences Department, University of Wisconsin}, 28878 address = {Madison, Wisconsin}, 28879 number = {00-01} 28880} 28881 28882@InCollection{ ferris.sinapiromsaran:formulating, 28883 author = {M. C. Ferris and K. Sinapiromsaran}, 28884 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 28885 booktitle = {Optimization}, 28886 key = {77}, 28887 publisher = {Springer-Verlag}, 28888 year = {2000}, 28889 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 28890 volume = {481}, 28891 series = {Lecture Notes in Economics and Mathematical Systems}, 28892 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 28893 type = {Mathematical Programming Technical Report}, 28894 institution = {Computer Sciences Department, University of Wisconsin}, 28895 address = {Madison, Wisconsin}, 28896 number = {98-21} 28897} 28898 28899@Article{ ferris.tin-loi:limit, 28900 author = {M. C. Ferris and F. Tin-Loi}, 28901 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 28902 Complementarity Constraints}, 28903 year = {2001}, 28904 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 28905 key = {78}, 28906 journal = {International Journal of Mechanical Sciences}, 28907 pages = {209--224}, 28908 volume = {43}, 28909 type = {Mathematical Programming Technical Report}, 28910 institution = {Computer Sciences Department, University of Wisconsin}, 28911 address = {Madison, Wisconsin}, 28912 number = {99-01} 28913} 28914 28915@Article{ ferris.tin-loi:nonlinear, 28916 author = {M. C. Ferris and F. Tin-Loi}, 28917 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 28918 Elastoplasticity}, 28919 year = {1998}, 28920 key = {64}, 28921 volume = {6}, 28922 pages = {857--870}, 28923 journal = {Structural Engineering and Mechanics} 28924} 28925 28926@Article{ ferris.tin-loi:solution, 28927 author = {M. C. Ferris and F. Tin-Loi}, 28928 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 28929 and Complementarity Constraints}, 28930 year = {1999}, 28931 journal = {Computer Methods in Applied Mechanics and Engineering}, 28932 volume = {174}, 28933 pages = {107--120}, 28934 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 28935 key = {66} 28936} 28937 28938@Article{ ferris.vlach:scheduling, 28939 author = {M. C. Ferris and M. Vlach}, 28940 title = {Scheduling with Earliness and Tardiness Penalties}, 28941 journal = {Naval Research Logistics Quarterly}, 28942 year = {1992}, 28943 volume = {39}, 28944 pages = {229--245}, 28945 key = {13} 28946} 28947 28948@TechReport{ ferris.zavriev:linear, 28949 author = {M. C. Ferris and S. K Zavriev}, 28950 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 28951 institution = {Computer Sciences Department, University of Wisconsin}, 28952 year = {1996}, 28953 key = {56}, 28954 address = {Madison, Wisconsin}, 28955 type = {Mathematical Programming Technical Report}, 28956 number = {96--12}, 28957 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 28958} 28959 28960@Article{ ferris:finite, 28961 author = {M. C. Ferris}, 28962 title = {Finite Termination of the Proximal Point Algorithm}, 28963 journal = {Mathematical Programming}, 28964 year = {1991}, 28965 volume = {50}, 28966 pages = {359--366}, 28967 key = {06} 28968} 28969 28970@Article{ ferris:iterative, 28971 author = {M. C. Ferris}, 28972 title = {Iterative Linear Programming Solution of Convex Programs}, 28973 journal = {Journal of Optimization Theory and Applications}, 28974 year = {1990}, 28975 volume = {65}, 28976 pages = {53--65}, 28977 key = {07} 28978} 28979 28980@Article{ ferris:linear, 28981 author = {M. C. Ferris}, 28982 title = {The Linear Complementarity Problem}, 28983 journal = {Bulletin of the American Mathematical Society}, 28984 year = {1993}, 28985 volume = {28}, 28986 pages = {169--175}, 28987 key = {27} 28988} 28989 28990@MastersThesis{ ferris:linear*1, 28991 author = {M. C. Ferris}, 28992 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 28993 Solving a Class of Structural Optimization Problems}, 28994 year = {1985}, 28995 school = {University of Cambridge}, 28996 address = {England}, 28997 key = {01} 28998} 28999 29000@TechReport{ ferris:matlab, 29001 author = {M. C. Ferris}, 29002 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 29003 institution = {Computer Sciences Department, University of Wisconsin}, 29004 year = {1998}, 29005 address = {Madison, Wisconsin}, 29006 type = {Mathematical Programming Technical Report}, 29007 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 29008 number = {98-19}, 29009 key = {75} 29010} 29011 29012@Article{ ferris:parallel, 29013 author = {M. C. Ferris}, 29014 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 29015 journal = {Mathematics of Operations Research}, 29016 year = {1994}, 29017 volume = {19}, 29018 pages = {645--658}, 29019 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 29020 key = {20} 29021} 29022 29023@TechReport{ ferris:parallel*1, 29024 author = {M. C. Ferris}, 29025 title = {Parallel Solution of Extremely Large Knapsack Problems}, 29026 institution = {Computer Sciences Department, University of Wisconsin}, 29027 year = {1989}, 29028 address = {Madison, Wisconsin}, 29029 number = {842}, 29030 key = {09} 29031} 29032 29033@PhDThesis{ ferris:weak, 29034 author = {M. C. Ferris}, 29035 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29036 year = {1988}, 29037 school = {University of Cambridge}, 29038 address = {England}, 29039 key = {02} 29040} 29041 29042@TechReport{ ferris:weak*1, 29043 author = {M. C. Ferris}, 29044 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 29045 institution = {Computer Sciences Department, University of Wisconsin}, 29046 year = {1988}, 29047 address = {Madison, Wisconsin}, 29048 number = {779}, 29049 key = {05} 29050} 29051 29052@Book{ fiacco.mccormick:nonlinear, 29053 author = {A. V. Fiacco and G. P. McCormick}, 29054 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 29055 year = {1968}, 29056 publisher = {John Wiley \& Sons}, 29057 address = {New York}, 29058 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 29059} 29060 29061@Book{ fiacco:introduction, 29062 author = {A. V. Fiacco}, 29063 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 29064 year = {1983}, 29065 publisher = {Academic Press}, 29066 address = {New York} 29067} 29068 29069@Article{ fiedler.ptak:matrices, 29070 author = {M. Fiedler and V. Pt\'{a}k}, 29071 title = {On matrices with nonpositive off-diagonal elements and positive principal 29072 minors}, 29073 journal = {Czechoslovak Mathematics Journal}, 29074 volume = {12}, 29075 pages = {382--400}, 29076 year = {1962} 29077} 29078 29079@Article{ fischer.kanzow:finite, 29080 author = {A. Fischer and C. Kanzow}, 29081 title = {On Finite Termination of an Iterative Method for Linear Complementarity 29082 Problems}, 29083 journal = {Mathematical Programming}, 29084 volume = {74}, 29085 pages = {279--292}, 29086 year = {1996} 29087} 29088 29089@TechReport{ fischer:constrained, 29090 author = {A. Fischer}, 29091 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 29092 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 29093 year = {1995}, 29094 type = {Technical Report}, 29095 number = {MATH-NM-10-1995}, 29096 address = {Dresden} 29097} 29098 29099@Article{ fischer:local, 29100 author = {A. Fischer}, 29101 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 29102 weak conditions}, 29103 journal = {Optimization Methods and Software}, 29104 year = {1995}, 29105 volume = {6}, 29106 pages = {83--107} 29107} 29108 29109@InCollection{ fischer:ncp-function, 29110 author = {A. Fischer}, 29111 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 29112 booktitle = {Recent Advances in Nonsmooth Optimization}, 29113 publisher = {World Scientific Publishers}, 29114 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 29115 year = {1995}, 29116 pages = {88--105} 29117} 29118 29119@Article{ fischer:newton-type, 29120 author = {A. Fischer}, 29121 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 29122 Problems}, 29123 journal = {Journal of Optimization Theory and Applications}, 29124 year = {1995}, 29125 volume = {86}, 29126 pages = {585--608} 29127} 29128 29129@Article{ fischer:solution, 29130 author = {A. Fischer}, 29131 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 29132 Functions}, 29133 year = {1997}, 29134 journal = {Mathematical Programming}, 29135 pages = {513--532} 29136} 29137 29138@Article{ fischer:special, 29139 author = {A. Fischer}, 29140 title = {A Special {N}ewton--Type Optimization Method}, 29141 journal = {Optimization}, 29142 year = {1992}, 29143 volume = {24}, 29144 pages = {269--284} 29145} 29146 29147@Article{ fisher:use, 29148 author = {R. A. Fisher}, 29149 title = {The Use of Multiple Measurements in Taxonomic Problems}, 29150 journal = {Annual Eugenics}, 29151 year = {1936}, 29152 volume = {7}, 29153 number = {Part II}, 29154 pages = {179--188} 29155} 29156 29157@Book{ fishman:principles, 29158 author = {G. Fishman}, 29159 title = {Principles of Discrete Event Simulation}, 29160 publisher = {Wiley}, 29161 address = {New York, NY}, 29162 year = {1978} 29163} 29164 29165@Article{ fitchard.aldridge.ea:registration, 29166 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 29167 title = {Registration of Synthetic Tomographic Projection Data Sets Using 29168 Cross-Correlation}, 29169 journal = {Physics in Medicine and Biology}, 29170 year = {1998}, 29171 volume = {43}, 29172 pages = {1645--1657} 29173} 29174 29175@Article{ fletcher.matthews:stable, 29176 author = {R. Fletcher and S. P. J. Matthews}, 29177 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 29178 journal = {Mathematical Programming}, 29179 year = {1984}, 29180 volume = {30}, 29181 pages = {267--284} 29182} 29183 29184@TechReport{ fletcher.maza:nonlinear, 29185 author = {R. Fletcher and E. Sainz de la Maza}, 29186 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 29187 Programming}, 29188 institution = {Department of Mathematical Sciences}, 29189 year = {1987}, 29190 address = {The University, Dundee, Scotland}, 29191 number = {NA/100}, 29192 type = {Numerical Analysis Report} 29193} 29194 29195@InCollection{ fletcher:class, 29196 author = {R. Fletcher}, 29197 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 29198 Properties}, 29199 booktitle = {Integer and Nonlinear Programming}, 29200 year = {1970}, 29201 editor = {J. Abadie}, 29202 publisher = {North--Holland}, 29203 address = {Amsterdam}, 29204 pages = {157--173} 29205} 29206 29207@Article{ fletcher:exact, 29208 author = {R. Fletcher}, 29209 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 29210 journal = {Mathematical Programming}, 29211 year = {1973}, 29212 volume = {5}, 29213 pages = {129--150} 29214} 29215 29216@Article{ fletcher:generalized, 29217 author = {R. Fletcher}, 29218 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 29219 Equations}, 29220 journal = {The Computer Journal}, 29221 year = {1968}, 29222 volume = {10}, 29223 pages = {392--399} 29224} 29225 29226@InProceedings{ fletcher:penalty, 29227 crossref = {bachem.grotschel.ea:mathematical}, 29228 author = {R. Fletcher}, 29229 title = {Penalty Functions}, 29230 pages = {87--114} 29231} 29232 29233@Book{ fletcher:practical, 29234 author = {R. Fletcher}, 29235 title = {Practical Methods of Optimization}, 29236 year = {1981}, 29237 publisher = {John Wiley \& Sons}, 29238 address = {Chichester}, 29239 volume = {1} 29240} 29241 29242@Book{ fletcher:practical*1, 29243 author = {R. Fletcher}, 29244 title = {Practical Methods of Optimization}, 29245 year = {1981}, 29246 publisher = {John Wiley \& Sons}, 29247 address = {Chichester}, 29248 volume = {2} 29249} 29250 29251@Book{ fletcher:practical*2, 29252 author = {R. Fletcher}, 29253 title = {Practical Methods of Optimization}, 29254 year = {1987}, 29255 publisher = {John Wiley \& Sons}, 29256 address = {New York}, 29257 edition = {second} 29258} 29259 29260@Unpublished{ fletcher:recent, 29261 author = {R. Fletcher}, 29262 title = {Recent Developments in Nonlinear Programming}, 29263 note = {Presentation at SOR 96, Braunchweig, Germany}, 29264 year = {1996} 29265} 29266 29267@InCollection{ fletcher:second, 29268 author = {R. Fletcher}, 29269 title = {Second Order Correction for Nondifferentiable Optimization}, 29270 booktitle = {Numerical Analysis}, 29271 year = {1982}, 29272 editor = {G. A. Watson}, 29273 publisher = {Springer-Verlag}, 29274 address = {Berlin}, 29275 pages = {85--114} 29276} 29277 29278@InCollection{ florian:mathematical, 29279 author = {M. Florian}, 29280 title = {Mathematical programming applications in national, regional, and urban planning}, 29281 editors = {M. Iri and K. Tanabe}, 29282 booktitle = {Mathematical Programming: Recent Developments and Applications}, 29283 publisher = {Kluwer Academic Publishers}, 29284 address = {Tokyo}, 29285 year = {1989} 29286} 29287 29288@Article{ florian:nonlinear, 29289 author = {M. Florian}, 29290 title = {Nonlinear Cost Network Models in Transportation Analysis}, 29291 journal = {Mathematical Programming Study}, 29292 year = {1986}, 29293 volume = {26}, 29294 pages = {167--196} 29295} 29296 29297@Article{ flynn:computer, 29298 author = {M.~J. Flynn}, 29299 title = {Some Computer Organizations and their Effectiveness}, 29300 journal = {IEEE Transactions on Computers}, 29301 year = {1972}, 29302 volume = {C-21}, 29303 pages = {948--960} 29304} 29305 29306@InProceedings{ fogarty:varying, 29307 crossref = {schaeffer:third}, 29308 author = {T. C. Fogarty}, 29309 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 29310 pages = {422--427} 29311} 29312 29313@Article{ forrest.goldfarb:steepest-edge, 29314 author = {J. J. Forrest and D. Goldfarb}, 29315 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 29316 journal = {Mathematical Programming}, 29317 year = {1992}, 29318 volume = {57}, 29319 pages = {341--374} 29320} 29321 29322@Article{ forrest.tomlin:updating, 29323 author = {J. J. H. Forrest and J. A. Tomlin}, 29324 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 29325 Simplex Method}, 29326 journal = {Mathematical Programming}, 29327 year = {1972}, 29328 volume = {2}, 29329 pages = {263--278} 29330} 29331 29332@TechReport{ forsgren.gill.ea:computing, 29333 author = {A. Forsgren and P. E. Gill and W. Murray}, 29334 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 29335 institution = {Department of Mathematics, Royal Institute of Technology}, 29336 year = {1993}, 29337 number = {TRITA-MAT-1993-9}, 29338 address = {Stockholm, Sweden} 29339} 29340 29341@TechReport{ forsgren.gill:primal-dual, 29342 author = {A. Forsgren and P. E. Gill}, 29343 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 29344 institution = {Department of Mathematics, University of California}, 29345 year = {1996}, 29346 type = {Report NA}, 29347 number = {96-3}, 29348 address = {San Diego} 29349} 29350 29351@InCollection{ fortin.glowinski:decomposition-coordination, 29352 author = {M. Fortin and R. Glowinski}, 29353 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 29354 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 29355 Problems}, 29356 publisher = {North-Holland}, 29357 year = {1983}, 29358 editor = {M. Fortin and R. Glowinski}, 29359 address = {Amsterdam} 29360} 29361 29362@Misc{ foster.kesselman:globus, 29363 author = {I. Foster and C. Kesselman}, 29364 title = {The Globus Project}, 29365 howpublished = {www.globus.org} 29366} 29367 29368@Article{ foster.kesselman:globus*1, 29369 author = {I. Foster and C. Kesselman}, 29370 title = {Globus: A Metacomputing Infrastructure Toolkit}, 29371 journal = {International Journal of Supercomputer Applications}, 29372 volume = {11}, 29373 pages = {115--128}, 29374 year = {1997} 29375} 29376 29377@Book{ foster.kesselman:grid, 29378 editor = {I. Foster and C. Kesselman}, 29379 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 29380 publisher = {Morgan Kaufmann Publishers}, 29381 year = {1999} 29382} 29383 29384@Book{ fourer.gay.ea:ampl, 29385 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29386 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 29387 year = {1993}, 29388 publisher = {Duxbury Press} 29389} 29390 29391@Article{ fourer.gay.ea:modeling, 29392 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29393 title = {A Modeling Language for Mathematical Programming}, 29394 journal = {Management Science}, 29395 year = {1990}, 29396 volume = {36}, 29397 pages = {519--554} 29398} 29399 29400@Article{ fraass:development, 29401 author = {A. Fraass}, 29402 title = {The development of conformal radiation therapy}, 29403 journal = {Medical Physics}, 29404 year = {1995}, 29405 volume = {22}, 29406 number = {11}, 29407 pages = {1911--1921} 29408} 29409 29410@TechReport{ fraley:algorithms, 29411 author = {C. Fraley}, 29412 title = {Algorithms for Nonlinear Least Squares}, 29413 institution = {Stanford University}, 29414 year = {1988}, 29415 number = {{SOL} 88.16}, 29416 type = {Technical Report} 29417} 29418 29419@InCollection{ francois.mcdonald.ea:uruguay, 29420 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29421 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 29422 booktitle = {The {U}ruguay Round and the Developing Economies}, 29423 address = {New York}, 29424 editors = {W. Martin and L. A. Winters}, 29425 publisher = {Cambridge University Press} 29426} 29427 29428@InCollection{ francois.mcdonald.ea:uruguay*1, 29429 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29430 title = {The {U}ruguay Round: {A} Global Analysis}, 29431 booktitle = {Challenges and Opportunities for East Asian Trade}, 29432 address = {Cambridge}, 29433 editors = {D. Robertson}, 29434 publisher = {Cambridge University Press} 29435} 29436 29437@Article{ frank.wolfe:algorithm, 29438 author = {M. Frank and P. Wolfe}, 29439 title = {An Algorithm for Quadratic Programming}, 29440 journal = {Naval Research Logistics Quarterly}, 29441 year = {1956}, 29442 volume = {3}, 29443 pages = {95--110} 29444} 29445 29446@Article{ freund.nachtigal:qmrpack, 29447 author = {R. W. Freund and N. M. Nachtigal}, 29448 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 29449 journal = {{ACM} Transactions on Mathematical Software}, 29450 year = {1996}, 29451 volume = {22}, 29452 pages = {46--77} 29453} 29454 29455@InProceedings{ freund.schapire:experiments, 29456 author = {Y. Freund and R. E. Schapire}, 29457 title = {Experiments with a New Boosting Algorithm}, 29458 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 29459 pages = {148--156}, 29460 year = {1996}, 29461 editor = {L. Saitta}, 29462 publisher = {Morgan Kaufmann} 29463} 29464 29465@Unpublished{ freund.todd:barrier, 29466 author = {Robert M. Freund and Michael J. Todd}, 29467 title = {Barrier functions and interior-point algorithms for linear programming with 29468 zero-, one-, or two-sided bounds on the variables}, 29469 year = {1992}, 29470 month = jul 29471} 29472 29473@Article{ friedman.chernina:iterative, 29474 author = {V. M. Friedman and V. S. Chernina}, 29475 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 29476 note = {In Russian}, 29477 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 29478 volume = {1}, 29479 pages = {116--120}, 29480 year = {1967} 29481} 29482 29483@Article{ friesz.bernstein.ea:day-to-day, 29484 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 29485 Ganjalizadeh}, 29486 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 29487 Systems}, 29488 journal = {Operations Research}, 29489 year = {1994}, 29490 volume = {42}, 29491 pages = {1120--1136} 29492} 29493 29494@Article{ friesz.tobin.ea:nonlinear, 29495 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 29496 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 29497 Derived Demand Network Equilibrium Problem}, 29498 journal = {Journal of Regional Science}, 29499 year = {1983}, 29500 volume = {23}, 29501 pages = {337--359} 29502} 29503 29504@Article{ friesz:network, 29505 author = {T. L. Friesz}, 29506 title = {Network Equilibrium, Design and Aggregation}, 29507 journal = {Transportation Research}, 29508 volume = {19A}, 29509 year = {1985}, 29510 pages = {413--427} 29511} 29512 29513@Unpublished{ frisch:logarithmic, 29514 author = {K. R. Frisch}, 29515 title = {The Logarithmic Potential Method of Convex Programming}, 29516 year = {1955}, 29517 note = {Unpublished manuscript, University Institute of Economics, Oslo} 29518} 29519 29520@Book{ fukunaga:statistical, 29521 author = {K. Fukunaga}, 29522 title = {Statistical Pattern Recognition}, 29523 year = {1990}, 29524 publisher = {Academic Press}, 29525 address = {New York} 29526} 29527 29528@Article{ fukushima.luo.ea:globally, 29529 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 29530 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 29531 Programs with Linear Complementarity Constraints}, 29532 journal = {Computational Optimization and Applications}, 29533 year = {1998}, 29534 volume = {10}, 29535 pages = {5--34} 29536} 29537 29538@Article{ fukushima:equivalent, 29539 author = {M. Fukushima}, 29540 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 29541 Asymmetric Variational Inequality Problems}, 29542 journal = {Mathematical Programming}, 29543 year = {1992}, 29544 volume = {53}, 29545 pages = {99--110} 29546} 29547 29548@Article{ fukushima:primal, 29549 author = {M. Fukushima}, 29550 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 29551 Mappings with Application to the Traffic Equilibrium Problem}, 29552 journal = {Mathematical Programming}, 29553 year = {1996}, 29554 volume = {72}, 29555 pages = {1--15} 29556} 29557 29558@Article{ gabay.mercier:dual, 29559 author = {D. Gabay and B. Mercier}, 29560 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 29561 Finite Element Approximations}, 29562 journal = {Computational Mathematics and Applications}, 29563 year = {1976}, 29564 volume = {2}, 29565 pages = {17--48} 29566} 29567 29568@InCollection{ gabay:applications, 29569 author = {D. Gabay}, 29570 title = {Applications of the Method of Multipliers to Variational Inequalities}, 29571 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 29572 Problems}, 29573 publisher = {North-Holland}, 29574 year = {1983}, 29575 editor = {M. Fortin and R. Glowinski}, 29576 address = {Amsterdam} 29577} 29578 29579@Unpublished{ gabriel.bernstein:path, 29580 author = {S. A. Gabriel and D. Berstein}, 29581 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 29582 Equilibrium Problem}, 29583 note = {Draft, 1995} 29584} 29585 29586@TechReport{ gabriel.kydes:nonlinear, 29587 author = {S. A. Gabriel and A. S. Kydes}, 29588 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 29589 System}, 29590 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 29591 year = {1995}, 29592 type = {Preprint}, 29593 number = {MCS-P504-0395}, 29594 address = {Argonne, Illinois}, 29595 month = mar 29596} 29597 29598@InProceedings{ gabriel.more:smoothing, 29599 crossref = {ferris.pang:complementarity}, 29600 author = {S. A. Gabriel and J. J. Mor\'{e}}, 29601 title = {Smoothing of Mixed Complementarity Problems} 29602} 29603 29604@Article{ gabriel.pang:inexact, 29605 author = {S. A. Gabriel and J. S. Pang}, 29606 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 29607 journal = {Computational Optimization and Applications}, 29608 year = {1992}, 29609 volume = {1}, 29610 pages = {67--91} 29611} 29612 29613@InCollection{ gabriel.pang:trust, 29614 author = {S. A. Gabriel and J. S. Pang}, 29615 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 29616 booktitle = {Large--Scale Optimization: State of the Art}, 29617 publisher = {Kluwer Academic Publishers}, 29618 year = {1994}, 29619 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 29620 pages = {159--186} 29621} 29622 29623@PhDThesis{ gabriel:algorithms, 29624 author = {S. A. Gabriel}, 29625 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 29626 Extensions}, 29627 school = {The Johns Hopkins University}, 29628 year = {1992}, 29629 address = {Baltimore, Maryland} 29630} 29631 29632@Article{ gafni.bertsekas:two-metric, 29633 author = {E. M. Gafni and D. P. Bertsekas}, 29634 title = {Two-Metric Projection Methods for Constrained Optimization}, 29635 journal = {SIAM Journal on Control and Optimization}, 29636 year = {1984}, 29637 volume = {22}, 29638 pages = {936--964} 29639} 29640 29641@InProceedings{ gaivoronski:convergence, 29642 author = {A. A. Gaivoronski}, 29643 title = {Convergence of Parallel Backpropagation for Neural Networks}, 29644 booktitle = {SIAM Journal on Optimization}, 29645 year = {1994}, 29646 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 29647 submitted} 29648} 29649 29650@Misc{ gaivoronski:private, 29651 author = {A. A. Gaivoronski}, 29652 title = {Private Communication}, 29653 year = {1992}, 29654 month = nov, 29655 address = {ITALTEL, Milan} 29656} 29657 29658@Book{ gale:theory, 29659 author = {D. Gale}, 29660 title = {The Theory of Linear Economic Models}, 29661 year = {1960}, 29662 publisher = {McGraw-Hill Book Company}, 29663 address = {New York} 29664} 29665 29666@Book{ gallant:neural, 29667 author = {S. I. Gallant}, 29668 title = {Neural Network Learning and Expert Systems}, 29669 year = {1993}, 29670 publisher = {MIT Press}, 29671 address = {Cambridge, Massachusetts} 29672} 29673 29674@InProceedings{ ganti.gehrke.ea:framework, 29675 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 29676 title = {A Framework for Measuring Changes in Data Characteristics}, 29677 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 29678 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 29679 publisher = {ACM Press}, 29680 year = {1999}, 29681 isbn = {1-58113-062-7}, 29682 pages = {126--137} 29683} 29684 29685@Book{ ganz:gamma, 29686 author = {J. C. Ganz}, 29687 title = {Gamma Knife Surgery}, 29688 publisher = {Springer-Verlag Wien}, 29689 year = {1997}, 29690 address = {Austria} 29691} 29692 29693@TechReport{ gao:nonlinear, 29694 author = {Y. Gao}, 29695 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 29696 Conditions}, 29697 type = {Manuscript}, 29698 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 29699 month = oct, 29700 year = {1994} 29701} 29702 29703@Article{ garcia-palomares.mangasarian:superlinearly, 29704 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 29705 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 29706 Optimization Problems}, 29707 journal = {Mathematical Programming}, 29708 year = {1976}, 29709 volume = {11}, 29710 pages = {1--13} 29711} 29712 29713@Article{ garcia-palomares.restuccia:global, 29714 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 29715 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 29716 journal = {Mathematical Programming}, 29717 year = {1981}, 29718 volume = {21}, 29719 pages = {290--300} 29720} 29721 29722@InProceedings{ garcia-palomares:superlinearly, 29723 author = {U. M. {Garcia--Palomares}}, 29724 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 29725 crossref = {mangasarian.meyer.ea:nonlinear*2}, 29726 pages = {101--119} 29727} 29728 29729@Article{ garcia.gould:theorem, 29730 author = {C. B. Garcia and F. J. Gould}, 29731 title = {A Theorem on Homotopy Paths}, 29732 journal = {Mathematics of Operations Research}, 29733 year = {1978}, 29734 volume = {3}, 29735 pages = {282--289} 29736} 29737 29738@Book{ garcia.zangwill:pathways, 29739 author = {C. B. Garcia and W. I. Zangwill}, 29740 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 29741 year = {1981}, 29742 publisher = {Prentice-Hall, Inc}, 29743 address = {Englewood Cliffs, New Jersey} 29744} 29745 29746@Book{ garey.johnson:computers, 29747 author = {M. R. Garey and D. S. Johnson}, 29748 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 29749 year = {1979}, 29750 publisher = {W.H. Freeman and Company}, 29751 address = {San Francisco} 29752} 29753 29754@Article{ garey.tarjan.ea:one-processor, 29755 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 29756 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 29757 journal = {Mathematics of Operations Research}, 29758 year = {1988}, 29759 volume = {13}, 29760 pages = {330--348} 29761} 29762 29763@Book{ garfinkel.nemhauser:integer, 29764 author = {R. S. Garfinkel and G. L. Nemhauser}, 29765 title = {Integer Programming}, 29766 year = {1972}, 29767 publisher = {John Wiley \& Sons}, 29768 address = {New York} 29769} 29770 29771@Book{ gass:linear, 29772 author = {S. Gass}, 29773 title = {Linear Programming Methods and Applications}, 29774 edition = {Fifth}, 29775 publisher = {Boyd and Fraser Publishing Company}, 29776 address = {Danvers, Massachusetts}, 29777 year = {1985} 29778} 29779 29780@InProceedings{ gay:combining, 29781 author = {D. M. Gay}, 29782 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 29783 booktitle = {Sparse Matrix Proceedings 1978}, 29784 editor = {I. S. Duff and G. W. Stewart}, 29785 year = {1978}, 29786 organization = {SIAM}, 29787 address = {Philadelphia, Pennsylvania}, 29788 pages = {313--334} 29789} 29790 29791@Article{ gay:electronic, 29792 author = {D. M. Gay}, 29793 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 29794 journal = {{COAL} Newsletter}, 29795 year = {1985}, 29796 volume = {13}, 29797 pages = {10--12} 29798} 29799 29800@TechReport{ gay:hooking, 29801 author = {D. M. Gay}, 29802 title = {Hooking Your Solver to {AMPL}}, 29803 year = {1997}, 29804 institution = {Bell Laboratories}, 29805 address = {Murray Hill, New Jersey}, 29806 note = {Revised 1994, 1997} 29807} 29808 29809@Article{ gay:variant, 29810 author = {D. Gay}, 29811 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 29812 Form}, 29813 journal = {Mathematical Programming}, 29814 year = {1987}, 29815 volume = {37}, 29816 pages = {81--90} 29817} 29818 29819@Article{ geiger.kanzow:resolution, 29820 author = {C. Geiger and C. Kanzow}, 29821 title = {On the Resolution of Monotone Complementarity Problems}, 29822 journal = {Computational Optimization and Applications}, 29823 volume = {5}, 29824 year = {1996}, 29825 pages = {155--173} 29826} 29827 29828@Book{ geist.beguelin.ea:pvm, 29829 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 29830 V. S. Sunderam}, 29831 title = {{PVM}: Parallel Virtual Machine}, 29832 publisher = {MIT Press}, 29833 address = {Cambridge, Massachusetts}, 29834 year = {1994} 29835} 29836 29837@Article{ gendron.crainic:parallel, 29838 author = {B. Gendron and T. G. Crainic}, 29839 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 29840 journal = {Operations Research}, 29841 year = {1994}, 29842 volume = {42}, 29843 pages = {1042--1060} 29844} 29845 29846@Article{ george:automatic, 29847 author = {A. George}, 29848 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 29849 journal = {SIAM Journal on Numerical Analysis}, 29850 vol = {17}, 29851 pages = {740--751}, 29852 year = {1980} 29853} 29854 29855@InProceedings{ georges-schleuter:asparagos, 29856 crossref = {schaeffer:third}, 29857 author = {M. Georges--Schleuter}, 29858 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 29859 pages = {416--421} 29860} 29861 29862@Article{ georgiou:comments, 29863 author = {G. M. Georgiou}, 29864 title = {Comments On Hidden Nodes in Neural Nets}, 29865 journal = {IEEE Transactions on Circuits and Systems}, 29866 year = {1991}, 29867 volume = {38}, 29868 pages = {1410} 29869} 29870 29871@TechReport{ gertz.linderoth.ea:object-oriented, 29872 author = {M. Gertz and J. Linderoth and S. Wright}, 29873 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 29874 institution = {MCS Division, Argonne National Laboratory}, 29875 year = {in preparation} 29876} 29877 29878@Article{ ghellinck.vial:polynomial, 29879 author = {G. de Ghellinck and J.--Ph. Vial}, 29880 title = {A Polynomial {N}ewton Method for Linear Programming}, 29881 journal = {Algorithmica}, 29882 year = {1986}, 29883 volume = {1}, 29884 pages = {425--453} 29885} 29886 29887@InCollection{ gilbert.ng:predicting, 29888 author = {J. R. Gilbert and E. Ng}, 29889 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 29890 year = {1993}, 29891 booktitle = {Graph Theory and Sparse Matrix Computation}, 29892 editor = {A. George and J. Gilbert and J. Liu}, 29893 publisher = {Springer-Verlag} 29894} 29895 29896@Article{ gilbert-lemarechal, 29897 author = {J. C. Gilbert and C. Lemarechal}, 29898 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 29899 journal = {Mathematical Programming}, 29900 year = {1989}, 29901 volume = {45}, 29902 pages = {407--434} 29903} 29904 29905@Article{ gill.murray.ea:computing, 29906 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29907 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 29908 journal = {SIAM Journal on Scientific and Statistical Computing}, 29909 year = {1983}, 29910 volume = {4}, 29911 pages = {310--321} 29912} 29913 29914@Article{ gill.murray.ea:maintaining, 29915 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29916 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 29917 year = {1987}, 29918 journal = {Linear Algebra and Its Applications}, 29919 volume = {88/89}, 29920 pages = {239--270} 29921} 29922 29923@Book{ gill.murray.ea:practical, 29924 author = {P. E. Gill and W. Murray and M. H. Wright}, 29925 title = {Practical Optimization}, 29926 year = {1981}, 29927 publisher = {Academic Press}, 29928 address = {London} 29929} 29930 29931@Article{ gill.murray.ea:practical*1, 29932 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29933 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 29934 journal = {Mathematical Programming}, 29935 year = {1989}, 29936 volume = {45}, 29937 pages = {437--474} 29938} 29939 29940@Article{ gill.murray.ea:projected, 29941 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 29942 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 29943 to {K}armarkar's Projective Method}, 29944 journal = {Mathematical Programming}, 29945 year = {1986}, 29946 volume = {36}, 29947 pages = {183--209} 29948} 29949 29950@Article{ gill.murray:newton-type, 29951 author = {P. E. Gill and W. Murray}, 29952 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 29953 journal = {Mathematical Programming}, 29954 year = {1974}, 29955 volume = {7}, 29956 pages = {311--350} 29957} 29958 29959@InProceedings{ gill.murray:nonlinear, 29960 author = {P. E. Gill and W. Murray}, 29961 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 29962 booktitle = {Numerical Analysis, Dundee 1975}, 29963 year = {1976}, 29964 editor = {G. A. Watson}, 29965 publisher = {Springer-Verlag}, 29966 address = {Berlin}, 29967 note = {Lecture Notes in Mathematics 506} 29968} 29969 29970@Book{ ginsburgh.waelbroeck:activity, 29971 author = {V. Ginsburgh and J. Waelbroeck}, 29972 title = {Activity Analysis and General Equilibrium Modelling}, 29973 publisher = {North--Holland}, 29974 year = {1981}, 29975 address = {Amsterdam} 29976} 29977 29978@Article{ glad.goldstein:errors, 29979 author = {T. Glad and A. Goldstein}, 29980 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 29981 journal = {BIT}, 29982 year = {1977}, 29983 volume = {17}, 29984 pages = {160--169} 29985} 29986 29987@Article{ glad.polak:multiplier, 29988 author = {T. Glad and E. Polak}, 29989 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 29990 journal = {Mathematical Programming}, 29991 year = {1979}, 29992 volume = {17}, 29993 pages = {140--155} 29994} 29995 29996@Book{ glashoff.gustafson:linear, 29997 author = {K. Glashoff and S.--\AA. Gustafson}, 29998 title = {Linear Optimization and Approximation}, 29999 year = {1983}, 30000 publisher = {Springer-Verlag}, 30001 address = {New York} 30002} 30003 30004@Article{ glover:improved, 30005 author = {F. Glover}, 30006 title = {Improved Linear Programming Models for Discriminant Analysis}, 30007 journal = {Decision Sciences}, 30008 year = {1990}, 30009 volume = {21}, 30010 pages = {771--785} 30011} 30012 30013@Book{ glasserman:gradient, 30014 author = {P. Glasserman}, 30015 title = {Gradient Estimation via Perturbation Analysis}, 30016 publisher = {Kluwer}, 30017 year = {1991}, 30018 address = {Norwell, MA} 30019} 30020 30021@Article{ glover:tabu, 30022 author = {F. Glover}, 30023 title = {Tabu Search -- Part 1}, 30024 journal = {ORSA Journal on Computing}, 30025 year = {1989}, 30026 volume = {1}, 30027 pages = {190--206} 30028} 30029 30030@Article{ glowinski.marroco:sur, 30031 author = {R. Glowinski and A. Marroco}, 30032 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 30033 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 30034 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 30035 year = {1975}, 30036 volume = {9(R-2)}, 30037 pages = {41--76} 30038} 30039 30040@TechReport{ goeleven.nguyen:convergence, 30041 author = {D. Goeleven and V. H. Nguyen}, 30042 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 30043 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 30044 year = {1992}, 30045 address = {B-5000 Namur, Belgium} 30046} 30047 30048@Book{ goldberg:genetic, 30049 author = {D. E. Goldberg}, 30050 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 30051 year = {1989}, 30052 publisher = {Addison-Wesley}, 30053 address = {Reading MA} 30054} 30055 30056@Article{ golden.skiscim:simulated, 30057 author = {B. L. Golden and C. C. Skiscim}, 30058 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 30059 journal = {Naval Research Logistics Quarterly}, 30060 year = {1989}, 30061 volume = {33}, 30062 pages = {261--279} 30063} 30064 30065@Article{ goldfarb.reid:practical, 30066 author = {D. Goldfarb and J. K. Reid}, 30067 title = {A Practical Steepest--Edge Simplex Algorithm}, 30068 journal = {Mathematical Programming}, 30069 year = {1977}, 30070 volume = {12}, 30071 pages = {361--371} 30072} 30073 30074@InProceedings{ goldman.tucker:theory, 30075 author = {A. J. Goldman and A. W. Tucker}, 30076 title = {Theory of Linear Programming}, 30077 booktitle = {Linear Inequalities and Related Systems}, 30078 year = {1956}, 30079 editor = {H. W. Kuhn and A. W. Tucker}, 30080 publisher = {Princeton University Press}, 30081 address = {Princeton, New Jersey}, 30082 pages = {53--97} 30083} 30084 30085@Book{ goldstein:constructive, 30086 author = {A. A. Goldstein}, 30087 title = {Constructive Real Analysis}, 30088 year = {1967}, 30089 publisher = {Harper and Row}, 30090 address = {New York} 30091} 30092 30093@Article{ golshtein:block, 30094 author = {Ye. G. Golshtein}, 30095 title = {The Block Method of Convex Programming}, 30096 journal = {Soviet Mathematics Doklady}, 30097 year = {1986}, 30098 volume = {33}, 30099 pages = {584--587} 30100} 30101 30102@Article{ golshtein:general, 30103 author = {Ye. G. Golshtein}, 30104 title = {A General Approach to Decomposition of Optimization Systems}, 30105 journal = {Soviet Journal of Computer and Systems Sciences}, 30106 year = {1987}, 30107 volume = {3}, 30108 pages = {105--114} 30109} 30110 30111@Article{ golub.kahan:calculating, 30112 author = {G. H. Golub and W. Kahan}, 30113 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 30114 journal = {SIAM Journal on Numerical Analysis}, 30115 year = {1965}, 30116 volume = {2}, 30117 pages = {205--224} 30118} 30119 30120@Book{ golub.vanloan:matrix, 30121 author = {G. H. Golub and C. F. {Van Loan}}, 30122 title = {Matrix Computations}, 30123 year = {1996}, 30124 publisher = {The John Hopkins University Press}, 30125 address = {Baltimore, Maryland}, 30126 edition = {Third} 30127} 30128 30129@TechReport{ gomez.barron:exponential, 30130 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 30131 title = {The Exponential Tunneling Method}, 30132 institution = {Universidad Nacional Autonoma de Mexico}, 30133 year = {1991}, 30134 type = {Serie Reportes de Investigacion}, 30135 number = {3}, 30136 address = {Mexico} 30137} 30138 30139@Article{ gondzio:multiple, 30140 author = {J. Gondzio}, 30141 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 30142 journal = {Computational Optimization and Applications}, 30143 year = {1996}, 30144 volume = {6}, 30145 pages = {137--156} 30146} 30147 30148@TechReport{ gonzaga:algorithm, 30149 author = {C. C. Gonzaga}, 30150 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 30151 operations}, 30152 institution = {Electronics Research Laboratory, University of California}, 30153 year = {1987}, 30154 address = {Berkeley, California}, 30155 number = {UCB/ERL M87/10}, 30156 type = {Memorandum} 30157} 30158 30159@Article{ gould.tolle:necessary, 30160 author = {F. J. Gould and J. W. Tolle}, 30161 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 30162 journal = {SIAM Journal on Applied Mathematics}, 30163 year = {1971}, 30164 volume = {20}, 30165 pages = {164--172} 30166} 30167 30168@InProceedings{ goux.kulkarni.ea:enabling, 30169 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 30170 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 30171 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 30172 Distributed Computing}, 30173 year = {2000} 30174} 30175 30176@Article{ gowda.pang:basic, 30177 author = {M. S. Gowda and J. S. Pang}, 30178 title = {The Basic Theorem of Complementarity Revisited}, 30179 journal = {Mathematical Programming}, 30180 year = {1993}, 30181 volume = {58}, 30182 pages = {161--178} 30183} 30184 30185@Article{ gowda.pang:boundedness, 30186 author = {M. S. Gowda and J. S. Pang}, 30187 title = {On the Boundedness and Stability of Solutions to the Affine Variational 30188 Inequality Problem}, 30189 journal = {SIAM Journal on Control and Optimization}, 30190 year = {1994}, 30191 volume = {32}, 30192 pages = {421--441} 30193} 30194 30195@Article{ gowda.pang:stability, 30196 author = {M. S. Gowda and J. S. Pang}, 30197 title = {Stability analysis of variational inequalities and nonlinear complementarity 30198 problems, via the mixed linear complementarity problem and degree theory}, 30199 journal = {Mathematics of Operations Research}, 30200 year = {1994}, 30201 volume = {19}, 30202 pages = {831--879} 30203} 30204 30205@Article{ gowda.sznajder:generalizations, 30206 author = {M. S. Gowda and R. Sznajder}, 30207 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 30208 Horizontal {LCP}s}, 30209 journal = {Linear Algebra and Its Applications}, 30210 year = {1995}, 30211 volume = {223/224}, 30212 pages = {695--715} 30213} 30214 30215@Article{ gowda.sznajder:generalized, 30216 author = {M. S. Gowda and R. Sznajder}, 30217 title = {The Generalized Order Linear Complementarity Problem}, 30218 journal = {SIAM Journal on Matrix Analysis and Applications}, 30219 year = {1994} 30220} 30221 30222@Article{ gowda:analysis, 30223 author = {M. S. Gowda}, 30224 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 30225 Function via its Recession Function}, 30226 journal = {SIAM Journal on Matrix Analysis and Applications}, 30227 year = {1996}, 30228 volume = {17}, 30229 pages = {594--609} 30230} 30231 30232@Article{ gowda:applications, 30233 author = {M. S. Gowda}, 30234 title = {Applications of Degree Theory to Linear Complementarity Problems}, 30235 journal = {Mathematics of Operations Research}, 30236 year = {1993}, 30237 volume = {18}, 30238 pages = {868--879} 30239} 30240 30241@Article{ grant.woo:clinical, 30242 author = {W. I. Grant and S. Y. Woo}, 30243 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 30244 Delivery}, 30245 journal = {Seminars in Radiation Oncology}, 30246 year = {1999}, 30247 volume = {9}, 30248 pages = {99--107} 30249} 30250 30251@Article{ greenberg.hegerich:branch, 30252 author = {H. Greenberg and R. L. Hegerich}, 30253 title = {A Branch Search Algorithm for the Knapsack Problem}, 30254 journal = {Management Science}, 30255 year = {1970}, 30256 volume = {16}, 30257 pages = {327--332} 30258} 30259 30260@InCollection{ grefenstette:incorporating, 30261 crossref = {davis:genetic}, 30262 author = {J. J. Grefenstette}, 30263 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 30264} 30265 30266@Book{ griewank.corliss:automatic, 30267 editor = {A. Griewank and G. F. Corliss}, 30268 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 30269 publisher = {SIAM}, 30270 year = {1991}, 30271 address = {Philadelphia, Pennsylvania} 30272} 30273 30274@Article{ griewank.juedes.ea:adol-c, 30275 author = {A. Griewank and D. Juedes and J. Utke}, 30276 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 30277 in {C}/{C}++}, 30278 journal = {{ACM} Transactions on Mathematical Software}, 30279 year = {1996}, 30280 volume = {22}, 30281 pages = {131--167} 30282} 30283 30284@Article{ griffith.stewart:nonlinear, 30285 author = {R. E. Griffith and R. A. Stewart}, 30286 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 30287 Systems}, 30288 journal = {Management Science}, 30289 year = {1961}, 30290 volume = {7}, 30291 pages = {379--392} 30292} 30293 30294@Article{ grinold:mathematical, 30295 author = {R. C. Grinold}, 30296 title = {Mathematical Methods for {PA}ttern Classification}, 30297 journal = {Management Science}, 30298 year = {1972}, 30299 volume = {19}, 30300 pages = {272--289} 30301} 30302 30303@Article{ grippo.lampariello.ea:class, 30304 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30305 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 30306 journal = {Numerische Mathematik}, 30307 year = {1991}, 30308 volume = {59}, 30309 pages = {779--805} 30310} 30311 30312@Article{ grippo.lampariello.ea:global, 30313 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30314 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 30315 Without Derivatives}, 30316 journal = {Journal of Optimization Theory and Applications}, 30317 year = {1988}, 30318 volume = {56}, 30319 pages = {385--406} 30320} 30321 30322@Article{ grippo.lampariello.ea:nonmonotone, 30323 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30324 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 30325 journal = {SIAM Journal on Numerical Analysis}, 30326 year = {1986}, 30327 volume = {23}, 30328 pages = {707--716} 30329} 30330 30331@Misc{ grippo:private, 30332 author = {L. Grippo}, 30333 title = {Private Communication}, 30334 year = {1992}, 30335 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 30336} 30337 30338@Article{ grotschel.lovasz.ea:ellipsoid, 30339 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 30340 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 30341 journal = {Combinatorica}, 30342 year = {1981}, 30343 volume = {1}, 30344 pages = {169--197} 30345} 30346 30347@Article{ guignard:generalized, 30348 author = {M. Guignard}, 30349 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 30350 {B}anach Space}, 30351 journal = {SIAM Journal on Control and Optimization}, 30352 year = {1969}, 30353 volume = {7}, 30354 pages = {232--241} 30355} 30356 30357@Article{ guler.ye:convergence, 30358 author = {O. G{\"{u}}ler and Y. Ye}, 30359 title = {Convergence Behavior of Interior--Point Algorithms}, 30360 journal = {Mathematical Programming}, 30361 year = {1993}, 30362 volume = {60}, 30363 pages = {215--228} 30364} 30365 30366@Article{ guler:existence, 30367 author = {O. G{\"{u}}ler}, 30368 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 30369 Complementarity Problems}, 30370 journal = {Mathematics of Operations Research}, 30371 year = {1993}, 30372 volume = {18}, 30373 pages = {128--147} 30374} 30375 30376@Article{ guler:generalized, 30377 author = {O. G{\"{u}}ler}, 30378 title = {Generalized Linear Complementarity Problems}, 30379 journal = {Mathematics of Operations Research}, 30380 year = {1995}, 30381 volume = {20}, 30382 pages = {441--448} 30383} 30384 30385@Article{ gupta.sen:minimizing, 30386 author = {S. Gupta and T. Sen}, 30387 title = {Minimizing the Range of Lateness on a Single Machine}, 30388 journal = {Journal of the Operational Research Society}, 30389 year = {1984}, 30390 volume = {35}, 30391 pages = {853--857} 30392} 30393 30394@InCollection{ gustafson:numerical, 30395 author = {S.-\AA. Gustafson}, 30396 title = {On Numerical Analysis in Semi-Infinite Programming}, 30397 booktitle = {Semi-Infinite Programming}, 30398 year = {1979}, 30399 editor = {R. Hettich}, 30400 publisher = {Springer-Verlag}, 30401 address = {Berlin} 30402} 30403 30404@Article{ gustafsson.lind.ea:simultaneous, 30405 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 30406 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 30407 or compensation filters using a generalized pencil beam algorithm}, 30408 journal = {Medical Physics}, 30409 year = {1995}, 30410 volume = {22}, 30411 number = {7}, 30412 pages = {1141--1156} 30413} 30414 30415@PhDThesis{ ha:decomposition, 30416 author = {C. D. Ha}, 30417 title = {Decomposition Methods for Structured Convex Programming}, 30418 year = {1980}, 30419 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30420} 30421 30422@TechReport{ haakonsen.mathiesen:toward, 30423 author = {L. Haakonsen and L. Mathiesen}, 30424 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 30425 institution = {NHH, Bergen}, 30426 year = {1995}, 30427 type = {Discussion Paper}, 30428 number = {3/95} 30429} 30430 30431@Article{ haaland.norman.ea:vemod, 30432 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 30433 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 30434 journal = {Scandinavian Journal of Economics}, 30435 year = {1987} 30436} 30437 30438@Article{ haarhoff.buys:method, 30439 author = {P. C. Haarhoff and J. D. Buys}, 30440 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 30441 Constraints}, 30442 journal = {Computer Journal}, 30443 year = {1970}, 30444 volume = {12}, 30445 pages = {178--184} 30446} 30447 30448@Article{ habetler.kostreva:direct, 30449 author = {G. J. Habetler and M. M. Kostreva}, 30450 title = {On a direct algorithm for nonlinear complementarity problems}, 30451 journal = {SIAM Journal on Control and Optimization}, 30452 volume = {16}, 30453 year = {1978}, 30454 pages = {504--511} 30455} 30456 30457@Book{ hadamard:cauchys, 30458 author = {J. Hadamard}, 30459 title = {Cauchy's Problem in Linear Partial Differential Equations}, 30460 year = {1923}, 30461 publisher = {Yale University Press} 30462} 30463 30464@Article{ haddock.mittenthal:simulation, 30465 author = {J. Haddock and J. Mittenthal}, 30466 title = {Simulation optimization using simulated annealing}, 30467 journal = {Comput. Ind. Eng.}, 30468 year = {1992}, 30469 volume = {22}, 30470 pages = {387--395} 30471} 30472 30473@TechReport{ hamala:general, 30474 author = {M. Hamala}, 30475 title = {A General Approach to Interior Point Methods with Linear Parameter for 30476 Mathematical Programming}, 30477 institution = {Royal Institute of Technology}, 30478 year = {1978}, 30479 number = {1978--20}, 30480 type = {Department of Mathematics Paper TRITA--MAT} 30481} 30482 30483@Article{ han.mangasarian:dual, 30484 author = {S.--P. Han and O. L. Mangasarian}, 30485 title = {A Dual Differentiable Exact Penalty Function}, 30486 journal = {Mathematical Programming}, 30487 year = {1983}, 30488 volume = {25}, 30489 pages = {293--301} 30490} 30491 30492@Article{ han.mangasarian:exact, 30493 author = {S.--P. Han and O. L. Mangasarian}, 30494 title = {Exact Penalty Functions in Nonlinear Programming}, 30495 journal = {Mathematical Programming}, 30496 year = {1979}, 30497 volume = {17}, 30498 pages = {251--269} 30499} 30500 30501@Article{ han.pang.ea:globally, 30502 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 30503 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 30504 journal = {Mathematics of Operations Research}, 30505 year = {1992}, 30506 volume = {17}, 30507 pages = {586--607} 30508} 30509 30510@Article{ han:decomposition, 30511 author = {S.--P. Han}, 30512 title = {A Decomposition Method and its Application to Convex Programming}, 30513 journal = {Mathematics of Operations Research}, 30514 year = {1989}, 30515 volume = {14}, 30516 pages = {237--248} 30517} 30518 30519@Article{ han:globally, 30520 author = {S.--P. Han}, 30521 title = {A Globally Convergent Method for Nonlinear Programming}, 30522 journal = {Journal of Optimization Theory and Applications}, 30523 year = {1977}, 30524 volume = {22}, 30525 pages = {297--309} 30526} 30527 30528@Article{ han:superlinearly, 30529 author = {S.--P. Han}, 30530 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 30531 Programming Problems}, 30532 journal = {Mathematical Programming}, 30533 year = {1976}, 30534 volume = {11}, 30535 pages = {263--282} 30536} 30537 30538@Article{ hansen.koopmans:definition, 30539 author = {T. Hansen and T. C. Koopmans}, 30540 title = {On the Definition and Computation of a Capital Stock Invariant Under 30541 Optimization}, 30542 journal = {Journal of Economic Theory}, 30543 year = {1972}, 30544 volume = {5}, 30545 pages = {487--523} 30546} 30547 30548@InCollection{ harker.pang:damped, 30549 author = {P. T. Harker and J. S. Pang}, 30550 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 30551 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 30552 publisher = {AMS}, 30553 year = {1990}, 30554 editor = {E. L. Allgower and K. Georg}, 30555 number = {26}, 30556 series = {Lectures on Applied Mathematics}, 30557 address = {Providence, Rhode Island}, 30558 pages = {265--284} 30559} 30560 30561@Article{ harker.pang:existence, 30562 author = {P. T. Harker and J. S. Pang}, 30563 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 30564 Constraints}, 30565 journal = {Operations Research Letters}, 30566 year = {1988}, 30567 volume = {7}, 30568 pages = {61--64} 30569} 30570 30571@Article{ harker.pang:finite-dimensional, 30572 author = {P. T. Harker and J. S. Pang}, 30573 title = {Finite--dimensional variational inequality and nonlinear complementarity 30574 problems: {A} survey of theory, algorithms and applications}, 30575 journal = {Mathematical Programming}, 30576 year = {1990}, 30577 volume = {48}, 30578 pages = {161--220} 30579} 30580 30581@Article{ harker.xiao:newtons, 30582 author = {P. T. Harker and B. Xiao}, 30583 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 30584 {B}--Differentiable Equation Approach}, 30585 journal = {Mathematical Programming}, 30586 year = {1990}, 30587 volume = {48}, 30588 pages = {339--358} 30589} 30590 30591@Article{ harker:accelerating, 30592 author = {P. T. Harker}, 30593 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 30594 Finite--Dimensional Variational Inequalities}, 30595 journal = {Mathematical Programming}, 30596 year = {1988}, 30597 volume = {41}, 30598 pages = {29--50} 30599} 30600 30601@Article{ harker:generalized, 30602 author = {P. T. Harker}, 30603 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 30604 journal = {European Journal of Operations Research}, 30605 volume = {54}, 30606 pages = {81--94}, 30607 year = {1987} 30608} 30609 30610@Book{ harker:lectures, 30611 author = {P. T. Harker}, 30612 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 30613 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 30614 year = {1993}, 30615 series = {CORE Lecture Series} 30616} 30617 30618@Article{ harris:pivot, 30619 author = {P. M. J. Harris}, 30620 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 30621 journal = {Mathematical Programming}, 30622 year = {1973}, 30623 volume = {5}, 30624 pages = {1--28} 30625} 30626 30627@InCollection{ harrison.kristrom:carbon, 30628 author = {G. W. Harrison and B. Kristrom}, 30629 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 30630 booktitle = {Environment and Transport in Economic Modelling}, 30631 publisher = {Kluwer Academic Publishers}, 30632 year = {1997}, 30633 editor = {R. Roson and K. A. Small}, 30634 address = {Amsterdam} 30635} 30636 30637@Article{ harrison.rutherford.ea:increased, 30638 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30639 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 30640 journal = {Journal of Economic Integration}, 30641 year = {1996}, 30642 volume = {11}, 30643 pages = {332--365} 30644} 30645 30646@Article{ harrison.rutherford.ea:liberalizing, 30647 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 30648 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 30649 journal = {Journal of Policy Modeling}, 30650 year = {1995}, 30651 volume = {17} 30652} 30653 30654@Article{ harrison.rutherford.ea:quantifying, 30655 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30656 title = {Quantifying the {U}ruguay Round}, 30657 journal = {Finance and Development}, 30658 year = {1995}, 30659 volume = {32}, 30660 pages = {38--41} 30661} 30662 30663@InProceedings{ harrison.rutherford.ea:quantifying*1, 30664 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30665 title = {Quantifying the {U}ruguay Round}, 30666 year = {1996}, 30667 booktitle = {The {U}ruguay Round and the Developing Economies}, 30668 address = {New York}, 30669 editors = {W. Martin and L. A. Winters}, 30670 publisher = {Cambridge University Press} 30671} 30672 30673@Article{ harrison.rutherford.ea:quantifying*2, 30674 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30675 title = {Quantifying the {U}ruguay Round}, 30676 journal = {The Economic Journal}, 30677 year = {1997}, 30678 volume = {107}, 30679 pages = {1405--1430} 30680} 30681 30682@Article{ harrison.rutherford.ea:trade, 30683 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30684 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 30685 journal = {The World Bank Economic Review}, 30686 year = {1993}, 30687 volume = {7}, 30688 pages = {191--217} 30689} 30690 30691@Article{ hartman.stampacchia:nonlinear, 30692 author = {P. Hartman and G. Stampacchia}, 30693 title = {On some nonlinear differential-functional equations}, 30694 journal = {Acta Mathematica}, 30695 year = {1966}, 30696 volume = {115}, 30697 pages = {271--310} 30698} 30699 30700@Book{ harvey:forecasting, 30701 author = {Andrew C. Harvey}, 30702 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 30703 publisher = {Cambridge University Press}, 30704 address = {New York, NY}, 30705 year = {1989} 30706} 30707 30708@Article{ haurie.marcotte:relationship, 30709 author = {A. Haurie and P. Marcotte}, 30710 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 30711 journal = {Networks}, 30712 year = {1985}, 30713 volume = {15}, 30714 pages = {295--308} 30715} 30716 30717@Article{ hearn.lawphongpanich.ea:restricted, 30718 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 30719 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 30720 journal = {Mathematical Programming Study}, 30721 year = {1987}, 30722 volume = {31}, 30723 pages = {99--118} 30724} 30725 30726@Article{ hearn:gap, 30727 author = {D. W. Hearn}, 30728 title = {The Gap Function of a Convex Program}, 30729 journal = {Operations Research Letters}, 30730 year = {1982}, 30731 volume = {1}, 30732 pages = {67--71} 30733} 30734 30735@Article{ hedlund.gustavsson:design, 30736 author = {P. Hedlund and A. Gustavsson}, 30737 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 30738 Ability}, 30739 journal = {Analytica Chimica Acta}, 30740 year = {1992}, 30741 volume = {259}, 30742 pages = {243--256} 30743} 30744 30745@Article{ helgason.kennington.ea:parallelization, 30746 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 30747 title = {A Parallelization of the Simplex Method}, 30748 journal = {Annals of Operations Research}, 30749 year = {1988}, 30750 volume = {14}, 30751 pages = {17--40} 30752} 30753 30754@Article{ helgason.kennington.ea:polynomially, 30755 author = {Richard Helgason and James Kennington and H. Lall}, 30756 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 30757 journal = {Mathematical Programming}, 30758 year = {1980}, 30759 volume = {18}, 30760 pages = {338--343} 30761} 30762 30763@Book{ henderson.quandt:microeconomic, 30764 author = {J. M. Henderson and R. E. Quandt}, 30765 title = {Microeconomic Theory}, 30766 publisher = {McGraw--Hill}, 30767 address = {New York}, 30768 year = {1980}, 30769 edition = {Third} 30770} 30771 30772@TechReport{ hendrickson.leland:chaco, 30773 author = {B. Hendrickson and R. Leland}, 30774 title = {The {C}haco User's Guide: Version 2}, 30775 institution = {Sandia National Laboratories}, 30776 type = {Technical Report}, 30777 number = {SAND94-2692}, 30778 address = {Albuquerque, New Mexico}, 30779 year = {1994} 30780} 30781 30782@InProceedings{ hendrickson.leland:multilevel, 30783 author = {B. Hendrickson and R. Leland}, 30784 title = {A Multilevel Algorithm for Partitioning Graphs}, 30785 booktitle = {Proceedings of Supercomputing '95}, 30786 year = {1995} 30787} 30788 30789@Book{ hertz.krogh.ea:introduction, 30790 author = {J. Hertz and A. Krogh and R. G. Palmer}, 30791 title = {Introduction to the Theory of Neural Computation}, 30792 year = {1991}, 30793 publisher = {Addison-Wesley}, 30794 address = {Redwood City, California} 30795} 30796 30797@Article{ hertz.werra:tabu, 30798 author = {A. Hertz and D. de Werra}, 30799 title = {Using {T}abu Search techniques for Graph Coloring}, 30800 journal = {Computing}, 30801 year = {1987}, 30802 volume = {29}, 30803 pages = {345--351} 30804} 30805 30806@InCollection{ hettich:review, 30807 author = {R. Hettich}, 30808 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 30809 booktitle = {Semi-Infinite Programming and Applications}, 30810 year = {1983}, 30811 editor = {A. V. Fiacco and K. O. Kortanek}, 30812 publisher = {Springer-Verlag}, 30813 address = {Berlin} 30814} 30815 30816@Article{ highleyman:note, 30817 author = {W. H. Highleyman}, 30818 title = {A Note on Linear Separation}, 30819 journal = {IRE Transactions on Electronic Computers}, 30820 year = {1961}, 30821 volume = {10}, 30822 pages = {777--778} 30823} 30824 30825@Article{ hildreth:quadratic, 30826 author = {C. Hildreth}, 30827 title = {A Quadratic Programming Procedure}, 30828 journal = {Naval Research Logistics Quarterly}, 30829 year = {1957}, 30830 volume = {4}, 30831 pages = {79--85}, 30832 note = {Erratum, p. 361} 30833} 30834 30835@Book{ himmelblau:applied, 30836 author = {D. M. Himmelblau}, 30837 title = {Applied Nonlinear Programming}, 30838 year = {1972}, 30839 publisher = {McGraw--Hill}, 30840 address = {New York} 30841} 30842 30843@Book{ hiriart-urruty.lemarechal:convex, 30844 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 30845 title = {Convex Analysis and Minimization Algorithms {I}}, 30846 year = {1993}, 30847 publisher = {Springer Verlag}, 30848 address = {Berlin}, 30849 volume = {305}, 30850 series = {Grundlehren der mathematischen Wissenschaften} 30851} 30852 30853@TechReport{ hironaka:introduction, 30854 author = {H. Hironaka}, 30855 title = {Introduction to real-analytic sets and real-analytic maps}, 30856 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 30857 year = {1973}, 30858 type = {Technical Report}, 30859 address = {Pisa, Italy} 30860} 30861 30862@Article{ ho.lee.ea:decomposition, 30863 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 30864 title = {Decomposition of Linear Programs Using Parallel Computation}, 30865 journal = {Mathematical Programming}, 30866 year = {1988}, 30867 volume = {42}, 30868 pages = {391--405} 30869} 30870 30871@Article{ ho.loute:computational, 30872 author = {J. K. Ho and E. Loute}, 30873 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 30874 for Linear Programming}, 30875 journal = {Mathematical Programming}, 30876 year = {1983}, 30877 volume = {27}, 30878 pages = {283--290} 30879} 30880 30881@Book{ hock.schittkowski:test, 30882 author = {W. Hock and K. Schittkowski}, 30883 title = {Test Examples for Nonlinear Programming Codes}, 30884 volume = {187}, 30885 series = {Lecture Notes in Economics and Mathematical Systems}, 30886 year = {1981}, 30887 publisher = {Springer Verlag}, 30888 address = {Berlin, Germany} 30889} 30890 30891@Book{ hockney.jesshope:parallel, 30892 author = {R. W. Hockney and C. R. Jesshope}, 30893 title = {Parallel Computers 2}, 30894 publisher = {Adam Hilger}, 30895 year = {1988}, 30896 address = {Bristol} 30897} 30898 30899@Article{ hoffman:approximate, 30900 author = {A. J. Hoffman}, 30901 title = {On Approximate Solutions of Systems of Linear Inequalities}, 30902 journal = {Journal of Research of the National Bureau of Standards}, 30903 year = {1952}, 30904 volume = {49}, 30905 pages = {263--265} 30906} 30907 30908@Article{ hogan:comments, 30909 author = {W. W. Hogan}, 30910 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 30911 for the {USA}}, 30912 journal = {The Energy Journal}, 30913 year = {1990}, 30914 volume = {11}, 30915 pages = {75--84} 30916} 30917 30918@Article{ hogan:energy, 30919 author = {W. W. Hogan}, 30920 title = {Energy Policy Models for {P}roject {I}ndependence}, 30921 journal = {Computers \& Operations Research}, 30922 year = {1975}, 30923 volume = {2}, 30924 pages = {251--271} 30925} 30926 30927@Book{ holland:adaptation, 30928 author = {J. Holland}, 30929 title = {Adaptation in Natural and Artificial Systems}, 30930 year = {1975}, 30931 publisher = {The University of Michigan Press}, 30932 address = {Ann Arbor, Michigan} 30933} 30934 30935@Article{ holmes.mackie:comparison, 30936 author = {T. Holmes and T. R. Mackie}, 30937 title = {A comparison of three inverse treatment planning algorithms}, 30938 journal = {Physics in Medicine and Biology}, 30939 year = {1994}, 30940 volume = {39}, 30941 number = {1}, 30942 pages = {91--106} 30943} 30944 30945@Article{ holmes.mackie:filtered, 30946 author = {T. Holmes and T. R. Mackie}, 30947 title = {A filtered backprojection dose calculation method for inverse treatment 30948 planning}, 30949 journal = {Medical Physics}, 30950 year = {1994}, 30951 volume = {21}, 30952 number = {2}, 30953 pages = {303--313} 30954} 30955 30956@Article{ hooke.jeeves:direct, 30957 author = {R. Hooke and T. A. Jeeves}, 30958 title = {Direct Search Solution of Numerical and Statistical Problems}, 30959 journal = {Journal of Associated Computing Machinery}, 30960 year = {1961}, 30961 volume = {8}, 30962 pages = {212--229} 30963} 30964 30965@Article{ hoppe.mittelmann:multi-grid, 30966 author = {R. H. W. Hoppe and H. D. Mittelmann}, 30967 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 30968 Inequalities}, 30969 journal = {Journal of Computational and Applied Mathematics}, 30970 year = {1989}, 30971 volume = {26}, 30972 pages = {35--46} 30973} 30974 30975@Book{ horn.johnson:matrix, 30976 author = {R. A. Horn and C. R. Johnson}, 30977 title = {Matrix Anaysis}, 30978 publisher = {Cambridge University Press}, 30979 year = {1985}, 30980 address = {Cambridge, England} 30981} 30982 30983@Article{ hornik.stinchcombe.ea:multilayer, 30984 author = {K. Hornik and M. Stinchcombe and H. White}, 30985 title = {Multilayer Feedforward Networks are Universal Approximators}, 30986 journal = {Neural Networks}, 30987 year = {1989}, 30988 volume = {2}, 30989 pages = {359--366} 30990} 30991 30992@Article{ horowitz.sahni:computing, 30993 author = {E. Horowitz and S. Sahni}, 30994 title = {Computing Partitions with Applications to the Knapsack Problem}, 30995 journal = {jacm}, 30996 year = {1974}, 30997 volume = {21}, 30998 pages = {277--292} 30999} 31000 31001@Article{ hristov.fallone:continuous, 31002 author = {D. H. Hristov and B. G. Fallone}, 31003 title = {A continuous penalty function method for inverse treatment planning}, 31004 journal = {Medical Physics}, 31005 year = {1998}, 31006 volume = {25}, 31007 number = {2}, 31008 pages = {208--223} 31009} 31010 31011@Article{ hu.cheng.ea:numerical, 31012 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 31013 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 31014 analysis}, 31015 journal = {Transactions of the {ASME}}, 31016 volume = {116}, 31017 year = {1994}, 31018 pages = {470--478} 31019} 31020 31021@InProceedings{ hua.sheu:skyscraper, 31022 author = {K. A. Hua and S. Sheu}, 31023 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 31024 Video-On-Demand Systems}, 31025 year = {1997}, 31026 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 31027 address = {Cannes, France}, 31028 pages = {89--100} 31029} 31030 31031@Article{ huang.pang:option, 31032 author = {J. Huang and J. S. Pang}, 31033 title = {Option Pricing and Linear Complementarity}, 31034 journal = {Journal of Computational Finance}, 31035 volume = {2}, 31036 year = {1998}, 31037 pages = {31--60} 31038} 31039 31040@InCollection{ huard:resolution, 31041 author = {P. Huard}, 31042 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 31043 of Centers}, 31044 booktitle = {Nonlinear Programming}, 31045 year = {1967}, 31046 editor = {J. Abadie}, 31047 publisher = {North--Holland}, 31048 address = {Amsterdam}, 31049 pages = {207--219} 31050} 31051 31052@Book{ huber:robust, 31053 author = {P. J. Huber}, 31054 title = {Robust Statistics}, 31055 year = {1981}, 31056 publisher = {John Wiley}, 31057 address = {New York} 31058} 31059 31060@Book{ hudson:piecewise, 31061 author = {J. F. P. Hudson}, 31062 title = {Piecewise Linear Topology}, 31063 publisher = {Benjamin}, 31064 address = {New York}, 31065 year = {1969} 31066} 31067 31068@InCollection{ hunter.markusen.ea:north, 31069 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 31070 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 31071 booktitle = {Modeling North American Economic Integration}, 31072 publisher = {Kluwer Academic Publishers}, 31073 year = {1995}, 31074 editor = {T. Kehoe and P. Kehoe}, 31075 pages = {117--130} 31076} 31077 31078@Article{ ibarra.kim:fast, 31079 author = {O. H. Ibarra and C. E. Kim}, 31080 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 31081 journal = {jacm}, 31082 year = {1975}, 31083 volume = {22}, 31084 pages = {463--468} 31085} 31086 31087@Article{ ijiri:fundamental, 31088 author = {Y. Ijiri}, 31089 title = {Fundamental Queries in Aggregation Theory}, 31090 journal = {Journal of the American Statistical Association}, 31091 year = {1971}, 31092 volume = {66}, 31093 pages = {766--782} 31094} 31095 31096@Article{ ingargiola.korsh:reduction, 31097 author = {G. P. Ingargiola and J. F. Korsh}, 31098 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 31099 journal = {Management Science}, 31100 year = {1973}, 31101 volume = {20}, 31102 pages = {460--463} 31103} 31104 31105@Article{ ioffe:variational, 31106 author = {A. D. Ioffe}, 31107 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 31108 Second--Order Directional Derivative}, 31109 journal = {Journal of Mathematical Analysis and its Applications}, 31110 year = {1993} 31111} 31112 31113@Article{ iri.imai:multiplicative, 31114 author = {M. Iri and H. Imai}, 31115 title = {A Multiplicative Barrier Function Method for Linear Programming}, 31116 journal = {Algorithmica}, 31117 year = {1986}, 31118 volume = {1}, 31119 pages = {455--482} 31120} 31121 31122@Article{ isac.goeleven:implicit, 31123 author = {G. Isac and D. Goeleven}, 31124 title = {The Implicit General Order Complementarity Problem, Models and Iterative 31125 Methods}, 31126 journal = {Annals of Operations Research}, 31127 year = {1993} 31128} 31129 31130@Article{ isac.kostreva:generalized, 31131 author = {G. Isac and M. M. Kostreva}, 31132 title = {The Generalized Order Complementarity Problem}, 31133 journal = {Journal of Optimization Theory and Applications}, 31134 volume = {19}, 31135 pages = {227--232}, 31136 year = {1991} 31137} 31138 31139@Book{ isac:complementarity, 31140 author = {G. Isac}, 31141 title = {Complementarity Problems}, 31142 publisher = {Springer-Verlag}, 31143 year = {1992}, 31144 series = {Lecture Notes in Mathematics}, 31145 address = {New York} 31146} 31147 31148@Article{ iusem.svaiter:variant, 31149 author = {A. N. Iusem and B. F. Svaiter}, 31150 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 31151 Search Strategy}, 31152 journal = {Optimization}, 31153 year = {1997}, 31154 volume = {42}, 31155 pages = {309--321} 31156} 31157 31158@Article{ iusem:convergence, 31159 author = {A. N. Iusem}, 31160 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 31161 Problems}, 31162 journal = {Mathematical Programming}, 31163 year = {1993}, 31164 volume = {59}, 31165 pages = {33--48} 31166} 31167 31168@Article{ jackson.kutcher.ea:probability, 31169 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 31170 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 31171 Architecture subject to Non-Uniform Irradiation}, 31172 journal = {Medical Physics}, 31173 year = {1993}, 31174 volume = {20}, 31175 pages = {613--625} 31176} 31177 31178@Article{ jackson:optimization, 31179 author = {A. Jackson and X. H. Wang and R. Mohan}, 31180 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 31181 (abstract)}, 31182 journal = {Medical Physics}, 31183 year = {1994}, 31184 volume = {21}, 31185 pages = {1006} 31186} 31187 31188@TechReport{ jackson:scheduling, 31189 author = {J. R. Jackson}, 31190 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 31191 institution = {University of California}, 31192 year = {1955}, 31193 address = {Los Angeles}, 31194 number = {43}, 31195 type = {Research Report} 31196} 31197 31198@Article{ jansen.roos.ea:polynomiality, 31199 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 31200 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 31201 Complementarity Problems}, 31202 journal = {Mathematical Programming}, 31203 volume = {78}, 31204 pages = {315--346}, 31205 year = {1997} 31206} 31207 31208@Article{ jiang.fukushima.ea:trust, 31209 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 31210 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 31211 journal = {SIAM Journal on Optimization}, 31212 volume = {8}, 31213 pages = {140--157}, 31214 year = {1998} 31215} 31216 31217@Article{ jiang.qi:nonsmooth, 31218 author = {H. Jiang and L. Qi}, 31219 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 31220 journal = {SIAM Journal on Control and Optimization}, 31221 volume = {35}, 31222 pages = {178--193}, 31223 year = {1997} 31224} 31225 31226@TechReport{ jiang.ralph:qpecgen, 31227 author = {H. Jiang and D. Ralph}, 31228 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 31229 Objectives and Affine Variational Inequality Constraints}, 31230 year = {1997}, 31231 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31232 address = {Australia} 31233} 31234 31235@TechReport{ jiang.ralph:smooth, 31236 author = {H. Jiang and D. Ralph}, 31237 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 31238 Constraints}, 31239 year = {1997}, 31240 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 31241 address = {Australia} 31242} 31243 31244@Article{ jiang:unconstrained, 31245 author = {H. Jiang}, 31246 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 31247 journal = {Journal of Global Optimization, forthcoming}, 31248 year = {1997} 31249} 31250 31251@Article{ jittorntrum.osborne:strong, 31252 author = {K. Jittorntrum and M. R. Osborne}, 31253 title = {Strong uniqueness and second order convergence in nonlinear discrete 31254 approximation}, 31255 journal = {Numerische Mathematik}, 31256 year = {1980}, 31257 volume = {34}, 31258 pages = {439--455} 31259} 31260 31261@InProceedings{ jog.suh.ea:effects, 31262 crossref = {schaeffer:third}, 31263 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31264 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 31265 Genetic Algorithm for the Travelling Salesman Problem}, 31266 pages = {110--115} 31267} 31268 31269@Article{ jog.suh.ea:parallel, 31270 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31271 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 31272 journal = {SIAM Journal on Optimization}, 31273 year = {1991}, 31274 volume = {1} 31275} 31276 31277@Article{ johansson.klarbring:rigid, 31278 author = {L. Johansson and A. Klarbring}, 31279 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 31280 Complementarity}, 31281 journal = {Mechanics of Structures \& Machines}, 31282 volume = {20}, 31283 pages = {293--319}, 31284 year = {1992} 31285} 31286 31287@Article{ johnson.aragon.ea:optimization, 31288 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 31289 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 31290 Partitioning}, 31291 journal = {Operations Research}, 31292 year = {1989}, 31293 volume = {37}, 31294 pages = {865--892} 31295} 31296 31297@Article{ johnson:optimally, 31298 author = {R. Johnson}, 31299 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 31300 journal = {Management Science}, 31301 year = {1988}, 31302 volume = {34}, 31303 pages = {240--253} 31304} 31305 31306@Article{ johnsson:solving, 31307 author = {S. L. Johnsson}, 31308 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 31309 journal = {SIAM Journal on Scientific and Statistical Computing}, 31310 year = {1987}, 31311 volume = {8}, 31312 pages = {475--489} 31313} 31314 31315@Article{ jorgenson.wilcoxen:reducing, 31316 author = {D. W. Jorgenson and P. J. Wilcoxen}, 31317 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 31318 journal = {Resource and Energy Economics}, 31319 year = {1993}, 31320 volume = {15}, 31321 pages = {7--25} 31322} 31323 31324@TechReport{ josephy:hogans, 31325 author = {N. H. Josephy}, 31326 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 31327 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31328 year = {1979}, 31329 address = {Madison, Wisconsin}, 31330 number = {1972}, 31331 type = {Technical Summary Report} 31332} 31333 31334@TechReport{ josephy:newton, 31335 author = {N. H. Josephy}, 31336 title = {A {N}ewton Method for the {PIES} Energy Model}, 31337 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31338 year = {1979}, 31339 address = {Madison, Wisconsin}, 31340 number = {1971}, 31341 type = {Technical Summary Report} 31342} 31343 31344@PhDThesis{ josephy:newtons, 31345 author = {N. H. Josephy}, 31346 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 31347 year = {1979}, 31348 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 31349} 31350 31351@TechReport{ josephy:newtons*1, 31352 author = {N. H. Josephy}, 31353 title = {{N}ewton's Method for Generalized Equations}, 31354 institution = {Mathematics Research Center, University of Wisconsin}, 31355 year = {1979}, 31356 address = {Madison, Wisconsin}, 31357 number = {1965}, 31358 type = {Technical Summary Report} 31359} 31360 31361@TechReport{ josephy:quasi-newton, 31362 author = {N. H. Josephy}, 31363 title = {Quasi--{N}ewton Methods for Generalized Equations}, 31364 institution = {Mathematics Research Center, University of Wisconsin}, 31365 year = {1979}, 31366 address = {Madison, Wisconsin}, 31367 number = {1966}, 31368 type = {Technical Summary Report} 31369} 31370 31371@PhDThesis{ kabbadj:methodes, 31372 author = {S. Kabbadj}, 31373 title = {Methodes Proximales Entropiques}, 31374 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 31375 year = {1994}, 31376 type = {Doctoral Thesis} 31377} 31378 31379@Book{ kall.wallace:stochastic, 31380 author = {P. Kall and S. W. Wallace}, 31381 title = {Stochastic Programming}, 31382 publisher = {John Wiley \& Sons}, 31383 year = {1994}, 31384 address = {Chichester} 31385} 31386 31387@Article{ kallman.agren.ea:tumor, 31388 author = {P. Kallman and A. Agren and A. Brahme}, 31389 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 31390 journal = {International Journal of Radiation Biology}, 31391 year = {1992}, 31392 volume = {62}, 31393 pages = {249--262} 31394} 31395 31396@Misc{ kalvelagen:gams, 31397 author = {Erwin Kalvelagen}, 31398 title = {The {GAMS} {I/O} Library}, 31399 howpublished = {mimeo, GAMS Development Corporation}, 31400 year = {1992}, 31401 note = {Preliminary Version} 31402} 31403 31404@Article{ kaneko:complete, 31405 author = {I. Kaneko}, 31406 title = {Complete solution of a class of elastic-plastic structures}, 31407 journal = {Computer Methods in Applied Mechanics and Engineering}, 31408 volume = {21}, 31409 year = {1980}, 31410 pages = {193--209} 31411} 31412 31413@Article{ kaneko:mathematical, 31414 author = {I. Kaneko}, 31415 title = {A mathematical programming method for the inelastic analysis of reinforced 31416 concrete frames}, 31417 journal = {International Journal for Numerical Methods in Engineering}, 31418 volume = {11}, 31419 year = {1977}, 31420 pages = {1137--1154} 31421} 31422 31423@Article{ kaneko:piecewise, 31424 author = {I. Kaneko}, 31425 title = {Piecewise linear elastic-plastic analysis}, 31426 journal = {International Journal for Numerical Methods in Engineering}, 31427 volume = {14}, 31428 year = {1979}, 31429 pages = {757--767} 31430} 31431 31432@Article{ kanet:minimizing, 31433 author = {J. J. Kanet}, 31434 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 31435 Date}, 31436 journal = {Naval Research Logistics Quarterly}, 31437 year = {1981}, 31438 volume = {28}, 31439 pages = {643--651} 31440} 31441 31442@Article{ kantorovich:mathematical, 31443 author = {L. V. Kantorovich}, 31444 title = {Mathematical Methods in the Organization and Planning of Production}, 31445 journal = {Management Science}, 31446 year = {1960}, 31447 volume = {6}, 31448 pages = {366--422}, 31449 note = {English translation, Russian version 1939} 31450} 31451 31452@Article{ kanzow.fukushima:equivalence, 31453 author = {C. Kanzow and M. Fukushima}, 31454 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 31455 Unconstrained Minimization}, 31456 journal = {Journal of Optimization Theory and Applications}, 31457 year = {1996}, 31458 volume = {90}, 31459 pages = {581--603} 31460} 31461 31462@Article{ kanzow.fukushima:theoretical, 31463 author = {C. Kanzow and M. Fukushima}, 31464 title = {Theoretical and Numerical Investigation of the {D}-gap function for 31465 Box-Constrained Variational Inequalities}, 31466 journal = {Mathematical Programming}, 31467 year = {1998}, 31468 volume = {83}, 31469 pages = {55--88} 31470} 31471 31472@Article{ kanzow.jiang:continuation, 31473 author = {C. Kanzow and H. Jiang}, 31474 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 31475 journal = {Mathematical Programming}, 31476 year = {1998}, 31477 volume = {81}, 31478 pages = {103--125} 31479} 31480 31481@Article{ kanzow.kleinmichel:class, 31482 author = {C. Kanzow and H. Kleinmichel}, 31483 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 31484 Optimization}, 31485 journal = {Optimization Methods and Software}, 31486 year = {1995}, 31487 volume = {5}, 31488 pages = {173--198} 31489} 31490 31491@Article{ kanzow.kleinmichel:new, 31492 author = {C. Kanzow and H. Kleinmichel}, 31493 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 31494 Problems}, 31495 journal = {Computational Optimization and Applications}, 31496 volume = {11}, 31497 pages = {227--251}, 31498 year = {1998} 31499} 31500 31501@Article{ kanzow.pieper:jacobian, 31502 author = {C. Kanzow and H. Pieper}, 31503 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 31504 journal = {SIAM Journal on Optimization}, 31505 year = {1999}, 31506 volume = {9}, 31507 pages = {342--373} 31508} 31509 31510@Article{ kanzow.qi:qp-free, 31511 author = {C. Kanzow and H. -D. Qi}, 31512 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 31513 problems}, 31514 journal = {Mathematical Programming}, 31515 year = {1999}, 31516 volume = {85}, 31517 pages = {81--106} 31518} 31519 31520@Article{ kanzow.yamashita.ea:ncp-functions, 31521 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 31522 title = {New {NCP}-functions and their properties}, 31523 journal = {Journal of Optimization Theory and Applications}, 31524 year = {1997}, 31525 volume = {94}, 31526 pages = {115--135} 31527} 31528 31529@TechReport{ kanzow.zupke:inexact, 31530 author = {C. Kanzow and M. Zupke}, 31531 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 31532 year = {1997}, 31533 institution = {Institute of Applied Mathematics, University of Hamburg}, 31534 type = {Preprint}, 31535 number = {127}, 31536 address = {Hamburg, Germany} 31537} 31538 31539@Article{ kanzow:approach, 31540 author = {C. Kanzow}, 31541 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 31542 {P}-Functions}, 31543 journal = {Operations Research Letters}, 31544 volume = {20}, 31545 year = {1997}, 31546 pages = {85--92} 31547} 31548 31549@Article{ kanzow:equation-based, 31550 author = {C. Kanzow}, 31551 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 31552 journal = {Optimization Methods and Software}, 31553 year = {1994}, 31554 volume = {3}, 31555 pages = {327--340} 31556} 31557 31558@Article{ kanzow:global, 31559 author = {C. Kanzow}, 31560 title = {Global Convergence Properties of Some Iterative Methods for Linear 31561 Complementarity Problems}, 31562 journal = {SIAM Journal on Optimization}, 31563 year = {1996}, 31564 volume = {6}, 31565 pages = {326--341} 31566} 31567 31568@Article{ kanzow:inexact, 31569 author = {C. Kanzow}, 31570 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 31571 journal = {Numerische Mathematik, forthcoming}, 31572 year = {1999} 31573} 31574 31575@Article{ kanzow:noninterior, 31576 author = {C. Kanzow}, 31577 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 31578 journal = {SIAM Journal on Matrix Analysis and Applications}, 31579 volume = {17}, 31580 pages = {851--868}, 31581 year = {1996} 31582} 31583 31584@Article{ kanzow:nonlinear, 31585 author = {C. Kanzow}, 31586 title = {Nonlinear Complementarity as Unconstrained Optimization}, 31587 journal = {Journal of Optimization Theory and Applications}, 31588 year = {1996}, 31589 volume = {88}, 31590 pages = {139--155} 31591} 31592 31593@TechReport{ kanzow:semismooth, 31594 author = {C. Kanzow}, 31595 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 31596 Problems}, 31597 institution = {Institute of Applied Mathematics, University of Hamburg}, 31598 year = {1997}, 31599 type = {Preprint}, 31600 address = {Hamburg, Germany} 31601} 31602 31603@TechReport{ kanzow:tools, 31604 annote = {This should be replaced by kanzow:noninterior}, 31605 author = {C. Kanzow}, 31606 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 31607 institution = {Institute of Applied Mathematics, University of Hamburg}, 31608 year = {1994}, 31609 address = {Germany} 31610} 31611 31612@Article{ kaplan.meier:nonparametric, 31613 author = {E. L. Kaplan and P. Meier}, 31614 title = {Nonparametric Estimation from Incomplete Observations}, 31615 journal = {J. Am. Stat. Assoc.}, 31616 year = {1958}, 31617 volume = {53}, 31618 pages = {457--481} 31619} 31620 31621@Article{ karamardian:complementarity, 31622 author = {S. Karamardian}, 31623 title = {The Complementarity Problem}, 31624 journal = {Mathematical Programming}, 31625 year = {1972}, 31626 volume = {2}, 31627 pages = {107--129} 31628} 31629 31630@Article{ karamardian:complementarity*1, 31631 author = {S. Karamardian}, 31632 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 31633 journal = {Journal of Optimization Theory and Applications}, 31634 year = {1976}, 31635 volume = {18}, 31636 pages = {445--454} 31637} 31638 31639@Article{ karamardian:generalized, 31640 author = {S. Karamardian}, 31641 title = {Generalized Complementarity Problem}, 31642 journal = {Journal of Optimization Theory and Applications}, 31643 year = {1971}, 31644 volume = {8}, 31645 pages = {161--167} 31646} 31647 31648@Article{ karmarkar.karp.ea:probabilistic, 31649 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 31650 title = {Probabilistic Analysis of Optimum Partitioning}, 31651 journal = {Journal of Applied Probability}, 31652 year = {1986}, 31653 volume = {23}, 31654 pages = {626--645} 31655} 31656 31657@Article{ karmarkar:polynomial, 31658 author = {N. Karmarkar}, 31659 title = {A New Polynomial Time Algorithm for Linear Programming}, 31660 journal = {Combinatorica}, 31661 year = {1984}, 31662 volume = {4}, 31663 pages = {373--395} 31664} 31665 31666@Unpublished{ karp:probabilistic, 31667 author = {R. M. Karp}, 31668 title = {Probabilistic Analysis of Algorithms}, 31669 note = {(Lecture Notes)} 31670} 31671 31672@InCollection{ karp:reducibility, 31673 author = {R. M. Karp}, 31674 title = {Reducibility among Combinatorial Problems}, 31675 booktitle = {Complexity of Computer Computations}, 31676 year = {1972}, 31677 editor = {R. E. Miller and J. W. Thatcher}, 31678 publisher = {Plenum Press}, 31679 address = {New York}, 31680 pages = {85--103} 31681} 31682 31683@MastersThesis{ karush:minima, 31684 author = {W. Karush}, 31685 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 31686 year = {1939}, 31687 school = {Department of Mathematics, University of Chicago} 31688} 31689 31690@TechReport{ karypis.kumar:metis, 31691 author = {G. Karypis and V. Kumar}, 31692 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 31693 Version 2.0}, 31694 institution = {University of Minnesota, Department of Computer Science}, 31695 type = {Technical Report}, 31696 address = {Minnesota}, 31697 year = {1995} 31698} 31699 31700@TechReport{ karypis.kumar:multilevel, 31701 author = {G. Karypis and V. Kumar}, 31702 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 31703 institution = {University of Minnesota, Department of Computer Science}, 31704 type = {Technical Report}, 31705 number = {95-064}, 31706 address = {Minnesota}, 31707 year = {1995} 31708} 31709 31710@Article{ katukani:generalization, 31711 author = {S. Katukani}, 31712 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 31713 journal = {Duke Mathematical Journal}, 31714 year = {1941}, 31715 volume = {8}, 31716 pages = {457--459} 31717} 31718 31719@Article{ keifer.wolfowitz:stochastic, 31720 author = {J. Keifer and J. Wolfowitz}, 31721 title = {Stochastic Estimation of the Maximum of a Regression Function}, 31722 journal = {Annals of Mathematical Statistics}, 31723 year = {1952}, 31724 volume = {23}, 31725 pages = {462--466} 31726} 31727 31728@InCollection{ kellog.li.ea:method, 31729 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 31730 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 31731 booktitle = {Computing Fixed Points with Applications}, 31732 year = {1977}, 31733 editor = {S. Karamardian}, 31734 publisher = {Academic Press}, 31735 pages = {133--147} 31736} 31737 31738@Book{ kennington.helgason:algorithms, 31739 author = {J. L. Kennington and R. V. Helgason}, 31740 title = {Algorithms for Network Programming}, 31741 year = {1980}, 31742 publisher = {John Wiley \& Sons}, 31743 address = {New York} 31744} 31745 31746@Article{ kernighan.lin:efficient, 31747 author = {B. W. Kernighan and S. Lin}, 31748 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 31749 journal = {The Bell System Technical Journal}, 31750 pages = {291--307}, 31751 volume = {29}, 31752 year = {1970} 31753} 31754 31755@Article{ khachian:polynomial, 31756 author = {L. G. Khachian}, 31757 title = {A Polynomial Algorithm for Linear Programming}, 31758 journal = {Soviet Mathematics Doklady}, 31759 year = {1979}, 31760 volume = {20}, 31761 pages = {191--194} 31762} 31763 31764@Article{ khobotov:modification, 31765 author = {E. N. Khobotov}, 31766 title = {A Modification of the Extragradient Method for the Solution of Variational 31767 Inequalities and some Optimization Problems}, 31768 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 31769 year = {1987}, 31770 volume = {27}, 31771 pages = {1462--1473} 31772} 31773 31774@Book{ khuri.cornell:response, 31775 author = {A. I. Khuri and J. A. Cornell}, 31776 title = {Response Surfaces: Designs and Analyses}, 31777 publisher = {Marcel Dekker}, 31778 year = {1987}, 31779 address = {New York} 31780} 31781 31782@Article{ kibardin:decomposition, 31783 author = {V. M. Kibardin}, 31784 title = {Decomposition into Functions in the Minimization Problems}, 31785 journal = {Automation and Remote Control}, 31786 year = {1980}, 31787 volume = {40}, 31788 pages = {1311--1323} 31789} 31790 31791@TechReport{ king:sposl, 31792 author = {A. J. King}, 31793 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 31794 institution = {IBM T.J. Watson Research Center}, 31795 year = {1994}, 31796 number = {RC 19757}, 31797 address = {Yorktown Heights, New York} 31798} 31799 31800@Article{ kirkpatrick.gelatt.ea:optimization, 31801 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 31802 title = {Optimization by Simulated Annealing}, 31803 journal = {Science}, 31804 year = {1983}, 31805 volume = {220}, 31806 pages = {671--680} 31807} 31808 31809@Book{ kiwiel:methods, 31810 author = {K. C. Kiwiel}, 31811 title = {Methods of Descent for Nondifferentiable Optimization}, 31812 year = {1985}, 31813 publisher = {Springer-Verlag}, 31814 address = {Berlin}, 31815 series = {Lecture Notes in Mathematics}, 31816 number = {1133} 31817} 31818 31819@Article{ kiwiel:twice, 31820 author = {K. C. Kiwiel}, 31821 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 31822 journal = {Journal of Optimization Theory and Applications}, 31823 year = {1996}, 31824 volume = {88}, 31825 pages = {233--236} 31826} 31827 31828@Article{ klarbring.bjorkman:mathematical, 31829 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31830 title = {A mathematical programming approach to contact problems with friction and varying 31831 contact surface}, 31832 journal = {Computers \& Structures}, 31833 volume = {30}, 31834 year = {1988}, 31835 pages = {1185--1198} 31836} 31837 31838@Article{ klarbring.bjorkman:solution, 31839 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31840 title = {Solution of large displacement contact problems with friction using {N}ewton's 31841 method for generalized equations}, 31842 journal = {International Journal for Numerical Methods in Engineering}, 31843 volume = {34}, 31844 year = {1992}, 31845 pages = {249--269} 31846} 31847 31848@Article{ klarbring.pang:existence, 31849 author = {A. Klarbring and J. S. Pang}, 31850 title = {Existence of solution to discrete semicoercive frictional contact problems}, 31851 journal = {{SIAM} Journal on Optimization, under review}, 31852 year = {1996} 31853} 31854 31855@Article{ klarbring:discrete, 31856 author = {A. Klarbring}, 31857 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 31858 (Stability, Uniqueness and Variational Principles)}, 31859 journal = {International Journal on Solids and Structures}, 31860 volume = {24}, 31861 pages = {459--479}, 31862 year = {1988} 31863} 31864 31865@TechReport{ klarbring:large, 31866 author = {A. Klarbring}, 31867 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 31868 Discretization}, 31869 number = {LiTH-IKP-R-798}, 31870 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 31871 address = {Link{\"o}ping}, 31872 year = {1994} 31873} 31874 31875@Article{ klarbring:mathematical, 31876 author = {A. Klarbring}, 31877 title = {A mathematical programming approach to three dimensional contact problems with 31878 friction}, 31879 journal = {Computer Methods in Applied Mechanics and Engineering}, 31880 volume = {58}, 31881 year = {1986}, 31882 pages = {175--200} 31883} 31884 31885@InCollection{ klarbring:mathematical*1, 31886 author = {A. Klarbring}, 31887 title = {Mathematical programming and augmented {L}agrangian methods for frictional 31888 contact problems}, 31889 editor = {A. Curnier}, 31890 booktitle = {Proceedings Contact Mechanics International Symposium}, 31891 publisher = {Presse Polytechniques et Universitaires Romandes}, 31892 address = {Lausanne}, 31893 year = {1992}, 31894 pages = {409--422} 31895} 31896 31897@InCollection{ klarbring:mathematical*2, 31898 author = {A. Klarbring}, 31899 title = {Mathematical programming in contact problems}, 31900 editors = {M. H. Aliabadi and C. A. Brebbia}, 31901 booktitle = {Computational Methods for Contact Problems}, 31902 publisher = {Computational Mechanics Publications}, 31903 address = {Southampton}, 31904 year = {1993}, 31905 pages = {233--264} 31906} 31907 31908@Article{ klarbring:quadratic, 31909 author = {A. Klarbring}, 31910 title = {A quadratic program in frictionless contact problems}, 31911 journal = {International Journal of Engineering Science}, 31912 volume = {24}, 31913 pages = {1207--1217}, 31914 year = {1986} 31915} 31916 31917@InCollection{ klee.minty:how, 31918 author = {V. Klee and G. J. Minty}, 31919 title = {How Good is the Simplex Algorithm?}, 31920 booktitle = {Inequalities--III}, 31921 year = {1972}, 31922 publisher = {Academic Press}, 31923 pages = {159--175} 31924} 31925 31926@Article{ kleywegt.shapiro:sample, 31927 author = {A. Kleywegt and A. Shapiro}, 31928 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 31929 journal = {Stochastic Programming E-Print Series}, 31930 year = {1999}, 31931 note = {Available from dochost.rz.hu-berlin.de/speps} 31932} 31933 31934@Book{ knuth:art, 31935 author = {D. E. Knuth}, 31936 title = {The Art of Computer Programming}, 31937 publisher = {Addison-Wesley Longman Inc.}, 31938 address = {Reading, Massachusetts}, 31939 year = {1998}, 31940 edition = {Third}, 31941 volume = {2} 31942} 31943 31944@InProceedings{ kocvara.outrata:nonsmooth, 31945 author = {M. Ko\v{c}vara and J. V. Outrata}, 31946 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 31947 crossref = {ferris.pang:complementarity}, 31948 pages = {148--164} 31949} 31950 31951@Article{ kocvara.outrata:optimization, 31952 author = {M. Ko\v{c}vara and J. V. Outrata}, 31953 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 31954 volume = {15}, 31955 journal = {Numerical Fucntional Analysis and Optimization}, 31956 year = {1994}, 31957 pages = {869--887} 31958} 31959 31960@InCollection{ kocvara.outrata:solution, 31961 author = {M. Ko\v{c}vara and J. V. Outrata}, 31962 title = {On the solution of optimum design problems with variational inequalities}, 31963 editors = {D. Z. Du and L. Qi and R. Womersley}, 31964 booktitle = {Recent Advances in Nonsmooth Optimization}, 31965 publisher = {World Scientific Publishers}, 31966 address = {Singapore}, 31967 year = {1995}, 31968 pages = {172--192} 31969} 31970 31971@Article{ kojima.hirabayashi:homotopy, 31972 author = {M. Kojima and R. Hirabayashi}, 31973 title = {Continuous deformation of nonlinear programs}, 31974 journal = {Mathematical Programming Study}, 31975 editor = {A.~V. Fiacco}, 31976 publisher = {North--Holland}, 31977 address = {Amsterdam}, 31978 year = {1984}, 31979 volume = {21}, 31980 pages = {150--198} 31981} 31982 31983@Article{ kojima.megiddo.ea:homotopy, 31984 author = {M. Kojima and N. Megiddo and T. Noma}, 31985 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 31986 journal = {Mathematics of Operations Research}, 31987 year = {1991}, 31988 volume = {16}, 31989 pages = {754--774} 31990} 31991 31992@TechReport{ kojima.megiddo.ea:primal-dual, 31993 author = {M. Kojima and N. Megiddo and S. Mizuno}, 31994 title = {A primal-dual exterior point algorithm for linear programming}, 31995 institution = {IBM Alamaden Research Center}, 31996 year = {1991}, 31997 number = {RJ 8500}, 31998 address = {San Jose, California} 31999} 32000 32001@Book{ kojima.megiddo.ea:unified, 32002 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 32003 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 32004 Problems}, 32005 year = {1991}, 32006 publisher = {Springer-Verlag}, 32007 address = {Berlin}, 32008 volume = {538}, 32009 series = {Lecture Notes in Computer Science} 32010} 32011 32012@Article{ kojima.mizuno.ea:continuation, 32013 author = {M. Kojima and S. Mizuno and T. Noma}, 32014 title = {A New Continuation Method for Complementarity Problems with Uniform 32015 {P}-function}, 32016 journal = {Mathematical Programming}, 32017 year = {1989}, 32018 volume = {43}, 32019 pages = {107--113} 32020} 32021 32022@TechReport{ kojima.mizuno.ea:infeasible, 32023 author = {M. Kojima and S. Mizuno and M. Todd}, 32024 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 32025 programming}, 32026 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 32027 year = {1992}, 32028 number = {1023}, 32029 address = {Ithaca, New York}, 32030 month = aug 32031} 32032 32033@Article{ kojima.mizuno.ea:onl, 32034 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32035 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 32036 complementarity problems}, 32037 journal = {Mathematical Programming}, 32038 year = {1991}, 32039 volume = {50}, 32040 pages = {331--342} 32041} 32042 32043@Article{ kojima.mizuno.ea:polynomial-time, 32044 author = {M. Kojima and S. Mizuno and A. Yoshise}, 32045 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 32046 journal = {Mathematical Programming}, 32047 year = {1989}, 32048 volume = {44}, 32049 pages = {1--20} 32050} 32051 32052@Article{ kojima.noma.ea:global, 32053 author = {M. Kojima and T. Noma and A. Yoshise}, 32054 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 32055 journal = {Mathematical Programming}, 32056 volume = {65}, 32057 pages = {43--72}, 32058 year = {1994} 32059} 32060 32061@Article{ kojima.shindo.ea:interior-point, 32062 author = {M. Kojima and S. Shindo and S. Hara}, 32063 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 32064 Problem in Symmetric Matrices}, 32065 journal = {SIAM Journal on Optimization}, 32066 volume = {7}, 32067 pages = {86--125} 32068} 32069 32070@Article{ kojima.shindo:extensions, 32071 author = {M. Kojima and S. Shindo}, 32072 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 32073 Equations}, 32074 journal = {Journal of Operations Research Society of Japan}, 32075 year = {1986}, 32076 volume = {29}, 32077 pages = {352--374} 32078} 32079 32080@Article{ kojima:computational, 32081 author = {M. Kojima}, 32082 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 32083 journal = {Keio Engineering Reports}, 32084 year = {1974}, 32085 volume = {27}, 32086 pages = {1--41} 32087} 32088 32089@Article{ kojima:recent, 32090 author = {M. Kojima}, 32091 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 32092 continuation methods}, 32093 journal = {Systems and Control}, 32094 year = {1981}, 32095 volume = {25}, 32096 pages = {421--430} 32097} 32098 32099@Article{ kolesar:branch, 32100 author = {P. J. Kolesar}, 32101 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 32102 journal = {Management Science}, 32103 year = {1967}, 32104 volume = {13}, 32105 pages = {723--735} 32106} 32107 32108@Book{ kolman.beck:elementary, 32109 author = {B. Kolman and R. E. Beck}, 32110 title = {Elementary Linear Programming with Applications}, 32111 year = {1980}, 32112 publisher = {Academic Press} 32113} 32114 32115@Book{ koopmans:activity, 32116 editor = {T. C. Koopmans}, 32117 title = {Activity Analysis of Production and Allocation}, 32118 publisher = {John Wiley}, 32119 address = {New York}, 32120 year = {1951} 32121} 32122 32123@Article{ korpelevich:extragradient, 32124 author = {G. M. Korpelevich}, 32125 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 32126 journal = {Matecon}, 32127 year = {1976}, 32128 volume = {12}, 32129 pages = {747--756} 32130} 32131 32132@Article{ kortanek.shi:convergence, 32133 author = {K. O. Kortanek and M. Shi}, 32134 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 32135 Algorithm}, 32136 journal = {European Journal of Operational Research}, 32137 year = {1987}, 32138 volume = {32}, 32139 pages = {47--61} 32140} 32141 32142@TechReport{ kortanek.shi:remarks, 32143 author = {K. O. Kortanek and M. Shi}, 32144 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 32145 Hybrid Algorithm 1985-6'}, 32146 institution = {College of Business Administration, University of Iowa}, 32147 year = {1987}, 32148 address = {Iowa City}, 32149 number = {87--1}, 32150 type = {Working Paper} 32151} 32152 32153@TechReport{ kortanek:vector-supercomputer, 32154 author = {K. O. Kortanek}, 32155 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 32156 institution = {College of Business Administration, University of Iowa}, 32157 year = {1987}, 32158 address = {Iowa City}, 32159 number = {87--2}, 32160 type = {Working Paper} 32161} 32162 32163@Article{ kostreva:block, 32164 author = {M. M. Kostreva}, 32165 title = {Block Pivot Methods for Solving the Complementarity Problem}, 32166 journal = {Linear Algebra and Its Applications}, 32167 volume = {21}, 32168 pages = {207--215}, 32169 year = {1978} 32170} 32171 32172@Article{ kostreva:elasto-hydrodynamic, 32173 author = {M. M. Kostreva}, 32174 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 32175 journal = {International Journal for Numerical Methods in Fluids}, 32176 year = {1984}, 32177 volume = {4}, 32178 pages = {377--397} 32179} 32180 32181@Article{ kostreva:recent, 32182 author = {M. M. Kostreva}, 32183 title = {Recent Results on Complementarity Models for Engineering and Economics}, 32184 journal = {Infor, Journal of the Canadian {OR} Society}, 32185 year = {1990}, 32186 volume = {28}, 32187 pages = {324--334} 32188} 32189 32190@Article{ kotiah.steinberg:occurrences, 32191 author = {T. C. T. Kotiah and D. I. Steinberg}, 32192 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 32193 Programming Models}, 32194 journal = {Communications of the ACM}, 32195 volume = {20}, 32196 year = {1977}, 32197 pages = {107--112} 32198} 32199 32200@Article{ kotiah.steinberg:possibility, 32201 author = {T. C. T. Kotiah and D. I. Steinberg}, 32202 title = {On the Possibility of Cycling with the Simplex Method}, 32203 journal = {Operations Research}, 32204 volume = {26}, 32205 year = {1978}, 32206 pages = {374--376} 32207} 32208 32209@InCollection{ kuhn.tucker:nonlinear, 32210 author = {H. W. Kuhn and A. W. Tucker}, 32211 title = {Nonlinear Programming}, 32212 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 32213 Probability}, 32214 year = {1951}, 32215 editor = {J. Neyman}, 32216 publisher = {University of California Press}, 32217 address = {Berkeley and Los Angeles}, 32218 pages = {481--492} 32219} 32220 32221@Article{ kummer:metric, 32222 author = {B. Kummer}, 32223 title = {Metric regularity: characterizations, nonsmooth variations, and successive 32224 approximation}, 32225 journal = {Journal of Mathematical Analysis and its Applications}, 32226 year = {}, 32227 optkey = {}, 32228 optvolume = {}, 32229 optnumber = {}, 32230 optpages = {}, 32231 optmonth = {}, 32232 optnote = {}, 32233 optannote = {} 32234} 32235 32236@InCollection{ kummer:newtons, 32237 author = {B. Kummer}, 32238 title = {{N}ewton's Method for Non--Differentiable Functions}, 32239 booktitle = {Advances in Mathematical Optimization}, 32240 publisher = {Akademie--Verlag}, 32241 year = {1988}, 32242 editors = {J. Guddat et al.}, 32243 pages = {114--125}, 32244 address = {Berlin} 32245} 32246 32247@Unpublished{ kuntsevich.kappel:solvopt, 32248 author = {A. Kuntsevich and F. Kappel}, 32249 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 32250 year = {1997}, 32251 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 32252 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 32253} 32254 32255@Book{ kushner.clark:stochastic, 32256 author = {H. J. Kushner and D. S. Clark}, 32257 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 32258 publisher = {Springer-Verlag}, 32259 year = {1978}, 32260 address = {New York} 32261} 32262 32263@Article{ kutcher.burman.ea:histogram, 32264 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 32265 title = {Histogram reduction method for calculating complication probabilities for 32266 three-dimensional treatment planning evaluation}, 32267 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32268 year = {1991}, 32269 optvolume = {21}, 32270 optpages = {137-146} 32271} 32272 32273@Article{ kutcher.burman:calculation, 32274 author = {G. J. Kutcher and C. Burman}, 32275 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 32276 Irradiation: The Effective Volume Method}, 32277 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32278 year = {1989}, 32279 volume = {16}, 32280 pages = {1623--1630} 32281} 32282 32283@Article{ kwak.lee:complementarity, 32284 author = {B. M. Kwak and B. C. Lee.}, 32285 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 32286 Problem}, 32287 journal = {Computers and Structures}, 32288 volume = {18}, 32289 pages = {469--480}, 32290 year = {1988} 32291} 32292 32293@Article{ kwak:complementarity, 32294 author = {B. M. Kwak}, 32295 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 32296 journal = {Journal of Applied Mechanics}, 32297 volume = {58}, 32298 pages = {134--140}, 32299 year = {1991} 32300} 32301 32302@Article{ lagarias.reeds.ea:convergence, 32303 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 32304 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 32305 journal = {SIAM Journal on Optimization}, 32306 year = {1998}, 32307 volume = {9}, 32308 pages = {112--147} 32309} 32310 32311@Article{ lahaye:methode, 32312 author = {E. Lahaye}, 32313 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 32314 transcendantes}, 32315 journal = {C. R. Acad. Sci. Paris}, 32316 year = {1934}, 32317 volume = {198}, 32318 pages = {1840--1842} 32319} 32320 32321@Article{ lahaye:solution, 32322 author = {E. Lahaye}, 32323 title = {Solution of Systems of Transcendental Equations}, 32324 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 32325 year = {1948}, 32326 volume = {5}, 32327 pages = {805--822} 32328} 32329 32330@Article{ lahenbruch.mickey:estimation, 32331 author = {P. A. Lahenbruch and R. M. Mickey}, 32332 title = {Estimation of Error Rates in Discriminant Analysis}, 32333 journal = {Technometrics}, 32334 year = {1968}, 32335 volume = {10}, 32336 pages = {1--11} 32337} 32338 32339@Article{ lakshminarayan.lakshmanan.ea:optimal, 32340 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 32341 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 32342 journal = {Operations Research}, 32343 year = {1978}, 32344 volume = {26}, 32345 pages = {1079--1082} 32346} 32347 32348@Article{ land.doig:automatic, 32349 author = {A. H. Land and A. G. Doig}, 32350 title = {An Automatic Method for Solving Discrete Programming Problems}, 32351 journal = {Econometrica}, 32352 volume = {28}, 32353 year = {1960}, 32354 pages = {497-520} 32355} 32356 32357@Article{ langer.morrill:comparison, 32358 author = {M. Langer and S. Morrill}, 32359 title = {A comparison of mixed integer programming and fast simulated annealing for 32360 optimized beam weights in radiation therapy}, 32361 journal = {Medical Physics}, 32362 year = {1996}, 32363 volume = {23}, 32364 number = {6}, 32365 pages = {957--964} 32366} 32367 32368@Article{ larsson.patriksson:class, 32369 author = {T. Larsson and M. Patriksson}, 32370 title = {A Class of Gap Functions for Variational Inequalities}, 32371 journal = {Mathematical Programming}, 32372 year = {1994}, 32373 volume = {64}, 32374 pages = {53--79} 32375} 32376 32377@Article{ lasdon.waren.ea:solving, 32378 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 32379 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 32380 Linear Programming Algorithms}, 32381 journal = {ACM SIGMAP Bulletin}, 32382 year = {1979}, 32383 volume = {27}, 32384 pages = {9--15} 32385} 32386 32387@TechReport{ lawler.lenstra.ea:sequencing, 32388 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 32389 title = {Sequencing and Scheduling: Algorithms and Complexity}, 32390 institution = {Centre for Mathematics and Computer Science}, 32391 year = {1989}, 32392 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 32393 number = {BS--R89xx} 32394} 32395 32396@Article{ lawler:fast, 32397 author = {E. L. Lawler}, 32398 title = {Fast Approximations Algorithms for Knapsack Problems}, 32399 journal = {Mathematics of Operations Research}, 32400 year = {1979}, 32401 volume = {4}, 32402 pages = {339--356} 32403} 32404 32405@Book{ lawless:statistical, 32406 author = {J. F. Lawless}, 32407 title = {Statistical Models and Methods for Lifetime Data}, 32408 year = {1982}, 32409 publisher = {John Wiley and Sons}, 32410 address = {New York, NY} 32411} 32412 32413@Article{ lawrence.spingarn:fixed, 32414 author = {J. Lawrence and J. E. Spingarn}, 32415 title = {On fixed points of non-expansive piecewise isometric mappings}, 32416 journal = {Proceedings of the London Mathematical Society}, 32417 year = {1987}, 32418 volume = {55}, 32419 number = {3}, 32420 pages = {605--624} 32421} 32422 32423@Article{ leavitt.martin.ea:dynamic, 32424 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 32425 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 32426 dose delivery}, 32427 journal = {Medical Physics}, 32428 year = {1990}, 32429 volume = {17}, 32430 number = {1}, 32431 pages = {87--92} 32432} 32433 32434@Article{ leblanc.morlok.ea:efficient, 32435 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 32436 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 32437 Problem}, 32438 journal = {Transportation Research}, 32439 volume = {9}, 32440 year = {1975}, 32441 pages = {309--318} 32442} 32443 32444@Article{ lee:computational, 32445 author = {S. S. Lee}, 32446 title = {A computational method for frictional contact problem using finite element 32447 method}, 32448 journal = {International Journal for Numerical Methods in Engineering}, 32449 volume = {37}, 32450 year = {1994}, 32451 pages = {217--228} 32452} 32453 32454@PhDThesis{ lee:military, 32455 author = {D. K. Lee}, 32456 title = {Military Force Planning Problems Under Uncertainty}, 32457 school = {University of Wisconsin -- Madison}, 32458 year = {1996}, 32459 address = {Madison, Wisconsin} 32460} 32461 32462@Article{ leibel.kutcher.ea:improved, 32463 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 32464 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 32465 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 32466 the Nasopharynx}, 32467 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32468 year = {1991}, 32469 volume = {20}, 32470 pages = {823--833} 32471} 32472 32473@Article{ lee.gallagher.ea:treatment, 32474 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 32475 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 32476 Computational Approaches and Experiments with Permanent Prostate Implant 32477 Planning}, 32478 journal = {Physics in Medicine and Biology}, 32479 year = {1999}, 32480 volume = {44}, 32481 pages = {145--165} 32482} 32483 32484@Article{ lemarechal.nemirovskii.ea:variants, 32485 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 32486 title = {New Variants of Bundle Methods}, 32487 year = {1995}, 32488 journal = {Mathematical Programming}, 32489 volume = {69}, 32490 pages = {111--147} 32491} 32492 32493@InCollection{ lemarechal.strodiot.ea:bundle, 32494 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 32495 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 32496 booktitle = {Nonlinear Programming}, 32497 year = {1981}, 32498 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 32499 publisher = {Academic Press}, 32500 pages = {245--282}, 32501 volume = {4} 32502} 32503 32504@Article{ lemke.howson:equilibrium, 32505 author = {C. E. Lemke and J. T. Howson}, 32506 title = {Equilibrium Points of Bimatrix Games}, 32507 journal = {SIAM Journal on Applied Mathematics}, 32508 year = {1964}, 32509 volume = {12}, 32510 pages = {413--423} 32511} 32512 32513@Article{ lemke:bimatrix, 32514 author = {C. E. Lemke}, 32515 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 32516 journal = {Management Science}, 32517 year = {1965}, 32518 volume = {11}, 32519 pages = {681--689} 32520} 32521 32522@InCollection{ lemke:complementary, 32523 author = {C. E. Lemke}, 32524 title = {On Complementary Pivot Theory}, 32525 booktitle = {Mathematics of the Decision Sciences: Part 1}, 32526 publisher = {American Mathematical Society}, 32527 year = {1968}, 32528 editor = {G. B. Dantzig and A. F. Veinott}, 32529 volume = {11}, 32530 series = {Lectures in Applied Mathematics}, 32531 address = {Providence}, 32532 pages = {95--114} 32533} 32534 32535@Article{ levenberg:method, 32536 author = {K. Levenberg}, 32537 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 32538 journal = {Quarterly Applied Mathematics}, 32539 year = {1944}, 32540 volume = {2}, 32541 pages = {164--168} 32542} 32543 32544@Article{ levitin.polyak:constrained, 32545 author = {E. S. Levitin and B. T. Polyak}, 32546 title = {Constrained minimization methods}, 32547 journal = {Computational Mathematics and Mathematical Physics}, 32548 year = {1968}, 32549 volume = {6}, 32550 pages = {1--50}, 32551 note = {Translated from Russian} 32552} 32553 32554@Article{ li.swetis:linear, 32555 author = {W. Li and J. J. Swetits}, 32556 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 32557 journal = {SIAM Journal on Optimization}, 32558 volume = {8}, 32559 pages = {457-475}, 32560 year = {1998} 32561} 32562 32563@TechReport{ li:error, 32564 author = {W. Li}, 32565 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 32566 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32567 year = {1993}, 32568 address = {Norfolk, VA 23529}, 32569 number = {TR93-1}, 32570 note = {SIAM Journal on Control and Optimization, to appear} 32571} 32572 32573@TechReport{ li:linearly, 32574 author = {W. Li}, 32575 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 32576 Quadratic Splines}, 32577 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32578 year = {1993}, 32579 address = {Norfolk, VA 23529}, 32580 number = {TR93-3}, 32581 note = {Journal of Optimization Theory and Applications, to appear} 32582} 32583 32584@InProceedings{ li:merit, 32585 author = {W. Li}, 32586 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 32587 Problems}, 32588 crossref = {ferris.pang:complementarity} 32589} 32590 32591@Article{ li:remarks, 32592 author = {W. Li}, 32593 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 32594 Complementarity Problem}, 32595 journal = {SIAM Journal on Optimization}, 32596 year = {1993}, 32597 volume = {3}, 32598 pages = {155--163} 32599} 32600 32601@TechReport{ li:sharp, 32602 author = {W. Li}, 32603 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 32604 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32605 year = {1991}, 32606 address = {Norfolk, VA 23529}, 32607 number = {TR91-13}, 32608 note = {SIAM Journal on Control and Optimization, to appear} 32609} 32610 32611@Article{ lin.kernighan:efficient, 32612 author = {S. Lin and B. W. Kernighan}, 32613 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 32614 journal = {Operations Research}, 32615 year = {1973}, 32616 volume = {21}, 32617 pages = {498--516} 32618} 32619 32620@Article{ lin.pang:iterative, 32621 author = {Y. Y. Lin and J. S. Pang}, 32622 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 32623 journal = {SIAM Journal on Control and Optimization}, 32624 year = {1987}, 32625 volume = {25}, 32626 pages = {383--411} 32627} 32628 32629@Unpublished{ linderoth:branch, 32630 author = {J. Linderoth}, 32631 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 32632 institution = {Argonne National Laboratories}, 32633 year = {2000}, 32634 note = {Working Paper} 32635} 32636 32637@Article{ lions.stampacchia:variational, 32638 author = {J. L. Lions and G. Stampacchia}, 32639 title = {Variational Inequalities}, 32640 journal = {Communications on Pure and Applied Math}, 32641 year = {1967}, 32642 volume = {20}, 32643 pages = {493--19} 32644} 32645 32646@Article{ lions.mercier:splitting, 32647 author = {P.--L. Lions and B. Mercier}, 32648 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 32649 journal = {SIAM Journal on Numerical Analysis}, 32650 year = {1979}, 32651 volume = {16}, 32652 pages = {964--979} 32653} 32654 32655@Article{ lions:methode, 32656 author = {P.--L. Lions}, 32657 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 32658 journal = {Israel Journal of Mathematics}, 32659 year = {1978}, 32660 volume = {31}, 32661 number = {2}, 32662 pages = {204--208} 32663} 32664 32665@InProceedings{ litzkow.livny.ea:condor, 32666 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 32667 title = {Condor: {A} Hunter of Idle Workstations}, 32668 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 32669 Systems}, 32670 year = {1988}, 32671 pages = {104--111}, 32672 month = jun 32673} 32674 32675@Article{ liu.nocedal:limited, 32676 author = {D. C. Liu and J. Nocedal}, 32677 title = {On the Limited Memory Method for Large Scale Optimization}, 32678 journal = {Mathematical Programming}, 32679 year = {1989}, 32680 volume = {45}, 32681 pages = {503--528} 32682} 32683 32684@InBook{ livny.raman:high, 32685 author = {M. Livny and R. Raman}, 32686 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 32687 chapter = {High Throughput Resource Management}, 32688 publisher = {Morgan Kaufmann Publishers}, 32689 year = {1999}, 32690 pages = {311--337} 32691} 32692 32693@Article{ llacer:inverse, 32694 author = {J. Llacer}, 32695 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 32696 Method}, 32697 journal = {Medical Physics}, 32698 year = {1997}, 32699 volume = {24}, 32700 number = {11}, 32701 pages = {1751--1764} 32702} 32703 32704@Book{ lojasiewicz:ensembles, 32705 author = {M. S. Lojasiewicz}, 32706 title = {Ensembles semi-analytiques}, 32707 publisher = {Institut des Hautes Etudes Scientifiques}, 32708 year = {1964}, 32709 address = {Bures-sur-Yvette} 32710} 32711 32712@Article{ lootsma:logarithmic, 32713 author = {F. A. Lootsma}, 32714 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 32715 journal = {Phillips Research Reports}, 32716 year = {1967}, 32717 volume = {22}, 32718 pages = {329--344} 32719} 32720 32721@InCollection{ lootsma:survey, 32722 author = {F. A. Lootsma}, 32723 title = {A Survey of Methods for Solving Constrained Minimization Problems via 32724 Unconstrained Minimization}, 32725 booktitle = {Numerical Methods for Nonlinear Optimization}, 32726 year = {1972}, 32727 editor = {F. A. Lootsma}, 32728 publisher = {Academic Press}, 32729 address = {London} 32730} 32731 32732@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 32733 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32734 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 32735 Regional Trade Blocks}, 32736 institution = {National Bureau of Economic Research, Inc.}, 32737 year = {1993}, 32738 number = {4512}, 32739 address = {Cambridge, Massechusetts} 32740} 32741 32742@InCollection{ lopezdesilanes.markusen.ea:auto, 32743 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32744 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 32745 year = {1994}, 32746 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 32747 publisher = {Cambridge University Press}, 32748 editor = {C. Shields and J. Francois} 32749} 32750 32751@Article{ lopezdesilanes.markusen.ea:complementarity, 32752 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32753 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 32754 journal = {Journal of Development Economics}, 32755 year = {1994}, 32756 volume = {45}, 32757 pages = {133--151} 32758} 32759 32760@Article{ lopezdesilanes.markusen.ea:trade, 32761 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32762 title = {Trade Policy Subtleties with Multinational Firms}, 32763 journal = {European Economic Review}, 32764 year = {1996} 32765} 32766 32767@Article{ lotstedt:coulomb, 32768 author = {P. L{\"{o}}tstedt}, 32769 title = {Coulomb friction in two-dimensional rigid body systems}, 32770 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 32771 volume = {61}, 32772 year = {1981}, 32773 pages = {605--615} 32774} 32775 32776@Article{ lotstedt:mechanical, 32777 author = {P. L{\"{o}}tstedt}, 32778 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 32779 journal = {SIAM Journal on Applied Mathematics}, 32780 volume = {42}, 32781 year = {1982}, 32782 pages = {281--296} 32783} 32784 32785@Book{ luenberger:linear, 32786 author = {D. G. Luenberger}, 32787 title = {Linear and Nonlinear Programming}, 32788 year = {1984}, 32789 publisher = {Addison-Wesley}, 32790 edition = {Second} 32791} 32792 32793@Book{ luenberger:optimization, 32794 author = {D. G. Luenberger}, 32795 title = {Optimization by Vector Space Methods}, 32796 year = {1969}, 32797 publisher = {John Wiley \& Sons}, 32798 address = {New York} 32799} 32800 32801@Article{ lundy.mees:convergence, 32802 author = {M. Lundy and A. Mees}, 32803 title = {Convergence of an Annealing Algorithm}, 32804 journal = {Mathematical Programming}, 32805 year = {1986}, 32806 volume = {34}, 32807 pages = {111--124} 32808} 32809 32810@Article{ luo.luo:extension, 32811 author = {X.-D. Luo and Z.-Q. Luo}, 32812 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 32813 journal = {SIAM Journal on Optimization}, 32814 year = {1994}, 32815 volume = {4}, 32816 pages = {383--392} 32817} 32818 32819@Article{ luo.mangasarian.ea:error, 32820 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 32821 title = {New Error Bounds for the Linear Complementarity Problem}, 32822 journal = {Mathematics of Operations Research}, 32823 year = {1994}, 32824 pages = {880--892}, 32825 volume = {19} 32826} 32827 32828@Article{ luo.pang.ea:exact, 32829 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 32830 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 32831 Equilibrium Constraints}, 32832 journal = {Mathematical Programming}, 32833 volume = {75}, 32834 pages = {19--76}, 32835 year = {1996} 32836} 32837 32838@Book{ luo.pang.ea:mathematical, 32839 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 32840 title = {Mathematical Programs with Equilibrium Constraints}, 32841 publisher = {Cambridge University Press}, 32842 year = {1996} 32843} 32844 32845@Article{ luo.pang:error, 32846 author = {Z.-Q. Luo and J. S. Pang}, 32847 title = {Error Bounds for Analytic Systems and their Applications}, 32848 journal = {Mathematical Programming}, 32849 year = {1994}, 32850 volume = {67}, 32851 pages = {1--28} 32852} 32853 32854@Article{ luo.shu.ea:optimizing, 32855 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 32856 title = {Optimizing computerized treatment planning for the Gamma Knife by source 32857 culling}, 32858 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32859 year = {1999}, 32860 volume = {45}, 32861 number = {5}, 32862 pages = {1339--1346} 32863} 32864 32865@InProceedings{ luo.tseng:class, 32866 author = {Z.-Q. Luo and P. Tseng}, 32867 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 32868 crossref = {ferris.pang:complementarity}, 32869 pages = {204--225} 32870} 32871 32872@Article{ luo.tseng:convergence, 32873 author = {Z.-Q. Luo and P. Tseng}, 32874 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 32875 Minimization}, 32876 journal = {Journal of Optimization Theory and Applications}, 32877 year = {1992}, 32878 volume = {72}, 32879 pages = {7--35} 32880} 32881 32882@Article{ luo.tseng:convergence*1, 32883 author = {Z.-Q. Luo and P. Tseng}, 32884 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 32885 Linear Complementarity Problem}, 32886 journal = {SIAM Journal on Control and Optimization}, 32887 year = {1991}, 32888 volume = {29}, 32889 pages = {1037--1060} 32890} 32891 32892@Article{ luo.tseng:convergence*2, 32893 author = {Z.-Q. Luo and P. Tseng}, 32894 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 32895 journal = {Mathematics of Operations Research}, 32896 year = {1993}, 32897 volume = {18}, 32898 pages = {846--867} 32899} 32900 32901@Article{ luo.tseng:error, 32902 author = {Z.--Q. Luo and P. Tseng}, 32903 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 32904 Affine Variational Inequality Problem}, 32905 journal = {SIAM Journal on Optimization}, 32906 year = {1992}, 32907 volume = {2}, 32908 pages = {43--54} 32909} 32910 32911@Article{ luo.tseng:error*1, 32912 author = {Z.-Q. Luo and P. Tseng}, 32913 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 32914 Over a Polyhedral Set}, 32915 journal = {SIAM Journal on Optimization}, 32916 year = {1993}, 32917 volume = {3}, 32918 pages = {43--59} 32919} 32920 32921@Article{ luo.tseng:error*2, 32922 author = {Z.-Q. Luo and P. Tseng}, 32923 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 32924 Approach}, 32925 journal = {Annals of Operations Research}, 32926 year = {1993}, 32927 volume = {46}, 32928 pages = {157--178} 32929} 32930 32931@Article{ luo.tseng:global, 32932 author = {Z.-Q. Luo and P. Tseng}, 32933 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 32934 Problems}, 32935 journal = {Operations Research Letters}, 32936 year = {1992}, 32937 volume = {11}, 32938 pages = {159--165} 32939} 32940 32941@Article{ luo.tseng:linear, 32942 author = {Z.-Q. Luo and P. Tseng}, 32943 title = {On the linear convergence of descent methods for convex essentially smooth 32944 minimization}, 32945 journal = {SIAM Journal on Control and Optimization}, 32946 year = {1992}, 32947 volume = {30}, 32948 pages = {408--425} 32949} 32950 32951@TechReport{ luo:convergence, 32952 author = {Z.-Q. Luo}, 32953 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 32954 Quadratic Programs}, 32955 institution = {Communications Research Laboratory, McMaster University}, 32956 year = {1992}, 32957 address = {Hamilton, Ontario} 32958} 32959 32960@Article{ lustig.marsten.ea:computational, 32961 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32962 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 32963 Programming}, 32964 journal = {Linear Algebra and Its Applications}, 32965 year = {1991}, 32966 volume = {152}, 32967 pages = {191--222} 32968} 32969 32970@Article{ lustig.marsten.ea:implementing, 32971 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32972 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 32973 programming}, 32974 journal = {SIAM Journal on Optimization}, 32975 year = {1992}, 32976 volume = {2}, 32977 pages = {435--449} 32978} 32979 32980@Article{ lustig.marsten.ea:interior-point, 32981 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32982 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 32983 journal = {ORSA Journal on Computing}, 32984 year = {1994}, 32985 volume = {6}, 32986 number = {1}, 32987 pages = {1--38} 32988} 32989 32990@Article{ lyman.wolbarst:optimization, 32991 author = {J. T. Lyman and A. B. Wolbarst}, 32992 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 32993 Algorithm}, 32994 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32995 year = {1989}, 32996 volume = {17}, 32997 pages = {433--436} 32998} 32999 33000@Article{ mackie.holmes.ea:tomotherapy*1, 33001 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 33002 J. Yang and B. Paliwal and T. Kinsella}, 33003 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 33004 journal = {Medical Physics}, 33005 year = {1993}, 33006 volume = {20}, 33007 number = {6}, 33008 pages = {1709--1719} 33009} 33010 33011@Article{ mackie.holmes.ea:tomotherapy*2, 33012 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 33013 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 33014 journal = {Int. J. of Imaging Systems and Technology}, 33015 year = {1995}, 33016 volume = {6}, 33017 pages = {43--55} 33018} 33019 33020@Article{ mackie.scrimger.ea:convolution, 33021 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 33022 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 33023 journal = {Medical Physics}, 33024 year = {1985}, 33025 volume = {12}, 33026 pages = {188--196} 33027} 33028 33029@Article{ mackinnon:technique, 33030 author = {James G. Mac{K}innon}, 33031 title = {A Technique for the Solution of Spatial Equilibrium Models}, 33032 journal = {Journal of Regional Science}, 33033 year = {1976}, 33034 volume = {16}, 33035 pages = {293--307} 33036} 33037 33038@PhDThesis{ madsen:minimization, 33039 author = {K. Madsen}, 33040 title = {Minimization of Nonlinear Approximation Functions}, 33041 year = {1985}, 33042 address = {Lyngby, Denmark}, 33043 school = {Institute of Numerical Analysis, Technical University of Denmark}, 33044 annote = {Dissertation} 33045} 33046 33047@Book{ magill.quinzii:theory, 33048 author = {M. Magill and M. Quinzii}, 33049 title = {Theory of Incomplete Markets}, 33050 publisher = {MIT Press}, 33051 year = {1996} 33052} 33053 33054@InCollection{ magnanti:models, 33055 author = {T. L. Magnanti}, 33056 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 33057 booktitle = {Transportation Planning Models}, 33058 year = {1984}, 33059 editor = {M. Florian}, 33060 publisher = {North Holland}, 33061 pages = {153--186} 33062} 33063 33064@InCollection{ maguregui:modified, 33065 author = {J. Maguregui}, 33066 title = {A modified {N}ewton algorithm for functions over convex sets}, 33067 crossref = {mangasarian.meyer.ea:nonlinear*3}, 33068 pages = {461--473} 33069} 33070 33071@PhDThesis{ maguregui:regular, 33072 author = {J. Maguregui}, 33073 title = {Regular Multivalued Functions and Algorithmic Applications}, 33074 year = {1977}, 33075 address = {Madison, Wisconsin}, 33076 school = {Computer Sciences Department, University of Wisconsin} 33077} 33078 33079@Article{ mahey.oualibouch.ea:proximal, 33080 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 33081 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 33082 journal = {SIAM Journal on Optimization}, 33083 year = {1995}, 33084 volume = {5}, 33085 pages = {454--466} 33086} 33087 33088@Article{ mahey.pham:partial, 33089 author = {P. Mahey and D. T. Pham}, 33090 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 33091 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 33092 year = {1993}, 33093 volume = {27}, 33094 pages = {375--392} 33095} 33096 33097@InCollection{ maier.novati:shakedown, 33098 author = {G. Maier and G. Novati}, 33099 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 33100 geometric effects with reference to discrete structural models}, 33101 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 33102 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 33103 publisher = {Pineridge Press}, 33104 address = {Swansea}, 33105 year = {1990}, 33106 pages = {451--471} 33107} 33108 33109@Article{ maier:incremental, 33110 author = {G. Maier}, 33111 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 33112 Instabilizing Effects}, 33113 journal = {International Journal of Solids and Structures}, 33114 volume = {7}, 33115 year = {1971}, 33116 pages = {345--372} 33117} 33118 33119@InCollection{ maier:inverse, 33120 author = {G. Maier}, 33121 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 33122 booktitle = {Serie VIII}, 33123 publisher = {Academia Nazionale dei Lincei}, 33124 year = {1981}, 33125 volume = {LXX}, 33126 pages = {203--209} 33127} 33128 33129@Article{ maier:matrix, 33130 author = {G. Maier}, 33131 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 33132 yield planes}, 33133 journal = {Meccanica}, 33134 volume = {5}, 33135 year = {1970}, 33136 pages = {54--66} 33137} 33138 33139@Article{ maier:quadratic, 33140 author = {G. Maier}, 33141 title = {A quadratic programming approach for certain classes of nonlinear structural 33142 problems}, 33143 journal = {Meccanica}, 33144 volume = {3}, 33145 year = {1968}, 33146 pages = {121--130} 33147} 33148 33149@Book{ manber:introduction, 33150 author = {U. Manber}, 33151 title = {Introduction to Algorithms: {A} Creative Approach}, 33152 year = {1989}, 33153 publisher = {Addison-Wesley} 33154} 33155 33156@Article{ mangasarian.deleone:error, 33157 author = {O. L. Mangasarian and R. {De~Leone}}, 33158 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 33159 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 33160 journal = {Applied Mathematics and Optimization}, 33161 year = {1988}, 33162 volume = {17}, 33163 pages = {1--14} 33164} 33165 33166@Article{ mangasarian.deleone:parallel, 33167 author = {O. L. Mangasarian and R. {De~Leone}}, 33168 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 33169 Problems and Linear Programs}, 33170 journal = {Journal of Optimization Theory and Applications}, 33171 year = {1987}, 33172 volume = {54}, 33173 pages = {437--446} 33174} 33175 33176@Article{ mangasarian.fromovitz:fritz, 33177 author = {O. L. Mangasarian and S. Fromovitz}, 33178 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 33179 and inequality constraints}, 33180 journal = {Journal of Mathematical Analysis and its Applications}, 33181 year = {1967}, 33182 volume = {17}, 33183 pages = {37--47} 33184} 33185 33186@Article{ mangasarian.mclinden:simple, 33187 author = {O. L. Mangasarian and L. McLinden}, 33188 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 33189 Programs}, 33190 journal = {Mathematical Programming}, 33191 year = {1985}, 33192 volume = {32}, 33193 pages = {32--40} 33194} 33195 33196@Article{ mangasarian.meyer:nonlinear, 33197 author = {O. L. Mangasarian and R. R. Meyer}, 33198 title = {Nonlinear Perturbation of Linear Programs}, 33199 journal = {SIAM Journal on Control and Optimization}, 33200 year = {1979}, 33201 volume = {17}, 33202 pages = {745--752} 33203} 33204 33205@TechReport{ mangasarian.musicant:active, 33206 author = {O. L. Mangasarian and David R. Musicant}, 33207 title = {Active Set Support Vector Machine Classification}, 33208 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33209 year = {2000}, 33210 number = {00-04}, 33211 address = {Madison, Wisconsin} 33212} 33213 33214@TechReport{ mangasarian.musicant:lagrangian, 33215 author = {O. L. Mangasarian and D. R. Musicant}, 33216 title = {Lagrangian Support Vector Machines}, 33217 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33218 year = {2000}, 33219 number = {00-06}, 33220 address = {Madison, Wisconsin} 33221} 33222 33223@TechReport{ mangasarian.musicant:robust, 33224 author = {O. L. Mangasarian and David R. Musicant}, 33225 title = {Robust Linear and Support Vector Regression}, 33226 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 33227 year = {1999}, 33228 number = {99-09}, 33229 address = {Madison, Wisconsin} 33230} 33231 33232@Article{ mangasarian.musicant:successive, 33233 author = {O. L. Mangasarian and David R. Musicant}, 33234 title = {Successive Overrelaxation for Support Vector Machines}, 33235 journal = {IEEE Transactions on Neural Networks}, 33236 volume = {10}, 33237 year = {1999}, 33238 pages = {1032-1037} 33239} 33240 33241@Article{ mangasarian.pang:exact, 33242 author = {O. L. Mangasarian and J. S. Pang}, 33243 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 33244 Constraints}, 33245 journal = {Optimization}, 33246 year = {1997}, 33247 volume = {42}, 33248 pages = {1--8} 33249} 33250 33251@Article{ mangasarian.pang:extended, 33252 author = {O. L. Mangasarian and J. S. Pang}, 33253 title = {The Extended Linear Complementarity Problem}, 33254 journal = {SIAM Journal on Matrix Analysis and Applications}, 33255 year = {1994}, 33256 volume = {16} 33257} 33258 33259@Article{ mangasarian.ren:error, 33260 author = {O. L. Mangasarian and J. Ren}, 33261 title = {New error bounds for the nonlinear complementarity problem}, 33262 year = {1994}, 33263 volume = {1}, 33264 pages = {49--56}, 33265 journal = {Communications on Applied Nonlinear Analysis} 33266} 33267 33268@Article{ mangasarian.ren:improved, 33269 author = {O. L. Mangasarian and J. Ren}, 33270 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 33271 year = {1994}, 33272 volume = {66}, 33273 journal = {Mathematical Programming}, 33274 pages = {241--255} 33275} 33276 33277@InProceedings{ mangasarian.setiono.ea:pattern, 33278 crossref = {coleman.li:large-scale}, 33279 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 33280 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 33281 Diagnosis}, 33282 pages = {22--31} 33283} 33284 33285@Article{ mangasarian.shiau:error, 33286 author = {O. L. Mangasarian and T.--H. Shiau}, 33287 title = {Error Bounds for Monotone Linear Complementarity Problems}, 33288 journal = {Mathematical Programming}, 33289 year = {1986}, 33290 volume = {36}, 33291 pages = {81--89} 33292} 33293 33294@Article{ mangasarian.shiau:lipschitz, 33295 author = {O. L. Mangasarian and T.--H. Shiau}, 33296 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 33297 Complementarity Problems}, 33298 journal = {SIAM Journal on Control and Optimization}, 33299 year = {1987}, 33300 volume = {25}, 33301 pages = {583--595} 33302} 33303 33304@Article{ mangasarian.solodov:nonlinear, 33305 author = {O. L. Mangasarian and M. V. Solodov}, 33306 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 33307 journal = {Mathematical Programming}, 33308 year = {1993}, 33309 volume = {62}, 33310 pages = {277--298} 33311} 33312 33313@Article{ mangasarian.solodov:serial, 33314 author = {O. L. Mangasarian and M. V. Solodov}, 33315 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 33316 Minimization}, 33317 year = {1994}, 33318 journal = {Optimization Methods and Software}, 33319 volume = {4}, 33320 pages = {103--116} 33321} 33322 33323@Article{ mangasarian.street.ea:breast, 33324 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 33325 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 33326 journal = {Operations Research}, 33327 year = {1995}, 33328 volume = {43}, 33329 pages = {570--577} 33330} 33331 33332@Article{ mangasarian.wolberg:cancer, 33333 author = {O. L. Mangasarian and W. H. Wolberg}, 33334 title = {Cancer Diagnosis via Linear Programming}, 33335 journal = {SIAM News}, 33336 year = {1990}, 33337 volume = {23}, 33338 pages = {1 \& 18} 33339} 33340 33341@InCollection{ mangasarian:applications, 33342 author = {O. L. Mangasarian}, 33343 title = {Some Applications of Penalty Functions in Mathematical Programming}, 33344 booktitle = {Optimization and Related Fields}, 33345 year = {1986}, 33346 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 33347 publisher = {Springer-Verlag}, 33348 address = {Heidelberg}, 33349 pages = {307--329}, 33350 note = {Lecture Notes in Mathematics 1190} 33351} 33352 33353@Article{ mangasarian:characterization, 33354 author = {O. L. Mangasarian}, 33355 title = {Characterization of linear complementarity problems as linear programs}, 33356 journal = {Mathematical Programming Study}, 33357 year = {1978}, 33358 volume = {7}, 33359 pages = {74--87} 33360} 33361 33362@InProceedings{ mangasarian:condition, 33363 author = {O. L. Mangasarian}, 33364 title = {A condition number for linear inequalities and linear programs}, 33365 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 33366 1981}, 33367 year = {1981}, 33368 editor = {G. Bamberg and O. Opitz}, 33369 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 33370 address = {Konigstein}, 33371 pages = {3--15} 33372} 33373 33374@Article{ mangasarian:convergence, 33375 author = {O. L. Mangasarian}, 33376 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 33377 Symmetric Monotone Linear Complementarity Problem}, 33378 journal = {SIAM Journal on Optimization}, 33379 volume = {1}, 33380 pages = {114--122}, 33381 year = {1991} 33382} 33383 33384@Article{ mangasarian:equivalence, 33385 author = {O. L. Mangasarian}, 33386 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 33387 journal = {SIAM Journal on Applied Mathematics}, 33388 year = {1976}, 33389 volume = {31}, 33390 pages = {89--92} 33391} 33392 33393@Article{ mangasarian:error, 33394 author = {O. L. Mangasarian}, 33395 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 33396 journal = {ORSA Journal on Computing}, 33397 volume = {15}, 33398 pages = {187--192}, 33399 year = {1994} 33400} 33401 33402@Article{ mangasarian:error*1, 33403 author = {O. L. Mangasarian}, 33404 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 33405 journal = {Mathematical Programming}, 33406 year = {1990}, 33407 volume = {48}, 33408 pages = {437--445} 33409} 33410 33411@Article{ mangasarian:generalized, 33412 author = {O. L. Mangasarian}, 33413 title = {Generalized Linear Complementarity Problems as Linear Programs}, 33414 journal = {Methods of Operations Research}, 33415 year = {1979}, 33416 editor = {W. Oettli and F. Steffens}, 33417 volume = {31}, 33418 pages = {393--402} 33419} 33420 33421@InCollection{ mangasarian:generalized*1, 33422 author = {O. L. Mangasarian}, 33423 title = {Generalized Support Vector Machines}, 33424 year = {2000}, 33425 pages = {135-146}, 33426 booktitle = {Advances in Large Margin Classifiers}, 33427 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 33428 publisher = {MIT Press}, 33429 address = {Cambridge, MA} 33430} 33431 33432@Article{ mangasarian:global, 33433 author = {O. L. Mangasarian}, 33434 title = {Global error bounds for monotone affine variational inequality problems}, 33435 journal = {Linear Algebra and Its Applications}, 33436 year = {1992}, 33437 pages = {153--164} 33438} 33439 33440@InCollection{ mangasarian:least, 33441 author = {O. L. Mangasarian}, 33442 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 33443 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 33444 year = {1990}, 33445 publisher = {Oxford University Press}, 33446 address = {New York}, 33447 pages = {217--221} 33448} 33449 33450@Article{ mangasarian:least-norm, 33451 author = {O. L. Mangasarian}, 33452 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 33453 Problem}, 33454 journal = {Journal of Mathematical Analysis and Applications}, 33455 year = {1983}, 33456 volume = {92}, 33457 pages = {240--251} 33458} 33459 33460@Article{ mangasarian:linear, 33461 author = {O. L. Mangasarian}, 33462 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 33463 journal = {Mathematical Programming}, 33464 year = {1976}, 33465 volume = {10}, 33466 pages = {263--270} 33467} 33468 33469@Article{ mangasarian:linear*1, 33470 author = {O. L. Mangasarian}, 33471 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 33472 journal = {Operations Research}, 33473 year = {1965}, 33474 volume = {13}, 33475 pages = {444--452} 33476} 33477 33478@Article{ mangasarian:locally, 33479 author = {O. L. Mangasarian}, 33480 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 33481 Complementarity Problems}, 33482 journal = {Mathematical Programming}, 33483 year = {1980}, 33484 volume = {19}, 33485 pages = {200--212} 33486} 33487 33488@InCollection{ mangasarian:machine, 33489 author = {O. L. Mangasarian}, 33490 title = {Machine Learning via Polyhedral Concave Minimization}, 33491 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 33492 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 33493 pages = {175-188}, 33494 year = {1996}, 33495 address = {Heidelberg}, 33496 publisher = {Physica-Verlag A Springer-Verlag Company} 33497} 33498 33499@Article{ mangasarian:mathematical, 33500 author = {O. L. Mangasarian}, 33501 title = {Mathematical Programming in Neural Networks}, 33502 journal = {ORSA Journal on Computing}, 33503 volume = {5}, 33504 pages = {349--360}, 33505 year = {1993} 33506} 33507 33508@InProceedings{ mangasarian:mathematical*1, 33509 author = {O. L. Mangasarian}, 33510 title = {Mathematical Programming in Machine Learning}, 33511 booktitle = {Nonlinear Optimization and Applications}, 33512 editor = {G. Di Pillo and F. Giannessi}, 33513 publisher = {Plenum Publishing}, 33514 address = {New York}, 33515 pages = {283--295}, 33516 year = {1996} 33517} 33518 33519@Article{ mangasarian:mathematical*2, 33520 author = {O. L. Mangasarian}, 33521 title = {Mathematical Programming in Data Mining}, 33522 journal = {Data Mining and Knowledge Discovery}, 33523 volume = {1}, 33524 year = {1997}, 33525 pages = {183-201} 33526} 33527 33528@Article{ mangasarian:multi-surface, 33529 author = {O. L. Mangasarian}, 33530 title = {Multi-surface Method of Pattern Separation}, 33531 journal = {IEEE Transactions on Information Theory}, 33532 year = {1968}, 33533 volume = {IT-14}, 33534 pages = {801--807} 33535} 33536 33537@Book{ mangasarian:nonlinear, 33538 author = {O. L. Mangasarian}, 33539 title = {Nonlinear Programming}, 33540 year = {1969}, 33541 publisher = {McGraw--Hill}, 33542 address = {New York}, 33543 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 33544} 33545 33546@Article{ mangasarian:normal, 33547 author = {O. L. Mangasarian}, 33548 title = {Normal Solutions of Linear Programs}, 33549 journal = {Mathematical Programming Study}, 33550 year = {1984}, 33551 volume = {22}, 33552 pages = {206--216} 33553} 33554 33555@Article{ mangasarian:optimal, 33556 author = {O. L. Mangasarian}, 33557 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 33558 Linear Programs}, 33559 journal = {Journal of Optimization Theory and Applications}, 33560 year = {1981}, 33561 volume = {35}, 33562 pages = {123--128} 33563} 33564 33565@Article{ mangasarian:parallel, 33566 author = {O. L. Mangasarian}, 33567 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 33568 journal = {SIAM Journal on Control and Optimization}, 33569 volume = {33}, 33570 pages = {1916--1925}, 33571 year = {1995} 33572} 33573 33574@TechReport{ mangasarian:regularized, 33575 author = {O. L. Mangasarian}, 33576 title = {Regularized Linear Programs with Equilibrium Constraints}, 33577 institution = {Computer Sciences Department, University of Wisconsin}, 33578 year = {1997}, 33579 address = {Madison, Wisconsin}, 33580 type = {Mathematical Programming Technical Report}, 33581 number = {97--13}, 33582 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 33583} 33584 33585@Article{ mangasarian:simple, 33586 author = {O. L. Mangasarian}, 33587 title = {A Simple Characterization of Solution Sets of Convex Programs}, 33588 journal = {Operations Research Letters}, 33589 year = {1988}, 33590 volume = {7}, 33591 pages = {21--26} 33592} 33593 33594@Article{ mangasarian:solution, 33595 author = {O. L. Mangasarian}, 33596 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 33597 journal = {Journal of Optimization Theory and Applications}, 33598 year = {1977}, 33599 month = aug, 33600 volume = {22}, 33601 pages = {465--485} 33602} 33603 33604@Article{ mangasarian:stable, 33605 author = {O. L. Mangasarian}, 33606 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 33607 journal = {Linear Algebra and Its Applications}, 33608 year = {1981}, 33609 volume = {41}, 33610 pages = {209--223} 33611} 33612 33613@Article{ mangasarian:sufficiency, 33614 author = {O. L. Mangasarian}, 33615 title = {Sufficiency of Exact Penalty Minimization}, 33616 journal = {SIAM Journal on Control and Optimization}, 33617 year = {1985}, 33618 month = jan, 33619 volume = {23}, 33620 pages = {30--37} 33621} 33622 33623@Article{ mangasarian:unconstrained, 33624 author = {O. L. Mangasarian}, 33625 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 33626 journal = {SIAM Journal on Control and Optimization}, 33627 year = {1975}, 33628 volume = {13}, 33629 pages = {772--791} 33630} 33631 33632@Book{ manne.richels:buying, 33633 author = {A. S. Manne and R. G. Richels}, 33634 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 33635 publisher = {MIT Press}, 33636 year = {1992}, 33637 address = {Cambridge MA} 33638} 33639 33640@Article{ manne.richels:global, 33641 author = {A. S. Manne and R. G. Richels}, 33642 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 33643 journal = {The Energy Journal}, 33644 year = {1991}, 33645 volume = {12}, 33646 pages = {87--107} 33647} 33648 33649@Article{ manne.richels:international, 33650 author = {A. S. Manne and R. G. Richels}, 33651 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 33652 journal = {Economic Review}, 33653 year = {1991}, 33654 volume = {81}, 33655 pages = {135--139} 33656} 33657 33658@Article{ manne.rutherford:international, 33659 author = {A. S. Manne and T. F. Rutherford}, 33660 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 33661 General Equilibrium Model}, 33662 journal = {The Energy Journal}, 33663 year = {1993}, 33664 volume = {14}, 33665 pages = {1--20} 33666} 33667 33668@InCollection{ manne:eta-macro, 33669 author = {A. S. Manne}, 33670 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 33671 booktitle = {Modeling Energy-Economy Interactions}, 33672 year = {1977}, 33673 editor = {C. J. Hitch}, 33674 publisher = {Resources for the Future}, 33675 address = {Washington DC} 33676} 33677 33678@PhDThesis{ maratos:exact, 33679 author = {N. Maratos}, 33680 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 33681 Problems}, 33682 year = {1978}, 33683 school = {Imperial College, University of London} 33684} 33685 33686@Article{ marcotte.dussault:note, 33687 author = {P. Marcotte and J.--P. Dussault}, 33688 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 33689 Inequalities}, 33690 journal = {Operations Research Letters}, 33691 year = {1987}, 33692 volume = {6}, 33693 pages = {35--42} 33694} 33695 33696@Article{ marcotte.zhu:exact, 33697 author = {P. Marcotte and D. L. Zhu}, 33698 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 33699 Problem}, 33700 journal = {Mathematical Programming}, 33701 year = {1996}, 33702 volume = {74}, 33703 pages = {141--158} 33704} 33705 33706@Article{ marcotte:algorithm, 33707 author = {P. Marcotte}, 33708 title = {A New Algorithm for Solving Variational Inequalities with Application to the 33709 Traffic Assignment Problem}, 33710 journal = {Mathematical Programming}, 33711 year = {1985}, 33712 volume = {33}, 33713 pages = {339--351} 33714} 33715 33716@Article{ marcotte:application, 33717 author = {P. Marcotte}, 33718 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 33719 Equilibrium Problems}, 33720 journal = {Information Systems and Operational Research}, 33721 year = {1991}, 33722 volume = {29}, 33723 pages = {258--270} 33724} 33725 33726@Article{ marcotte:network, 33727 author = {P. Marcotte}, 33728 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 33729 journal = {Mathematical Programming}, 33730 year = {1986}, 33731 volume = {34}, 33732 pages = {142--162} 33733} 33734 33735@Article{ markusen.rutherford.ea:el, 33736 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33737 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 33738 journal = {Cuadernos Economicos de Ice}, 33739 year = {1995}, 33740 volume = {59}, 33741 pages = {57--68} 33742} 33743 33744@Article{ markusen.rutherford.ea:trade, 33745 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33746 title = {Trade liberalization in a multinational-dominated industry}, 33747 journal = {Journal of International Economics}, 33748 year = {1995}, 33749 volume = {38}, 33750 pages = {95--118} 33751} 33752 33753@Article{ markusen.rutherford:discrete, 33754 author = {J. R. Markusen and T. F. Rutherford}, 33755 title = {Discrete plant-location decisions in an applied general equilibrium model of 33756 trade liberalization}, 33757 journal = {Weltwirtshchaftliches Archiv}, 33758 year = {1994} 33759} 33760 33761@Article{ markusen.wigle:nash, 33762 author = {J. Markusen and R. Wigle}, 33763 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 33764 Country Size, Scale Economies and Capital Mobility}, 33765 journal = {Journal of Political Mobility}, 33766 year = {1989}, 33767 volume = {97}, 33768 pages = {368--386} 33769} 33770 33771@Article{ marquardt:algorithm, 33772 author = {D. W. Marquardt}, 33773 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 33774 journal = {SIAM Journal on Applied Mathematics}, 33775 year = {1963}, 33776 volume = {11}, 33777 pages = {431--441} 33778} 33779 33780@Article{ martello.toth:algorithm, 33781 author = {S. Martello and P. Toth}, 33782 title = {A New Algorithm for the 0--1 Knapsack Problem}, 33783 journal = {Management Science}, 33784 year = {1988}, 33785 volume = {34}, 33786 pages = {633--644} 33787} 33788 33789@InCollection{ martello.toth:algorithms, 33790 author = {S. Martello and P. Toth}, 33791 title = {Algorithms for Knapsack Problems}, 33792 booktitle = {Surveys in Combinatorial Optimization}, 33793 year = {1987}, 33794 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 33795 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 33796 address = {Amsterdam} 33797} 33798 33799@Article{ martello.toth:mixture, 33800 author = {S. Martello and P. Toth}, 33801 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 33802 Problem}, 33803 journal = {Management Science}, 33804 year = {1984}, 33805 volume = {30}, 33806 pages = {765--771} 33807} 33808 33809@Article{ martello.toth:worst-case, 33810 author = {S. Martello and P. Toth}, 33811 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 33812 journal = {Mathematical Programming}, 33813 year = {1984}, 33814 volume = {28}, 33815 pages = {198--205} 33816} 33817 33818@Article{ martinet:regularisation, 33819 author = {Bernard Martinet}, 33820 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 33821 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 33822 year = {1970}, 33823 volume = {4}, 33824 pages = {154--159} 33825} 33826 33827@Article{ maskin.tirole:theory, 33828 author = {E. Maskin and J. Tirole}, 33829 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 33830 fixed costs}, 33831 journal = {Econometrica}, 33832 volume = {56}, 33833 year = {1988}, 33834 pages = {549--569} 33835} 33836 33837@Article{ maskin.tirole:theory*1, 33838 author = {E. Maskin and J. Tirole}, 33839 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 33840 Edgeworth cycles}, 33841 journal = {Econometrica}, 33842 volume = {56}, 33843 year = {1988}, 33844 pages = {571--579} 33845} 33846 33847@Article{ maskus.rutherford.ea:economic, 33848 author = {K. Maskus and T. F. Rutherford and S. Selby}, 33849 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 33850 {M}exico}, 33851 journal = {North American Journal of Economics and Finance}, 33852 year = {1996} 33853} 33854 33855@Article{ mastor:experimental, 33856 author = {A. A. Mastor}, 33857 title = {An Experimental Investigation and Comparative Evaluation of Production Line 33858 Balancing Techniques}, 33859 journal = {Management Science}, 33860 year = {1970}, 33861 volume = {16}, 33862 pages = {728--746} 33863} 33864 33865@Article{ mathias.pang:error, 33866 author = {R. Mathias and J. S. Pang}, 33867 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 33868 journal = {Linear Algebra and Its Applications}, 33869 year = {1990}, 33870 volume = {132}, 33871 pages = {123--136} 33872} 33873 33874@Article{ mathiesen:algorithm, 33875 author = {L. Mathiesen}, 33876 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 33877 {W}alrasian Equilibrium Model: An Example}, 33878 journal = {Mathematical Programming}, 33879 year = {1987}, 33880 volume = {37}, 33881 pages = {1--18} 33882} 33883 33884@Article{ mathiesen:computation, 33885 author = {L. Mathiesen}, 33886 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 33887 Problems}, 33888 journal = {Mathematical Programming Study}, 33889 year = {1985}, 33890 volume = {23}, 33891 pages = {144--162} 33892} 33893 33894@Article{ mathiesen:computational, 33895 author = {L. Mathiesen}, 33896 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 33897 Complementarity Problems}, 33898 journal = {Operations Research}, 33899 year = {1985}, 33900 volume = {33}, 33901 pages = {1225--1250} 33902} 33903 33904@Book{ matlab:users, 33905 author = {{MATLAB}}, 33906 title = {User's Guide}, 33907 year = {1992}, 33908 publisher = {The MathWorks, Inc.} 33909} 33910 33911@Book{ mcclelland.rummelhart:explorations, 33912 author = {J. L. McClelland and D. E. Rummelhart}, 33913 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 33914 Programs, and Exercises}, 33915 year = {1987}, 33916 publisher = {MIT Press}, 33917 address = {Cambridge, Massachusetts} 33918} 33919 33920@Article{ mccormick:modification, 33921 author = {G. P. McCormick}, 33922 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 33923 journal = {Mathematical Programming}, 33924 year = {1977}, 33925 volume = {13}, 33926 pages = {111--115} 33927} 33928 33929@Book{ mccormick:nonlinear, 33930 author = {G. P. McCormick}, 33931 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 33932 year = {1983}, 33933 publisher = {John Wiley \& Sons}, 33934 address = {New York} 33935} 33936 33937@Article{ mcculloch.pitts:logical, 33938 author = {W. McCulloch and W. Pitts}, 33939 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 33940 journal = {Bulletin of Mathematical Biophysics}, 33941 year = {1943}, 33942 volume = {7}, 33943 pages = {115--133} 33944} 33945 33946@TechReport{ mckenna.zenios:optimal, 33947 author = {M. McKenna and S. A. Zenios}, 33948 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 33949 institution = {Thinking Machines Corporation}, 33950 year = {1990}, 33951 type = {Working Paper}, 33952 address = {Cambridge, MA} 33953} 33954 33955@Article{ mckinnon:convergence, 33956 author = {K. I. M. McKinnon}, 33957 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 33958 journal = {SIAM Journal on Optimization}, 33959 year = {1998}, 33960 volume = {9}, 33961 pages = {148--158} 33962} 33963 33964@Article{ mcshane.monma.ea:implementation, 33965 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 33966 title = {An implementation of a primal-dual interior point method for linear programming}, 33967 journal = {ORSA Journal of Computing}, 33968 year = {1989}, 33969 volume = {1}, 33970 pages = {70--83} 33971} 33972 33973@PhDThesis{ medhi:decomposition, 33974 author = {D. Medhi}, 33975 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 33976 Optimization}, 33977 school = {Computer Sciences Department, University of Wisconsin}, 33978 year = {1987}, 33979 address = {Madison, Wisconsin}, 33980 note = {Technical Report 718} 33981} 33982 33983@Article{ medhi:parallel, 33984 author = {D. Medhi}, 33985 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 33986 Programming Problems}, 33987 journal = {Annals of Operations Research}, 33988 year = {1990}, 33989 volume = {22}, 33990 pages = {101--127} 33991} 33992 33993@Article{ megiddo:complexity, 33994 author = {N. Megiddo}, 33995 title = {On the complexity of polyhedral separability}, 33996 journal = {Discrete and Computational Geometry}, 33997 year = {1988}, 33998 volume = {3}, 33999 pages = {325--337} 34000} 34001 34002@Article{ megiddo:finding, 34003 author = {N. Megiddo}, 34004 title = {On Finding Primal-- and Dual--Optimal Bases}, 34005 journal = {ORSA Journal on Computing}, 34006 year = {1991}, 34007 volume = {3}, 34008 pages = {63--65} 34009} 34010 34011@Article{ mehrotra:implementation, 34012 author = {S. Mehrotra}, 34013 title = {On the implementation of a primal-dual interior point method}, 34014 journal = {SIAM Journal on Optimization}, 34015 year = {1992}, 34016 volume = {2}, 34017 pages = {575--601} 34018} 34019 34020@PhDThesis{ merrill:applications, 34021 author = {O. H. Merrill}, 34022 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 34023 Semicontinuous Point to Set Mappings}, 34024 year = {1972}, 34025 school = {University of Michigan} 34026} 34027 34028@Article{ merten.muller:variance, 34029 author = {A. G. Merten and M. E. Muller}, 34030 title = {Variance Minimization in Single Machine Sequencing Problems}, 34031 journal = {Management Science}, 34032 year = {1972}, 34033 volume = {18}, 34034 pages = {518--528} 34035} 34036 34037@TechReport{ meyer:continuity, 34038 author = {R. R. Meyer}, 34039 title = {Continuity Properties of Linear Programs}, 34040 institution = {Computer Sciences Department, University of Wisconsin}, 34041 year = {1979}, 34042 address = {Madison, Wisconsin}, 34043 number = {373} 34044} 34045 34046@Article{ miersemann.mittelmann:continuation, 34047 author = {E. Miersemann and H. D. Mittelmann}, 34048 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 34049 journal = {Journal of Computational and Applied Mathematics}, 34050 year = {1989}, 34051 volume = {26}, 34052 pages = {23--34} 34053} 34054 34055@Article{ mifflin:semismooth, 34056 author = {R. Mifflin}, 34057 title = {Semismooth and semiconvex functions in constrained optimization}, 34058 journal = {SIAM Journal on Control and Optimization}, 34059 year = {1977}, 34060 volume = {15}, 34061 pages = {957--972} 34062} 34063 34064@Article{ mifflin:stable, 34065 author = {R. Mifflin}, 34066 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 34067 journal = {Mathematical Programming}, 34068 vol = {16}, 34069 pages = {141--158}, 34070 year = {1979} 34071} 34072 34073@Book{ miller:survival, 34074 author = {Jr. R. G. Miller}, 34075 title = {Survival Analysis}, 34076 year = {1981}, 34077 publisher = {John Wiley \& Sons}, 34078 address = {New York} 34079} 34080 34081@Book{ minsky.papert:perceptrons, 34082 author = {M. Minsky and S. Papert}, 34083 title = {Perceptrons: An Introduction to Computational Geometry}, 34084 year = {1969}, 34085 publisher = {MIT Press}, 34086 address = {Cambridge, Massachusetts} 34087} 34088 34089@Article{ minty:monotone, 34090 author = {G. J. Minty}, 34091 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 34092 journal = {Duke Mathematics Journal}, 34093 year = {1962}, 34094 volume = {29}, 34095 pages = {341--346} 34096} 34097 34098@Article{ minty:monotonicity, 34099 author = {G. J. Minty}, 34100 title = {On the Monotonicity of the Gradient of a Convex Function}, 34101 journal = {Pacific Journal of Mathematics}, 34102 year = {1964}, 34103 volume = {14}, 34104 pages = {243--247} 34105} 34106 34107@TechReport{ mizuno.jarre.ea:unified, 34108 author = {S. Mizuno and F. Jarre and J. Stoer}, 34109 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 34110 linear complementarity problems}, 34111 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 34112 address = {W{\"{u}}rzburg, Germany}, 34113 year = {1994}, 34114 number = {Nr. 213}, 34115 type = {Preprint} 34116} 34117 34118@TechReport{ mizuno:polynomiality, 34119 author = {S. Mizuno}, 34120 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 34121 for linear programming}, 34122 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 34123 year = {1993}, 34124 number = {1006}, 34125 address = {Ithaca, New York}, 34126 month = jan 34127} 34128 34129@Article{ mohan.mageras.ea:clinically, 34130 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 34131 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 34132 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 34133 journal = {Medical Physics}, 34134 year = {1992}, 34135 volume = {19}, 34136 number = {4}, 34137 pages = {933--944} 34138} 34139 34140@Article{ mohan:field, 34141 author = {R. Mohan}, 34142 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 34143 Collimation}, 34144 journal = {Seminars in Radiation Oncology}, 34145 year = {1995}, 34146 volume = {5}, 34147 number = {2}, 34148 pages = {86--99} 34149} 34150 34151@Article{ monteiro.pang.ea:positive, 34152 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 34153 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 34154 journal = {SIAM Journal on Optimization}, 34155 year = {1995}, 34156 volume = {5}, 34157 pages = {129--148} 34158} 34159 34160@Article{ monteiro.tsuchiya:limiting, 34161 author = {R. D. C. Monteiro and T. Tsuchiya}, 34162 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 34163 Monotone Horizontal Linear Complementarity Problem}, 34164 year = {1996}, 34165 journal = {Mathematics of Operations Research}, 34166 pages = {793--814}, 34167 volume = {21} 34168} 34169 34170@Article{ monteiro.wright:local, 34171 author = {R. D. C. Monteiro and S. J. Wright}, 34172 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 34173 journal = {Computational Optimization and Applications}, 34174 year = {1994}, 34175 volume = {3}, 34176 pages = {131--155} 34177} 34178 34179@Article{ monteiro.wright:superlinear, 34180 author = {R. D. C. Monteiro and S. J. Wright}, 34181 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 34182 year = {1996}, 34183 journal = {SIAM Journal on Optimization}, 34184 volume = {6}, 34185 pages = {1--18} 34186} 34187 34188@Article{ monteiro.wright:superlinear*1, 34189 author = {R. D. C. Monteiro and S. J. Wright}, 34190 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 34191 journal = {Mathematical Programming}, 34192 year = {1995}, 34193 volume = {69}, 34194 pages = {311--333} 34195} 34196 34197@Article{ more.garbow.ea:testing, 34198 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 34199 title = {Testing Unconstrained Optimization Software}, 34200 journal = {ACM Transactions on Mathematical Software}, 34201 year = {1981}, 34202 volume = {7}, 34203 pages = {17--41} 34204} 34205 34206@Article{ more.rheinboldt:p, 34207 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 34208 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 34209 Mappings}, 34210 journal = {Linear Algebra and Its Applications}, 34211 year = {1973}, 34212 volume = {6}, 34213 pages = {45--68} 34214} 34215 34216@Article{ more.sorensen:use, 34217 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34218 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 34219 journal = {Mathematical Programming}, 34220 year = {1979}, 34221 volume = {16}, 34222 pages = {1--20} 34223} 34224 34225@Article{ more.sorensen:computing, 34226 author = {J. J. Mor\'{e} and D. C. Sorensen}, 34227 title = {Computing a Trust Region Step}, 34228 journal = {SIAM Journal on Scientific and Statistical Computing}, 34229 year = {1983}, 34230 volume = {4}, 34231 pages = {553--572} 34232} 34233 34234@Article{ more.toraldo:solution, 34235 author = {J. J. Mor\'e and G. Toraldo}, 34236 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 34237 journal = {SIAM Journal on Optimization}, 34238 year = {1991}, 34239 volume = {1}, 34240 pages = {93--113} 34241} 34242 34243@TechReport{ more.vavasis:solution, 34244 author = {J. J. Mor\'{e} and S. A. Vavasis}, 34245 title = {On the Solution of Concave Knapsack Problems}, 34246 institution = {Argonne National Laboratory}, 34247 year = {1988}, 34248 address = {Argonne, Illinois}, 34249 number = {ANL/MCS--P40--1288}, 34250 type = {Mathematics and Computer Science Division Report} 34251} 34252 34253@Book{ more.wright:optimization, 34254 author = {J. J. Mor\'{e} and S. J. Wright}, 34255 title = {Optimization Software Guide}, 34256 publisher = {SIAM}, 34257 address = {Philadelphia, Pennsylvania}, 34258 series = {Frontiers in Applied Mathematics}, 34259 number = {14}, 34260 year = {1993} 34261} 34262 34263@TechReport{ more.wu:global, 34264 author = {J. J. Mor\'{e} and Z. Wu}, 34265 title = {Global Continuation for Distance Geometry Problems}, 34266 institution = {Argonne National Laboratory}, 34267 year = {1995}, 34268 type = {Preprint}, 34269 number = {MCS-P505-0395}, 34270 address = {Argonne, Illinois} 34271} 34272 34273@TechReport{ more.wu:issues, 34274 author = {J. J. Mor\'{e} and Z. Wu}, 34275 title = {Issues in Large-Scale Global Molecular Optimization}, 34276 institution = {Argonne National Laboratory}, 34277 year = {1995}, 34278 type = {Preprint}, 34279 number = {MCS-P539-1095}, 34280 address = {Argonne, Illinois} 34281} 34282 34283@TechReport{ more:collection, 34284 author = {J. J. Mor\'e}, 34285 title = {A Collection of Nonlinear Model Problems}, 34286 institution = {Argonne National Laboratory}, 34287 year = {1989}, 34288 type = {Preprint}, 34289 address = {Argonne, Illinois}, 34290 number = {MCS-P60-0289} 34291} 34292 34293@Article{ more:global, 34294 author = {J. J. Mor\'e}, 34295 title = {Global Methods for Nonlinear Complementarity Problems}, 34296 year = {1996}, 34297 journal = {Mathematics of Operations Research}, 34298 pages = {589--614}, 34299 volume = {21} 34300} 34301 34302@Article{ moreau:proximite, 34303 author = {J.--J. Moreau}, 34304 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 34305 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 34306 year = {1965}, 34307 volume = {93}, 34308 pages = {273--299} 34309} 34310 34311@Article{ morrill.lane.ea:dose-volume, 34312 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 34313 title = {Dose-volume considerations with linear programming}, 34314 journal = {Medical Physics}, 34315 year = {1991}, 34316 volume = {18}, 34317 number = {6}, 34318 pages = {1201--1210} 34319} 34320 34321@Article{ morrill:very, 34322 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 34323 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 34324 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34325 year = {1995}, 34326 volume = {31}, 34327 pages = {179--188} 34328} 34329 34330@TechReport{ morshedi.tapia:karmarkar, 34331 author = {A. M. Morshedi and R. A. Tapia}, 34332 title = {Karmarkar as a Classical Method}, 34333 institution = {Department of Mathematical Sciences, Rice University}, 34334 year = {1987}, 34335 number = {87--7}, 34336 type = {Technical Report} 34337} 34338 34339@Article{ mosco:dual, 34340 author = {U. Mosco}, 34341 title = {Dual Variational Inequalities}, 34342 journal = {Journal of Mathematical Analysis and its Applications}, 34343 year = {1972}, 34344 volume = {40}, 34345 pages = {202--206} 34346} 34347 34348@Article{ motzkin.schoenberg:relaxation, 34349 author = {T. S. Motzkin and I. J. Schoenberg}, 34350 title = {The relaxation method for linear inequalities}, 34351 journal = {Canadian Journal of Mathematics}, 34352 year = {1954}, 34353 volume = {6}, 34354 pages = {393--404} 34355} 34356 34357@InProceedings{ muhlenbein:parallel, 34358 crossref = {schaeffer:third}, 34359 author = {H. M{\"{}u}hlenbein}, 34360 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 34361 pages = {416--421} 34362} 34363 34364@Article{ mukhopadhyay.roy.ea:polynomial, 34365 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 34366 title = {A polynomial time algorithm for generating neural networks for pattern 34367 classification: Its stability properties and some test results}, 34368 journal = {Neural Computation}, 34369 year = {1993}, 34370 volume = {5}, 34371 pages = {317--330} 34372} 34373 34374@Article{ mulvey.ruszczynski:diagonal, 34375 author = {J. M. Mulvey and A. Ruszczynski}, 34376 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 34377 journal = {Operations Research Letters}, 34378 year = {1992}, 34379 volume = {12}, 34380 pages = {205--215} 34381} 34382 34383@TechReport{ mulvey.ruszczynski:scenario, 34384 author = {J. M. Mulvey and A. Ruszczynski}, 34385 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 34386 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 34387 year = {1991}, 34388 address = {Princeton, New Jersey}, 34389 number = {SOR 91-19}, 34390 type = {Technical Report} 34391} 34392 34393@PhDThesis{ munson:algorithms, 34394 author = {T. S. Munson}, 34395 title = {Algorithms and Environments for Complementarity}, 34396 school = {University of Wisconsin--Madison}, 34397 year = {2000}, 34398 address = {Madison, Wisconsin}, 34399 month = aug, 34400 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 34401} 34402 34403@Article{ munson.facchinei.ea:semismooth, 34404 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 34405 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 34406 journal = {INFORMS Journal on Computing}, 34407 year = {2001}, 34408 volume = {forthcoming} 34409} 34410 34411@Article{ murchland:braess, 34412 author = {J. D. Murchland}, 34413 title = {Braess' Paradox of Traffic Flow}, 34414 journal = {Transportation Research}, 34415 year = {1970}, 34416 volume = {4}, 34417 pages = {391--394} 34418} 34419 34420@Unpublished{ murphy.aha:uci, 34421 author = {P. M. Murphy and D. W. Aha}, 34422 title = {{UCI} Repository of Machine Learning Databases}, 34423 year = {1992}, 34424 note = {Department of Information and Computer Science, University of California, Irvine, 34425 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 34426} 34427 34428@Book{ murphy.lawrence.ea:american, 34429 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 34430 title = {American Cancer Society Textbook of Clinical Oncology}, 34431 publisher = {The American Cancer Society, Inc.}, 34432 address = {Atlanta, Georgia}, 34433 year = {1995} 34434} 34435 34436@Article{ murphy.sherali.ea:mathematical, 34437 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 34438 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 34439 Equilibrium}, 34440 journal = {Mathematical Programming}, 34441 year = {1982}, 34442 volume = {24}, 34443 pages = {92--106} 34444} 34445 34446@TechReport{ murtagh.saunders:minos, 34447 author = {B. A. Murtagh and M. A. Saunders}, 34448 title = {{MINOS} 5.0 User's Guide}, 34449 institution = {Stanford University}, 34450 address = {Stanford, California}, 34451 year = {1983}, 34452 number = {{SOL} 83.20}, 34453 type = {Technical Report} 34454} 34455 34456@InProceedings{ murthy.kasif.ea:oc1, 34457 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 34458 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 34459 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 34460 year = {1993}, 34461 publisher = {The AAAI Press/The MIT Press}, 34462 address = {Cambridge, MA 02142}, 34463 pages = {322--327} 34464} 34465 34466@Book{ murty:linear, 34467 author = {K. G. Murty}, 34468 title = {Linear Complementarity, Linear and Nonlinear Programming}, 34469 year = {1988}, 34470 publisher = {Helderman-Verlag}, 34471 address = {Berlin} 34472} 34473 34474@Book{ murty:linear*1, 34475 author = {K. G. Murty}, 34476 title = {Linear Programming}, 34477 year = {1983}, 34478 publisher = {John Wiley \& Sons}, 34479 address = {New York} 34480} 34481 34482@Article{ murty:number, 34483 author = {K. G. Murty}, 34484 title = {On the number of solutions of the complementarity problem and spanning properties 34485 of cones}, 34486 journal = {Linear Algebra and Its Applications}, 34487 year = {1972}, 34488 volume = {5}, 34489 pages = {65--108} 34490} 34491 34492@Book{ murty:linear*2, 34493 author = {K. G. Murty}, 34494 title = {Linear and Combinatorial Programming}, 34495 year = {1976}, 34496 publisher = {John Wiley \& Sons}, 34497 address = {New York} 34498} 34499 34500@Book{ nagurney:network, 34501 author = {A. Nagurney}, 34502 title = {Network Economics -- {A} Variational Inequality Approach}, 34503 publisher = {Kluwer Academic Publishers}, 34504 year = {1993}, 34505 address = {Dordrecht, The Netherlands} 34506} 34507 34508@Article{ nash.nocedal:numerical, 34509 author = {S. G. Nash and J. Nocedal}, 34510 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 34511 Method for Large Scale Optimization}, 34512 journal = {SIAM Journal on Optimization}, 34513 year = {1991}, 34514 volume = {3}, 34515 pages = {358--372} 34516} 34517 34518@Article{ nash:equilibrium, 34519 author = {J. F. Nash}, 34520 title = {Equilibrium Points in {N}--Person Games}, 34521 journal = {Proceedings of the National Academy of Sciences}, 34522 year = {1950}, 34523 volume = {36}, 34524 pages = {48--49} 34525} 34526 34527@Article{ nash:non-cooperative, 34528 author = {J. F. Nash}, 34529 title = {Non-cooperative games}, 34530 journal = {Annals of Mathematics}, 34531 year = {1951}, 34532 volume = {54}, 34533 pages = {286--295} 34534} 34535 34536@Article{ nash:newton-type, 34537 author = {S. G. Nash}, 34538 title = {{N}ewton--Type Minimization via {L}anczos Method}, 34539 journal = {SIAM Journal on Numerical Analysis}, 34540 year = {1984}, 34541 volume = {21}, 34542 pages = {770--788} 34543} 34544 34545@Article{ nauss:efficient, 34546 author = {R. M. Nauss}, 34547 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 34548 journal = {Management Science}, 34549 year = {1976}, 34550 volume = {23}, 34551 pages = {27--31} 34552} 34553 34554@Book{ nazareth:computer, 34555 author = {J. L. Nazareth}, 34556 title = {Computer Solution of Linear Programs}, 34557 year = {1987}, 34558 publisher = {Oxford University Press}, 34559 address = {Oxford} 34560} 34561 34562@Article{ nelder.mead:simplex, 34563 title = {A Simplex Method for Function Minimization}, 34564 author = {J. A. Nelder and R. Mead}, 34565 journal = {Computer Journal}, 34566 volume = {7}, 34567 pages = {308--313}, 34568 year = {1965} 34569} 34570 34571@Article{ nemhauser.savelsbergh.ea:minto, 34572 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 34573 title = {{MINTO}, {A} Mixed Integer Optimizer}, 34574 journal = {Operations Research Letters}, 34575 year = {1994}, 34576 optkey = {}, 34577 optvolume = {15}, 34578 optnumber = {}, 34579 optpages = {47--58}, 34580 optmonth = {}, 34581 optnote = {}, 34582 optannote = {} 34583} 34584 34585@Book{ nemhauser.wolsey:integer, 34586 author = {G. L. Nemhauser and L. A. Wolsey}, 34587 title = {Integer and Combinatorial Optimization}, 34588 publisher = {John Wiley \& Sons}, 34589 year = {1988}, 34590 address = {New York, NY} 34591} 34592 34593@Article{ nestor.pasurka:alternative, 34594 author = {D. Vaughn Nestor and C. Pasurka}, 34595 title = {Alternative Specifications for Environmental Control Costs in a General 34596 Equilibrium Framework}, 34597 journal = {Economics Letters}, 34598 year = {1995}, 34599 volume = {48}, 34600 pages = {273--280} 34601} 34602 34603@Article{ nestor.pasurka:cge, 34604 author = {D. Vaughn Nestor and C. Pasurka}, 34605 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 34606 of Environmental Policy}, 34607 journal = {Economic Modelling}, 34608 year = {1995}, 34609 volume = {12}, 34610 pages = {53--59} 34611} 34612 34613@Article{ newman.shapiro:theorems, 34614 author = {D. J. Newman and H. S. Shapiro}, 34615 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 34616 journal = {Duke Mathematical Journal}, 34617 year = {1963}, 34618 volume = {30}, 34619 pages = {673--682} 34620} 34621 34622@Article{ ng.peyton:block, 34623 author = {E. Ng and B. Peyton}, 34624 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 34625 journal = {SIAM Journal on Scientific and Statistical Computing}, 34626 year = {1993}, 34627 volume = {14}, 34628 pages = {1034--1056} 34629} 34630 34631@TechReport{ nielsen.zenios:solving, 34632 author = {S. S. Nielsen and S. A. Zenios}, 34633 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 34634 Algorithms}, 34635 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 34636 year = {1992}, 34637 address = {Philadelphia}, 34638 number = {92-01-05} 34639} 34640 34641@Article{ niemierko:optimization, 34642 author = {A. Niemierko}, 34643 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 34644 Points and Constraints}, 34645 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34646 year = {1992}, 34647 volume = {23}, 34648 pages = {99--108} 34649} 34650 34651@InCollection{ niemierko:treatment, 34652 author = {A. Niemierko}, 34653 title = {Treatment Plan Optimization}, 34654 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 34655 editor = {J. A. Purdy and B. Emami}, 34656 publisher = {Medical Physics Publishing}, 34657 year = {1993}, 34658 pages = {49--55}, 34659 address = {St. Louis, Missouri} 34660} 34661 34662@Article{ niemireko:optimization, 34663 author = {A. Niemierko}, 34664 title = {Optimization of intensity modulated beams: Local or global optimum?}, 34665 journal = {Medical Physics}, 34666 year = {1996}, 34667 optvolume = {23}, 34668 optpages = {1072} 34669} 34670 34671@Manual{ nih:radiation, 34672 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 34673 author = {N. C. I. National Institutes of Health}, 34674 organization = {NIH Publication}, 34675 address = {Bethesda, Maryland}, 34676 edition = {97-2227}, 34677 year = {1997} 34678} 34679 34680@Book{ nilsson:learning, 34681 author = {N. J. Nilsson}, 34682 title = {Learning Machines}, 34683 year = {1966}, 34684 publisher = {MIT Press}, 34685 address = {Cambridge, Massachusetts} 34686} 34687 34688@Article{ nocedal:theory, 34689 author = {J. Nocedal}, 34690 title = {Theory of Algorithms for Unconstrained Optimization}, 34691 journal = {Acta Numerica}, 34692 year = {1992}, 34693 pages = {199--242} 34694} 34695 34696@InProceedings{ noyes:neural, 34697 author = {J. L. Noyes}, 34698 title = {Neural Network Optimization Methods}, 34699 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 34700 Processing}, 34701 year = {1991}, 34702 publisher = {Indiana-Purdue University}, 34703 address = {Fort Wayne, Indiana}, 34704 pages = {1--12} 34705} 34706 34707@Article{ nygard.juell.ea:neural, 34708 author = {K. E. Nygard and P. Juell and N. Kadaba}, 34709 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 34710 journal = {ORSA Journal on Computing}, 34711 year = {1990}, 34712 volume = {4}, 34713 pages = {353--364} 34714} 34715 34716@Article{ oh.goenka:elastohydrodynamic, 34717 author = {K. P. Oh and P. K. Goenka}, 34718 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 34719 journal = {Transactions of the {ASME}, Journal of Tribology}, 34720 volume = {107}, 34721 year = {1985}, 34722 pages = {389--395} 34723} 34724 34725@Article{ oh.li.ea:elastohydrodynamic, 34726 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 34727 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 34728 journal = {Transactions of the {ASME}, Journal of Tribology}, 34729 volume = {109}, 34730 pages = {356--362}, 34731 year = {1987} 34732} 34733 34734@Article{ oh:analysis, 34735 author = {K. P. Oh}, 34736 title = {Analysis of a Needle Bearing}, 34737 journal = {Transactions of the {ASME}, Journal of Tribology}, 34738 volume = {106}, 34739 pages = {78--87}, 34740 year = {1984} 34741} 34742 34743@Article{ oh:formulation, 34744 author = {K. P. Oh}, 34745 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 34746 Complementarity Problem}, 34747 journal = {Transactions of the {ASME}, Journal of Tribology}, 34748 volume = {108}, 34749 year = {1986}, 34750 pages = {598--604} 34751} 34752 34753@Article{ oh:numerical, 34754 author = {K. P. Oh}, 34755 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 34756 Nonlinear Complementarity Problem}, 34757 journal = {Transactions of the {ASME}, Journal of Tribology}, 34758 volume = {106}, 34759 year = {1984}, 34760 pages = {88--95} 34761} 34762 34763@Article{ olivera.shepard.ea:maximum, 34764 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 34765 and E. E. Fitchard and T. R. Mackie}, 34766 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 34767 journal = {Physics in Medicine and Biology}, 34768 year = {1998}, 34769 pages = {3277--3294} 34770} 34771 34772@Article{ opial:weak, 34773 author = {Z. Opial}, 34774 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 34775 Mappings}, 34776 journal = {Bulletin of the American Mathematical Society}, 34777 year = {1967}, 34778 volume = {73}, 34779 pages = {591--597} 34780} 34781 34782@Book{ orchard-hays:advanced, 34783 author = {W. Orchard--Hays}, 34784 title = {Advanced Linear Programming Computing Techniques}, 34785 year = {1968}, 34786 publisher = {McGraw--Hill}, 34787 address = {New York} 34788} 34789 34790@Article{ orourke.taylor.ea:factor, 34791 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 34792 title = {Factor price convergence in the late nineteenth century}, 34793 journal = {International Economic Review}, 34794 year = {1996} 34795} 34796 34797@Article{ orourke.williamson:open, 34798 author = {K. O'Rourke and J. G. Williamson}, 34799 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 34800 accounting}, 34801 journal = {Scandinavian Economic and Social History}, 34802 year = {1995}, 34803 volume = {XLIII}, 34804 pages = {171--203} 34805} 34806 34807@Article{ orourke:costs, 34808 author = {K. O'Rourke}, 34809 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 34810 journal = {Research in Economic History}, 34811 year = {1995}, 34812 volume = {15}, 34813 pages = {215--259} 34814} 34815 34816@Article{ orourke:industrial, 34817 author = {K. O'Rourke}, 34818 title = {Industrial policy, employment policy and the non-traded sector}, 34819 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 34820 year = {1996} 34821} 34822 34823@Article{ orourke:measuring, 34824 author = {K. O'Rourke}, 34825 title = {Measuring protection: a cautionary tale}, 34826 journal = {Journal of Development Economics}, 34827 year = {1996} 34828} 34829 34830@Book{ ortega.rheinboldt:iterative, 34831 author = {J. M. Ortega and W. C. Rheinboldt}, 34832 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 34833 year = {1970}, 34834 publisher = {Academic Press}, 34835 address = {San Diego, California} 34836} 34837 34838@Book{ ortega:introduction, 34839 author = {J. M. Ortega}, 34840 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 34841 year = {1988}, 34842 publisher = {Plenum Press}, 34843 address = {New York} 34844} 34845 34846@Book{ ortega:numerical, 34847 author = {J. M. Ortega}, 34848 title = {Numerical Analysis, {A} Second Course}, 34849 year = {1972}, 34850 publisher = {Academic Press} 34851} 34852 34853@Article{ osborne.womersley:strong, 34854 author = {M. R. Osborne and R. S. Womersley}, 34855 title = {Strong uniqueness in sequential linear programming}, 34856 journal = {Journal of the Australian Mathematical Society, Series B}, 34857 year = {1990}, 34858 volume = {31}, 34859 pages = {379--384} 34860} 34861 34862@InCollection{ osborne:strong, 34863 author = {M. R. Osborne}, 34864 title = {Strong uniqueness in nonlinear approximation}, 34865 booktitle = {The numerical solution of nonlinear problems}, 34866 year = {1981}, 34867 editor = {C. T. H. Baker and C. Phillips}, 34868 publisher = {Clarendon Press}, 34869 address = {Oxford} 34870} 34871 34872@Book{ outrata.kocvara.ea:nonsmooth, 34873 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 34874 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 34875 publisher = {Kluwer Academic Publishers}, 34876 year = {1998}, 34877 address = {Dordrecht, The Netherlands} 34878} 34879 34880@Article{ outrata.zowe:numerical, 34881 author = {J. V. Outrata and J. Zowe}, 34882 title = {A Numerical Approach to Optimization Problems with Variational Inequality 34883 Constraints}, 34884 journal = {Mathematical Programming}, 34885 year = {1995}, 34886 volume = {68}, 34887 pages = {105--130} 34888} 34889 34890@Article{ outrata:necessary, 34891 author = {J. V. Outrata}, 34892 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 34893 journal = {Journal of Optimization Theory and Applications}, 34894 volume = {76}, 34895 year = {1993}, 34896 pages = {305--320} 34897} 34898 34899@Article{ outrata:numerical, 34900 author = {J. V. Outrata}, 34901 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 34902 journal = {Zeitschrift f{\"{u}}r Operations Research}, 34903 volume = {4}, 34904 year = {1990}, 34905 pages = {255--278} 34906} 34907 34908@Article{ outrata:optimization, 34909 author = {J. V. Outrata}, 34910 title = {On Optimization Problems with Variational Inequality Constraints}, 34911 journal = {SIAM Journal on Optimization}, 34912 volume = {4}, 34913 year = {1994}, 34914 pages = {340--357} 34915} 34916 34917@Article{ paige.saunders:lsqr, 34918 author = {C. C. Paige and M. A. Saunders}, 34919 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 34920 journal = {{ACM} Transactions on Mathematical Software}, 34921 year = {1982}, 34922 volume = {8}, 34923 pages = {43--71} 34924} 34925 34926@Article{ paige.saunders:solution, 34927 author = {C. C. Paige and M. A. Saunders}, 34928 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 34929 journal = {SIAM Journal on Numerical Analysis}, 34930 year = {1975}, 34931 volume = {12}, 34932 pages = {617--629} 34933} 34934 34935@Article{ palacios-gomez.lasdon.ea:nonlinear, 34936 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 34937 title = {Nonlinear Optimization by Successive Linear Programming}, 34938 journal = {Management Science}, 34939 year = {1982}, 34940 volume = {28}, 34941 pages = {1106--1120} 34942} 34943 34944@Article{ palomares.mangasarian:superlinearly, 34945 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 34946 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 34947 Optimization Problems}, 34948 journal = {Mathematical Programming}, 34949 year = {1976}, 34950 volume = {11}, 34951 pages = {1--13} 34952} 34953 34954@Article{ panagiotopoulos.al-fahed:robot, 34955 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 34956 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 34957 journal = {The International Journal of Robotics Research}, 34958 year = {1994}, 34959 volume = {13}, 34960 pages = {127--136} 34961} 34962 34963@Book{ panagiotopoulos:hemivariational, 34964 author = {P. D. Panagiotopoulos}, 34965 title = {Hemivariational Inequalities}, 34966 publisher = {Springer-Verlag}, 34967 address = {Berlin}, 34968 year = {1993} 34969} 34970 34971@Book{ panagiotopoulos:inequality, 34972 author = {P. D. Panagiotopoulos}, 34973 title = {Inequality Problems in Mechanics and Applications}, 34974 publisher = {Birkh{\"{a}}user}, 34975 address = {Boston}, 34976 year = {1985} 34977} 34978 34979@Article{ pang.chan:iterative, 34980 author = {J. S. Pang and D. Chan}, 34981 title = {Iterative Methods for Variational and Complementarity Problems}, 34982 journal = {Mathematical Programming}, 34983 year = {1982}, 34984 volume = {24}, 34985 pages = {284--313} 34986} 34987 34988@Article{ pang.gabriel:nesqp, 34989 author = {J. S. Pang and S. A. Gabriel}, 34990 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 34991 journal = {Mathematical Programming}, 34992 year = {1993}, 34993 volume = {60}, 34994 pages = {295--338} 34995} 34996 34997@Article{ pang.han.ea:minimization, 34998 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 34999 title = {Minimization of Locally {L}ipschitzian Functions}, 35000 journal = {SIAM Journal on Optimization}, 35001 year = {1991}, 35002 volume = {1}, 35003 pages = {57--82} 35004} 35005 35006@Article{ pang.qi:nonsmooth, 35007 author = {J. S. Pang and L. Qi}, 35008 title = {Nonsmooth Equations: Motivation and Algorithms}, 35009 journal = {SIAM Journal on Optimization}, 35010 year = {1993}, 35011 volume = {3}, 35012 pages = {443--465} 35013} 35014 35015@Article{ pang.trinkle.ea:complementarity, 35016 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 35017 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 35018 journal = {Computational Optimization and Applications}, 35019 volume = {5}, 35020 pages = {97--138}, 35021 year = {1996} 35022} 35023 35024@Article{ pang.trinkle:complementarity, 35025 author = {J. S. Pang and J. C. Trinkle}, 35026 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 35027 Contact Problems with {C}oulomb Friction}, 35028 year = {1996}, 35029 journal = {Mathematical Programming}, 35030 volume = {73}, 35031 pages = {199--226} 35032} 35033 35034@TechReport{ pang.wang:embedding, 35035 author = {J. S. Pang and Z. P. Wang}, 35036 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 35037 Problems}, 35038 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35039 year = {1990}, 35040 address = {Baltimore, Maryland} 35041} 35042 35043@TechReport{ pang.yang:parallel, 35044 author = {J. S. Pang and J. M. Yang}, 35045 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 35046 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 35047 year = {1987}, 35048 address = {Baltimore, Maryland}, 35049 type = {Manuscript} 35050} 35051 35052@Article{ pang.yu:linearized, 35053 author = {J. S. Pang and C. S. Yu}, 35054 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 35055 Networks}, 35056 journal = {Networks}, 35057 volume = {14}, 35058 pages = {427--438}, 35059 year = {1984} 35060} 35061 35062@Article{ pang:b-differentiable, 35063 author = {J. S. Pang}, 35064 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 35065 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 35066 Inequality Problems}, 35067 journal = {Mathematical Programming}, 35068 year = {1991}, 35069 volume = {51}, 35070 pages = {101--132} 35071} 35072 35073@InCollection{ pang:complementarity, 35074 author = {J. S. Pang}, 35075 title = {Complementarity Problems}, 35076 booktitle = {Handbook in Global Optimization}, 35077 publisher = {Kluwer Academic Publishers}, 35078 year = {1994}, 35079 editor = {R. Horst and P. Pardalos}, 35080 address = {Boston} 35081} 35082 35083@Article{ pang:convergence, 35084 author = {J. S. Pang}, 35085 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 35086 Problem}, 35087 journal = {Journal of Optimization Theory and Applications}, 35088 year = {1982}, 35089 volume = {37}, 35090 pages = {149--162} 35091} 35092 35093@Article{ pang:convergence*1, 35094 author = {J. S. Pang}, 35095 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 35096 Application of some Sensitivity Results}, 35097 journal = {Mathematical Programming}, 35098 year = {1993}, 35099 volume = {58}, 35100 pages = {149--160} 35101} 35102 35103@Article{ pang:inexact, 35104 author = {J. S. Pang}, 35105 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 35106 journal = {Mathematical Programming}, 35107 year = {1986}, 35108 volume = {36}, 35109 pages = {54--71} 35110} 35111 35112@Article{ pang:more, 35113 author = {J. S. Pang}, 35114 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 35115 Complementarity Problem}, 35116 journal = {Journal of Optimization Theory and Applications}, 35117 year = {1986}, 35118 volume = {49}, 35119 pages = {107--134} 35120} 35121 35122@Article{ pang:more*1, 35123 author = {J. S. Pang}, 35124 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 35125 Complementarity Problems}, 35126 journal = {Journal of Optimization Theory and Applications}, 35127 year = {1986}, 35128 volume = {49}, 35129 pages = {107--134} 35130} 35131 35132@Article{ pang:necessary, 35133 author = {J. S. Pang}, 35134 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 35135 the Linear Complementarity Problem}, 35136 journal = {Journal of Optimization Theory and Applications}, 35137 year = {1984}, 35138 volume = {42}, 35139 pages = {1--17} 35140} 35141 35142@Article{ pang:newtons, 35143 author = {J. S. Pang}, 35144 title = {{N}ewton's Method for {B}--Differentiable Equations}, 35145 journal = {Mathematics of Operations Research}, 35146 year = {1990}, 35147 volume = {15}, 35148 pages = {311--341} 35149} 35150 35151@Article{ pang:posteriori, 35152 author = {J. S. Pang}, 35153 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 35154 Problem}, 35155 journal = {Mathematics of Operations Research}, 35156 year = {1987}, 35157 volume = {12}, 35158 pages = {474--484} 35159} 35160 35161@Article{ pantoja.mayne:sequential, 35162 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 35163 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 35164 with Control Inequality Constraints}, 35165 journal = {International Journal on Control}, 35166 year = {1991}, 35167 volume = {53}, 35168 pages = {823--836} 35169} 35170 35171@Book{ papadimitriou.steiglitz:combinatorial, 35172 author = {C. H. Papadimitriou and K. Steiglitz}, 35173 title = {Combinatorial Optimization: Algorithms and Complexity}, 35174 year = {1982}, 35175 publisher = {Prentice-Hall, Inc}, 35176 address = {Englewood Cliffs, New Jersey} 35177} 35178 35179@Article{ papanikolau.mackie.ea:investigation, 35180 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 35181 Reckwerdt}, 35182 title = {Investigation of the convolution method for polyenergetic spectra}, 35183 journal = {Medical Physics}, 35184 year = {1993}, 35185 volume = {20}, 35186 number = {5}, 35187 pages = {1327--1336} 35188} 35189 35190@Article{ parisot:resolution, 35191 author = {G. R. Parisot}, 35192 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 35193 Lin\'{e}aire par Application de la Programmation Logarithmique}, 35194 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 35195 year = {1961}, 35196 volume = {20}, 35197 pages = {227--259} 35198} 35199 35200@Article{ parker.cave.ea:comparison, 35201 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 35202 title = {Comparison of Simplex Algorithms}, 35203 journal = {Analytica Chimica Acta}, 35204 year = {1985}, 35205 volume = {175}, 35206 pages = {231--237} 35207} 35208 35209@InProceedings{ parker:optimal, 35210 author = {D. Parker}, 35211 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 35212 Second Order Hebbian Learning}, 35213 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 35214 II}, 35215 year = {1987}, 35216 address = {San Diego:IEEE}, 35217 pages = {593--600} 35218} 35219 35220@Book{ pascali.sburlan:nonlinear, 35221 author = {D. Pascali and S. Sburlan}, 35222 title = {Nonlinear Mappings of Monotone Type}, 35223 publisher = {Editura Academeie}, 35224 year = {1978} 35225} 35226 35227@Article{ passty:ergodic, 35228 author = {G. B. Passty}, 35229 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 35230 space}, 35231 journal = {Journal of Mathematical Analysis and Applications}, 35232 year = {1979}, 35233 volume = {72}, 35234 pages = {383--390} 35235} 35236 35237@Article{ peaceman.rachford:numerical, 35238 author = {D. W. Peaceman and H. H. Rachford}, 35239 title = {The numerical solution of parabolic and elliptic differential equations}, 35240 journal = {SIAM Journal}, 35241 year = {1955}, 35242 volume = {3}, 35243 pages = {28--41} 35244} 35245 35246@Book{ peck.tiesberg:global, 35247 author = {S. Peck and T. Tiesberg}, 35248 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 35249 {CETA}}, 35250 publisher = {The Electric Power Institute}, 35251 year = {1992}, 35252 address = {Paolo Alto CA} 35253} 35254 35255@TechReport{ peng:convexity, 35256 author = {J. -M. Peng}, 35257 title = {The Convexity of the Implicit {L}agrangian}, 35258 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35259 year = {1995}, 35260 type = {Technical Report}, 35261 address = {Beijing} 35262} 35263 35264@Article{ peng:equivalence, 35265 author = {J. -M. Peng}, 35266 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 35267 journal = {Mathematical Programming}, 35268 year = {1997}, 35269 volume = {78}, 35270 pages = {347--356} 35271} 35272 35273@Article{ pennisi:taking, 35274 author = {E. Pennisi}, 35275 title = {Taking a structured approach to understanding proteins}, 35276 journal = {Science}, 35277 year = {1998}, 35278 volume = {279}, 35279 pages = {978--979} 35280} 35281 35282@Article{ penot:regularity, 35283 author = {J. P. Penot}, 35284 title = {On regularity conditions in mathematical programming}, 35285 journal = {Mathematical Programming Study}, 35286 year = {1982}, 35287 volume = {17}, 35288 pages = {28--66} 35289} 35290 35291@Book{ perez:principles, 35292 author = {C. A. Perez and L. W. Brady}, 35293 title = {Principles and practice of radiotherapy}, 35294 publisher = {Lippincott-Raven}, 35295 year = {1998}, 35296 address = {Philadelphia}, 35297 edition = {3rd} 35298} 35299 35300@Article{ perroni.rutherford:international, 35301 author = {C. Perroni and T. Rutherford}, 35302 title = {International Trade in Carbon Emission Rights and Basic Materials: General 35303 Equilibrium Calculations for 2020}, 35304 journal = {Scandinavian Journal of Economics}, 35305 year = {1993} 35306} 35307 35308@Article{ perroni.rutherford:regular, 35309 author = {C. Perroni and T. Rutherford}, 35310 title = {Regular Flexibility of Nested {CES} Functions}, 35311 journal = {European Economic Review}, 35312 year = {1995}, 35313 volume = {39}, 35314 pages = {335--343} 35315} 35316 35317@InCollection{ perroni.wigle:environmental, 35318 author = {C. Perroni and R. M. Wigle}, 35319 title = {Environmental Policy Modeling}, 35320 booktitle = {Global Trade Analysis: Modeling and Applications}, 35321 publisher = {Cambridge University Press}, 35322 year = {1996}, 35323 editor = {T. Hertel} 35324} 35325 35326@Article{ peterson:review, 35327 author = {D. W. Peterson}, 35328 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 35329 journal = {SIAM Review}, 35330 year = {1973}, 35331 volume = {15}, 35332 pages = {639--654} 35333} 35334 35335@PhDThesis{ petersson:optimization, 35336 author = {J. Petersson}, 35337 title = {Optimization of Structures in Unilateral Contact}, 35338 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 35339 number = {397}, 35340 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 35341 University}, 35342 address = {Link{\"o}ping, Sweden}, 35343 year = {1995} 35344} 35345 35346@Book{ petri:modelling, 35347 author = {P. Petri}, 35348 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 35349 publisher = {Harvard University Press}, 35350 year = {1984} 35351} 35352 35353@InProceedings{ petrzykowski:application, 35354 author = {T. Petrzykowski}, 35355 title = {Application of the Steepest Ascent Method to Concave Programming}, 35356 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 35357 year = {1962}, 35358 publisher = {North--Holland}, 35359 address = {Amsterdam}, 35360 pages = {185--189} 35361} 35362 35363@InProceedings{ pettey.leuze.ea:parallel, 35364 crossref = {grefenstette:genetic}, 35365 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 35366 title = {A Parallel Genetic Algorithm}, 35367 pages = {155--161} 35368} 35369 35370@InProceedings{ pettey.leuze:theoretical, 35371 crossref = {schaeffer:third}, 35372 author = {C. C. Pettey and M. R. Leuze}, 35373 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 35374 pages = {398--405} 35375} 35376 35377@Book{ pfeiffer.glocker:multibody, 35378 author = {F. Pfeiffer and C. Glocker}, 35379 title = {Multibody Dynamics with Unilateral Contact}, 35380 year = {1996}, 35381 publisher = {John Wiley \& Sons} 35382} 35383 35384@TechReport{ pierro.iusem:convergence, 35385 author = {A. R. de Pierro and A. N. Iusem}, 35386 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 35387 Linear Complementarity Problems}, 35388 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 35389 year = {1990}, 35390 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 35391} 35392 35393@InCollection{ pillo.grippo.ea:class, 35394 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 35395 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 35396 booktitle = {System Modelling and Optimization}, 35397 year = {1981}, 35398 editor = {R. F. Drenick and F. Kozin}, 35399 publisher = {Springer-Verlag}, 35400 address = {Berlin} 35401} 35402 35403@Article{ pillo.grippo:augmented, 35404 author = {G. Di Pillo and L. Grippo}, 35405 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 35406 Problems}, 35407 journal = {Journal of Optimization Theory and Applications}, 35408 year = {1982}, 35409 volume = {36}, 35410 pages = {495--519} 35411} 35412 35413@Article{ pillo.grippo:class, 35414 author = {G. Di Pillo and L. Grippo}, 35415 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 35416 journal = {SIAM Journal on Control and Optimization}, 35417 year = {1979}, 35418 volume = {17}, 35419 pages = {618--628} 35420} 35421 35422@Article{ pillo.grippo:continuously, 35423 author = {G. Di Pillo and L. Grippo}, 35424 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 35425 Problems with Inequality Constraints}, 35426 journal = {SIAM Journal on Control and Optimization}, 35427 year = {1985}, 35428 volume = {23}, 35429 pages = {72--84} 35430} 35431 35432@Article{ pillo.grippo:exact, 35433 author = {G. Di Pillo and L. Grippo}, 35434 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 35435 Programming Problems}, 35436 journal = {Mathematical Programming}, 35437 year = {1986}, 35438 volume = {36}, 35439 pages = {1--18} 35440} 35441 35442@InProceedings{ plambeck.fu.ea:throughput, 35443 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35444 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 35445 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 35446 editor = {J. Schoen}, 35447 year = {1993}, 35448 publisher = {Society for Computer Simulation}, 35449 address = {San Diego, CA}, 35450 pages = {70--75} 35451} 35452 35453@Article{ plambeck.fu.ea:sample-path, 35454 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35455 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 35456 journal = {Mathematical Programming}, 35457 year = {1996}, 35458 volume = {75}, 35459 pages = {137--176} 35460} 35461 35462@InProceedings{ platt:sequential, 35463 author = {J. Platt}, 35464 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 35465 Machines}, 35466 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 35467 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 35468 publisher = {MIT Press}, 35469 pages = {185-208}, 35470 year = {1999} 35471} 35472 35473@Book{ poincare:sur, 35474 author = {H. Poincar\'{e}}, 35475 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 35476 year = {1881}, 35477 publisher = {Oeuvres I}, 35478 address = {Gauthier--Villars, Paris} 35479} 35480 35481@Article{ polak.ribiere:note, 35482 author = {E. Polak and G. Ribi\`{e}re}, 35483 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 35484 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 35485 year = {1969}, 35486 volume = {16-R1}, 35487 pages = {35--43} 35488} 35489 35490@Book{ polak:computational, 35491 author = {E. Polak}, 35492 title = {Computational Methods in Optimization; {A} Unified Approach}, 35493 year = {1971}, 35494 publisher = {Academic Press}, 35495 address = {New York} 35496} 35497 35498@Article{ polak:global, 35499 author = {E. Polak}, 35500 title = {On the Global Stabilization of Locally Convergent Algorithms}, 35501 journal = {Automatica}, 35502 year = {1976}, 35503 volume = {12}, 35504 pages = {337--349} 35505} 35506 35507@Article{ polyak.tretiyakov:concerning, 35508 author = {B. T. Polyak and N. V. Tretiyakov}, 35509 title = {Concerning an Iterative Method for Linear Programming and its Economic 35510 Interpretation}, 35511 journal = {Economics and Mathematical Methods}, 35512 year = {1972}, 35513 volume = {8}, 35514 pages = {740--751}, 35515 note = {(Russian)} 35516} 35517 35518@Article{ polyak.tretiyakov:method, 35519 author = {B. T. Polyak and N. V. Tretiyakov}, 35520 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 35521 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 35522 year = {1973}, 35523 volume = {13}, 35524 pages = {42--58} 35525} 35526 35527@Article{ polyak:conjugate, 35528 author = {B. T. Polyak}, 35529 title = {The conjugate gradient method in extremal problems}, 35530 journal = {USSR Computational Mathematics and Mathematical Physics}, 35531 year = {1969}, 35532 volume = {9}, 35533 pages = {94--112}, 35534 note = {Translated from Russian} 35535} 35536 35537@Book{ polyak:introduction, 35538 author = {B. T. Polyak}, 35539 title = {Introduction to Optimization}, 35540 year = {1987}, 35541 publisher = {Optimization Software, Inc.}, 35542 address = {Publications Division, New York} 35543} 35544 35545@Unpublished{ polyak:methods, 35546 author = {R. A. Polyak}, 35547 title = {On the Methods of Centers}, 35548 year = {1988}, 35549 note = {Unpublished manuscript} 35550} 35551 35552@Unpublished{ polyak:sharp, 35553 author = {B. T. Polyak}, 35554 title = {Sharp Minima}, 35555 year = {1979}, 35556 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 35557 Applications, {IIASA}, Laxenburg, Austria} 35558} 35559 35560@InProceedings{ polyak:smooth, 35561 author = {R. A. Polyak}, 35562 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 35563 Problems with Constraints}, 35564 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 35565 Programming}, 35566 year = {1982}, 35567 address = {Bonn} 35568} 35569 35570@Article{ polychronopoulos.tsitsiklis:analysis, 35571 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 35572 title = {Stochastic Shortest Path Problems with Recourse}, 35573 journal = {Networks}, 35574 year = {1996}, 35575 volume = {27}, 35576 pages = {133--143} 35577} 35578 35579@TechReport{ potra.bonnans:infeasible, 35580 author = {F. A. Potra and J. F. Bonnans}, 35581 title = {Infeasible path following algorithms for linear complementarity problems}, 35582 institution = {INRIA}, 35583 year = {1994}, 35584 month = dec, 35585 number = {RR--2445}, 35586 type = {Research Report} 35587} 35588 35589@Article{ potra.sheng:large-step, 35590 author = {F. A. Potra and R. Sheng}, 35591 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 35592 year = {1997}, 35593 journal = {SIAM Journal on Optimization}, 35594 volume = {7}, 35595 pages = {318--335} 35596} 35597 35598@Article{ potra:infeasible, 35599 author = {F. A. Potra}, 35600 title = {An infeasible interior-point predictor-corrector algorithm for linear 35601 programming}, 35602 journal = {SIAM Journal on Optimization}, 35603 year = {1996}, 35604 volume = {6}, 35605 pages = {19--32} 35606} 35607 35608@TechReport{ potra:onl, 35609 author = {F. A. Potra}, 35610 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 35611 convergence.}, 35612 institution = {Department of Mathematics, The University of Iowa}, 35613 address = {Iowa City, Iowa}, 35614 year = {1994}, 35615 number = {50}, 35616 type = {Reports on Computational Mathematics} 35617} 35618 35619@TechReport{ potra:predictor-corrector, 35620 author = {F. A. Potra}, 35621 title = {On a predictor-corrector method for solving linear programs from infeasible 35622 starting points}, 35623 institution = {Department of Mathematics, University of Iowa}, 35624 address = {Iowa City, Iowa}, 35625 year = {1992}, 35626 number = {34}, 35627 type = {Reports on Computational Mathematics} 35628} 35629 35630@TechReport{ potra:quadratically, 35631 author = {F. A. Potra}, 35632 title = {A quadratically convergent infeasible interior-point algorithm for linear 35633 programming}, 35634 institution = {Department of Mathematics, University of Iowa}, 35635 year = {1992}, 35636 number = {28}, 35637 address = {Iowa City, Iowa}, 35638 month = jul 35639} 35640 35641@InCollection{ powell:convergence, 35642 author = {M. J. D. Powell}, 35643 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 35644 Optimization Calculations}, 35645 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35646 pages = {27--63} 35647} 35648 35649@InProceedings{ powell:direct, 35650 author = {M. J. D. Powell}, 35651 title = {A Direct Search Optimization Method that Models the Objective and Constraint 35652 Functions by Linear Interpolation}, 35653 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 35654 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 35655 volume = {275}, 35656 year = {1994}, 35657 publisher = {Kluwer Academic Publishers}, 35658 pages = {51--67}, 35659 address = {Dordrecht, The Netherlands} 35660} 35661 35662@Article{ powell:efficient, 35663 author = {M. J. D. Powell}, 35664 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 35665 without Calculating Derivatives}, 35666 journal = {Computer Journal}, 35667 year = {1964}, 35668 volume = {17}, 35669 pages = {155--162} 35670} 35671 35672@InCollection{ powell:general, 35673 author = {M. J. D. Powell}, 35674 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 35675 booktitle = {Approximation Theory IV}, 35676 year = {1983}, 35677 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 35678 publisher = {Academic Press}, 35679 address = {New York}, 35680 pages = {187--218} 35681} 35682 35683@InCollection{ powell:hybrid, 35684 author = {M. J. D. Powell}, 35685 title = {A hybrid method for nonlinear equations}, 35686 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 35687 publisher = {Gordon and Breach}, 35688 year = {1970}, 35689 editor = {P. Rabinowitz} 35690} 35691 35692@TechReport{ powell:karmarkars, 35693 author = {M. J. D. Powell}, 35694 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 35695 institution = {Department of Applied Mathematics and Theoretical Physics, University of 35696 Cambridge}, 35697 year = {1989}, 35698 month = nov, 35699 address = {Cambridge, CB3 9EW, England} 35700} 35701 35702@InCollection{ powell:method, 35703 author = {M. J. D. Powell}, 35704 title = {A Method for Nonlinear Constraints in Minimization Problems}, 35705 booktitle = {Optimization}, 35706 year = {1969}, 35707 editor = {R. Fletcher}, 35708 publisher = {Academic Press}, 35709 address = {London}, 35710 pages = {283--298} 35711} 35712 35713@Book{ prekopa:stochastic, 35714 author = {A. Pr{\'{e}}kopa}, 35715 title = {Stochastic Programming}, 35716 publisher = {Kluwer Academic Publishers}, 35717 year = {1995}, 35718 address = {Dordrecht, The Netherlands} 35719} 35720 35721@Book{ press.flannery.ea:numerical, 35722 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 35723 Vetterling}, 35724 title = {Numerical Recipes : the Art of Scientific Computing}, 35725 publisher = {Cambridge University Press}, 35726 year = {1988} 35727} 35728 35729@Article{ pruyne.livny:interfacing, 35730 author = {J. Pruyne and M. Livny}, 35731 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 35732 journal = {Journal on Future Generations of Computer Systems}, 35733 volume = {12}, 35734 year = {1996}, 35735 pages = {67--85} 35736} 35737 35738@InCollection{ pruyne.livny:parallel, 35739 author = {J. Pruyne and M. Livny}, 35740 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 35741 booktitle = {Job Scheduling Strategies for Parallel Processing}, 35742 publisher = {Springer-Verlag}, 35743 year = {1995}, 35744 editor = {D. G. Feitelson and L. Rudolph}, 35745 volume = {949}, 35746 series = {Lecture Notes in Computer Science} 35747} 35748 35749@PhDThesis{ pruyne:resource, 35750 author = {J. C. Pruyne}, 35751 title = {Resource Management Services for Parallel Applications}, 35752 school = {University of Wisconsin--Madison}, 35753 year = {1996}, 35754 address = {Madison, Wisconsin} 35755} 35756 35757@Book{ pshenichny.danilin:numerical, 35758 author = {B. N. Pshenichny and Yu. M. Danilin}, 35759 title = {Numerical Methods in Extremal Problems}, 35760 year = {1978}, 35761 publisher = {MIR Publishers}, 35762 address = {Moscow} 35763} 35764 35765@TechReport{ qi.chen:globally, 35766 author = {L. Qi and X. Chen}, 35767 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 35768 institution = {School of Mathematics, University of New South Wales}, 35769 year = {1993}, 35770 annote = {revised}, 35771 address = {Sydney} 35772} 35773 35774@Article{ qi.jiang:semismooth, 35775 author = {L. Qi and H. Jiang}, 35776 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 35777 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 35778 journal = {Mathematics of Operations Research}, 35779 volume = {22}, 35780 pages = {301--325}, 35781 year = {1997} 35782} 35783 35784@TechReport{ qi.peng:unconstrained, 35785 author = {H. -D. Qi and J. -M. Peng}, 35786 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 35787 Problems}, 35788 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35789 year = {1996}, 35790 type = {Technical Report}, 35791 address = {Beijing} 35792} 35793 35794@InCollection{ qi.sun:survey, 35795 author = {L. Qi and D. Sun}, 35796 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 35797 year = {1999}, 35798 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 35799 booktitle = {Progress in Optimization}, 35800 pages = {121--146}, 35801 series = {Applied Optimization}, 35802 volume = {30}, 35803 publisher = {Kluwer Academic Publishers}, 35804 address = {Dordrecht} 35805} 35806 35807@Article{ qi.sun:nonsmooth, 35808 author = {L. Qi and J. Sun}, 35809 title = {A Nonsmooth Version of {N}ewton's Method}, 35810 journal = {Mathematical Programming}, 35811 year = {1993}, 35812 volume = {58}, 35813 pages = {353--368} 35814} 35815 35816@Article{ qi:convergence, 35817 author = {L. Qi}, 35818 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 35819 journal = {Mathematics of Operations Research}, 35820 year = {1993}, 35821 volume = {18}, 35822 pages = {227--244} 35823} 35824 35825@TechReport{ qi:regular, 35826 author = {L. Qi}, 35827 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 35828 convergent generalized {N}ewton methods for complementarity and variational 35829 inequality problems}, 35830 institution = {School of Mathematics, University of New South Wales}, 35831 year = {1997}, 35832 type = {Applied Mathematics Report}, 35833 number = {AMR 97/14}, 35834 address = {Sydney, Australia} 35835} 35836 35837@Article{ radner:competitive, 35838 author = {R. Radner}, 35839 title = {Competitive Equilibrium under Uncertainty}, 35840 journal = {Econometrica}, 35841 year = {1968}, 35842 volume = {36}, 35843 pages = {31--58} 35844} 35845 35846@Article{ radstrom:embedding, 35847 author = {H. R{\aa}dstr{\"{o}}m}, 35848 title = {An embedding theorem for spaces of convex sets}, 35849 journal = {Proc. Amer. Math. Soc.}, 35850 year = {1952}, 35851 volume = {3}, 35852 pages = {165--169} 35853} 35854 35855@Article{ raghavachari:connections, 35856 author = {M. Raghavachari}, 35857 title = {On Connections between Zero--One Integer Programming and Concave Programming 35858 Under Linear Constraints}, 35859 journal = {Operations Research}, 35860 year = {1969}, 35861 volume = {17}, 35862 pages = {680--684} 35863} 35864 35865@Article{ rajan.burridge.ea:dynamics, 35866 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 35867 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 35868 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 35869 month = mar, 35870 year = {1987}, 35871 pages = {671--677} 35872} 35873 35874@Article{ ralph:branching, 35875 author = {D. Ralph}, 35876 title = {On Branching Numbers of Normal Manifolds}, 35877 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 35878 volume = {22}, 35879 pages = {1041--1050}, 35880 year = {1994} 35881} 35882 35883@Article{ ralph:global, 35884 author = {D. Ralph}, 35885 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 35886 Path Search}, 35887 journal = {Mathematics of Operations Research}, 35888 year = {1994}, 35889 volume = {19}, 35890 pages = {352--389} 35891} 35892 35893@InProceedings{ ralph:piecewise, 35894 author = {D. Ralph}, 35895 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 35896 with Linear Complementarity Constraints}, 35897 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 35898 Applications (CTAC95)}, 35899 year = {1996} 35900} 35901 35902@PhDThesis{ raman:integration, 35903 author = {R. Raman}, 35904 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 35905 for process systems.}, 35906 address = {Pittsburgh, Pennsylvania}, 35907 year = {1993}, 35908 school = {Department of Chemical Engineering, Carnegie Mellon University} 35909} 35910 35911@PhDThesis{ rangaraj:nonsmooth, 35912 author = {Narayan Rangaraj}, 35913 title = {Nonsmooth Optimization: Algorithms and Applications}, 35914 year = {1990}, 35915 address = {Baltimore, MD}, 35916 school = {Department of Mathematical Sciences, The Johns Hopkins University} 35917} 35918 35919@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 35920 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 35921 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 35922 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35923 Radiation Therapy, Salt Lake City}, 35924 year = {1997}, 35925 editor = {D. D. Leavitt and G. Starkshall}, 35926 publisher = {Medical Physics Publishing}, 35927 address = {St. Louis, Missouri}, 35928 pages = {420--422} 35929} 35930 35931@Article{ reid:sparsity-exploiting, 35932 author = {J. K. Reid}, 35933 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear 35934 Programming Bases}, 35935 journal = {Mathematical Programming}, 35936 year = {1982}, 35937 volume = {24}, 35938 pages = {55--69} 35939} 35940 35941@Book{ reingold.nievergelt.ea:combinatorial, 35942 author = {E. Reingold and J. Nievergelt and N. Deo}, 35943 title = {Combinatorial Algorithms: Theory and Practice}, 35944 publisher = {Prentice-Hall, Inc}, 35945 address = {Englewood Cliffs, New Jersey} 35946} 35947 35948@PhDThesis{ reinoza:degree, 35949 author = {J. A. Reinoza}, 35950 title = {A Degree for Generalized Equations}, 35951 year = {1979}, 35952 address = {Madison, Wisconsin}, 35953 school = {University of Wisconsin} 35954} 35955 35956@Article{ reinoza:solving, 35957 author = {A. Reinoza}, 35958 title = {Solving Generalized Equations via Homotopies}, 35959 journal = {Mathematical Programming}, 35960 year = {1985}, 35961 volume = {31}, 35962 pages = {307--320} 35963} 35964 35965@PhDThesis{ ren:computable, 35966 author = {J. Ren}, 35967 title = {Computable Error Bounds in Mathematical Programming}, 35968 school = {Computer Sciences Department, University of Wisconsin}, 35969 year = {1993}, 35970 address = {Madison, Wisconsin}, 35971 note = {Technical Report 1173} 35972} 35973 35974@Article{ renegar:polynomial-time, 35975 author = {J. Renegar}, 35976 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 35977 Programming}, 35978 journal = {Mathematical Programming}, 35979 year = {1988}, 35980 volume = {40}, 35981 pages = {59--94} 35982} 35983 35984@Article{ robbins.monro:stochastic, 35985 author = {H. Robbins and S. Monro}, 35986 title = {A Stochastic Approximation Method}, 35987 journal = {Annals of Mathematical Statistics}, 35988 year = {1951}, 35989 volume = {22}, 35990 pages = {400--407} 35991} 35992 35993@Article{ robinson:analysis, 35994 author = {S. M. Robinson}, 35995 title = {Analysis of Sample-Path Optimization}, 35996 journal = {Mathematics of Operations Research}, 35997 year = {1996}, 35998 volume = {21}, 35999 pages = {513--528} 36000} 36001 36002@InCollection{ robinson:bundle-based, 36003 author = {S. M. Robinson}, 36004 title = {Bundle-Based Decomposition: Conditions for Convergence}, 36005 booktitle = {Analyse Non Lin\'{e}aire}, 36006 year = {1989}, 36007 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 36008 publisher = {Gauthier-Villaars}, 36009 address = {Paris}, 36010 pages = {435--447} 36011} 36012 36013@InCollection{ robinson:bundle-based*1, 36014 author = {S. M. Robinson}, 36015 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 36016 booktitle = {System Modeling and Optimization}, 36017 year = {1986}, 36018 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 36019 publisher = {Springer-Verlag}, 36020 address = {Berlin}, 36021 pages = {751--756}, 36022 volume = {84}, 36023 series = {Lecture Notes in Control and Information Sciences} 36024} 36025 36026@Article{ robinson:continuity, 36027 author = {S. M. Robinson}, 36028 title = {Some Continuity Properties of Polyhedral Multifunctions}, 36029 journal = {Mathematical Programming Study}, 36030 year = {1981}, 36031 volume = {14}, 36032 pages = {206--214} 36033} 36034 36035@Article{ robinson:extension, 36036 author = {S. M. Robinson}, 36037 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 36038 journal = {Numerische Mathematik}, 36039 year = {1972}, 36040 volume = {19}, 36041 pages = {341--347} 36042} 36043 36044@InCollection{ robinson:generalized, 36045 crossref = {bachem.grotschel.ea:mathematical}, 36046 author = {S. M. Robinson}, 36047 title = {Generalized Equations}, 36048 pages = {346--367} 36049} 36050 36051@Article{ robinson:generalized*1, 36052 author = {S. M. Robinson}, 36053 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 36054 journal = {Mathematical Programming Study}, 36055 year = {1979}, 36056 volume = {10}, 36057 pages = {128--141} 36058} 36059 36060@InCollection{ robinson:homeomorphism, 36061 author = {S. M. Robinson}, 36062 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 36063 booktitle = {Optimization and Nonlinear Analysis}, 36064 year = {1992}, 36065 editor = {A. Ioffe and M. Marcus and S. Reich}, 36066 publisher = {Longman}, 36067 address = {Harlow, Essex, England}, 36068 pages = {240--248}, 36069 series = {Pitman Research Notes in Mathematics Series No. 244} 36070} 36071 36072@Article{ robinson:implicit-function, 36073 author = {S. M. Robinson}, 36074 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 36075 journal = {Mathematics of Operations Research}, 36076 year = {1991}, 36077 volume = {16}, 36078 pages = {292--309} 36079} 36080 36081@Article{ robinson:local*1, 36082 author = {S. M. Robinson}, 36083 title = {Local Epi--Continuity and Local Optimization}, 36084 journal = {Mathematical Programming}, 36085 year = {1987}, 36086 volume = {37}, 36087 pages = {208--222} 36088} 36089 36090@Article{ robinson:local*2, 36091 author = {S. M. Robinson}, 36092 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 36093 Nondegeneracy}, 36094 journal = {Mathematical Programming Study}, 36095 year = {1984}, 36096 volume = {22}, 36097 pages = {217--230} 36098} 36099 36100@Article{ robinson:local*3, 36101 author = {S. M. Robinson}, 36102 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 36103 Stability and Sensitivity}, 36104 journal = {Mathematical Programming Study}, 36105 year = {1987}, 36106 volume = {30}, 36107 pages = {45--66} 36108} 36109 36110@Article{ robinson:mathematical, 36111 author = {S. M. Robinson}, 36112 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 36113 journal = {Mathematical Programming}, 36114 year = {1990}, 36115 volume = {48}, 36116 pages = {221--229} 36117} 36118 36119@Article{ robinson:newtons, 36120 author = {S. M. Robinson}, 36121 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 36122 journal = {Set Valued Analysis}, 36123 year = {1994}, 36124 volume = {2}, 36125 pages = {291--305} 36126} 36127 36128@Article{ robinson:nonsingularity, 36129 author = {S. M. Robinson}, 36130 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 36131 journal = {Mathematical Programming}, 36132 year = {1993}, 36133 volume = {62}, 36134 pages = {415--425} 36135} 36136 36137@InCollection{ robinson:nonsmooth, 36138 author = {S. M. Robinson}, 36139 title = {Nonsmooth Continuation for Generalized Equations}, 36140 year = {1997}, 36141 pages = {282--291}, 36142 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 36143 booktitle = {Recent Advances in Optimization}, 36144 series = {Lecture Notes in Economics and Mathematical Systems}, 36145 volume = {452}, 36146 publisher = {Springer-Verlag}, 36147 address = {Heidelberg} 36148} 36149 36150@Article{ robinson:normal, 36151 author = {S. M. Robinson}, 36152 title = {Normal Maps Induced by Linear Transformations}, 36153 journal = {Mathematics of Operations Research}, 36154 year = {1992}, 36155 volume = {17}, 36156 pages = {691--714} 36157} 36158 36159@Article{ robinson:normed, 36160 author = {S. M. Robinson}, 36161 title = {Normed Convex Processes}, 36162 journal = {Transactions of the American Mathematical Society}, 36163 year = {1972}, 36164 volume = {174}, 36165 pages = {127--140} 36166} 36167 36168@Article{ robinson:reduction, 36169 author = {S. M. Robinson}, 36170 title = {A reduction method for variational inequalities}, 36171 journal = {Mathematical Programming}, 36172 year = {1998}, 36173 volume = {80}, 36174 pages = {161--169} 36175} 36176 36177@Article{ robinson:regularity, 36178 author = {S. M. Robinson}, 36179 title = {Regularity and stability for convex multivalued functions}, 36180 journal = {Mathematics of Operations Research}, 36181 year = {1976}, 36182 volume = {1}, 36183 pages = {130--143} 36184} 36185 36186@Unpublished{ robinson:shadow, 36187 author = {S. M. Robinson}, 36188 title = {Shadow {JUNK} for biblio file}, 36189 year = {1800} 36190} 36191 36192@Article{ robinson:shadow*1, 36193 author = {S. M. Robinson}, 36194 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 36195 journal = {Operations Research}, 36196 year = {1993}, 36197 volume = {41}, 36198 pages = {518--535} 36199} 36200 36201@Article{ robinson:shadow*2, 36202 author = {S. M. Robinson}, 36203 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 36204 journal = {Operations Research}, 36205 year = {1993}, 36206 volume = {41}, 36207 pages = {536--548} 36208} 36209 36210@Unpublished{ robinson:stability, 36211 author = {S. M. Robinson}, 36212 title = {Stability {JUNK} for biblio file}, 36213 year = {1800} 36214} 36215 36216@Article{ robinson:stability*1, 36217 author = {S. M. Robinson}, 36218 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 36219 journal = {SIAM Journal on Numerical Analysis}, 36220 year = {1975}, 36221 volume = {12}, 36222 pages = {754--769} 36223} 36224 36225@Article{ robinson:stability*2, 36226 author = {S. M. Robinson}, 36227 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 36228 Nonlinear Systems}, 36229 journal = {SIAM Journal on Numerical Analysis}, 36230 year = {1976}, 36231 volume = {13}, 36232 pages = {497--513} 36233} 36234 36235@Article{ robinson:strongly, 36236 author = {S. M. Robinson}, 36237 title = {Strongly Regular Generalized Equations}, 36238 journal = {Mathematics of Operations Research}, 36239 year = {1980}, 36240 volume = {5}, 36241 pages = {43--62} 36242} 36243 36244@Article{ rockafellar.wets:generalized, 36245 author = {R. T. Rockafellar and R. J.--B. Wets}, 36246 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 36247 Control in Discrete Time}, 36248 journal = {SIAM Journal on Control and Optimization}, 36249 year = {1990}, 36250 volume = {28}, 36251 pages = {810--822} 36252} 36253 36254@Article{ rockafellar.wets:lagrangian, 36255 author = {R. T. Rockafellar and R. J.--B. Wets}, 36256 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 36257 in Stochastic Programming}, 36258 journal = {Mathematical Programming Study}, 36259 year = {1986}, 36260 volume = {28}, 36261 pages = {63--93} 36262} 36263 36264@InCollection{ rockafellar.wets:linear-quadratic, 36265 author = {R. T. Rockafellar and R. J.--B. Wets}, 36266 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 36267 Generation Algorithm}, 36268 booktitle = {Stochastic Optimization}, 36269 publisher = {Springer-Verlag}, 36270 year = {1987}, 36271 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 36272 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 36273 pages = {545--560}, 36274 address = {New York, Berlin} 36275} 36276 36277@Article{ rockafellar.wets:scenarios, 36278 author = {R. T. Rockafellar and R. J.--B. Wets}, 36279 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 36280 journal = {Mathematics of Operations Research}, 36281 year = {1991}, 36282 volume = {10}, 36283 pages = {119--147} 36284} 36285 36286@InProceedings{ rockafellar:applications, 36287 author = {R. T. Rockafellar}, 36288 title = {New Applications of Duality in Convex Programming}, 36289 booktitle = {Proceedings of the Fourth Conference on Probability}, 36290 year = {1971}, 36291 address = {Brasov, Romania} 36292} 36293 36294@Article{ rockafellar:augmented, 36295 author = {R. T. Rockafellar}, 36296 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 36297 journal = {SIAM Journal on Control and Optimization}, 36298 year = {1974}, 36299 volume = {12}, 36300 pages = {268--285} 36301} 36302 36303@Article{ rockafellar:augmented*1, 36304 author = {R. T. Rockafellar}, 36305 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 36306 Convex Programming}, 36307 journal = {Mathematics of Operations Research}, 36308 year = {1976}, 36309 volume = {1}, 36310 pages = {97--116} 36311} 36312 36313@Article{ rockafellar:characterization, 36314 author = {R. T. Rockafellar}, 36315 title = {Characterization of the subdifferentials of convex functions}, 36316 journal = {Pacific Journal of Mathematics}, 36317 year = {1966}, 36318 volume = {17}, 36319 number = {3}, 36320 pages = {497--510} 36321} 36322 36323@Article{ rockafellar:computational, 36324 author = {R. T. Rockafellar}, 36325 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 36326 Programming}, 36327 journal = {Mathematical Programming}, 36328 year = {1990}, 36329 volume = {48}, 36330 pages = {447--474} 36331} 36332 36333@Book{ rockafellar:conjugate, 36334 author = {R. T. Rockafellar}, 36335 title = {Conjugate Duality and Optimization}, 36336 year = {1974}, 36337 publisher = {SIAM}, 36338 address = {Philadelphia, Pennsylvania}, 36339 volume = {16}, 36340 series = {Conference Board of the Mathematical Sciences} 36341} 36342 36343@Book{ rockafellar:convex, 36344 author = {R. T. Rockafellar}, 36345 title = {Convex Analysis}, 36346 year = {1970}, 36347 publisher = {Princeton University Press}, 36348 address = {Princeton, New Jersey} 36349} 36350 36351@Article{ rockafellar:first-, 36352 author = {R. T. Rockafellar}, 36353 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 36354 journal = {Transactions of the American Mathematical Society}, 36355 year = {1988}, 36356 volume = {307}, 36357 pages = {75--108} 36358} 36359 36360@InProceedings{ rockafellar:generalized, 36361 author = {R. T. Rockafellar}, 36362 title = {A Generalized Approach to Linear-Quadratic Programming}, 36363 booktitle = {Proceedings of the International Conference on Numerical Optimization and 36364 Applications}, 36365 year = {1986}, 36366 pages = {58--66}, 36367 note = {(Xi'an, China)} 36368} 36369 36370@InProceedings{ rockafellar:generalized*1, 36371 crossref = {bachem.grotschel.ea:mathematical}, 36372 author = {R. T. Rockafellar}, 36373 title = {Generalized Subgradients in Mathematical Programming}, 36374 pages = {368--390} 36375} 36376 36377@InCollection{ rockafellar:large-scale, 36378 author = {R. T. Rockafellar}, 36379 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 36380 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 36381 chapter = {15}, 36382 year = {1991}, 36383 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 36384 publisher = {SIAM Publications}, 36385 pages = {247--261} 36386} 36387 36388@Article{ rockafellar:linear-quadratic, 36389 author = {R. T. Rockafellar}, 36390 title = {Linear-Quadratic Programming and Optimal Control}, 36391 journal = {SIAM Journal on Control and Optimization}, 36392 year = {1987}, 36393 volume = {25}, 36394 pages = {781--814} 36395} 36396 36397@Article{ rockafellar:maximality, 36398 author = {R. T. Rockafellar}, 36399 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 36400 journal = {Transactions of the American Mathematical Society}, 36401 year = {1970}, 36402 volume = {149}, 36403 pages = {75--88} 36404} 36405 36406@InCollection{ rockafellar:monotone, 36407 author = {R. T. Rockafellar}, 36408 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 36409 crossref = {mangasarian.meyer.ea:nonlinear*3}, 36410 pages = {1--26} 36411} 36412 36413@Article{ rockafellar:monotone*1, 36414 author = {R. T. Rockafellar}, 36415 title = {Monotone Operators and the Proximal Point Algorithm}, 36416 journal = {SIAM Journal on Control and Optimization}, 36417 year = {1976}, 36418 volume = {14}, 36419 pages = {877--898} 36420} 36421 36422@Article{ rockafellar:multiplier, 36423 author = {R. T. Rockafellar}, 36424 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 36425 journal = {Journal of Optimization Theory and Applications}, 36426 year = {1973}, 36427 volume = {12}, 36428 pages = {555--562} 36429} 36430 36431@Article{ rockafellar:multistage, 36432 author = {R. T. Rockafellar}, 36433 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 36434 journal = {Control and Cybernetics}, 36435 year = {1988}, 36436 volume = {17}, 36437 number = {2-3}, 36438 pages = {225--245} 36439} 36440 36441@Book{ rockafellar:network, 36442 author = {R. T. Rockafellar}, 36443 title = {Network Flows and Monotropic Optimization}, 36444 publisher = {John Wiley}, 36445 year = {1984}, 36446 address = {New York} 36447} 36448 36449@Article{ rodrigues:mixed, 36450 author = {H. C. Rodrigues}, 36451 title = {A mixed variational formulation for shape optimization of solids with contact 36452 conditions}, 36453 journal = {Structural Optimization}, 36454 volume = {6}, 36455 year = {1993}, 36456 pages = {19--28} 36457} 36458 36459@Book{ rodrigues:obstacle, 36460 author = {J. F. Rodrigues}, 36461 title = {Obstacle Problems in Mathematical Physics}, 36462 publisher = {Elsevier Publishing Company}, 36463 address = {Amsterdam}, 36464 year = {1987} 36465} 36466 36467@Book{ roos.terlaky.ea:theory, 36468 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 36469 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 36470 publisher = {John Wiley \& Sons}, 36471 year = {1997}, 36472 address = {Chichester} 36473} 36474 36475@TechReport{ rosa:decomposition, 36476 author = {C. H. Rosa}, 36477 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 36478 institution = {IIASA}, 36479 year = {1996}, 36480 number = {WP-96-013}, 36481 address = {A-2361 Laxenburg, Austria} 36482} 36483 36484@Article{ rosen.lane.ea:treatment, 36485 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 36486 title = {Treatment Plan Optimization Using Linear Programming}, 36487 journal = {Medical Physics}, 36488 year = {1990}, 36489 volume = {18}, 36490 number = {2}, 36491 pages = {141--152} 36492} 36493 36494@TechReport{ rosenblatt:perceptron-a, 36495 author = {F. Rosenblatt}, 36496 title = {The perceptron--a perceiving and recognizing automaton}, 36497 institution = {Cornell Aeronautical Laboratory}, 36498 year = {1957}, 36499 month = jan, 36500 address = {Ithaca, New York}, 36501 number = {85-460-1} 36502} 36503 36504@Book{ rosenblatt:principles, 36505 author = {F. Rosenblatt}, 36506 title = {Principles of Neurodynamics}, 36507 year = {1962}, 36508 publisher = {Spartan Books}, 36509 address = {New York} 36510} 36511 36512@InProceedings{ rosenblatt:two, 36513 author = {F. Rosenblatt}, 36514 title = {Two theorems of statistical separability in the perceptron}, 36515 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 36516 year = {1959}, 36517 publisher = {{HMS} Stationery Office}, 36518 address = {London}, 36519 volume = {1} 36520} 36521 36522@Article{ rosenbrock:automatic, 36523 author = {H. H. Rosenbrock}, 36524 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 36525 journal = {Computer Journal}, 36526 year = {1960}, 36527 volume = {3}, 36528 pages = {175--184} 36529} 36530 36531@Article{ roy.mukhopadhyay:pattern, 36532 author = {A. Roy and S. Mukhopadhyay}, 36533 title = {Pattern Classification Using Linear Programming}, 36534 journal = {ORSA Journal on Computing}, 36535 year = {1990}, 36536 volume = {3}, 36537 pages = {66--80} 36538} 36539 36540@Book{ rubinstein:monte, 36541 author = {R. Rubinstein}, 36542 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 36543 Networks}, 36544 publisher = {Wiley}, 36545 address = {New York, NY}, 36546 year = {1986} 36547} 36548 36549@Article{ ruchala.olivera.ea:comparison, 36550 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 36551 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 36552 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 36553 journal = {Physics in Medicine and Biology, forthcoming}, 36554 year = {1999} 36555} 36556 36557@Book{ rudin:principles, 36558 author = {W. Rudin}, 36559 title = {Principles of Mathematical Analysis}, 36560 year = {1976}, 36561 publisher = {McGraw--Hill}, 36562 address = {Tokyo, Japan}, 36563 edition = {Third} 36564} 36565 36566@Book{ rudin:real, 36567 author = {W. Rudin}, 36568 title = {Real and Complex Analysis}, 36569 year = {1974}, 36570 publisher = {McGraw--Hill}, 36571 address = {Tokyo, Japan}, 36572 edition = {Second} 36573} 36574 36575@InProceedings{ rumelhart.hinton.ea:learning, 36576 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 36577 title = {Learning Internal Representations by Error Propagation}, 36578 booktitle = {Parallel Distributed Processing}, 36579 year = {1986}, 36580 editor = {D. E. Rumelhart and J. L. McClelland}, 36581 publisher = {MIT Press}, 36582 address = {Cambridge, Massachusetts}, 36583 pages = {318--362} 36584} 36585 36586@Book{ rumelhart.mcclelland:parallel, 36587 author = {D. E. Rumelhart and J. L. McClelland}, 36588 title = {Parallel Distributed Processing}, 36589 year = {1986}, 36590 publisher = {MIT Press}, 36591 address = {Cambridge, Massachusetts} 36592} 36593 36594@InCollection{ ruszczynski:regularized, 36595 author = {A. Ruszczynski}, 36596 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 36597 year = {1995}, 36598 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 36599 editor = {K. Marti and P. Kall}, 36600 publisher = {Springer-Verlag}, 36601 address = {Berlin}, 36602 volume = {425}, 36603 series = {Lecture Notes in Control and Information Sciences}, 36604 pages = {93--108} 36605} 36606 36607@Article{ rutherford.rutstrom.ea:lacord, 36608 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 36609 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 36610 quantitative}, 36611 journal = {Revue d' Economie du developpement}, 36612 year = {1994} 36613} 36614 36615@InCollection{ rutherford.tarr:blueprints, 36616 author = {T. Rutherford and D. Tarr}, 36617 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 36618 Open Economy}, 36619 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 36620 publisher = {Cambridge University Press}, 36621 year = {1997}, 36622 editor = {R. Baldwin and J. Francois}, 36623 address = {New York} 36624} 36625 36626@Article{ rutherford:applied, 36627 author = {T. F. Rutherford}, 36628 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 36629 Overview of the Modeling Framework and Syntax}, 36630 year = {1999}, 36631 volume = {14}, 36632 pages = {1--46}, 36633 journal = {Computational Economics} 36634} 36635 36636@PhDThesis{ rutherford:applied*1, 36637 author = {T. F. Rutherford}, 36638 title = {Applied General Equilibrium Modeling}, 36639 school = {Stanford University}, 36640 year = {1987} 36641} 36642 36643@Article{ rutherford:extensions, 36644 author = {T. F. Rutherford}, 36645 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 36646 Analysis}, 36647 journal = {Journal of Economic Dynamics and Control}, 36648 volume = {19}, 36649 pages = {1299--1324}, 36650 year = {1995} 36651} 36652 36653@Misc{ rutherford:gnuplot, 36654 author = {T. F. Rutherford}, 36655 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 36656 organization = {Department of Economics, University of Colorado}, 36657 address = {Boulder, Colorado}, 36658 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 36659} 36660 36661@Unpublished{ rutherford:miles, 36662 author = {T. F. Rutherford}, 36663 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 36664 year = {1993}, 36665 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 36666} 36667 36668@TechReport{ rutherford:modeling, 36669 author = {T. F. Rutherford}, 36670 title = {A Modeling System for Applied General Equilibrium Analysis}, 36671 type = {Cowles Foundation Discussion Paper}, 36672 number = {836}, 36673 institution = {Yale University}, 36674 year = {1987} 36675} 36676 36677@TechReport{ rutherford:mpsge, 36678 author = {T. F. Rutherford}, 36679 title = {{MPSGE}}, 36680 institution = {University of Western Ontario}, 36681 year = {1988}, 36682 address = {London, Ontario} 36683} 36684 36685@Article{ rykov:simplex, 36686 author = {A. S. Rykov}, 36687 title = {Simplex Direct Search Algorithms}, 36688 journal = {Automation and Remote Control}, 36689 year = {1980}, 36690 volume = {41}, 36691 pages = {784--793} 36692} 36693 36694@Article{ saad.schultz:gmres, 36695 author = {Y. Saad and M. Schultz}, 36696 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 36697 Linear Systems}, 36698 journal = {SIAM Journal on Scientific and Statistical Computing}, 36699 year = {1986}, 36700 volume = {44}, 36701 pages = {856--869} 36702} 36703 36704@Book{ saad:iterative, 36705 author = {Y. Saad}, 36706 title = {Iterative Methods for Sparse Linear Systems}, 36707 year = {1996}, 36708 publisher = {PWS Publishing Company}, 36709 address = {Boston, Massachusetts} 36710} 36711 36712@Article{ sahni:approximate, 36713 author = {S. Sahni}, 36714 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 36715 journal = {jacm}, 36716 year = {1975}, 36717 volume = {22}, 36718 pages = {115--124} 36719} 36720 36721@InProceedings{ sauer.shepard.ea:comparison, 36722 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 36723 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 36724 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36725 Radiation Therapy, Salt Lake City}, 36726 year = {1997}, 36727 editor = {D. D. Leavitt and G. Starkshall}, 36728 publisher = {Medical Physics Publishing}, 36729 address = {St. Louis, Missouri} 36730} 36731 36732@Article{ sauer.xu:multivariate, 36733 author = {Th. Sauer and Y. Xu}, 36734 title = {On Multivariate {L}agrange Interpolation}, 36735 journal = {Mathematics of Computation}, 36736 year = {1995}, 36737 volume = {64}, 36738 pages = {1147--1170} 36739} 36740 36741@Article{ savelsbergh:preprocessing, 36742 author = {M. W. P. Savelsbergh}, 36743 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 36744 journal = {ORSA Journal on Computing}, 36745 year = {1994}, 36746 volume = {6}, 36747 pages = {445--454} 36748} 36749 36750@Article{ scarf:approximation, 36751 author = {H. E. Scarf}, 36752 title = {The Approximation of Fixed Points of a Continuous Mapping}, 36753 journal = {SIAM Journal on Applied Mathematics}, 36754 year = {1967}, 36755 volume = {15}, 36756 pages = {1328--1343} 36757} 36758 36759@Book{ scarf:computation, 36760 author = {H. E. Scarf}, 36761 title = {The Computation of Economic Equilibria}, 36762 year = {1973}, 36763 publisher = {Yale University Press}, 36764 address = {New Haven, Connecticut} 36765} 36766 36767@TechReport{ scheel.scholtes:mathematical, 36768 author = {H. Scheel and S. Scholtes}, 36769 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 36770 and Sensitivity}, 36771 institution = {Judge Institute of Management Studies, University of Cambridge}, 36772 year = {1998}, 36773 type = {Technical Report}, 36774 address = {Cambridge, England} 36775} 36776 36777@Article{ schlick:modified, 36778 author = {T. Schlick}, 36779 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 36780 journal = {SIAM Journal on Scientific Computing}, 36781 year = {1993}, 36782 volume = {14}, 36783 pages = {424--445} 36784} 36785 36786@Article{ schnabel.eskow:modified, 36787 author = {R. B. Schnabel and E. Eskow}, 36788 title = {A New Modified {C}holesky Factorization}, 36789 journal = {SIAM Journal on Scientific and Statistical Computing}, 36790 year = {1991}, 36791 volume = {11}, 36792 pages = {1136--1158} 36793} 36794 36795@Article{ schneider.zenios:comparative, 36796 author = {M. H. Schneider and S. A. Zenios}, 36797 title = {A Comparative Study of Algorithms for Matrix Balancing}, 36798 journal = {Operations Research}, 36799 year = {1990}, 36800 volume = {38}, 36801 pages = {439--455} 36802} 36803 36804@Book{ scholkopf.burges.ea:advances, 36805 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 36806 title = {Advances in Kernel Methods: Support Vector Machines}, 36807 publisher = {MIT Press}, 36808 address = {Cambridge, MA }, 36809 year = {1998}, 36810 isbn = {0-262-19416-3} 36811} 36812 36813@Article{ scholtes.stohr:exact, 36814 author = {S. Scholtes and M. St{\"{o}}hr}, 36815 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 36816 journal = {SIAM Journal on Control and Optimization}, 36817 volume = {37}, 36818 pages = {617--652}, 36819 year = {1999} 36820} 36821 36822@TechReport{ scholtes:introduction, 36823 author = {S. Scholtes}, 36824 title = {Introduction to piecewise differentiable equations}, 36825 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 36826 Universit{\"{a}}t Karlsruhe}, 36827 year = {1994}, 36828 type = {Preprint}, 36829 number = {No. 53/1994}, 36830 address = {Karlsruhe, Germany} 36831} 36832 36833@Article{ schramm.zowe:version, 36834 author = {H. Schramm and J. Zowe}, 36835 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 36836 Idea, Convergence Analysis, Numerical Results}, 36837 journal = {SIAM Journal on Optimization}, 36838 year = {1992}, 36839 volume = {2}, 36840 pages = {121--152} 36841} 36842 36843@Article{ schultz.meyer:interior, 36844 author = {G. L. Schultz and R. R. Meyer}, 36845 title = {An Interior Point Method for Block Angular Optimization}, 36846 journal = {SIAM Journal on Optimization}, 36847 year = {1991}, 36848 volume = {1}, 36849 pages = {583--602} 36850} 36851 36852@InProceedings{ sekiguchi.sato.ea:ninf, 36853 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 36854 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 36855 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 36856 year = {1996}, 36857 address = {Santa Fe} 36858} 36859 36860@InCollection{ sellami.robinson:homotopies, 36861 author = {H. Sellami and S. M. Robinson}, 36862 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 36863 Inequalities}, 36864 booktitle = {Nonlinear Optimization and Applications}, 36865 editor = {G. Di Pillo and F. Giannessi}, 36866 year = {1996}, 36867 pages = {327--343}, 36868 publisher = {Plenum Press}, 36869 address = {New York} 36870} 36871 36872@Article{ sellami.robinson:implementation, 36873 author = {H. Sellami and S. M. Robinson}, 36874 title = {Implementation of a Continuation Method for Normal Maps}, 36875 journal = {Mathematical Programming}, 36876 year = {1997}, 36877 volume = {76}, 36878 pages = {563--578} 36879} 36880 36881@PhDThesis{ sellami:continuation, 36882 author = {H. Sellami}, 36883 title = {A Continuation Method for Normal Maps}, 36884 school = {University of Wisconsin -- Madison}, 36885 year = {1994}, 36886 address = {Madison, Wisconsin} 36887} 36888 36889@Article{ sellami:homotopy, 36890 author = {H. Sellami}, 36891 title = {A Homotopy Continuation Method for Normal Maps}, 36892 journal = {Mathematical Programming}, 36893 vol = {82}, 36894 year = {1998}, 36895 pages = {317--337} 36896} 36897 36898@Book{ seuss:one, 36899 author = {{Dr.} A. Seuss}, 36900 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 36901 year = {1960}, 36902 publisher = {Beginner Books}, 36903 address = {New York}, 36904 series = {Beginner Books, B13}, 36905 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 36906 Yink, Yop, Gack, and the Zeds} 36907} 36908 36909@Article{ seyfferth.pfeiffer:dynamics, 36910 author = {W. Seyfferth and F. Pfeiffer}, 36911 title = {Dynamics of Assembly Processes With a Manipulator}, 36912 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 36913 and Systems}, 36914 year = {1992}, 36915 pages = {1303--1310} 36916} 36917 36918@Article{ shanno.simantiraki:infeasible, 36919 author = {D. Shanno and E. Simantiraki}, 36920 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 36921 year = {1997}, 36922 journal = {SIAM Journal on Optimization}, 36923 volume = {7}, 36924 pages = {620--640} 36925} 36926 36927@InProceedings{ shanno.simantiraki:interior, 36928 author = {D. Shanno and E. Simantiraki}, 36929 title = {Interior Point Methods for Linear and Nonlinear Programming}, 36930 booktitle = {State of the Art in Numerical Analysis}, 36931 year = {1997}, 36932 editor = {I. S. Duff and G. A. Watson}, 36933 publisher = {Oxford University Press}, 36934 address = {Oxford} 36935} 36936 36937@Article{ shannon:introduction, 36938 author = {R. E. Shannon}, 36939 title = {Introduction to the Art and Science of simulation}, 36940 journal = {WSC98 1998 Winter simulation conference proceedings}, 36941 year = {1998}, 36942 volume = {1}, 36943 pages = {7--14} 36944} 36945 36946@TechReport{ shapiro:concepts, 36947 author = {A. Shapiro}, 36948 title = {On Concepts of Directional Differentiability}, 36949 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 36950 year = {1988}, 36951 address = {Pretoria, South Africa}, 36952 number = {73/88(18)}, 36953 type = {Research Report} 36954} 36955 36956@Book{ shavlik.editors:readings, 36957 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 36958 title = {Readings in Machine Learning}, 36959 year = {1990}, 36960 publisher = {Morgan Kaufman}, 36961 address = {San Mateo, California} 36962} 36963 36964@Article{ shavlik.mooney.ea:symbolic, 36965 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 36966 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 36967 journal = {Machine Learning}, 36968 year = {1991}, 36969 volume = {6}, 36970 pages = {111--143} 36971} 36972 36973@Book{ sheffi:urban, 36974 author = {Y. Sheffi}, 36975 title = {Urban Transportation Networks}, 36976 publisher = {Prentice-Hall, Inc}, 36977 year = {1985}, 36978 address = {Englewood Cliffs, New Jersey} 36979} 36980 36981@Article{ sheng.potra:quadratically, 36982 author = {R. Sheng and F. A. Potra}, 36983 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 36984 Polynomial {CO}mplexity}, 36985 journal = {SIAM Journal on Optimization}, 36986 year = {1997}, 36987 volume = {7}, 36988 pages = {304--317} 36989} 36990 36991@InProceedings{ shepard.angelos.ea:simple, 36992 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 36993 title = {A Simple Model for Examining Radiotherapy Optimization}, 36994 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36995 Radiation Therapy, Salt Lake City}, 36996 year = {1997}, 36997 editor = {D. D. Leavitt and G. Starkshall}, 36998 publisher = {Medical Physics Publishing}, 36999 address = {St. Louis, Missouri} 37000} 37001 37002@Article{ shepard.ferris.ea:inverse, 37003 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 37004 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 37005 journal = {Medical Physics}, 37006 volume = {27}, 37007 pages = {12}, 37008 year = {2000}, 37009 key = {93} 37010} 37011 37012@Article{ shepard.ferris.ea:optimizing, 37013 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 37014 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 37015 journal = {SIAM Review}, 37016 volume = {41}, 37017 pages = {721--744}, 37018 year = {1999}, 37019 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 37020 key = {68}, 37021 institution = {Computer Sciences Department, University of Wisconsin}, 37022 address = {Madison, Wisconsin}, 37023 number = {98-07}, 37024 type = {Mathematical Programming Technical Report} 37025} 37026 37027@Article{ sherali.shetty:finitely, 37028 author = {H. D. Sherali and C. M. Shetty}, 37029 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 37030 Cuts and Disjunctive Face Cuts}, 37031 journal = {Mathematical Programming}, 37032 year = {1980}, 37033 volume = {19}, 37034 pages = {14--31} 37035} 37036 37037@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 37038 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 37039 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 37040 journal = {Operations Research}, 37041 year = {1983}, 37042 volume = {31}, 37043 pages = {253--276} 37044} 37045 37046@Article{ shi.olafsson.ea:hybrid, 37047 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 37048 title = {A New Hybrid Optimization Algorithm}, 37049 journal = {Computers and Industrial Engineering}, 37050 year = {1999}, 37051 volume = {36}, 37052 pages = {409--426} 37053} 37054 37055@PhDThesis{ shiau:iterative, 37056 author = {T.--H. Shiau}, 37057 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 37058 school = {Computer Sciences Department, University of Wisconsin}, 37059 year = {1983}, 37060 address = {Madison, Wisconsin}, 37061 note = {Technical Report 507} 37062} 37063 37064@InProceedings{ shor:generalized, 37065 crossref = {bachem.grotschel.ea:mathematical}, 37066 author = {N. Z. Shor}, 37067 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 37068 Dilation Operations}, 37069 pages = {501--529} 37070} 37071 37072@Book{ shor:minimization, 37073 author = {N. Z. Shor}, 37074 title = {Minimization Methods for Nondifferentiable Functions}, 37075 year = {1985}, 37076 publisher = {Springer-Verlag}, 37077 address = {Berlin} 37078} 37079 37080@Article{ shoven.whalley:applied, 37081 author = {J. Shoven and J. Whalley}, 37082 title = {Applied General Equilibrium Models of Taxation and International Trade: 37083 Introduction and Survey}, 37084 journal = {Journal of Economic Literature}, 37085 year = {1984}, 37086 volume = {22}, 37087 pages = {1007--1051} 37088} 37089 37090@Article{ shultz.meyer:interior, 37091 author = {G. L. Shultz and R. R. Meyer}, 37092 title = {An Interior Point Method for Block Angular Optimization}, 37093 journal = {SIAM Journal on Optimization}, 37094 year = {1991}, 37095 volume = {1}, 37096 pages = {583--602} 37097} 37098 37099@Article{ shultz.schnabel.ea:family, 37100 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 37101 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 37102 journal = {SIAM Journal on Numerical Analysis}, 37103 year = {1985}, 37104 volume = {22}, 37105 pages = {44--67} 37106} 37107 37108@Article{ sibony:methodes, 37109 author = {M. Sibony}, 37110 title = {Methodes iteratives pur les equations et inequations aux derives partielles 37111 nonlineaires de type monotone}, 37112 journal = {Calcolo}, 37113 year = {1970}, 37114 volume = {7}, 37115 pages = {65--183} 37116} 37117 37118@Article{ sidney:optimal, 37119 author = {J. B. Sidney}, 37120 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 37121 journal = {Operations Research}, 37122 year = {1977}, 37123 volume = {25}, 37124 pages = {62--69} 37125} 37126 37127@Book{ siegel:corba, 37128 author = {J. Siegel}, 37129 title = {{CORBA} - Fundamentals and Programming}, 37130 publisher = {John Wiley \& Sons}, 37131 year = {1996}, 37132 address = {New York, New York} 37133} 37134 37135@TechReport{ simantiraki.shanno:infeasible-interior-point, 37136 author = {E. Simantiraki and D. F. Shanno}, 37137 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 37138 type = {Research Report}, 37139 number = {7-95}, 37140 institution = {Rutgers Center for Operations Research, Rutgers University}, 37141 address = {New Brunswick, New Jersey}, 37142 year = {1995} 37143} 37144 37145@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 37146 author = {E. Simantiraki and D. F. Shanno}, 37147 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 37148 Problems}, 37149 crossref = {ferris.pang:complementarity}, 37150 pages = {386--404} 37151} 37152 37153@Book{ simpson:artificial, 37154 author = {P. K. Simpson}, 37155 title = {Artificial Neural Systems}, 37156 year = {1990}, 37157 publisher = {Pergamon Press}, 37158 address = {New York} 37159} 37160 37161@Article{ smeers:computable, 37162 author = {Y. Smeers}, 37163 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 37164 and Gas Markets}, 37165 journal = {The Energy Journal}, 37166 year = {1997}, 37167 optkey = {}, 37168 optvolume = {18}, 37169 optnumber = {}, 37170 optmonth = {}, 37171 optpages = {1--32}, 37172 optnote = {}, 37173 optannote = {} 37174} 37175 37176@Article{ smith:design, 37177 author = {F. W. Smith}, 37178 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 37179 Procedures}, 37180 journal = {IEEE Transactions on Computers}, 37181 year = {1969}, 37182 volume = {18}, 37183 pages = {367--372} 37184} 37185 37186@Article{ smith:existence, 37187 author = {M. J. Smith}, 37188 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 37189 journal = {Transportation Research}, 37190 year = {1979}, 37191 volume = {13B}, 37192 pages = {295--304} 37193} 37194 37195@Article{ smith:existence*1, 37196 author = {M. J. Smith}, 37197 title = {The existence and calculation of traffic equilibria}, 37198 journal = {Transportation Research}, 37199 volume = {17B}, 37200 year = {1983}, 37201 pages = {291--303} 37202} 37203 37204@Article{ smith:pattern, 37205 author = {F. W. Smith}, 37206 title = {Pattern Classifier Design by Linear Programming}, 37207 journal = {IEEE Transactions on Computers}, 37208 year = {1968}, 37209 volume = {C-17}, 37210 pages = {367--372} 37211} 37212 37213@Article{ solodov.svaiter:projection, 37214 author = {M. V. Solodov and B. F. Svaiter}, 37215 title = {A New Projection Method for Variational Inequality Problems}, 37216 journal = {SIAM Journal on Control and Optimization}, 37217 volume = {37}, 37218 pages = {765--776}, 37219 year = {1999} 37220} 37221 37222@Article{ solodov.tseng:modified, 37223 author = {M. V. Solodov and P. Tseng}, 37224 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 37225 year = {1996}, 37226 journal = {SIAM Journal on Control and Optimization}, 37227 pages = {1814--1830}, 37228 volume = {34} 37229} 37230 37231@Article{ solodov:stationary, 37232 author = {M. V. Solodov}, 37233 title = {Stationary Points of Bound Constrained Minimization Reformulations of 37234 Complementarity Problems}, 37235 journal = {Journal of Optimization Theory and Applications, forthcoming}, 37236 year = {1997} 37237} 37238 37239@Article{ spendley.hext.ea:sequential, 37240 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 37241 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 37242 Operation}, 37243 journal = {Technometrics}, 37244 year = {1962}, 37245 pages = {441--461}, 37246 volume = {4} 37247} 37248 37249@Article{ spingarn:applications, 37250 author = {J. E. Spingarn}, 37251 title = {Applications of the Method of Partial Inverses to Convex Programming}, 37252 journal = {Mathematical Programming}, 37253 year = {1985}, 37254 volume = {32}, 37255 pages = {199--223} 37256} 37257 37258@Book{ srinivasan.whalley:general, 37259 author = {T. Srinivasan and J. Whalley}, 37260 title = {General Equilibrium Trade Policy Modelling}, 37261 publisher = {MIT Press}, 37262 year = {1986}, 37263 address = {Boston} 37264} 37265 37266@Book{ stackelberg:theory, 37267 author = {H. Van Stackelberg}, 37268 title = {The Theory of Market Economy}, 37269 publisher = {Oxford University Press}, 37270 year = {1952} 37271} 37272 37273@Article{ stavroulakis.panagiotopoulos.ea:rigid, 37274 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 37275 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 37276 Applications}, 37277 journal = {Computers \& Structures}, 37278 volume = {40}, 37279 year = {1991}, 37280 pages = {599--614} 37281} 37282 37283@Article{ stavroulakis:optimal, 37284 author = {G. E. Stavroulakis}, 37285 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 37286 optimal control problem for variational inequalities}, 37287 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 37288 year = {1996} 37289} 37290 37291@Article{ stavroulakis:optimal*1, 37292 author = {G. E. Stavroulakis}, 37293 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 37294 journal = {Archives of Applied Mechanics, forthcoming}, 37295 year = {1996} 37296} 37297 37298@Book{ steenbrink:optimization, 37299 author = {P. A. Steenbrink}, 37300 title = {Optimization of Transport Networks}, 37301 publisher = {John Wiley \& Sons}, 37302 address = {London, England}, 37303 year = {1974} 37304} 37305 37306@Article{ stephens:asymptotic, 37307 author = {M. A. Stephens}, 37308 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 37309 journal = {Annals of Statistics}, 37310 year = {1976}, 37311 volume = {4}, 37312 pages = {357--369} 37313} 37314 37315@Article{ stephens:edf, 37316 author = {M. A. Stephens}, 37317 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 37318 journal = {Journal of the American Statistical Association}, 37319 year = {1974}, 37320 volume = {69}, 37321 pages = {730--737} 37322} 37323 37324@Article{ stevens:location, 37325 author = {B. H. Stevens}, 37326 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 37327 journal = {Papers of the Regional Science Association}, 37328 year = {1968}, 37329 volume = {21}, 37330 pages = {19--34} 37331} 37332 37333@Article{ stewart.trinkle:implicit, 37334 author = {D. E. Stewart and J. C. Trinkle}, 37335 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 37336 Collisions and {C}oulomb Friction}, 37337 journal = {International Journal for Numerical Methods in Engineering}, 37338 year = {1996}, 37339 volume = {39}, 37340 pages = {2673--2691} 37341} 37342 37343@Book{ stoer.bulirsch:introduction, 37344 author = {J. Stoer and R. Bulirsch}, 37345 title = {Introduction to Numerical Analysis}, 37346 year = {1980}, 37347 publisher = {Springer-Verlag}, 37348 address = {New York} 37349} 37350 37351@Article{ stoer:complexity, 37352 author = {J. Stoer}, 37353 title = {The complexity of an infeasible interior--point path--following method for the 37354 solution of linear programs}, 37355 journal = {Optimization Methods and Software}, 37356 year = {1994}, 37357 volume = {3}, 37358 pages = {1--12} 37359} 37360 37361@Article{ stone:cross-validatory, 37362 author = {M. Stone}, 37363 title = {Cross-validatory choice and assessment of statistical predictions}, 37364 journal = {Journal of the Royal Statistical Society}, 37365 year = {1974}, 37366 volume = {36}, 37367 pages = {111--147} 37368} 37369 37370@Article{ stone.smith.ea:inverse, 37371 author = {R. A. Stone and V. Smith and L. Verhey}, 37372 title = {Inverse Planning for the {G}amma {K}nife}, 37373 journal = {Medical Physics}, 37374 year = {1993}, 37375 volume = {20}, 37376 pages = {865} 37377} 37378 37379@Book{ strang:linear, 37380 author = {G. Strang}, 37381 title = {Linear Algebra and its Applications}, 37382 year = {1980}, 37383 publisher = {Academic Press}, 37384 address = {New York}, 37385 edition = {Second} 37386} 37387 37388@InProceedings{ street.wolberg.ea:nuclear, 37389 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 37390 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 37391 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 37392 year = {1993}, 37393 publisher = {SPIE--The International Society for Optical Engineering}, 37394 address = {San Jose, California}, 37395 pages = {861--870}, 37396 volume = {1905} 37397} 37398 37399@Article{ subramanian:gauss-newton, 37400 author = {P. K. Subramanian}, 37401 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 37402 journal = {Journal of Optimization Theory and Applications}, 37403 year = {1993}, 37404 volume = {77}, 37405 pages = {467--482} 37406} 37407 37408@PhDThesis{ subramanian:iterative, 37409 author = {P. K. Subramanian}, 37410 title = {Iterative Methods of Solution for Complementarity Problems}, 37411 year = {1985}, 37412 address = {Madison, Wisconsin}, 37413 school = {Computer Sciences Department, University of Wisconsin} 37414} 37415 37416@TechReport{ subramanian:note, 37417 author = {P. K. Subramanian}, 37418 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 37419 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 37420 year = {1985}, 37421 address = {Madison, Wisconsin}, 37422 number = {2844}, 37423 type = {Technical Summary Report} 37424} 37425 37426@TechReport{ suh.gucht:distributed, 37427 author = {J. Y. Suh and D. Van Gucht}, 37428 title = {Distributed Genetic Algorithms}, 37429 institution = {Computer Science Department, Indiana University}, 37430 year = {1987}, 37431 address = {Bloomington}, 37432 number = {225} 37433} 37434 37435@Article{ sun.natori.ea:computational, 37436 author = {S. M. Sun and M. C. Natori and K. C. Park}, 37437 title = {A Computational Procedure for Flexible Beams with Frictional Contact 37438 Constraints}, 37439 journal = {International Journal for Numerical Methods in Engineering}, 37440 volume = {36}, 37441 pages = {3781--3800}, 37442 year = {1993} 37443} 37444 37445@Article{ sun.qi:ncp-functions, 37446 author = {D. Sun and L. Qi}, 37447 title = {On {NCP}-Functions}, 37448 journal = {Computational Optimization and Applications, forthcoming}, 37449 year = {1998} 37450} 37451 37452@Article{ sun.womersley:unconstrained, 37453 author = {D. Sun and R. S. Womersley}, 37454 title = {A new unconstrained differentiable merit function for box constrained variational 37455 inequality problems and a damped {G}auss-{N}ewton method}, 37456 journal = {SIAM Journal on Optimization}, 37457 year = {1999}, 37458 volume = {9}, 37459 pages = {388--413} 37460} 37461 37462@Article{ sun:class, 37463 author = {D. Sun}, 37464 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 37465 journal = {Journal of Optimization Theory and Applications}, 37466 year = {1996}, 37467 volume = {91}, 37468 pages = {123--140} 37469} 37470 37471@PhDThesis{ sun:monotropic, 37472 author = {J. Sun}, 37473 title = {On Monotropic Piecewise Quadratic Programming}, 37474 school = {University of Washington}, 37475 year = {1986}, 37476 address = {Seattle, Washington} 37477} 37478 37479@Article{ sun:thermal, 37480 author = {D. C. Sun}, 37481 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 37482 journal = {Journal of Applied Mechanics}, 37483 volume = {58}, 37484 pages = {141--153}, 37485 year = {1991} 37486} 37487 37488@Article{ sundararaghavan.ahmed:minimizing, 37489 author = {P. S. Sundararaghavan and M. U. Ahmed}, 37490 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 37491 Scheduling}, 37492 journal = {Naval Research Logistics Quarterly}, 37493 year = {1984}, 37494 volume = {31}, 37495 pages = {325--333} 37496} 37497 37498@TechReport{ sznajder.gowda:generalizations, 37499 author = {R. Sznajder and M. S. Gowda}, 37500 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 37501 horizontal {LCP}s}, 37502 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 37503 year = {1992}, 37504 address = {Catonsville, Maryland}, 37505 number = {92--16}, 37506 type = {Research Report} 37507} 37508 37509@Article{ sznajder.gowda:nondegeneracy, 37510 author = {R. Sznajder and M. S. Gowda}, 37511 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 37512 journal = {Mathematics of Operations Research}, 37513 year = {1998}, 37514 volume = {23}, 37515 pages = {221--238} 37516} 37517 37518@Article{ taji.fukushima.ea:globally, 37519 author = {K. Taji and M. Fukushima and T. Ibaraki}, 37520 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 37521 Inequalities}, 37522 journal = {Mathematical Programming}, 37523 year = {1993}, 37524 volume = {58}, 37525 pages = {369--383} 37526} 37527 37528@Article{ taji.fukushima:optimization, 37529 author = {K. Taji and M. Fukushima}, 37530 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 37531 Problem}, 37532 journal = {Journal of the Operations Research Society of Japan}, 37533 year = {1994}, 37534 volume = {37}, 37535 pages = {310--331} 37536} 37537 37538@Article{ talbot.patterson.ea:comparative, 37539 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 37540 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 37541 journal = {Management Science}, 37542 year = {1986}, 37543 volume = {32}, 37544 pages = {430--454} 37545} 37546 37547@Article{ talman.yamamoto:simplicial, 37548 author = {A. J. J. Talman and Y. Yamamoto}, 37549 title = {A {S}implicial Algorithm for Stationary Point Problems}, 37550 journal = {Mathematics of Operations Research}, 37551 year = {1989}, 37552 volume = {14}, 37553 pages = {383--399} 37554} 37555 37556@InProceedings{ tanese:distributed, 37557 crossref = {schaeffer:third}, 37558 author = {R. Tanese}, 37559 title = {Distributed Genetic Algorithms}, 37560 pages = {434--439} 37561} 37562 37563@InProceedings{ tanese:parallel, 37564 crossref = {grefenstette:genetic}, 37565 author = {R. Tanese}, 37566 title = {Parallel Genetic Algorithms for a Hypercube}, 37567 pages = {177--183} 37568} 37569 37570@Article{ teboulle:entropic, 37571 author = {M. Teboulle}, 37572 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 37573 year = {1992}, 37574 journal = {Mathematics of Operations Research}, 37575 volume = {17}, 37576 pages = {670--690} 37577} 37578 37579@Article{ thuente:duality, 37580 author = {D. J. Thuente}, 37581 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 37582 journal = {Operations Research}, 37583 year = {1980}, 37584 volume = {28}, 37585 pages = {1005--1011} 37586} 37587 37588@Book{ tikhonov.arsenin:solutions, 37589 author = {A. N. Tikhonov and V. Y. Arsenin}, 37590 title = {Solutions of Ill--Posed Problems}, 37591 year = {1977}, 37592 publisher = {John Wiley \& Sons}, 37593 address = {New York} 37594} 37595 37596@InProceedings{ tin-loi.ferris:complementarity, 37597 author = {F. Tin-Loi and M. C. Ferris}, 37598 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 37599 booktitle = {Computational Mechanics for the Next Millenium}, 37600 key = {79}, 37601 pages = {1029--1036}, 37602 year = {1999}, 37603 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 37604 volume = {2}, 37605 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 37606 Mechanics}, 37607 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 37608 publisher = {Elsevier Science Ltd}, 37609 type = {Mathematical Programming Technical Report}, 37610 institution = {Computer Sciences Department, University of Wisconsin}, 37611 address = {Madison, Wisconsin}, 37612 number = {99-02} 37613} 37614 37615@InProceedings{ tin-loi.ferris:holonomic, 37616 author = {F. Tin-Loi and M. C. Ferris}, 37617 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 37618 booktitle = {Advances in Fracture Research}, 37619 year = {1997}, 37620 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 37621 volume = {2}, 37622 publisher = {Pergamon Press}, 37623 pages = {2183--2190}, 37624 key = {53} 37625} 37626 37627@InProceedings{ tin-loi.ferris:simple, 37628 author = {F. Tin-Loi and M. C. Ferris}, 37629 title = {A Simple Mathematical Programming Method for a Structural Identification 37630 Problem}, 37631 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 37632 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 37633 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 37634 publisher = {Techno-Press}, 37635 address = {Korea}, 37636 year = {1997}, 37637 pages = {511--518}, 37638 key = {59} 37639} 37640 37641@Article{ tin-loi.misa:large, 37642 author = {F. Tin-Loi and J. S. Misa}, 37643 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 37644 journal = {International Journal for Numerical Methods in Engineering}, 37645 volume = {39}, 37646 pages = {741--762}, 37647 year = {1996} 37648} 37649 37650@Article{ tin-loi.pang:elastoplastic, 37651 author = {F. Tin-Loi and J. S. Pang}, 37652 title = {Elastoplastic analysis of structures with nonlinear hardening}, 37653 journal = {Computer Methods in Applied Mechanics and Engineering}, 37654 volume = {107}, 37655 year = {1993}, 37656 pages = {299--312} 37657} 37658 37659@Article{ tin-loi.vimonsatit:nonlinear, 37660 author = {F. Tin-Loi and V. Vimonsatit}, 37661 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 37662 journal = {Engineering Structures}, 37663 volume = {18}, 37664 year = {1996}, 37665 pages = {115--124} 37666} 37667 37668@Article{ tobin:uniqueness, 37669 author = {R. L. Tobin}, 37670 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 37671 journal = {Annals of Operations Research}, 37672 volume = {34}, 37673 year = {1992}, 37674 pages = {21--36} 37675} 37676 37677@Article{ tobin:variable, 37678 author = {R. L. Tobin}, 37679 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 37680 Problem}, 37681 journal = {Mathematical Programming}, 37682 year = {1988}, 37683 volume = {40}, 37684 pages = {33--51} 37685} 37686 37687@Article{ todd.burrell:extension, 37688 author = {M. J. Todd and B. P. Burrell}, 37689 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 37690 Variables}, 37691 journal = {Algorithmica}, 37692 year = {1986}, 37693 volume = {1}, 37694 pages = {409--424} 37695} 37696 37697@Book{ todd:computation, 37698 author = {M. J. Todd}, 37699 title = {Computation of Fixed Points and Applications}, 37700 publisher = {Springer-Verlag}, 37701 year = {1976}, 37702 volume = {124}, 37703 series = {Lecture Notes in Economics and Mathematical Systems}, 37704 address = {Heidelberg} 37705} 37706 37707@Article{ todd:note, 37708 author = {M. J. Todd}, 37709 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 37710 Production}, 37711 journal = {Journal of Mathematical Economics}, 37712 year = {1976}, 37713 volume = {6}, 37714 pages = {135--144} 37715} 37716 37717@Article{ toint:assesment, 37718 author = {Ph. L. Toint}, 37719 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37720 Optimization}, 37721 year = {1996}, 37722 journal = {SIAM Journal on Scientific Computing}, 37723 volume = {17}, 37724 pages = {725=-739} 37725} 37726 37727@TechReport{ toint:assesment*1, 37728 author = {Ph. L. Toint}, 37729 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37730 Optimization: The Complete Numerical Results}, 37731 institution = {Department of Mathematics, FUNDP}, 37732 year = {1994}, 37733 number = {94/15}, 37734 address = {Namur, Belgium} 37735} 37736 37737@Article{ toint:global, 37738 author = {Ph. L. Toint}, 37739 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 37740 in a {H}ilbert Space}, 37741 journal = {IMA Journal of Numerical Analysis}, 37742 year = {1988}, 37743 volume = {8}, 37744 pages = {231--252} 37745} 37746 37747@Article{ toint:non-monotone, 37748 author = {Ph. L. Toint}, 37749 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 37750 Convex Constraints}, 37751 year = {1997}, 37752 journal = {Mathematical Programming}, 37753 volume = {77}, 37754 pages = {69--94} 37755} 37756 37757@InCollection{ toint:transportation, 37758 author = {Ph. L. Toint}, 37759 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 37760 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 37761 Management}, 37762 publisher = {Springer-Verlag}, 37763 series = {NATO ASI Series F}, 37764 year = {1997}, 37765 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 37766} 37767 37768@Article{ tomlin.welch:finding, 37769 author = {J. Tomlin and J. Welch}, 37770 title = {Finding Duplicate Rows in a Linear Programming Model}, 37771 journal = {Operations Research Letters}, 37772 year = {1986}, 37773 volume = {5}, 37774 number = {1}, 37775 pages = {7--11} 37776} 37777 37778@Article{ torczon:convergence, 37779 author = {V. Torczon}, 37780 title = {On the Convergence of the Multidirectional Search Algorithm}, 37781 journal = {SIAM Journal on Optimization}, 37782 year = {1991}, 37783 volume = {1}, 37784 pages = {123--145} 37785} 37786 37787@Article{ torczon:convergence*1, 37788 author = {V. Torczon}, 37789 title = {On the Convergence of Pattern Search Algorithms}, 37790 journal = {SIAM Journal on Optimization}, 37791 year = {1997}, 37792 volume = {7}, 37793 pages = {1--25} 37794} 37795 37796@Misc{ torma.rutherford:general, 37797 author = {H. Torma and T. Rutherford}, 37798 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 37799 year = {1992}, 37800 howpublished = {Working Paper 15/1992}, 37801 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 37802} 37803 37804@Article{ trinkle.pang.ea:dynamic, 37805 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 37806 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 37807 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 37808 year = {1997}, 37809 pages = {267--279}, 37810 volume = {77} 37811} 37812 37813@InProceedings{ trinkle.pang:dynamic, 37814 author = {J. C. Trinkle and J. S. Pang}, 37815 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 37816 book = {{IEEE} International Conference on Robotics and Automation}, 37817 pages = {2276--2281}, 37818 year = {1997} 37819} 37820 37821@TechReport{ tseng.bertsekas:convergence, 37822 author = {P. Tseng and D. P. Bertsekas}, 37823 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 37824 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 37825 Technology}, 37826 year = {1990}, 37827 type = {technical report}, 37828 number = {LIDS-P-1995}, 37829 address = {Cambridge, MA} 37830} 37831 37832@Article{ tseng.yamashita.ea:equivalence, 37833 author = {P. Tseng and N. Yamashita and M. Fukushima}, 37834 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 37835 Approach}, 37836 year = {1996}, 37837 journal = {SIAM Journal on Optimization}, 37838 volume = {6}, 37839 pages = {446--460} 37840} 37841 37842@Article{ tseng:applications, 37843 author = {P. Tseng}, 37844 title = {Applications of a splitting algorithm to decomposition in convex programming and 37845 variational inequalities}, 37846 journal = {SIAM Journal on Control and Optimization}, 37847 year = {1991}, 37848 volume = {29}, 37849 pages = {119--138} 37850} 37851 37852@Article{ tseng:dual, 37853 author = {P. Tseng}, 37854 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 37855 Constraints: a Unified Approach}, 37856 journal = {SIAM Journal on Control and Optimization}, 37857 year = {1990}, 37858 volume = {28}, 37859 pages = {214--242} 37860} 37861 37862@Article{ tseng:dual*1, 37863 author = {P. Tseng}, 37864 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 37865 Unified Approach}, 37866 journal = {SIAM Journal on Control and Optimization}, 37867 year = {1990}, 37868 volume = {28}, 37869 pages = {214--242} 37870} 37871 37872@Article{ tseng:dual*2, 37873 author = {P. Tseng}, 37874 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 37875 journal = {Mathematical Programming}, 37876 year = {1993}, 37877 volume = {59}, 37878 pages = {231--248} 37879} 37880 37881@Article{ tseng:fortified-descent, 37882 author = {P. Tseng}, 37883 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 37884 journal = {SIAM Journal on Optimization}, 37885 volume = {10}, 37886 pages = {269--288}, 37887 year = {2000} 37888} 37889 37890@Article{ tseng:growth, 37891 author = {P. Tseng}, 37892 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 37893 Problem}, 37894 journal = {Journal of Optimization Theory and Applications}, 37895 volume = {89}, 37896 year = {1996}, 37897 pages = {17--37} 37898} 37899 37900@Unpublished{ tseng:matlab, 37901 author = {P. Tseng}, 37902 title = {Matlab Implementations of Complementarity Codes}, 37903 year = {1995}, 37904 note = {Private Communication} 37905} 37906 37907@Article{ ursescu:multifunctions, 37908 author = {C. Ursescu}, 37909 title = {Multifunctions with closed convex graph}, 37910 journal = {Czech. Math. J.}, 37911 year = {1975}, 37912 volume = {35}, 37913 pages = {438--441} 37914} 37915 37916@TechReport{ vaidya:algorithm, 37917 author = {P. M. Vaidya}, 37918 title = {An Algorithm for Linear Programming which Requires 37919 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 37920 institution = {AT\&T Bell Laboratories}, 37921 year = {1987}, 37922 address = {Murray Hill, New Jersey} 37923} 37924 37925@Article{ val:unloading, 37926 author = {P. Du Val}, 37927 title = {The Unloading Problem for Plane Curves}, 37928 journal = {American Journal of Mathematics}, 37929 year = {1940}, 37930 volume = {62}, 37931 pages = {307--311} 37932} 37933 37934@InCollection{ valentine:problem, 37935 author = {F. A. Valentine}, 37936 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 37937 Conditions}, 37938 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 37939 year = {1937}, 37940 publisher = {University of Chicago Press}, 37941 address = {Chicago}, 37942 pages = {407--448} 37943} 37944 37945@Article{ valle.poch.ea:comparison, 37946 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 37947 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 37948 Flow-Injection Systems}, 37949 journal = {Analytica Chimica Acta}, 37950 year = {1990}, 37951 volume = {241}, 37952 pages = {31--42} 37953} 37954 37955@Article{ vandenberghe.demoor.ea:generalized, 37956 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 37957 title = {The generalized linear complementarity problem applied to the complete analysis 37958 of resistive piecewise-linear circuits}, 37959 journal = {IEEE Transactions on Circuits and Systems}, 37960 volume = {36}, 37961 year = {1989}, 37962 pages = {1382--1391} 37963} 37964 37965@Article{ vanderbei.meketon.ea:modification, 37966 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 37967 title = {A Modification of {K}armarkar's Algorithm}, 37968 journal = {Algorithmica}, 37969 year = {1986}, 37970 volume = {1}, 37971 pages = {395--407} 37972} 37973 37974@Article{ vanderbei:affine-scaling, 37975 author = {R. J. Vanderbei}, 37976 title = {Affine--Scaling for Linear Programs with Free Variables}, 37977 journal = {Mathematical Programming}, 37978 year = {1989}, 37979 volume = {43}, 37980 pages = {31--44} 37981} 37982 37983@Article{ vanroy.wolsey:solving, 37984 author = {T. J. Van~Roy and L. A. Wolsey}, 37985 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 37986 journal = {Operations Research}, 37987 volume = {35}, 37988 pages = {45--57}, 37989 year = {1987} 37990} 37991 37992@Book{ vapnik:nature, 37993 author = {V. N. Vapnik}, 37994 title = {The Nature of Statistical Learning Theory}, 37995 publisher = {John Wiley \& Sons}, 37996 address = {New York}, 37997 year = {1996} 37998} 37999 38000@Book{ varian:microeconomic, 38001 author = {Hal R. Varian}, 38002 title = {Microeconomic Analysis}, 38003 year = {1978}, 38004 publisher = {W.W. Norton \& Company}, 38005 address = {New York, New York} 38006} 38007 38008@Article{ verhey:immobilizing, 38009 author = {L. J. Verhey}, 38010 title = {Immobilizing and Positioning Patients for Radiotherapy}, 38011 journal = {Seminars in Radiation Oncology}, 38012 year = {1995}, 38013 volume = {5}, 38014 number = {2}, 38015 pages = {100--113} 38016} 38017 38018@Article{ vinante.pintos:differentiable, 38019 author = {C. Vinante and S. Pintos}, 38020 title = {On Differentiable Exact Penalty Functions}, 38021 journal = {Journal of Optimization Theory and Applications}, 38022 year = {1986}, 38023 volume = {50}, 38024 pages = {479--493} 38025} 38026 38027@Article{ vlach:scheduling, 38028 author = {M. Vlach}, 38029 title = {On Scheduling with Earliness and Tardiness Penalties}, 38030 journal = {Methods of Operations Research}, 38031 year = {1983}, 38032 volume = {45}, 38033 pages = {367--375} 38034} 38035 38036@InCollection{ wacker:summary, 38037 author = {H.--J. Wacker}, 38038 title = {A Summary of the Developments on Imbedding Methods}, 38039 booktitle = {Continuation Methods}, 38040 year = {1978}, 38041 editor = {H.--J. Wacker}, 38042 publisher = {Academic Press}, 38043 address = {New York}, 38044 pages = {1--35} 38045} 38046 38047@Article{ wakefield.tin-loi:large, 38048 author = {R. R. Wakefield and F. Tin-Loi}, 38049 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 38050 Formulation}, 38051 journal = {Computer Methods in Applied Mechanics and Engineering}, 38052 volume = {84}, 38053 year = {1990}, 38054 pages = {229--242} 38055} 38056 38057@Article{ wakefield.tin-loi:large*1, 38058 author = {R. R. Wakefield and F. Tin-Loi}, 38059 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 38060 Approach}, 38061 journal = {International Journal Mechanical Science}, 38062 volume = {33}, 38063 year = {1991}, 38064 pages = {379--391} 38065} 38066 38067@Article{ walker:implementation, 38068 author = {H. F. Walker}, 38069 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 38070 journal = {SIAM Journal on Scientific Computing}, 38071 volume = {9}, 38072 year = {1988}, 38073 pages = {152--163} 38074} 38075 38076@Book{ wall.schwartz:programming, 38077 author = {L. Wall and R. L. Schwartz}, 38078 title = {Programming Perl}, 38079 publisher = {O'Reilly and Associates, Inc.}, 38080 address = {Sebastopol, CA}, 38081 year = {1991} 38082} 38083 38084@Book{ walras:elements, 38085 author = {L. Walras}, 38086 title = {Elements of Pure Economics}, 38087 publisher = {Allen and Unwin}, 38088 year = {1954}, 38089 address = {London} 38090} 38091 38092@Article{ wang.monteiro.ea:interior, 38093 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 38094 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 38095 journal = {Mathematical Programming}, 38096 volume = {74}, 38097 pages = {159--196}, 38098 year = {1996} 38099} 38100 38101@Article{ wardi:stochastic, 38102 author = {Y. Wardi}, 38103 title = {A Stochastic Steepest-Descent Algorithm}, 38104 journal = {Journal of Optimization Theory and Applications}, 38105 year = {1988}, 38106 volume = {59}, 38107 pages = {307--323} 38108} 38109 38110@Article{ wardi:stochastic*1, 38111 author = {Y. Wardi}, 38112 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 38113 journal = {Journal of Optimization Theory and Applications}, 38114 year = {1990}, 38115 volume = {64}, 38116 pages = {399--417} 38117} 38118 38119@Article{ wardrop:theoretical, 38120 author = {J. G. Wardrop}, 38121 title = {Some Theoretical Aspects of Road Traffic Research}, 38122 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 38123 year = {1952}, 38124 pages = {325--378} 38125} 38126 38127@Article{ warga:minimizing, 38128 author = {J. Warga}, 38129 title = {Minimizing certain convex functions}, 38130 journal = {Journal of SIAM on Applied Mathematics}, 38131 year = {1963}, 38132 volume = {11}, 38133 pages = {588--593} 38134} 38135 38136@Article{ watson.billups.ea:hompack, 38137 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 38138 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 38139 Algorithms}, 38140 journal = {{ACM} Transactions on Mathematical Software}, 38141 year = {1987}, 38142 volume = {13}, 38143 pages = {281--310} 38144} 38145 38146@Article{ watson.billups.ea:slow, 38147 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 38148 title = {Slow Viscous Flow in a Syringe}, 38149 journal = {Journal of Biomechanical Engineering}, 38150 year = {1986}, 38151 volume = {108}, 38152 pages = {317--323} 38153} 38154 38155@Article{ watson:discrete, 38156 author = {G. A. Watson}, 38157 title = {Discrete $\ell_1$ approximation by rational functions}, 38158 journal = {IMA Journal of Numerical Analysis}, 38159 year = {1984}, 38160 volume = {4}, 38161 pages = {275--288} 38162} 38163 38164@Article{ watson:solving, 38165 author = {L. T. Watson}, 38166 title = {Solving the nonlinear complementarity problem by a homotopy method}, 38167 journal = {SIAM Journal on Control and Optimization}, 38168 year = {1979}, 38169 volume = {17}, 38170 pages = {36--46} 38171} 38172 38173@Article{ webb:optimum, 38174 author = {S. Webb}, 38175 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 38176 Heterogeneity}, 38177 journal = {Physics in Medicine and Biology}, 38178 year = {1994}, 38179 volume = {39}, 38180 pages = {1895--1914} 38181} 38182 38183@Book{ webb:physics, 38184 author = {S. Webb}, 38185 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 38186 publisher = {Institute of Physics Publishing Ltd.}, 38187 year = {1997}, 38188 optaddress = {Philadelphia} 38189} 38190 38191@InBook{ webb:theory, 38192 author = {S. Webb}, 38193 editor = {E. Sternick}, 38194 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 38195 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 38196 publisher = {Advanced Medical Publishing}, 38197 year = {1997} 38198} 38199 38200@Book{ weiss.kulikowski:computer, 38201 author = {S. M. Weiss and C. A. Kulikowski}, 38202 title = {Computer Systems that Learn}, 38203 year = {1991}, 38204 publisher = {Morgan Kaufmann Publishers, Inc}, 38205 address = {San Mateo, California} 38206} 38207 38208@PhDThesis{ werbos:beyond, 38209 author = {P. J. Werbos}, 38210 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 38211 Sciences}, 38212 year = {1974}, 38213 school = {Harvard University} 38214} 38215 38216@InCollection{ wets:convergence, 38217 author = {R. J.-B. Wets}, 38218 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 38219 Problems}, 38220 booktitle = {Variational Inequalites and Complementarity Problems}, 38221 year = {1980}, 38222 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 38223 publisher = {John Wiley \& Sons}, 38224 address = {New York}, 38225 pages = {375--403} 38226} 38227 38228@InCollection{ wets:large, 38229 author = {R. J.-B. Wets}, 38230 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 38231 booktitle = {Numerical Techniques for Stochastic Optimization}, 38232 publisher = {Springer-Verlag}, 38233 year = {1988}, 38234 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 38235 address = {Berlin}, 38236 pages = {65--93} 38237} 38238 38239@Article{ white:asymptotic, 38240 author = {H. White}, 38241 title = {Some asymptotic results for learning in single hidden-layer feedforward network 38242 models}, 38243 journal = {Journal of the American Stattistical Association}, 38244 year = {1989}, 38245 volume = {84}, 38246 number = {408}, 38247 pages = {1003--1013} 38248} 38249 38250@Article{ white:learning, 38251 author = {H. White}, 38252 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 38253 journal = {Neural Computation}, 38254 year = {1989}, 38255 volume = {1}, 38256 pages = {425--461} 38257} 38258 38259@InProceedings{ whitley.starkweather.ea:scheduling, 38260 crossref = {schaeffer:third}, 38261 author = {D. Whitley and T. Starkweather and D. Fuquay}, 38262 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 38263 Operator}, 38264 pages = {133--140} 38265} 38266 38267@Book{ williams:model, 38268 author = {H. P. Williams}, 38269 title = {Model Building in Mathematical Programming}, 38270 publisher = {John Wiley \& Sons}, 38271 year = {1990}, 38272 edition = {Third} 38273} 38274 38275@Book{ wilmott.dewynne.ea:option, 38276 author = {P. Wilmott and J. Dewynne and S. Howison}, 38277 title = {Option Pricing}, 38278 publisher = {Oxford Financial Press}, 38279 year = {1993}, 38280 address = {Oxford, England} 38281} 38282 38283@PhDThesis{ wilson:simplicial, 38284 author = {R. B. Wilson}, 38285 title = {A Simplicial Algorithm for Concave Programming}, 38286 year = {1963}, 38287 address = {Boston, MA}, 38288 school = {Graduate School of Business Administration, Harvard University} 38289} 38290 38291@TechReport{ wolberg.bennett.ea:breast, 38292 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 38293 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 38294 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 38295 Wisconsin}, 38296 year = {1992}, 38297 address = {Madison, WI 53706}, 38298 type = {Manuscript} 38299} 38300 38301@Article{ wolberg.mangasarian:multisurface, 38302 author = {W. H. Wolberg and O. L. Mangasarian}, 38303 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 38304 Cytology}, 38305 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 38306 year = {1990}, 38307 volume = {87}, 38308 pages = {9193--9196} 38309} 38310 38311@Unpublished{ wolberg.mangasarian:wbcd, 38312 author = {W. H. Wolberg and O. L. Mangasarian}, 38313 title = {{WBCD: Wisconsin Breast Cancer Database}}, 38314 year = {1991}, 38315 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 38316 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 38317} 38318 38319@Article{ wolberg.street.ea:breast, 38320 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38321 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 38322 journal = {Analytical and Quantitative Cytology and Histology}, 38323 year = {1993}, 38324 volume = {15}, 38325 number = {6}, 38326 pages = {396--404} 38327} 38328 38329@Unpublished{ wolberg.street.ea:wdbc, 38330 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38331 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 38332 year = {1995}, 38333 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38334 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 38335} 38336 38337@Unpublished{ wolberg.street.ea:wpbc, 38338 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38339 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 38340 year = {1995}, 38341 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38342 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 38343} 38344 38345@Book{ wolsey:integer, 38346 author = {L. A. Wolsey}, 38347 title = {Integer Programming}, 38348 publisher = {John Wiley \& Sons}, 38349 year = {1998}, 38350 address = {New York, NY} 38351} 38352 38353@Article{ womersley:local, 38354 author = {R. S. Womersley}, 38355 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 38356 journal = {Mathematical Programming}, 38357 year = {1985}, 38358 volume = {32}, 38359 pages = {69--89} 38360} 38361 38362@Article{ woo.sanders.ea:peacock, 38363 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 38364 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 38365 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38366 year = {1994}, 38367 volume = {29}, 38368 number = {1}, 38369 pages = {213--214} 38370} 38371 38372@Article{ wright.ralph:superlinear, 38373 author = {S. J. Wright and D. Ralph}, 38374 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 38375 Problems}, 38376 year = {1996}, 38377 journal = {Mathematics of Operations Research}, 38378 volume = {21}, 38379 pages = {815--838} 38380} 38381 38382@TechReport{ wright.zhang:superquadratic, 38383 author = {S. J. Wright and Y. Zhang}, 38384 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 38385 problems}, 38386 institution = {Argonne National Laboratory}, 38387 year = {1994}, 38388 annote = {revised}, 38389 number = {MCS--P418--0294}, 38390 address = {Argonne, Illinois}, 38391 type = {Preprint} 38392} 38393 38394@TechReport{ wright:dynfgm, 38395 author = {S. E. Wright}, 38396 title = {{DYNFGM}: Dynamic Finite Generation Method}, 38397 institution = {Department of Mathematics, University of Washington}, 38398 year = {1989}, 38399 address = {Seattle, Washington} 38400} 38401 38402@Article{ wright:infeasible-interior-point, 38403 author = {S. J. Wright}, 38404 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 38405 journal = {Mathematical Programming}, 38406 volume = {67}, 38407 pages = {29--51}, 38408 year = {1994} 38409} 38410 38411@Article{ wright:path-following, 38412 author = {S. J. Wright}, 38413 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 38414 Complementarity Problems}, 38415 journal = {Optimization Methods and Software}, 38416 year = {1993}, 38417 volume = {2}, 38418 pages = {79--106} 38419} 38420 38421@TechReport{ wright:path-following*1, 38422 author = {S. J. Wright}, 38423 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 38424 Problems}, 38425 institution = {Argonne National Laboratory}, 38426 year = {1993}, 38427 number = {MCS--P401--1293}, 38428 address = {Argonne, Illinois} 38429} 38430 38431@Book{ wright:primal-dual, 38432 author = {S. J. Wright}, 38433 title = {Primal--Dual Interior--Point Methods}, 38434 year = {1997}, 38435 publisher = {SIAM}, 38436 address = {Philadelphia, Pennsylvania} 38437} 38438 38439@TechReport{ wright:reduced, 38440 author = {S. J. Wright}, 38441 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 38442 institution = {Argonne National Laboratory}, 38443 year = {2000}, 38444 number = {MCS--P808--0400}, 38445 address = {Argonne, Illinois} 38446} 38447 38448@Article{ wright:solution, 38449 author = {S. J. Wright}, 38450 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 38451 journal = {Parallel Computing}, 38452 year = {1990}, 38453 volume = {16}, 38454 pages = {221--238} 38455} 38456 38457@Article{ wu.bourland:morphology, 38458 author = {Q. J. Wu and J. D. Bourland}, 38459 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 38460 isocenters}, 38461 journal = {Medical Physics}, 38462 year = {1999}, 38463 volume = {26}, 38464 number = {10}, 38465 pages = {2151--2160} 38466} 38467 38468@Misc{ wunderling:soplex, 38469 author = {R. Wunderling}, 38470 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 38471 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 38472} 38473 38474@Article{ xiao.harker:nonsmooth, 38475 author = {B. Xiao and P. T. Harker}, 38476 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 38477 journal = {Mathematical Programming}, 38478 year = {1994}, 38479 volume = {65}, 38480 pages = {151--194} 38481} 38482 38483@Article{ xiao.harker:nonsmooth*1, 38484 author = {B. Xiao and P. T. Harker}, 38485 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 38486 Results}, 38487 journal = {Mathematical Programming}, 38488 year = {1994}, 38489 volume = {65}, 38490 pages = {195--216} 38491} 38492 38493@Article{ xiao.zhou:nonmonotone, 38494 author = {Y. Xiao and F. J. Zhou}, 38495 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 38496 Minimization}, 38497 journal = {Computing}, 38498 year = {1992}, 38499 volume = {48}, 38500 pages = {303--317} 38501} 38502 38503@TechReport{ xiao:global, 38504 author = {B. Xiao}, 38505 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 38506 {B}-differentiable equation approach}, 38507 type = {{Ph.D. Thesis}}, 38508 year = {1990}, 38509 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 38510 address = {Philadelphia, PA} 38511} 38512 38513@Article{ xu.burke:polynomial, 38514 author = {S. Xu and J. V. Burke}, 38515 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 38516 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 38517 year = {1999}, 38518 journal = {Mathematical Programming}, 38519 volume = {86}, 38520 pages = {91--104} 38521} 38522 38523@TechReport{ xu:global, 38524 author = {S. Xu}, 38525 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 38526 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 38527 institution = {Department of Mathematics, University of Washington}, 38528 year = {1996}, 38529 type = {Technical Report}, 38530 address = {Seattle, WA} 38531} 38532 38533@Article{ yajima.konno:efficient, 38534 author = {Y. Yajima and H. Konno}, 38535 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 38536 Problems}, 38537 journal = {Journal of Global Optimization}, 38538 year = {1991}, 38539 volume = {1:1}, 38540 pages = {155--171} 38541} 38542 38543@Article{ yamamoto:path-following, 38544 author = {Y. Yamamoto}, 38545 title = {A Path--Following Algorithm for Stationary Point Problems}, 38546 journal = {Journal of Operations Society of Japan}, 38547 year = {1987}, 38548 volume = {30}, 38549 pages = {181--198} 38550} 38551 38552@Article{ yamashita.fukushima:modified, 38553 author = {N. Yamashita and M. Fukushima}, 38554 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 38555 Complementarity Problems}, 38556 journal = {Mathematical Programming}, 38557 year = {1997}, 38558 volume = {76}, 38559 pages = {469--492} 38560} 38561 38562@Article{ yamashita.fukushima:stationary, 38563 author = {N. Yamashita and M. Fukushima}, 38564 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 38565 Problems}, 38566 journal = {Journal of Optimization Theory and Applications}, 38567 volume = {84}, 38568 pages = {653--663}, 38569 year = {1995} 38570} 38571 38572@Article{ yamashita.taji.ea:unconstrained, 38573 author = {N. Yamashita and K. Taji and M. Fukushima}, 38574 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 38575 journal = {Journal of Optimization Theory and Applications}, 38576 year = {1997}, 38577 volume = {92}, 38578 pages = {439--456} 38579} 38580 38581@TechReport{ yamashita:properties, 38582 author = {N. Yamashita}, 38583 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 38584 Complementarity Problem}, 38585 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 38586 year = {1996}, 38587 type = {Technical Report}, 38588 address = {Kyoto, Japan} 38589} 38590 38591@Article{ yang.mackie.ea:investigation, 38592 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 38593 Thomadsen}, 38594 title = {An investigation of tomotherapy beam delivery}, 38595 journal = {Medical Physics}, 38596 year = {1997}, 38597 volume = {24}, 38598 number = {3}, 38599 pages = {425--436} 38600} 38601 38602@Article{ yan.shu.ea:clinical, 38603 author = {Y. Yan and H. Shu and X. Bao}, 38604 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 38605 Treatmen System}, 38606 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38607 year = {1997}, 38608 volume = {39}, 38609 pages = {247--254} 38610} 38611 38612@Article{ yau.gao:obstacle, 38613 author = {S. T. Yau and Y. Gao}, 38614 title = {Obstacle problem for von {K}arm\'an equations}, 38615 journal = {Advances in Applied Mathematics}, 38616 volume = {13}, 38617 year = {1992}, 38618 pages = {123--141} 38619} 38620 38621@Article{ ye.tse:extension, 38622 author = {Y. Ye and E. Tse}, 38623 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 38624 Programming}, 38625 journal = {Mathematical Programming}, 38626 year = {1989}, 38627 volume = {44} 38628} 38629 38630@Article{ ye:affine, 38631 author = {Y. Ye}, 38632 title = {On affine scaling algorithms for nonconvex quadratic programming}, 38633 journal = {Mathematical Programming}, 38634 year = {1992}, 38635 volume = {56}, 38636 pages = {285--300} 38637} 38638 38639@PhDThesis{ ye:interior, 38640 author = {Y. Ye}, 38641 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 38642 Programming}, 38643 year = {1987}, 38644 address = {Stanford, California}, 38645 school = {Department of Engineering--Economic Systems, Stanford University} 38646} 38647 38648@Book{ ye:interior*1, 38649 author = {Y. Ye}, 38650 title = {Interior-Point Algorithms: Theory and Analysis}, 38651 publisher = {John Wiley \& Sons}, 38652 year = {1997}, 38653 address = {New York, NY} 38654} 38655 38656@Article{ yu:convergence, 38657 author = {W. --C. Yu}, 38658 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 38659 journal = {Scientia Sinica, Special issue of Mathematics}, 38660 year = {1979}, 38661 volume = {1}, 38662 pages = {68--77} 38663} 38664 38665@Article{ yu.schell:genetic, 38666 author = {Y. Yu and M. C. Schell}, 38667 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 38668 journal = {Medical Physics}, 38669 year = {1996}, 38670 volume = {23}, 38671 pages = {2085--2091} 38672} 38673 38674@Article{ yuan:superlinear, 38675 author = {Y. Yuan}, 38676 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 38677 Optimization}, 38678 journal = {Mathematical Programming}, 38679 year = {1985}, 38680 volume = {31}, 38681 pages = {269--285} 38682} 38683 38684@Book{ zangwill:nonlinear, 38685 author = {W. I. Zangwill}, 38686 title = {Nonlinear Programming: {A} Unified Approach}, 38687 year = {1969}, 38688 publisher = {Prentice-Hall, Inc}, 38689 address = {Englewood Cliffs, New Jersey} 38690} 38691 38692@TechReport{ zangwill:nonlinear*1, 38693 author = {W. I. Zangwill}, 38694 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 38695 institution = {Center for Research in Management Science, University of California}, 38696 year = {1965}, 38697 address = {Berkeley}, 38698 number = {131}, 38699 type = {Working Paper} 38700} 38701 38702@Article{ zangwill:nonlinear*2, 38703 author = {W. I. Zangwill}, 38704 title = {Nonlinear Programming via Penalty Functions}, 38705 journal = {Management Science}, 38706 year = {1967}, 38707 volume = {13}, 38708 pages = {344--358} 38709} 38710 38711@TechReport{ zenios.censor:massively, 38712 author = {S. A. Zenios and Y. Censor}, 38713 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 38714 Problems}, 38715 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 38716 year = {1990}, 38717 type = {report}, 38718 number = {89-09-10}, 38719 address = {Philadelphia, PA} 38720} 38721 38722@Article{ zenios.lasken:nonlinear, 38723 author = {S. A. Zenios and R. A. Lasken}, 38724 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 38725 journal = {Annals of Operations Research}, 38726 year = {1988}, 38727 volume = {14}, 38728 pages = {147--163} 38729} 38730 38731@Article{ zenios.mulvey:distributed, 38732 author = {S. A. Zenios and J. M. Mulvey}, 38733 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 38734 journal = {Parallel Computing}, 38735 year = {1988}, 38736 volume = {6}, 38737 pages = {43--56} 38738} 38739 38740@TechReport{ zenios.neilsen:massively, 38741 author = {S. A. Zenios and S. Neilsen}, 38742 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 38743 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38744 year = {1990}, 38745 type = {report}, 38746 number = {90-03-01}, 38747 address = {Philadelphia, PA} 38748} 38749 38750@TechReport{ zenios.qi.ea:comparative, 38751 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 38752 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 38753 Nonlinear Network Optimization}, 38754 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38755 year = {1990}, 38756 type = {report}, 38757 number = {89-10-02}, 38758 address = {Philadelphia, PA} 38759} 38760 38761@Article{ zhang.kim.ea:improved, 38762 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 38763 title = {An Improved Successive Linear Programming Algorithm}, 38764 year = {1985}, 38765 journal = {Management Science}, 38766 volume = {31}, 38767 pages = {1312--1331} 38768} 38769 38770@Article{ zhang.tapia.ea:superlinear, 38771 author = {Y. Zhang and R. A. Tapia and F. Potra}, 38772 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 38773 of problems}, 38774 journal = {SIAM Journal on Optimization}, 38775 year = {1993}, 38776 volume = {3}, 38777 number = {?}, 38778 pages = {413--422}, 38779} 38780 38781@Article{ zhang.tapia:superlinearly, 38782 author = {Y. Zhang and R. A. Tapia}, 38783 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 38784 linear programming}, 38785 journal = {SIAM Journal on Optimization}, 38786 year = {1993}, 38787 volume = {3}, 38788 pages = {118--133} 38789} 38790 38791@TechReport{ zhang.zhang:superlinear, 38792 author = {Y. Zhang and D. Zhang}, 38793 title = {Superlinear convergence of infeasible interior-point methods for linear 38794 programming}, 38795 institution = {Department of Mathematics and Statistics, University of Maryland}, 38796 year = {1992}, 38797 number = {92-15}, 38798 address = {Baltimore County, Maryland} 38799} 38800 38801@Article{ zhang:convergence, 38802 author = {Yin Zhang}, 38803 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 38804 Horizontal Linear Complementarity Problem}, 38805 journal = {SIAM Journal on Optimization}, 38806 year = {1994}, 38807 volume = {4}, 38808 pages = {208--227} 38809} 38810 38811@Article{ zhang:convergence*1, 38812 author = {Y. Zhang}, 38813 title = {On the convergence of a class of infeasible interior-point methods for the 38814 horizontal linear complementarity problem}, 38815 journal = {SIAM Journal on Optimization}, 38816 year = {1994}, 38817 volume = {4}, 38818 pages = {208--227} 38819} 38820 38821@Article{ zhu.rockafellar:primal-dual, 38822 author = {C. Y. Zhu and R. T. Rockafellar}, 38823 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 38824 Programming}, 38825 journal = {SIAM Journal on Optimization}, 38826 year = {1993}, 38827 volume = {3}, 38828 pages = {751--783} 38829} 38830 38831@Article{ zhu:modified, 38832 author = {C. Y. Zhu}, 38833 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 38834 journal = {Computational Optimization and Applications}, 38835 year = {1992}, 38836 volume = {2}, 38837 pages = {182--205} 38838} 38839 38840@Article{ zhu:primal-dual, 38841 author = {C. Y. Zhu}, 38842 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 38843 Programming}, 38844 journal = {SIAM Journal on Optimization}, 38845 year = {1995}, 38846 volume = {5}, 38847 pages = {114--128} 38848} 38849 38850@Book{ zoutendijk:methods, 38851 author = {G. Zoutendijk}, 38852 title = {Methods of Feasible Directions}, 38853 year = {1960}, 38854 publisher = {Elsevier Publishing Company}, 38855 address = {Amsterdam} 38856} 38857 38858@Article{ zowe.kurcyusz:regularity, 38859 author = {J. Zowe and S. Kurcyusz}, 38860 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 38861 journal = {Applied Mathematics and Optimization}, 38862 year = {1979}, 38863 volume = {5}, 38864 pages = {49--62} 38865} 38866 38867@InProceedings{ zowe:nondifferentiable, 38868 author = {J. Zowe}, 38869 title = {Nondifferentiable Optimization}, 38870 booktitle = {Computational Mathematical Programming}, 38871 year = {1985}, 38872 editor = {K. Schittkowski}, 38873 publisher = {Springer-Verlag}, 38874 address = {Berlin} 38875} 38876 38877@Proceedings{ bachem.grotschel.ea:mathematical, 38878 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 38879 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 38880 year = {1983}, 38881 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 38882 publisher = {Springer Verlag}, 38883 address = {Berlin} 38884} 38885 38886@Proceedings{ belew.booker:fourth, 38887 year = {1991}, 38888 editor = {R. K. Belew and L. B. Booker}, 38889 publisher = {Morgan Kaufmann Publishers, Inc}, 38890 address = {San Mateo, California}, 38891 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 38892} 38893 38894@Proceedings{ coleman.li:large-scale, 38895 year = {1990}, 38896 editor = {T. F. Coleman and Y. Li}, 38897 publisher = {SIAM}, 38898 address = {Philadelphia, Pennsylvania}, 38899 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 38900 University, Ithaca, New York, October 19-20, 1989}, 38901 booktitle = {Large-Scale Numerical Optimization} 38902} 38903 38904@Book{ davis:genetic, 38905 title = {Genetic Algorithms and Simulated Annealing}, 38906 year = {1987}, 38907 editor = {L. D. Davis}, 38908 publisher = {Pitman}, 38909 address = {London}, 38910 booktitle = {Genetic Algorithms and Simulated Annealing} 38911} 38912 38913@Proceedings{ ferris.pang:complementarity, 38914 title = {Complementarity and Variational Problems: State of the Art}, 38915 booktitle = {Complementarity and Variational Problems: State of the Art}, 38916 year = {1997}, 38917 key = {57}, 38918 editor = {M. C. Ferris and J. S. Pang}, 38919 publisher = {SIAM Publications}, 38920 address = {Philadelphia, Pennsylvania} 38921} 38922 38923@Proceedings{ ferris.mangasarian.ea:complementarity, 38924 title = {Complementarity: Applications, Algorithms and Extensions}, 38925 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 38926 year = {2001}, 38927 key = {95}, 38928 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 38929 publisher = {Kluwer Academic Publishers}, 38930 address = {Dordrecht, The Netherlands} 38931} 38932 38933@Proceedings{ florian:traffic, 38934 title = {Traffic Equilibrium Methods}, 38935 year = {1976}, 38936 editor = {M. Florian}, 38937 publisher = {Springer-Verlag}, 38938 address = {Berlin} 38939} 38940 38941@Proceedings{ grefenstette:genetic, 38942 title = {Genetic Algorithms and their Applications: Proceedings of the Second 38943 International Conference on Genetic Algorithms}, 38944 year = {1987}, 38945 editor = {J. J. Grefenstette}, 38946 publisher = {Lawrence Erlbaum Associates}, 38947 address = {Hillsdale, New Jersey}, 38948 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 38949 International Conference on Genetic Algorithms} 38950} 38951 38952@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 38953 booktitle = {Nonlinear Programming}, 38954 volume = {2}, 38955 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38956 publisher = {Academic Press}, 38957 address = {New York}, 38958 year = {1975} 38959} 38960 38961@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 38962 booktitle = {Nonlinear Programming}, 38963 volume = {3}, 38964 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38965 publisher = {Academic Press}, 38966 address = {London}, 38967 year = {1978} 38968} 38969 38970@Proceedings{ robinson:local, 38971 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 38972 Regularity}, 38973 year = {1983}, 38974 editor = {V. Pereyra and A. Reinoza}, 38975 publisher = {Springer-Verlag}, 38976 address = {Berlin}, 38977 author = {S. M. Robinson}, 38978 pages = {240--251}, 38979 series = {Numerical Methods: Proceedings, Caracas 1982} 38980} 38981 38982@Proceedings{ schaeffer:third, 38983 year = {1989}, 38984 editor = {J. D. Schaeffer}, 38985 publisher = {Morgan Kaufmann Publishers, Inc}, 38986 address = {San Mateo, California}, 38987 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 38988} 38989 38990@Book{ vanderbei:linear, 38991 author = {R. J. Vanderbei}, 38992 title = {Linear Programming: Foundations and Extensions}, 38993 year = {1997}, 38994 publisher = {Kluwer Academic Publishers}, 38995 address = {Boston, Massachusetts} 38996} 38997 38998@Book{ dfobook, 38999 title = {Introduction to Derivative-Free Optimization}, 39000 publisher = {Society for Industrial and Applied Mathematics}, 39001 year = {2009}, 39002 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 39003 series = {MPS/SIAM Series on Optimization}, 39004 address = {Philadelphia, PA, USA}, 39005 isbn = {0-89871-460-5} 39006} 39007 39008@Article{ unedf0, 39009 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 39010 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 39011 title = {Nuclear Energy Density Optimization}, 39012 journal = {Physical Review C}, 39013 year = {2010}, 39014 volume = {82}, 39015 number = {2}, 39016 pages = {024313}, 39017 doi = {10.1103/PhysRevC.82.024313} 39018} 39019 39020@Article{ hestenes1969multiplier, 39021 title = {Multiplier and gradient methods}, 39022 author = {Hestenes, Magnus R}, 39023 journal = {Journal of optimization theory and applications}, 39024 volume = {4}, 39025 number = {5}, 39026 pages = {303--320}, 39027 year = {1969}, 39028 publisher = {Springer} 39029} 39030 39031@Article{ powell1969method, 39032 title = {A method for nonlinear constraints in minimization problems}, 39033 author = {Powell, Michael JD}, 39034 journal = {Optimization}, 39035 pages = {283--298}, 39036 year = {1969}, 39037 publisher = {Academic Press} 39038} 39039 39040@Book{ nocedal2006numerical, 39041 title = {Numerical optimization}, 39042 author = {Jorge Nocedal and Stephen Wright}, 39043 year = {2006}, 39044 publisher = {Springer Science \& Business Media} 39045} 39046 39047@Article{ rockafellar1974augmented, 39048 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 39049 author = {Rockafellar, R Tyrrell}, 39050 journal = {SIAM Journal on Control}, 39051 volume = {12}, 39052 number = {2}, 39053 pages = {268--285}, 39054 year = {1974}, 39055 publisher = {SIAM} 39056} 39057 39058@Article{ bacuta2006, 39059 title = {A unified approach for Uzawa algorithms}, 39060 author = {Constantin Bacuta}, 39061 journal = {SIAM Journal on Numerical Analysis}, 39062 volume = {44}, 39063 number = {6}, 39064 pages = {2633--2649}, 39065 year = {2006} 39066} 39067 39068@Article{ manteuffelrugesouthworth2018, 39069 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 39070 (AIR)}, 39071 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 39072 journal = {SIAM Journal on Scientific Computing}, 39073 volume = {40}, 39074 number = {6}, 39075 pages = {A4105--A4130}, 39076 year = {2018} 39077} 39078 39079@Article{ manteuffelmunzenmaierrugesouthworth2019, 39080 title = {Nonsymmetric reduction-based algebraic multigrid}, 39081 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 39082 journal = {SIAM Journal on Scientific Computing}, 39083 volume = {41}, 39084 number = {5}, 39085 pages = {S242--S268}, 39086 year = {2019} 39087} 39088 39089@PhDThesis{ sivas2021, 39090 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 39091 author = {Abdullah Ali Sivas}, 39092 department = {Applied Mathematics}, 39093 institution = {University of Waterloo}, 39094 year = {2021} 39095} 39096 39097@Article{ brookshughes1982, 39098 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 39099 with particular emphasis on the incompressible {Navier-Stokes} equations}, 39100 author = {Alexander N Brooks and Thomas JR Hughes}, 39101 journal = {Computer methods in applied mechanics and engineering}, 39102 volume = {32}, 39103 number = {1-3}, 39104 pages = {199--259}, 39105 year = {1982}, 39106 publisher = {Elsevier} 39107} 39108 39109@InProceedings{ suhisaac2020, 39110 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 39111 author = {Hansol Suh and Tobin Isaac}, 39112 booktitle = {SC20: International Conference for High Performance Computing, Networking, 39113 Storage and Analysis}, 39114 pages = {1--12}, 39115 year = {2020}, 39116 organization = {IEEE} 39117} 39118 39119@Misc{ alauzet2010, 39120 title = {Metric-Based Anisotropic Mesh Adaptation}, 39121 author = {Fr\'{e}d\'{e}ric Alauzet}, 39122 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 39123 year = {2010} 39124} 39125 39126@Article{ chan1994qmrcgs, 39127 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 39128 systems}, 39129 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 39130 and Tong, Charles H}, 39131 journal = {SIAM Journal on Scientific Computing}, 39132 volume = {15}, 39133 number = {2}, 39134 pages = {338--347}, 39135 year = {1994}, 39136 publisher = {SIAM} 39137} 39138 39139@Article{ ghai2019comparison, 39140 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 39141 nonsymmetric linear systems}, 39142 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 39143 journal = {Numerical Linear Algebra with Applications}, 39144 volume = {26}, 39145 number = {1}, 39146 pages = {e2215}, 39147 year = {2019}, 39148 publisher = {Wiley Online Library} 39149} 39150 39151@Article{ mishrasalacknepley2022, 39152 title = {On the order of accuracy for finite difference approximations of partial 39153 differential equations using stencil composition}, 39154 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 39155 journal = {International Journal on Numerical Methods in Engineering}, 39156 note = {Submitted}, 39157 year = {2022} 39158} 39159 39160@Article{ nathawaniknepley2022, 39161 title = {Droplet formation simulation using mixed finite elements}, 39162 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39163 journal = {Physics of Fluids}, 39164 volume = {34}, 39165 pages = {064105}, 39166 doi = {10.1063/5.0089752}, 39167 year = {2022} 39168} 39169 39170@InProceedings{ nathawaniknepley2022b, 39171 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 39172 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39173 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 39174 (ICCFD11)}, 39175 editor = {Christoph Brehm and Shishir Pandya}, 39176 number = {4103}, 39177 year = {2022} 39178} 39179 39180@Article{ nathawaniknepley2023, 39181 title = {One-dimensional model to simulate shear-induced droplet formation}, 39182 author = {Darsh K. Nathawani and Matthew G. Knepley}, 39183 journal = {International Journal of Multiphase Flow}, 39184 note = {Submitted}, 39185 year = {2023} 39186} 39187 39188@InProceedings{ georgalisnathawaniknepleypatra2023, 39189 title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, 39190 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 39191 Patra}, 39192 booktitle = {AIAA SciTech 2024}, 39193 note = {Accepted}, 39194 year = {2023} 39195} 39196 39197@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 39198 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 39199 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 39200 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 39201 Thompson and Junchao Zhang}, 39202 doi = {10.48550/ARXIV.2204.01722}, 39203 url = {https://arxiv.org/abs/2204.01722}, 39204 publisher = {arXiv}, 39205 note = {Submitted}, 39206 year = {2022} 39207} 39208 39209@InCollection{ mayknepley2023, 39210 title = {Numerical Modeling of Subduction}, 39211 author = {Dave A. May and Matthew G. Knepley}, 39212 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 39213 editor = {João C. Duarte}, 39214 pages = {539-571}, 39215 isbn = {978-0-323-85733-8}, 39216 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 39217 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 39218 year = {2023} 39219} 39220 39221@Article{ adamsknepley2023, 39222 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 39223 plasmas in {PETSc}}, 39224 author = {Mark F. Adams and Matthew G. Knepley}, 39225 url = {https://arxiv.org/abs/2302.10242}, 39226 note = {In preparation}, 39227 year = {2023}, 39228 petsc_uses = {DMPlex} 39229} 39230 39231@Article{ finnknepleypusztayadams2023, 39232 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 39233 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 39234 url = {https://arxiv.org/abs/2303.12620}, 39235 journal = {Communications in Applied Mathematics and Computational Science}, 39236 volume = {18}, 39237 number = {1}, 39238 pages = {135--152}, 39239 doi = {10.2140/camcos.2023.18.135}, 39240 year = {2023} 39241} 39242 39243@Article{ eggersdupont1994, 39244 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 39245 equation}, 39246 author = {Jens Eggers and Todd F. Dupont}, 39247 journal = {Journal of fluid mechanics}, 39248 volume = {262}, 39249 pages = {205--221}, 39250 year = {1994}, 39251 publisher = {Cambridge University Press} 39252} 39253 39254@PhDThesis{ pusztaythesis2023, 39255 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 39256 author = {Joseph V. Pusztay}, 39257 type = {{PhD} thesis}, 39258 school = {University at Buffalo, Department of Computer Science and Engineering}, 39259 address = {Buffalo, NY}, 39260 month = may, 39261 year = {2022} 39262} 39263 39264@PhDThesis{ finnthesis2023, 39265 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 39266 System}, 39267 author = {Daniel S. Finn}, 39268 type = {{PhD} thesis}, 39269 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39270 Engineering}, 39271 address = {Buffalo, NY}, 39272 month = may, 39273 year = {2023} 39274} 39275 39276@PhDThesis{ nathawanithesis2023, 39277 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 39278 author = {Darsh Kiritbhai Nathawani}, 39279 type = {{PhD} thesis}, 39280 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39281 Engineering}, 39282 address = {Buffalo, NY}, 39283 month = may, 39284 year = {2023} 39285} 39286 39287@article{MckayEriksonKozdon2019, 39288 title = {A computational method for earthquake cycles within anisotropic media}, 39289 author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, 39290 journal = {Geophysical Journal International}, 39291 volume = {219}, 39292 number = {2}, 39293 pages = {816--833}, 39294 year = {2019}, 39295} 39296 39297@article{EricksonOReillyNordstrom2019, 39298 title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, 39299 author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, 39300 journal = {Journal of Scientific Computing}, 39301 volume = {81}, 39302 pages = {2356--2387}, 39303 year = {2019}, 39304} 39305 39306@article{KozdonEricksonWilcox2021, 39307 title = {Hybridized summation-by-parts finite difference methods}, 39308 author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, 39309 journal = {Journal of Scientific Computing}, 39310 volume = {87}, 39311 number = {3}, 39312 pages = {85}, 39313 year = {2021}, 39314} 39315 39316@article{SEAS2022, 39317 title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, 39318 author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, 39319 journal = {Journal of Geophysical Research: Solid Earth}, 39320 volume = {127}, 39321 number = {3}, 39322 pages = {e2021JB023519}, 39323 year = {2022}, 39324} 39325 39326@article{EricksonKozdonHarvey2022, 39327 title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, 39328 author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, 39329 journal = {Journal of Scientific Computing}, 39330 volume = {93}, 39331 number = {1}, 39332 pages = {17}, 39333 year = {2022}, 39334} 39335 39336@article{RuckerEriksonKarlstromLeeGopalakrishnan2022, 39337 title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, 39338 author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, 39339 journal = {Journal of Geophysical Research: Solid Earth}, 39340 volume = {127}, 39341 number = {9}, 39342 pages = {e2022JB024506}, 39343 year = {2022}, 39344} 39345 39346@article{HarveyEriksonKozdon2023, 39347 title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, 39348 author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, 39349 journal = {Journal of Geophysical Research: Solid Earth}, 39350 pages = {e2022JB025357}, 39351 year = {2023}, 39352} 39353 39354@article{SEAS2023, 39355 title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, 39356 author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, 39357 journal = {Bulletin of the Seismological Society of America}, 39358 volume = {113}, 39359 number = {2}, 39360 pages = {499--523}, 39361 year = {2023}, 39362} 39363