1% 2% This file is formatted by: 3% bibtool petsc.bib -- expand.macros=on -- print.line.length=100 -- pass.comments=on 4% 5% If the reference uses PETSc, include a field listing components used, e.g. 6% petsc_uses = {KSP, SNES, TS, TAO}, 7% 8% For journal names, write out the full name, do not define abbreviations 9% 10% There are some additional historical comments below which may be of interest, 11% particularly in terms of notes about particularly impactful publications using PETSc. 12% 13 14% LiteralHTML: 15% LiteralHTML: <H2><center>Research and Publications that make use of PETSc</center></H2> 16% LiteralHTML: 17% LiteralHTML: <a name="nano"><H3><center>Nano-simulations</center></H3> 18% LiteralHTML: 19@article{veldhuizen1984d, 20 title = {{D}-stability and {K}aps-{R}entrop-methods}, 21 author = {Veldhuizen, M van}, 22 journal = {Computing}, 23 volume = {32}, 24 number = {3}, 25 pages = {229--237}, 26 year = {1984}, 27 publisher = {Springer} 28} 29 30@article{shampine1982implementation, 31 title = {Implementation of {R}osenbrock methods}, 32 author = {Shampine, Lawrence F}, 33 journal = {ACM Transactions on Mathematical Software (TOMS)}, 34 volume = {8}, 35 number = {2}, 36 pages = {93--113}, 37 year = {1982}, 38 publisher = {ACM New York, NY, USA} 39} 40 41@book{wanner1996solving, 42 title = {Solving ordinary differential equations {II}}, 43 author = {Wanner, Gerhard and Hairer, Ernst}, 44 volume = {375}, 45 year = {1996}, 46 publisher = {Springer Berlin Heidelberg New York} 47} 48 49@article{kaps1979generalized, 50 title = {Generalized {R}unge--{K}utta methods of order four with stepsize control for stiff ordinary differential equations}, 51 author = {Kaps, Peter and Rentrop, Peter}, 52 journal = {Numerische Mathematik}, 53 volume = {33}, 54 pages = {55--68}, 55 year = {1979}, 56 publisher = {Springer} 57} 58 59@book{butcher2016numerical, 60 title = {Numerical methods for ordinary differential equations}, 61 author = {Butcher, John Charles}, 62 year = {2016}, 63 publisher = {John Wiley \& Sons} 64} 65 66@article{chung1993, 67 author = {Chung, J. and Hulbert, G. M.}, 68 title = {A Time Integration Algorithm for Structural Dynamics With Improved Numerical Dissipation: The Generalized-alpha Method}, 69 journal = {Journal of Applied Mechanics}, 70 volume = {60}, 71 number = {2}, 72 pages = {371-375}, 73 year = {1993}, 74 month = {06}, 75 issn = {0021-8936}, 76 doi = {10.1115/1.2900803}, 77 url = {https://doi.org/10.1115/1.2900803}, 78 eprint = {https://asmedigitalcollection.asme.org/appliedmechanics/article-pdf/60/2/371/5463014/371\_1.pdf}, 79} 80 81@article{hosea1996analysis, 82 title = {Analysis and implementation of {TR-BDF2}}, 83 author = {Hosea, ME and Shampine, LF}, 84 journal = {Applied Numerical Mathematics}, 85 volume = {20}, 86 number = {1-2}, 87 pages = {21--37}, 88 year = {1996}, 89 publisher = {Elsevier} 90} 91 92@article{kennedy2019diagonally, 93 title = {Diagonally implicit {R}unge--{K}utta methods for stiff {ODE}s}, 94 author = {Kennedy, Christopher A and Carpenter, Mark H}, 95 journal = {Applied Numerical Mathematics}, 96 volume = {146}, 97 pages = {221--244}, 98 year = {2019}, 99 publisher = {Elsevier} 100} 101 102@inproceedings{xu2017adaptive, 103 title = {Adaptive relaxed {ADMM}: Convergence theory and practical implementation}, 104 author = {Xu, Zheng and Figueiredo, Mario AT and Yuan, Xiaoming and Studer, Christoph and Goldstein, Tom}, 105 booktitle = {Proceedings of the IEEE conference on computer vision and pattern recognition}, 106 pages = {7389--7398}, 107 year = {2017} 108} 109 110@article{hindmarsh1996time, 111 title = {Time-step limits for stable solutions of the ice-sheet equation}, 112 author = {Hindmarsh, Richard CA and Payne, Antony J}, 113 journal = {Annals of Glaciology}, 114 volume = {23}, 115 pages = {74--85}, 116 year = {1996}, 117 publisher = {Cambridge University Press} 118} 119 120@article{benson2006flexible, 121 title = {Flexible complementarity solvers for large-scale applications}, 122 author = {Benson, Steven J and Munson, Todd S}, 123 journal = {Optimization Methods and Software}, 124 volume = {21}, 125 number = {1}, 126 pages = {155--168}, 127 year = {2006}, 128 publisher ={Taylor \& Francis} 129} 130 131@article{byrd1994representations, 132 title = {Representations of quasi-{N}ewton matrices and their use in limited memory methods}, 133 author = {Byrd, Richard H and Nocedal, Jorge and Schnabel, Robert B}, 134 journal = {Mathematical Programming}, 135 volume = {63}, 136 number = {1-3}, 137 pages = {129--156}, 138 year = {1994}, 139 publisher = {Springer} 140} 141 142@article{gilbert1989some, 143 title = {Some numerical experiments with variable-storage quasi-{N}ewton algorithms}, 144 author = {Gilbert, Jean Charles and Lemar{\'e}chal, Claude}, 145 journal = {Mathematical programming}, 146 volume = {45}, 147 number = {1-3}, 148 pages = {407--435}, 149 year = {1989}, 150 publisher = {Springer} 151} 152 153@inproceedings{dener2019accelerating, 154 title = {Accelerating limited-memory quasi-{N}ewton convergence for large-scale optimization}, 155 author = {Dener, Alp and Munson, Todd}, 156 booktitle = {Computational Science--ICCS 2019: 19th International Conference, Faro, Portugal, June 12--14, 2019, Proceedings, Part III 19}, 157 pages = {495--507}, 158 year = {2019}, 159 organization = {Springer} 160} 161 162@article{park2021linear, 163 title = {Linear and nonlinear solvers for simulating multiphase flow within large-scale engineered subsurface systems}, 164 author = {Park, Heeho D and Hammond, Glenn E and Valocchi, Albert J and LaForce, Tara}, 165 journal = {Advances in Water Resources}, 166 volume = {156}, 167 pages = {104029}, 168 year = {2021}, 169 publisher = {Elsevier} 170} 171 172@inproceedings{va1981design, 173 title = {Design of optimally smoothing multi-stage schemes for the {E}uler equations}, 174 author = {Van Leer, Bram and Tai, Chang-Hsien and Powell, Kenneth}, 175 booktitle = {9th Computational Fluid Dynamics Conference}, 176 pages = {1933}, 177 year = {1981} 178} 179 180@article{pierce1997preconditioned, 181 title = {Preconditioned multigrid methods for compressible flow calculations on stretched meshes}, 182 author = {Pierce, Niles A and Giles, Michael B}, 183 journal = {Journal of Computational Physics}, 184 volume = {136}, 185 number = {2}, 186 pages = {425--445}, 187 year = {1997}, 188 publisher = {Elsevier} 189} 190 191@article{kong2016highly, 192 title = {A highly scalable multilevel {S}chwarz method with boundary geometry preserving coarse spaces for {3D} elasticity problems on domains with complex geometry}, 193 author = {Kong, Fande and Cai, Xiao-Chuan}, 194 journal = {SIAM Journal on Scientific Computing}, 195 volume = {38}, 196 number = {2}, 197 pages = {C73--C95}, 198 year = {2016}, 199 publisher = {SIAM} 200} 201 202@inproceedings{gutierrez2017accommodating, 203 title = {Accommodating thread-level heterogeneity in coupled parallel applications}, 204 author = {Guti{\'e}rrez, Samuel K and Davis, Kei and Arnold, Dorian C and Baker, Randal S and Robey, Robert W and McCormick, Patrick and 205 Holladay, Daniel and Dahl, Jon A and Zerr, R Joe and Weik, Florian and others}, 206 booktitle = {2017 {IEEE} International Parallel and Distributed Processing Symposium ({IPDPS})}, 207 pages = {469--478}, 208 year = {2017}, 209 organization = {IEEE} 210} 211 212@article{heroux2011bi, 213 title = {Bi-modal MPI and MPI+ threads computing on scalable multicore systems}, 214 author = {Heroux, Michael A and Brightwell, R and Wolf, Michael M}, 215 journal = {IJHPCA (Submitted)}, 216 year = {2011} 217} 218 219@inproceedings{bozdaug2005parallel, 220 title = {A parallel distance-2 graph coloring algorithm for distributed memory computers}, 221 author = {Bozda{\u{g}}, Doruk and Catalyurek, Umit and Gebremedhin, Assefaw H and Manne, Fredrik and Boman, Erik G and {\"O}zg{\"u}ner, F{\"u}sun}, 222 booktitle = {International conference on high performance computing and communications}, 223 pages = {796--806}, 224 year = {2005}, 225 organization = {Springer} 226} 227 228@article{dohrmann2009overlapping, 229 title = {An overlapping {S}chwarz algorithm for almost incompressible elasticity}, 230 author = {Dohrmann, Clark R and Widlund, Olof B}, 231 journal = {SIAM journal on numerical analysis}, 232 volume = {47}, 233 number = {4}, 234 pages = {2897--2923}, 235 year = {2009}, 236 publisher = {SIAM} 237} 238 239@article{dohrmann2008domain, 240 title = {Domain decomposition for less regular subdomains: Overlapping {S}chwarz in two dimensions}, 241 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 242 journal = {SIAM journal on numerical analysis}, 243 volume = {46}, 244 number = {4}, 245 pages = {2153--2168}, 246 year = {2008}, 247 publisher = {SIAM} 248} 249 250@incollection{dohrmann2008family, 251 title = {A family of energy minimizing coarse spaces for overlapping {S}chwarz preconditioners}, 252 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 253 booktitle = {Domain decomposition methods in science and engineering XVII}, 254 pages = {247--254}, 255 year = {2008}, 256 publisher = {Springer} 257} 258 259@book{dohrmann2008extending, 260 title = {Extending theory for domain decomposition algorithms to irregular subdomains}, 261 author = {Dohrmann, Clark R and Klawonn, Axel and Widlund, Olof B}, 262 year = {2008}, 263 publisher = {Springer} 264} 265 266@article{dryja1994schwarz, 267 title = {{S}chwarz analysis of iterative substructuring algorithms for elliptic problems in three dimensions}, 268 author = {Dryja, Maksymilian and Smith, Barry F and Widlund, Olof B}, 269 journal = {SIAM journal on numerical analysis}, 270 volume = {31}, 271 number = {6}, 272 pages = {1662--1694}, 273 year = {1994}, 274 publisher = {SIAM} 275} 276 277@book{smith1990domain, 278 title = {Domain decomposition algorithms for the partial differential equations of linear elasticity}, 279 author = {Smith, Barry F}, 280 year = {1990}, 281 publisher = {New York University} 282} 283 284@article{bramble1989construction, 285 title = {The construction of preconditioners for elliptic problems by substructuring. {IV}}, 286 author = {Bramble, James H and Pasciak, Joseph E and Schatz, Alfred H}, 287 journal = {Mathematics of Computation}, 288 volume = {53}, 289 number = {187}, 290 pages = {1--24}, 291 year = {1989} 292} 293 294@article{kaczmarz1937angenaherte, 295 title = {Angenaherte auflosung von systemen linearer gleichungen}, 296 author = {Kaczmarz, Stefan}, 297 journal = {Bull. Int. Acad. Pol. Sic. Let., Cl. Sci. Math. Nat.}, 298 pages = {355--357}, 299 year = {1937} 300} 301 302@article{nataf2022recent, 303 title = {Recent advances in domain decomposition methods for large-scale saddle point problems}, 304 author = {Nataf, Fr{\'e}d{\'e}ric and Tournier, Pierre-Henri}, 305 journal = {Comptes Rendus. M{\'e}canique}, 306 volume = {350}, 307 number = {S1}, 308 pages = {1--15}, 309 year = {2022} 310} 311 312@article{al2022robustpd, 313 title = {A robust algebraic multilevel domain decomposition preconditioner for sparse symmetric positive definite matrices}, 314 author = {Al Daas, Hussam and Jolivet, Pierre}, 315 journal = {SIAM Journal on Scientific Computing}, 316 volume = {44}, 317 number = {4}, 318 pages = {A2582--A2598}, 319 year = {2022}, 320 publisher = {SIAM} 321} 322 323@article{al2022robust, 324 title = {A robust algebraic domain decomposition preconditioner for sparse normal equations}, 325 author = {Al Daas, Hussam and Jolivet, Pierre and Scott, Jennifer A}, 326 journal = {SIAM Journal on Scientific Computing}, 327 volume = {44}, 328 number = {3}, 329 pages = {A1047--A1068}, 330 year = {2022}, 331 publisher = {SIAM} 332} 333 334@article{al2021multilevel, 335 title = {A multilevel {S}chwarz preconditioner based on a hierarchy of robust coarse spaces}, 336 author = {Al Daas, Hussam and Grigori, Laura and Jolivet, Pierre and Tournier, Pierre-Henri}, 337 journal = {SIAM Journal on Scientific Computing}, 338 volume = {43}, 339 number = {3}, 340 pages = {A1907--A1928}, 341 year = {2021}, 342 publisher = {SIAM} 343} 344 345@book{dolean2015introduction, 346 title = {An introduction to domain decomposition methods: algorithms, theory, and parallel implementation}, 347 author = {Dolean, Victorita and Jolivet, Pierre and Nataf, Fr{\'e}d{\'e}ric}, 348 year = {2015}, 349 publisher = {SIAM} 350} 351 352@article{spillane2011robust, 353 title = {A robust two-level domain decomposition preconditioner for systems of {PDE}s}, 354 author = {Spillane, Nicole and Dolean, Victorita and Hauret, Patrice and Nataf, Fr{\'e}d{\'e}ric and Pechstein, Clemens and Scheichl, Robert}, 355 journal = {Comptes Rendus Mathematique}, 356 volume = {349}, 357 number = {23-24}, 358 pages = {1255--1259}, 359 year = {2011}, 360 publisher = {Elsevier} 361} 362 363@article{kong2020highly, 364 title = {A Highly Parallel Multilevel {N}ewton--{K}rylov--{S}chwarz Method with Subspace-Based Coarsening and 365 Partition-Based Balancing for the Multigroup Neutron Transport Equation on Three-Dimensional Unstructured Meshes}, 366 author = {Kong, Fande and Wang, Yaqi and Gaston, Derek R and Permann, Cody J and Slaughter, Andrew E and Lindsay, 367 Alexander D and DeHart, Mark D and Martineau, Richard C}, 368 journal = {SIAM Journal on Scientific Computing}, 369 volume = {42}, 370 number = {5}, 371 pages = {C193--C220}, 372 year = {2020}, 373 publisher = {SIAM} 374} 375 376@article{ipsen2001note, 377 title = {A note on preconditioning nonsymmetric matrices}, 378 author = {Ipsen, Ilse CF}, 379 journal = {SIAM Journal on Scientific Computing}, 380 volume = {23}, 381 number = {3}, 382 pages = {1050--1051}, 383 year = {2001}, 384 publisher = {SIAM} 385} 386 387@article{murphy2000note, 388 title = {A note on preconditioning for indefinite linear systems}, 389 author = {Murphy, Malcolm F and Golub, Gene H and Wathen, Andrew J}, 390 journal = {SIAM Journal on Scientific Computing}, 391 volume = {21}, 392 number = {6}, 393 pages = {1969--1972}, 394 year = {2000}, 395 publisher = {SIAM} 396} 397 398@article{oliphant1961implicit, 399 title = {An implicit, numerical method for solving two-dimensional time-dependent diffusion problems}, 400 author = {Oliphant, Thomas A}, 401 journal = {Quarterly of Applied mathematics}, 402 volume = {19}, 403 number = {3}, 404 pages = {221--229}, 405 year = {1961} 406} 407 408@article{dupont1968approximate, 409 title = {An approximate factorization procedure for solving self-adjoint elliptic difference equations}, 410 author = {Dupont, Todd and Kendall, Richard P and Rachford, Jr, HH}, 411 journal = {SIAM Journal on Numerical Analysis}, 412 volume = {5}, 413 number = {3}, 414 pages = {559--573}, 415 year = {1968}, 416 publisher = {SIAM} 417} 418 419@inproceedings{manteuffel1979shifted, 420 title = {Shifted incomplete {C}holesky factorization}, 421 author = {Manteuffel, Thomas A}, 422 booktitle = {Sparse Matrix Proceedings 1978}, 423 pages = {41--61}, 424 year = {1979}, 425 organization = {SIAM, Philadelphia, PA} 426} 427 428@incollection{chan1997approximate, 429 title = {Approximate and incomplete factorizations}, 430 author = {Chan, Tony F and Van Der Vorst, Henk A}, 431 booktitle = {Parallel numerical algorithms}, 432 pages = {167--202}, 433 year = {1997}, 434 publisher = {Springer} 435} 436 437@article{mandel2008multispace, 438 title = {Multispace and multilevel {BDDC}}, 439 author = {Mandel, Jan and Soused{\'\i}k, Bed{\v{r}}ich and Dohrmann, Clark R}, 440 journal = {Computing}, 441 volume = {83}, 442 number = {2-3}, 443 pages = {55--85}, 444 year = {2008}, 445 publisher = {Springer} 446} 447 448@article{klawonn2006dual, 449 title = {Dual-primal {FETI} methods for linear elasticity}, 450 author = {Klawonn, Axel and Widlund, Olof B}, 451 journal = {Communications on Pure and Applied Mathematics: A Journal Issued by the Courant Institute of Mathematical Sciences}, 452 volume = {59}, 453 number = {11}, 454 pages = {1523--1572}, 455 year = {2006}, 456 publisher = {Wiley Online Library} 457} 458 459@article{dohrmann2007approximate, 460 title = {An approximate {BDDC} preconditioner}, 461 author = {Dohrmann, Clark R}, 462 journal = {Numerical Linear Algebra with Applications}, 463 volume = {14}, 464 number = {2}, 465 pages = {149--168}, 466 year = {2007}, 467 publisher = {Wiley Online Library} 468} 469 470@book{dryja1987additive, 471 title = {An additive variant of the {S}chwarz alternating method for the case of many subregions}, 472 author = {Dryja, Maksymilian and Widlund, Olof}, 473 year = {1987}, 474 publisher = {Ultracomputer Research Laboratory, Univ., Courant Inst. of Mathematical~…} 475} 476 477@article{couturier2016tsirm, 478 title = {{TSIRM}: A two-stage iteration with least-squares residual minimization algorithm to solve large sparse linear and nonlinear systems}, 479 author = {Couturier, Rapha{\"e}l and Khodja, Lilia Ziane and Guyeux, Christophe}, 480 journal = {Journal of Computational Science}, 481 volume = {17}, 482 pages = {535--546}, 483 year = {2016}, 484 publisher = {Elsevier} 485} 486 487@article{chan1998transpose, 488 title = {Transpose-free formulations of Lanczos-type methods for nonsymmetric linear systems}, 489 author = {Chan, Tony F and De Pillis, Lisette and Van Der Vorst, Henk}, 490 journal = {Numerical Algorithms}, 491 volume = {17}, 492 pages = {51--66}, 493 year = {1998}, 494 publisher = {Springer} 495} 496 497@article{catabriga2006performance, 498 title = {Performance of {LCD} iterative method in the finite element and finite difference solution of convection--diffusion equations}, 499 author = {Catabriga, L and Valli, AMP and Melotti, BZ and Pessoa, LM and Coutinho, ALGA}, 500 journal = {Communications in numerical methods in engineering}, 501 volume = {22}, 502 number = {6}, 503 pages = {643--656}, 504 year = {2006}, 505 publisher = {Wiley Online Library} 506} 507 508@article{catabriga2004evaluating, 509 title = {Evaluating the {LCD} algorithm for solving linear systems of equations arising from implicit {SUPG} formulation of compressible flows}, 510 author = {Catabriga, Lucia and Coutinho, Alvaro LGA and Franca, Leopoldo P}, 511 journal = {International Journal for Numerical Methods in Engineering}, 512 volume = {60}, 513 number = {9}, 514 pages = {1513--1534}, 515 year = {2004}, 516 publisher = {Wiley Online Library} 517} 518 519@article{dai2004study, 520 title = {Study on semi-conjugate direction methods for non-symmetric systems}, 521 author = {Dai, Yu-Hong and Yuan, Jinyun}, 522 journal = {International journal for numerical methods in engineering}, 523 volume = {60}, 524 number = {8}, 525 pages = {1383--1399}, 526 year = {2004}, 527 publisher = {Wiley Online Library} 528} 529 530@article{yuan2004semi, 531 title = {Semi-conjugate direction methods for real positive definite systems}, 532 author = {Yuan, JY and Golub, Gene H and Plemmons, Robert J and Cecilio, WAG}, 533 journal = {BIT Numerical Mathematics}, 534 volume = {44}, 535 pages = {189--207}, 536 year = {2004}, 537 publisher = {Springer} 538} 539 540@article{ji2017breakdown, 541 title = {A breakdown-free block conjugate gradient method}, 542 author = {Ji, Hao and Li, Yaohang}, 543 journal = {BIT Numerical Mathematics}, 544 volume = {57}, 545 pages = {379--403}, 546 year = {2017}, 547 publisher = {Springer} 548} 549 550@inproceedings{jolivet2016block, 551 title = {Block iterative methods and recycling for improved scalability of linear solvers}, 552 author = {Jolivet, Pierre and Tournier, Pierre-Henri}, 553 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 554 pages = {190--203}, 555 year = {2016}, 556 organization = {IEEE} 557} 558 559@article{calandra2013modified, 560 title = {A modified block flexible {GMRES} method with deflation at each iteration for the solution of non-{H}ermitian linear systems with multiple right-hand sides}, 561 author = {Calandra, Henri and Gratton, Serge and Lago, Rafael and Vasseur, Xavier and Carvalho, Luiz Mariano}, 562 journal = {SIAM Journal on Scientific Computing}, 563 volume = {35}, 564 number = {5}, 565 pages = {S345--S367}, 566 year = {2013}, 567 publisher = {SIAM} 568} 569 570@article{o1980block, 571 title = {The block conjugate gradient algorithm and related methods}, 572 author = {O'Leary, Dianne P}, 573 journal = {Linear algebra and its applications}, 574 volume = {29}, 575 pages = {293--322}, 576 year = {1980}, 577 publisher = {Elsevier} 578} 579 580@article{erhel1996restarted, 581 title = {Restarted {GMRES} preconditioned by deflation}, 582 author = {Erhel, Jocelyne and Burrage, Kevin and Pohl, Bert}, 583 journal = {Journal of computational and applied mathematics}, 584 volume = {69}, 585 number = {2}, 586 pages = {303--318}, 587 year = {1996}, 588 publisher = {Elsevier} 589} 590 591@article{bai1994newton, 592 title = {A {N}ewton basis {GMRES} implementation}, 593 author = {Bai, Zhaojun and Hu, Dan and Reichel, Lothar}, 594 journal = {IMA Journal of Numerical Analysis}, 595 volume = {14}, 596 number = {4}, 597 pages = {563--581}, 598 year = {1994}, 599 publisher = {Oxford University Press} 600} 601 602@article{sidje1997alternatives, 603 title = {Alternatives for parallel Krylov subspace basis computation}, 604 author = {Sidje, Roger B}, 605 journal = {Numerical linear algebra with applications}, 606 volume = {4}, 607 number = {4}, 608 pages = {305--331}, 609 year = {1997}, 610 publisher = {Wiley Online Library} 611} 612 613@inproceedings{mohiyuddin2009minimizing, 614 title = {Minimizing communication in sparse matrix solvers}, 615 author = {Mohiyuddin, Marghoob and Hoemmen, Mark and Demmel, James and Yelick, Katherine}, 616 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage and Analysis}, 617 pages = {1--12}, 618 year = {2009} 619} 620 621@article{demmel2012communication, 622 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 623 author = {Demmel, James and Grigori, Laura and Hoemmen, Mark and Langou, Julien}, 624 journal = {SIAM Journal on Scientific Computing}, 625 volume = {34}, 626 number = {1}, 627 pages = {A206--A239}, 628 year = {2012}, 629 publisher = {SIAM} 630} 631 632@article{philippe2012generation, 633 title = {On the generation of {K}rylov subspace bases}, 634 author = {Philippe, Bernard and Reichel, Lothar}, 635 journal = {Applied Numerical Mathematics}, 636 volume = {62}, 637 number = {9}, 638 pages = {1171--1186}, 639 year = {2012}, 640 publisher = {Elsevier} 641} 642 643@article{wakam2013memory, 644 title = {Memory efficient hybrid algebraic solvers for linear systems arising from compressible flows}, 645 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Pacull, Fran{\c{c}}ois}, 646 journal = {Computers \& Fluids}, 647 volume = {80}, 648 pages = {158--167}, 649 year = {2013}, 650 publisher = {Elsevier} 651} 652 653@misc{wakam2011parallelism, 654 title = {Parallelism and robustness in {GMRES} with the {N}ewton basis and the deflated restarting}, 655 author = {Wakam, D{\'e}sir{\'e} Nuentsa and Erhel, Jocelyne}, 656 year = {2011}, 657 url = {https://hal.inria.fr/inria-00638247/en} 658} 659 660@article{tu2015feti, 661 title = {A {FETI-DP} type domain decomposition algorithm for three-dimensional incompressible {S}tokes equations}, 662 author = {Tu, Xuemin and Li, Jing}, 663 journal = {SIAM Journal on Numerical Analysis}, 664 volume = {53}, 665 number = {2}, 666 pages = {720--742}, 667 year = {2015}, 668 publisher = {SIAM} 669} 670 671@article{farhat2001feti, 672 title = {{FETI-DP}: a dual--primal unified {FETI} method—part {I}: A faster alternative to the two-level {FETI} method}, 673 author = {Farhat, Charbel and Lesoinne, Michel and LeTallec, Patrick and Pierson, Kendall and Rixen, Daniel}, 674 journal = {International journal for numerical methods in engineering}, 675 volume = {50}, 676 number = {7}, 677 pages = {1523--1544}, 678 year = {2001}, 679 publisher = {Wiley Online Library} 680} 681 682@article{lottes2023optimal, 683 title = {Optimal polynomial smoothers for multigrid {V}-cycles}, 684 author = {Lottes, James}, 685 journal = {Numerical Linear Algebra with Applications}, 686 volume = {30}, 687 number = {6}, 688 pages = {e2518}, 689 year = {2023}, 690 publisher = {Wiley Online Library} 691} 692 693@article{phillips2022optimal, 694 title = {Optimal {C}hebyshev Smoothers and One-sided {V}-cycles}, 695 author = {Phillips, Malachi and Fischer, Paul}, 696 journal = {arXiv preprint arXiv:2210.03179}, 697 year = {2022} 698} 699 700@incollection{toint1981towards, 701 title = {Towards an efficient sparsity exploiting {N}ewton method for minimization}, 702 author = {Toint, Philippe}, 703 booktitle = {Sparse matrices and their uses}, 704 pages = {57--88}, 705 year = {1981}, 706 publisher = {Academic press} 707} 708 709@article{cools2019numerically, 710 title = {Numerically stable recurrence relations for the communication hiding pipelined conjugate gradient method}, 711 author = {Cools, Siegfried and Cornelis, Jeffrey and Vanroose, Wim}, 712 journal = {IEEE Transactions on Parallel and Distributed Systems}, 713 volume = {30}, 714 number = {11}, 715 pages = {2507--2522}, 716 year = {2019}, 717 publisher = {IEEE} 718} 719 720@article{cornelis2018communication, 721 title = {The communication-hiding conjugate gradient method with deep pipelines}, 722 author = {Cornelis, Jeffrey and Cools, Siegfried and Vanroose, Wim}, 723 journal = {arXiv preprint arXiv:1801.04728}, 724 year = {2018} 725} 726 727@article{d1993conjugate, 728 title = {Conjugate gradient algorithms with reduced synchronization overhead on distributed memory multiprocessors}, 729 author = {D’Azevedo, EF and Eijkhout, VL and Romine, CH}, 730 journal = {Computer Science Technical Report CS-93-185, University of Tennessee, Knoxville}, 731 year = {1993} 732} 733 734@book{malek2014preconditioning, 735 title = {Preconditioning and the conjugate gradient method in the context of solving {PDEs}}, 736 author = {M{\'a}lek, Josef and Strako{\v{s}}, Zden{\v{e}}k}, 737 year = {2014}, 738 publisher = {SIAM} 739} 740 741@book{fokkema1996enhanced, 742 title = {Enhanced implementation of {BiCGstab}(l) for solving linear systems of equations}, 743 author = {Fokkema, Diederik R}, 744 year = {1996}, 745 publisher = {Citeseer} 746} 747 748@article{sleijpen1994bicgstab, 749 title = {{BiCGstab}(l) and other hybrid {Bi-CG} methods}, 750 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A and Fokkema, Diederik R}, 751 journal = {Numerical Algorithms}, 752 volume = {7}, 753 pages = {75--109}, 754 year = {1994}, 755 publisher = {Springer} 756} 757 758@article{sleijpen1995overview, 759 title = {An overview of approaches for the stable computation of hybrid {BiCG} methods}, 760 author = {Sleijpen, Gerard LG and Van der Vorst, Henk A}, 761 journal = {Applied numerical mathematics}, 762 volume = {19}, 763 number = {3}, 764 pages = {235--254}, 765 year = {1995}, 766 publisher = {Elsevier} 767} 768 769@article{fischer1998projection, 770 title = {Projection techniques for iterative solution of Ax= b with successive right-hand sides}, 771 author = {Fischer, Paul F}, 772 journal = {Computer methods in applied mechanics and engineering}, 773 volume = {163}, 774 number = {1-4}, 775 pages = {193--204}, 776 year = {1998}, 777 publisher = {Elsevier} 778} 779 780@article{maskery2018insights, 781 title = {Insights into the mechanical properties of several triply periodic minimal surface lattice structures 782 made by polymer additive manufacturing}, 783 author = {Maskery, Ian and Sturm, Logan and Aremu, Adedeji O and Panesar, Ajit and Williams, 784 Christopher B and Tuck, Christopher J and Wildman, Ricky D and Ashcroft, Ian A and Hague, Richard JM}, 785 journal = {Polymer}, 786 volume = {152}, 787 pages = {62--71}, 788 year = {2018}, 789 publisher = {Elsevier} 790} 791 792@book{karniadakis2005spectral, 793 title = {Spectral/hp element methods for computational fluid dynamics}, 794 author = {Karniadakis, George and Sherwin, Spencer J}, 795 year = {2005}, 796 publisher = {Oxford University Press, USA} 797} 798 799@article{golub1969calculation, 800 title = {Calculation of {G}auss quadrature rules}, 801 author = {Golub, Gene H and Welsch, John H}, 802 journal = {Mathematics of computation}, 803 volume = {23}, 804 number = {106}, 805 pages = {221--230}, 806 year = {1969} 807} 808 809@article{soderlind2006adaptive, 810 title = {Adaptive time-stepping and computational stability}, 811 author = {S{\"o}derlind, Gustaf and Wang, Lina}, 812 journal = {Journal of Computational and Applied Mathematics}, 813 volume = {185}, 814 number = {2}, 815 pages = {225--243}, 816 year = {2006}, 817 publisher = {Elsevier} 818} 819 820@article{soderlind2003digital, 821 title = {Digital filters in adaptive time-stepping}, 822 author = {S{\"o}derlind, Gustaf}, 823 journal = {{ACM} Transactions on Mathematical Software ({TOMS})}, 824 volume = {29}, 825 number = {1}, 826 pages = {1--26}, 827 year = {2003}, 828 publisher = {ACM New York, NY, USA} 829} 830 831@article{volkwein2013proper, 832 title = {Proper orthogonal decomposition: Theory and reduced-order modelling}, 833 author = {Volkwein, Stefan}, 834 journal = {Lecture Notes, University of Konstanz}, 835 volume = {4}, 836 number = {4}, 837 pages = {1--29}, 838 year = {2013}, 839 url = {http://www.math.uni-konstanz.de/numerik/personen/volkwein/teaching/POD-Book.pdf} 840} 841 842@article{frisvad2012building, 843 title = {Building an orthonormal basis from a {3D} unit vector without normalization}, 844 author = {Frisvad, Jeppe Revall}, 845 journal = {Journal of Graphics Tools}, 846 volume = {16}, 847 number = {3}, 848 pages = {151--159}, 849 year = {2012}, 850 publisher = {Taylor \& Francis} 851} 852 853@article{constantinescu2007multirate, 854 title = {Multirate timestepping methods for hyperbolic conservation laws}, 855 author = {Constantinescu, Emil M and Sandu, Adrian}, 856 journal = {Journal of Scientific Computing}, 857 volume = {33}, 858 number = {3}, 859 pages = {239--278}, 860 year = {2007}, 861 publisher = {Springer} 862} 863 864@article{liu2022newton, 865 title = {A {N}ewton-{MR} algorithm with complexity guarantees for nonconvex smooth unconstrained optimization}, 866 author = {Liu, Yang and Roosta, Fred}, 867 journal = {arXiv preprint arXiv:2208.07095}, 868 year = {2022} 869} 870 871@article{choi2011minres, 872 title = {{MINRES-QLP}: A {K}rylov subspace method for indefinite or singular symmetric systems}, 873 author = {Choi, Sou-Cheng T and Paige, Christopher C and Saunders, Michael A}, 874 journal = {SIAM Journal on Scientific Computing}, 875 volume = {33}, 876 number = {4}, 877 pages = {1810--1836}, 878 year = {2011}, 879 publisher = {SIAM} 880} 881 882@article{chen2020predict, 883 title = {Predict-and-recompute conjugate gradient variants}, 884 author = {Chen, Tyler and Carson, Erin}, 885 journal = {SIAM Journal on Scientific Computing}, 886 volume = {42}, 887 number = {5}, 888 pages = {A3084--A3108}, 889 year = {2020}, 890 publisher = {SIAM} 891} 892 893@article{cools2018analyzing, 894 title = {Analyzing the effect of local rounding error propagation on the maximal attainable accuracy of the pipelined conjugate gradient method}, 895 author = {Cools, Siegfried and Yetkin, Emrullah Fatih and Agullo, Emmanuel and Giraud, Luc and Vanroose, Wim}, 896 journal = {SIAM Journal on Matrix Analysis and Applications}, 897 volume = {39}, 898 number = {1}, 899 pages = {426--450}, 900 year = {2018}, 901 publisher = {SIAM} 902} 903 904@inproceedings{tiwari2020pipelined, 905 title = {Pipelined preconditioned conjugate gradient methods for distributed memory systems}, 906 author = {Tiwari, Manasi and Vadhiyar, Sathish}, 907 booktitle = {2020 IEEE 27th International Conference on High Performance Computing, Data, and Analytics (HiPC)}, 908 pages = {151--160}, 909 year = {2020}, 910 organization = {IEEE} 911} 912 913@article{nash1984newton, 914 title = {Newton-type minimization via the {L}anczos method}, 915 author = {Nash, Stephen G}, 916 journal = {SIAM Journal on Numerical Analysis}, 917 volume = {21}, 918 number = {4}, 919 pages = {770--788}, 920 year = {1984}, 921 publisher = {SIAM} 922} 923 924@inproceedings{eller2016scalable, 925 title = {Scalable non-blocking preconditioned conjugate gradient methods}, 926 author = {Eller, Paul R and Gropp, William}, 927 booktitle = {SC'16: Proceedings of the International Conference for High Performance Computing, Networking, Storage and Analysis}, 928 pages = {204--215}, 929 year = {2016}, 930 organization = {IEEE} 931} 932 933@article{gould1999solving, 934 title = {Solving the trust-region subproblem using the Lanczos method}, 935 author = {Gould, Nicholas IM and Lucidi, Stefano and Roma, Massimo and Toint, Philippe L}, 936 journal = {SIAM Journal on Optimization}, 937 volume = {9}, 938 number = {2}, 939 pages = {504--525}, 940 year = {1999}, 941 publisher = {SIAM} 942} 943 944@article{cools2017communication, 945 title = {The communication-hiding pipelined {BiCGstab} method for the parallel solution of large unsymmetric linear systems}, 946 author = {Cools, Siegfried and Vanroose, Wim}, 947 journal = {Parallel Computing}, 948 volume = {65}, 949 pages = {1--20}, 950 year = {2017}, 951 publisher = {Elsevier} 952} 953 954@Misc{moabwebsite, 955 key = {MOAB}, 956 title = {{MOAB} Website}, 957 howpublished = {\url{https://www.mcs.anl.gov/~fathom/moab-docs/html/contents.html}}, 958 year = {2023} 959} 960 961@book{deuflhard2011, 962 title = {{N}ewton Methods for Nonlinear Problems}, 963 author = {Peter Deuflhard}, 964 volume = {35}, 965 year = {2011}, 966 isbn = {978-3-642-23898-7}, 967 doi = {10.1007/978-3-642-23899-4}, 968 publisher = {Springer-Verlag}, 969 address = {Berlin, Heidelberg} 970} 971 972@article{ketcheson2010runge, 973 title = {{R}unge--{K}utta methods with minimum storage implementations}, 974 author = {Ketcheson, David I}, 975 journal = {Journal of Computational Physics}, 976 volume = {229}, 977 number = {5}, 978 pages = {1763--1773}, 979 year = {2010}, 980 publisher = {Elsevier} 981} 982 983@article{WalkerNi2011, 984 title = {{A}nderson acceleration for fixed-point iterations}, 985 author = {Homer F Walker and Peng Ni}, 986 journal = {SIAM Journal on Numerical Analysis}, 987 volume = {49}, 988 number = {4}, 989 pages = {1715--1735}, 990 year = {2011}, 991 publisher = {SIAM} 992} 993 994@article{Hua2007, 995 title = {Numerical simulation of microdroplet formation in coflowing immiscible liquids}, 996 author = {Hua, Jinsong and Zhang, Baili and Lou, Jing}, 997 journal = {AIChE Journal}, 998 volume = {53}, 999 number = {10}, 1000 pages = {2534--2548}, 1001 year = {2007}, 1002 publisher = {Wiley Online Library} 1003} 1004 1005@Article{ openblas, 1006 title = {{OpenBLAS}: A High Performance {BLAS} Library on {L}oongson {3A} {CPU}}, 1007 journal = {Journal of Software}, 1008 volume = {22}, 1009 pages = {208--216}, 1010 year = {2011}, 1011 url = {https://www.jos.org.cn/josen/article/abstract/11042}, 1012 author = {ZHANG Xian-Yi and WANG Qian and ZHANG Yun-Quan Richard} 1013} 1014 1015@Misc{ openblas-website, 1016 title = {{OpenBLAS}}, 1017 key = {OpenBLAS}, 1018 howpublished = {\url{https://www.openblas.net}} 1019} 1020 1021@Misc{ openacc-website, 1022 title = {{OpenACC}}, 1023 key = {OpenACC}, 1024 howpublished = {\url{https://www.openacc.org}} 1025} 1026 1027@Misc{ bueler2020petsc, 1028 title = {{PETSc} for Partial Differential Equations: Numerical Solutions in {C} and {P}ython}, 1029 author = {Bueler, Ed}, 1030 year = {2020}, 1031 publisher = {SIAM}, 1032 petsc_uses = {KSP} 1033} 1034 1035@TechReport{ petscforgpuexascale, 1036 title = {Toward Performance-Portable {PETSc} for {GPU}-based Exascale Systems}, 1037 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1038 and Matthew Knepley and Scott E. Kruger and Hannah~Morgan and Todd Munson and Karl 1039 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang}, 1040 institution = {Argonne National Laboratory}, 1041 number = {ANL/MCS-P9401-1020}, 1042 note = {\url{https://arxiv.org/abs/2011.00715}}, 1043 year = {2020}, 1044 petsc_uses = {KSP} 1045} 1046 1047@Article{ mills2021, 1048 title = {Toward performance-portable {PETS}c for {GPU}-based exascale systems}, 1049 journal = {Parallel Computing}, 1050 volume = {108}, 1051 pages = {102831}, 1052 year = {2021}, 1053 issn = {0167-8191}, 1054 doi = {https://doi.org/10.1016/j.parco.2021.102831}, 1055 url = {https://www.sciencedirect.com/science/article/pii/S016781912100079X}, 1056 author = {Richard Tran Mills and Mark F. Adams and Satish Balay and Jed Brown and Alp Dener 1057 and Matthew Knepley and Scott E. Kruger and Hannah Morgan and Todd Munson and Karl 1058 Rupp and Barry F. Smith and Stefano Zampini and Hong Zhang and Junchao Zhang} 1059} 1060 1061@Article{ rupp:2016:pis:2988256.2907944, 1062 author = {Karl Rupp and Josef Weinbub and Ansgar J\"{u}ngel and Tibor Grasser}, 1063 title = {Pipelined Iterative Solvers with Kernel Fusion for Graphics Processing Units}, 1064 journal = {ACM Trans. Math. Softw.}, 1065 issue_date = {September 2016}, 1066 volume = {43}, 1067 number = {2}, 1068 month = aug, 1069 year = {2016}, 1070 issn = {0098-3500}, 1071 pages = {11:1--11:27}, 1072 articleno = {11}, 1073 numpages = {27}, 1074 doi = {10.1145/2907944}, 1075 acmid = {2907944}, 1076 publisher = {ACM}, 1077 address = {New York, NY, USA}, 1078 keywords = {BiCGStab method, CUDA, GMRES method, GPU, Iterative solvers, OpenCL, conjugate 1079 gradient method}, 1080 petsc_uses = {KSP} 1081} 1082 1083@Article{ dalcin2011parallel, 1084 title = {Parallel distributed computing using python}, 1085 author = {Dalcin, Lisandro D and Paz, Rodrigo R and Kler, Pablo A and Cosimo, Alejandro}, 1086 journal = {Advances in Water Resources}, 1087 volume = {34}, 1088 number = {9}, 1089 pages = {1124--1139}, 1090 year = {2011}, 1091 publisher = {Elsevier}, 1092 petsc_uses = {KSP} 1093} 1094 1095@Article{ mendezpongaortiz2018, 1096 title = {Diffusive molecular dynamics simulations of lithiation of silicon nanopillars}, 1097 author = {JP Mendez and M Ponga and M Ortiz}, 1098 journal = {Journal of the Mechanics and Physics of Solids}, 1099 year = {2018}, 1100 petsc_uses = {KSP} 1101} 1102 1103@TechReport{ morgan2020evaluation, 1104 title = {Evaluation of {PETS}c on a Heterogeneous Architecture, the {OLCF} {S}ummit 1105 System: Part 1: Vector Node Performance}, 1106 author = {Morgan, Hannah Mairs and Mills, Richard Tran and Smith, Barry}, 1107 year = {2020}, 1108 institution = {Argonne National Laboratory}, 1109 url = {https://publications.anl.gov/anlpubs/2020/04/159190.pdf}, 1110 petsc_uses = {KSP} 1111} 1112 1113@TechReport{ pdeconstrainedspectraladjoints, 1114 title = {PDE constrained optimization, error estimation and control with spectral elements 1115 using PETSc and TAO}, 1116 author = {Oana Marin and Emil Constantinescu and Barry Smith}, 1117 type = {Preprint}, 1118 number = {ANL/MCS-P9031-1117}, 1119 institution = {ANL}, 1120 month = nov, 1121 year = {2017}, 1122 petsc_uses = {KSP} 1123} 1124 1125@InProceedings{ asc2013, 1126 author = {S. Abhyankar and B. F. Smith and E. Constantinescu}, 1127 title = {Evaluation of overlapping restricted additive {S}chwarz preconditioning for 1128 parallel solution of very large power flow problems}, 1129 booktitle = {HiPCNA-PG’13}, 1130 year = {2013}, 1131 petsc_uses = {KSP} 1132} 1133 1134@InProceedings{ as2013, 1135 author = {S. Abhyankar and B. F. Smith}, 1136 title = {{PETSc:} An Advanced Math and Computing Framework for Rapidly Developing Parallel 1137 Smart Grid Applications}, 1138 booktitle = {Proceedings of the IEEE PES General Meeting}, 1139 year = {2013}, 1140 petsc_uses = {KSP} 1141} 1142 1143@TechReport{ tspaper, 1144 title = {{PETSc/TS}: A Modern Scalable {DAE/ODE} Solver Library}, 1145 author = {Shrirang Abhyankar and Jed Brown and Emil Constantinescu and Debojyoti Ghosh and 1146 Barry F. Smith}, 1147 type = {Preprint}, 1148 number = {ANL/MCS-P5061-0114}, 1149 institution = {ANL}, 1150 month = jan, 1151 year = {2014}, 1152 petsc_uses = {KSP} 1153} 1154 1155@TechReport{ abhyankaretal2018, 1156 author = {Shrirang Abhyankar and Jed Brown and Emil M. Constantinescu and Debojyoti Ghosh 1157 and Barry F. Smith and Hong Zhang}, 1158 title = {{PETSc/TS}: {A} Modern Scalable {ODE/DAE} Solver Library}, 1159 journal = {arXiv e-preprints}, 1160 eprint = {1806.01437}, 1161 archiveprefix = {arXiv}, 1162 year = {2018}, 1163 petsc_uses = {KSP} 1164} 1165 1166@Article{ zhang2021cams, 1167 title = {Optimal checkpointing for adjoint multistage time-stepping schemes}, 1168 author = {Hong Zhang and Emil M. Constantinescu}, 1169 journal = {arXiv e-preprints}, 1170 eprint = {2202.11890}, 1171 archiveprefix = {arXiv}, 1172 year = {2022}, 1173 petsc_uses = {KSP} 1174} 1175 1176@InProceedings{ zhangconstantinescu2021b, 1177 title = {Revolve-based adjoint checkpointing for multistage time integration}, 1178 author = {Hong Zhang and Emil M. Constantinescu}, 1179 booktitle = {Proceedings of the International Conference on Computational Science (ICCS)}, 1180 month = jun, 1181 year = {2021}, 1182 petsc_uses = {KSP} 1183} 1184 1185@Article{ zhang2022tsadjoint, 1186 author = {Zhang, Hong and Constantinescu, Emil M. and Smith, Barry F.}, 1187 title = {{PETSc TSAdjoint: A Discrete Adjoint ODE Solver for First-Order and Second-Order 1188 Sensitivity Analysis}}, 1189 journal = {SIAM Journal on Scientific Computing}, 1190 volume = {44}, 1191 number = {1}, 1192 pages = {C1-C24}, 1193 year = {2022}, 1194 doi = {10.1137/21M140078X}, 1195 petsc_uses = {KSP} 1196} 1197 1198@TechReport{ bb2008, 1199 author = {Tomasz Blachowicz and Bartlomiej Baron}, 1200 title = {A graphical extension for the Windows version of the Parallel Finite Element 1201 Micromagnetics Package (MagParExt)}, 1202 url = {http://arxiv.org/abs/0807.2655}, 1203 year = {2008}, 1204 petsc_uses = {KSP} 1205} 1206 1207@Article{ jacvgv2008, 1208 author = {R. Y. Jaafar and A Asenjo and O Chubykalo-Fesenko and M Vazquez and E M Gonzalez 1209 and J L Vicent}, 1210 title = {Field induced vortex dynamics in magnetic {Ni} nanotriangles}, 1211 journal = {Nanotechnology}, 1212 volume = {19}, 1213 year = {2008}, 1214 doi = {10.1088/0957-4484/19/28/285717}, 1215 petsc_uses = {KSP} 1216} 1217 1218@Article{ yjdwh2008, 1219 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1220 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1221 journal = {Journal of the Magnetics Society of Japan}, 1222 volume = {32}, 1223 year = {2008}, 1224 pages = {50-53}, 1225 url = {http://www.jstage.jst.go.jp/article/msjmag/32/2_1/32_50/_article}, 1226 petsc_uses = {KSP} 1227} 1228 1229@Article{ mtrtrsa2008, 1230 author = {D. Makarov and S. Tibus and C. T. Rettner and T. Thomson and B. D. Terris and T. 1231 Schrefl and M. Albrecht}, 1232 title = {Magnetic strip patterns induced by focused ion beam irradiation}, 1233 journal = {J. Appl. Phys.}, 1234 volume = {103}, 1235 year = {2008}, 1236 doi = {10.1063/1.2894587}, 1237 petsc_uses = {KSP} 1238} 1239 1240@InProceedings{ tmrttsa2008, 1241 author = {S. Tibus and D. Makarov and C. T. Rettner and T. Thomson and B. D. Terris and T. 1242 Schrefl and M. Albrecht}, 1243 title = {Patterning of magnetic films by focused ion beam irradiation}, 1244 booktitle = {Intermag 2008 paper no. CM-05, submitted to IEEE Trans. Magn.}, 1245 year = {2008}, 1246 petsc_uses = {KSP} 1247} 1248 1249@Article{ yjdbh2007, 1250 author = {Lin Yuan and Jianju Jiang and Yongjiang di and Shaowei Bie and Huahui He}, 1251 title = {Micromagnetic simulation of the magnetic dispersion angle and effective damping 1252 factor for the single-phase soft magnetic films}, 1253 journal = {J. Magn. Magn. Mater.}, 1254 volume = {320}, 1255 number = {7}, 1256 pages = {1393-1397}, 1257 doi = {10.1016/j.jmmm.2007.11.025}, 1258 petsc_uses = {KSP} 1259} 1260 1261@Article{ lxky2007, 1262 author = {DENG Lian-wen and HUANG Xiao-zhong and ZH0U Ke-sheng and YANG}, 1263 title = {Micromagnetic simulation and experimental study on microwave permeability of 1264 nano-magnetic films}, 1265 journal = {Transactions of Nonferrous Metals Society of China}, 1266 year = {2007}, 1267 pages = {756-759}, 1268 url = {http://www.ysxbcn.com/icnfm2007/part2B/s0756.pdf}, 1269 petsc_uses = {KSP} 1270} 1271 1272@Article{ yjdwh2008a, 1273 author = {Lin Yuan and Jianjun Jiang and Gang Du and Zhongyou Wang and Huahui He}, 1274 title = {Micromagnetic Simulation of Magnetic Particles with Surface Anisotropy}, 1275 journal = {Journal of the Magnetics Society of Japan}, 1276 volume = {32}, 1277 year = {2008}, 1278 pages = {50-53}, 1279 doi = {10.3379/msjmag.32.50}, 1280 petsc_uses = {KSP} 1281} 1282 1283@Article{ lylw2007, 1284 author = {Ching-Ming Lee and L. X. Ye and J. M. Lee and Te-Ho Wu}, 1285 title = {Micromagnetic study of magnetization reversal in patterned {DyFeCo} thin films}, 1286 journal = {Phys. Stat. Sol.}, 1287 volume = {204}, 1288 number = {12}, 1289 pages = {4049-4052}, 1290 year = {2007}, 1291 doi = {10.1002/pssa.200777359}, 1292 petsc_uses = {KSP} 1293} 1294 1295@InProceedings{ sg2007, 1296 author = {Simon Greaves}, 1297 title = {Micromagnetic Simulations of Magnetic Recording Media}, 1298 booktitle = {High Performance Computing on Vector Systems 2007}, 1299 doi = {10.1007/978-3-540-74384-2_17}, 1300 petsc_uses = {KSP} 1301} 1302 1303@Article{ bsc2007, 1304 author = {Nadjib Benatmane and Werner Scholz and T.W. Clinton}, 1305 title = {Magnetic Configurations and Phase Diagrams of sub-100 nm {NiFe} Nanorings}, 1306 journal = {IEEE Trans. Magn.}, 1307 volume = {43}, 1308 year = {2007}, 1309 pages = {2884-2886}, 1310 doi = {10.1109/TMAG.2007.892867}, 1311 petsc_uses = {KSP} 1312} 1313 1314@Article{ ffbf, 1315 author = {T. Fischbacher and M. Franchin and G. Bordignon and H. Fangohr}, 1316 title = {A Systematic Approach to Multiphysics Extensions of Finite-Element-Based 1317 Micromagnetic Simulations: Nmag.}, 1318 journal = {IEEE Trans. Magn. Volume}, 1319 volume = {43}, 1320 pages = {2896-2898}, 1321 doi = {10.1109/TMAG.2007.893843}, 1322 petsc_uses = {KSP} 1323} 1324 1325@InBook{ dfssfs2006, 1326 author = {R. Dittrich and J. Fidler and D. Suess and W. Schol and H. Forster, T. Schrefl}, 1327 chapter = {Computational Aspects of Micromagnetics}, 1328 title = {The Science of Hysteresis}, 1329 editor = { G. Bertotti and I. Mayergoyz}, 1330 url = {http://books.elsevier.com/us/elsevier/us/subindex.asp?maintarget=&isbn=0124808743}, 1331 petsc_uses = {KSP} 1332} 1333 1334@InBook{ fss, 1335 author = {J. Fidler and T. Schrefl and W. Scholz}, 1336 chapter = {Computational Micromagnetics}, 1337 title = {Handbook of Theoretical and Computational Nanotechnology}, 1338 editor = {M. Rieth and W. Schommers}, 1339 url = {http://www.amazon.com/gp/product/158883042X}, 1340 petsc_uses = {KSP} 1341} 1342 1343@InBook{ shbsef, 1344 author = {Thomas Schrefl and Gino Hrkac and Simon Bance and Dieter Suess and Otmar Ertl and 1345 Josef Fidler}, 1346 chapter = {Numerical Methods in Micromagnetics (Finite Element Method)}, 1347 title = {Handbook of Magnetism and Advanced Magnetic Materials}, 1348 editor = {Helmut Kronmueller and Stuart Parkin}, 1349 doi = {10.1002/9780470022184.hmm203}, 1350 petsc_uses = {KSP} 1351} 1352 1353@InBook{ sfs, 1354 author = {D. Suess and J. Fidler and T. Schrefl}, 1355 chapter = {Micromagnetic Simulation of magnetic materials}, 1356 title = {Handbook of Magnetic Materials}, 1357 editor = {K. H. J. Buschow}, 1358 url = {http://www.amazon.com/gp/product/0444518509}, 1359 petsc_uses = {KSP} 1360} 1361 1362@Article{ fsxzs, 1363 author = {J. Fernandez-de-Castro and Xiao Shen and Jianhua Xue and Yuming Zhou and S. 1364 Sharma}, 1365 title = {Writer Flux Closure and Transition Degradation Mechanism in Perpendicular 1366 Recording.}, 1367 journal = {IEEE Trans. Magn. Volume}, 1368 volume = {43}, 1369 pages = {2175-2177}, 1370 doi = {10.1109/TMAG.2007.893122}, 1371 petsc_uses = {KSP} 1372} 1373 1374@Article{ sb2006, 1375 author = {W. Scholz and S. Batra}, 1376 title = {Effect of write current waveform on magnetization and head field dynamics of 1377 perpendicular recording heads}, 1378 journal = {IEEE Trans. Magn.}, 1379 volume = {42}, 1380 year = {2006}, 1381 pages = {2264--2266}, 1382 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/ieee/scholz_2006_42_2264.pdf}, 1383 petsc_uses = {KSP} 1384} 1385 1386@Article{ bsr2006, 1387 author = {S. Batra and W. Scholz and T. Roscamp}, 1388 title = {Effect of thermal fluctuation field on the noise performance of a perpendicular 1389 recording system}, 1390 journal = {J. Appl. Phys.}, 1391 volume = {99}, 1392 year = {2006}, 1393 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/jap/batra_2006_99.pdf}, 1394 petsc_uses = {KSP} 1395} 1396 1397@InProceedings{ japios2006, 1398 author = {F. Johnson and S. Amancherla and G.J. Parker and L.E. Iorio and P.R. 1399 Subramanian}, 1400 title = {Micromagnetic simulations of the dependence of domain wall width with grain size 1401 in systems with cubic and uniaxial anisotropy.}, 1402 booktitle = {Intermag 2006 Conference}, 1403 petsc_uses = {KSP} 1404} 1405 1406@Article{ kbmb2006, 1407 author = {A. Kaya and M. Benakli and M.L. Mallary and J.A. Bain}, 1408 title = {A Micromagnetic Study of the Effect of Spatial Variations in Damping in 1409 Perpendicular Recording Heads}, 1410 journal = {IEEE Trans. Magn.}, 1411 volume = {42}, 1412 year = {2006}, 1413 pages = {2428--2430}, 1414 doi = {10.1109/TMAG.2006.879430}, 1415 petsc_uses = {KSP} 1416} 1417 1418@Article{ cclcw2006, 1419 author = {C. C. Chang and Y. C. Chang and C. M. Lee and C. C. Chen and J. Wu}, 1420 title = {Control of Domain Wall Motion in Permalloy Ring}, 1421 journal = {IEEE Trans. Magn.}, 1422 volume = {42}, 1423 year = {2006}, 1424 pages = {2960--2962}, 1425 doi = {10.1109/TMAG.2006.878414}, 1426 petsc_uses = {KSP} 1427} 1428 1429@Article{ bfmfzczg2007, 1430 author = {Richard P. Boardman and Hans Fangohr and Matthew J. Fairman and J. Zimmermann and 1431 Simon J. Cox and Alexander A. Zhukov and Peter A.J. de Groot}, 1432 title = {Micromagnetic modelling of ferromagnetic cones}, 1433 journal = {J. Magn. Magn. Mater.}, 1434 volume = {312}, 1435 year = {2007}, 1436 pages = {234-238}, 1437 url = {http://eprints.soton.ac.uk/45900/}, 1438 petsc_uses = {KSP} 1439} 1440 1441@PhDThesis{ rb2005, 1442 author = {Richard Boardman}, 1443 title = {Computer simulation studies of magnetic nanostructures}, 1444 school = {Computational Engineering and Design Group, School of Engineering Sciences, 1445 University of Southampton, United Kingdom}, 1446 year = {2005}, 1447 url = {http://www.soton.ac.uk/~rpb/thesis.pdf}, 1448 petsc_uses = {KSP} 1449} 1450 1451@InProceedings{ cwwy2006, 1452 author = {I-Hsin Chung and Robert E. Walkup and Hui-Fang Wen and Hao Yu}, 1453 title = {MPI Performance Analysis Tools on Blue Gene/L}, 1454 booktitle = {ACM/IEEE SC 2006 Conference (SC'06)}, 1455 year = {2006}, 1456 url = {http://sc06.supercomputing.org/schedule/pdf/pap159.pdf}, 1457 petsc_uses = {KSP} 1458} 1459 1460@InProceedings{ ch2006, 1461 author = {I.-H. Chung and J.K. Hollingsworth}, 1462 title = {A Case Study Using Automatic Performance Tuning for Large-Scale Scientific 1463 Programs}, 1464 booktitle = {High Performance Distributed Computing, 2006 15th IEEE International Symposium}, 1465 pages = {45--56}, 1466 doi = {10.1109/HPDC.2006.1652135}, 1467 petsc_uses = {KSP} 1468} 1469 1470@Article{ lkpl2005, 1471 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1472 title = {Multibit {MRAM} using a pair of memory cells}, 1473 journal = {IEEE Trans. Magn.}, 1474 volume = {41}, 1475 year = {2005}, 1476 pages = {2670-2672}, 1477 doi = {10.1109/TMAG.2005.855288}, 1478 petsc_uses = {KSP} 1479} 1480 1481@Article{ gscn2005, 1482 author = {K. Yu. Guslienko and W. Scholz and R. W. Chantrell and V. Novosad}, 1483 title = {Vortex state oscillations in soft magnetic cylindrical dots}, 1484 journal = {Phys. Rev. B}, 1485 volume = {71}, 1486 year = {2005}, 1487 doi = {10.1103/PhysRevB.71.144407}, 1488 petsc_uses = {KSP} 1489} 1490 1491@PhDThesis{ mda, 1492 author = {Massimiliano d'Aquino}, 1493 title = {Nonlinear Magnetization Dynamics in Thin-Films and Nanoparticles}, 1494 school = { Universita di Napoli Federico II.}, 1495 url = {http://www.fedoa.unina.it/148/01/d_Aquino_thesis.pdf}, 1496 petsc_uses = {KSP} 1497} 1498 1499@TechReport{ ssdfssf2003, 1500 author = {T. Schrefl and W. Scholz and R. Dittrich and H. Forster and D. Suess and M. 1501 Stehno and J. Fidler}, 1502 title = {Micromagnetic Simulations of Domainstructures in Softmagnetic Thin Films}, 1503 url = {http://www.zid.tuwien.ac.at/projekte/2003/03-138-1.html}, 1504 petsc_uses = {KSP} 1505} 1506 1507@InProceedings{ sb2006a, 1508 author = {W. Scholz and S. Batra}, 1509 title = {Effect of write current waveform on magnetization and head field dynamics of 1510 perpendicular recording heads}, 1511 booktitle = {Intermag 2006 Conference, San Diego, CA, paper no. EF-03}, 1512 petsc_uses = {KSP} 1513} 1514 1515@Article{ scholz-batra1, 1516 author = {W. Scholz and S. Batra}, 1517 title = {Micromagnetic Simulation of Head Field and Write Bubble Dynamics in Perpendicular 1518 Recording}, 1519 journal = {IEEE Trans. Magn.}, 1520 note = {submitted}, 1521 year = {2005}, 1522 petsc_uses = {KSP} 1523} 1524 1525@Article{ scholz-batra2, 1526 author = {W. Scholz and S. Batra}, 1527 title = {Micromagnetic Modeling of Head Field Rise Time for High Data-Rate Recording}, 1528 journal = {IEEE Trans. Magn.}, 1529 volume = {41}, 1530 year = {2005}, 1531 pages = {702-706}, 1532 petsc_uses = {KSP} 1533} 1534 1535@Article{ daquino-scholz1, 1536 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1537 title = {Micromagnetic Analysis of Fast Precessional Switching}, 1538 journal = {J. Magn. Magn. Mater.}, 1539 volume = {290-291}, 1540 year = {2005}, 1541 pages = {510-513}, 1542 petsc_uses = {KSP} 1543} 1544 1545@Article{ aq-scholz-fid, 1546 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and J. Fidler}, 1547 title = {Numerical and analytical study of fast precessional switching}, 1548 journal = {J. Appl. Phys.}, 1549 volume = {95}, 1550 year = {2004}, 1551 pages = {7055-7057}, 1552 petsc_uses = {KSP} 1553} 1554 1555@InProceedings{ gar-tabik-gar, 1556 author = {E. M. Garzon and S. Tabik and I. Garcia and A. R. Bretones}, 1557 title = {Multiprocessing of the Time Domain Analysis of Thin-Wire Antennas and 1558 Scatterers}, 1559 booktitle = {12th Euromicro Conference on Parallel, Distributed and Network-Based Processing 1560 (PDP'04)}, 1561 year = {2004}, 1562 pages = {80--}, 1563 petsc_uses = {KSP} 1564} 1565 1566@InProceedings{ aq-scholz-mia, 1567 author = {M. d'Aquino and W. Scholz and T. Schrefl and C. Serpico and G. Miano}, 1568 title = {Analysis of fast precessional switching in magnetic thin films}, 1569 booktitle = {Proceedings of PIERS (Progress In Electromagnetic Research Symposium)}, 1570 year = {2004}, 1571 pages = {257-260}, 1572 petsc_uses = {KSP} 1573} 1574 1575@Article{ scholz-fid-seus, 1576 author = {W. Scholz and J. Fidler and T. Schrefl and D. Suess and H. Forster and R. 1577 Dittrich and V. Tsiantos}, 1578 title = {Numerical Micromagnetic Simulation of Fe-Pt Nanoparticles with Multiple Easy 1579 Axes}, 1580 journal = {J. Magn. Magn. Mater.}, 1581 year = {2004}, 1582 pages = {1524-1525}, 1583 petsc_uses = {KSP} 1584} 1585 1586@Article{ boardman-zimmerman, 1587 author = {Richard Boardman and Juergen Zimmermann and Hans Fangohr and Alexander Zhukov and 1588 Peter de Groot}, 1589 title = {Micromagnetic simulation studies of ferromagnetic part-spheres}, 1590 journal = {Journal of Applied Physics}, 1591 year = {2005}, 1592 petsc_uses = {KSP} 1593} 1594 1595@Article{ lim-kim-park, 1596 author = {C. K. Lim and Y. S. Kim and N. Y. Park and J. Lee}, 1597 title = {High Density Magnetic Random Access Memory Using a Pair of Asymmetrical Cell}, 1598 journal = {IEEE Trans. Magn.}, 1599 note = {submitted}, 1600 petsc_uses = {KSP} 1601} 1602 1603@Article{ scholz-suess2, 1604 author = {W. Scholz and D. Suess and T. Schrefl and and J. Fidler}, 1605 title = {Micromagnetic simulation of magnetization reversal in small particles with 1606 surface anisotropy}, 1607 journal = {J. Appl. Phys.}, 1608 volume = {95}, 1609 year = {2004}, 1610 pages = {6807-6809}, 1611 petsc_uses = {KSP} 1612} 1613 1614@Article{ scholz-schrefl1, 1615 author = {W. Scholz and T. Schrefl and J. Fidler and T. Matthias and D. Suess and V. 1616 Tsiantos}, 1617 title = {Micromagnetic simulation of the pinning and depinning process in permanent 1618 magnets}, 1619 journal = {IEEE Trans. Magn.}, 1620 volume = {39}, 1621 year = {2003}, 1622 pages = {2920-2922}, 1623 petsc_uses = {KSP} 1624} 1625 1626@Article{ scholz-guslienko, 1627 author = {W. Scholz and K. Y. Guslienko and V. Novosad and D. Suess and T. Schrefl and R. 1628 W. Chantrell and J. Fidler}, 1629 title = {Transition from single-domain to vortex state in soft magnetic cylindrical 1630 nanodots}, 1631 journal = {J. Magn. Magn. Mater.}, 1632 volume = {266}, 1633 year = {2003}, 1634 pages = {155-163}, 1635 petsc_uses = {KSP} 1636} 1637 1638@Article{ scholz1, 1639 author = { W. Scholz and J. Fidler and T. Schrefl and D. Suess and R. Dittrich and H. 1640 Forster and V. Tsiantos}, 1641 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1642 journal = {Comp. Mat. Sci}, 1643 year = {2003}, 1644 pages = {366--383}, 1645 volume = {28}, 1646 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/cms03/magpar.pdf}, 1647 petsc_uses = {KSP} 1648} 1649 1650@PhDThesis{ scholz2, 1651 author = {W. Scholz}, 1652 title = {Scalable Parallel Micromagnetic Solvers for Magnetic Nanostructures}, 1653 school = {Vienna University of Technology, Vienna, Austria}, 1654 year = {2003}, 1655 petsc_uses = {KSP} 1656} 1657 1658@Article{ scholz3, 1659 author = {W. Scholz and D. Suess and R. Dittrich and T. Schrefl and V. Tsiantos and H. 1660 Forster and J. Fidler}, 1661 title = {Implementation of a high performance parallel finite element micromagnetics 1662 package}, 1663 journal = {J. Magn. Magn. Mater.}, 1664 year = {2004}, 1665 url = {http://magnet.atp.tuwien.ac.at/scholz/projects/papers/preprint/scholz/icm2003/scholz_petsc.pdf}, 1666 petsc_uses = {KSP} 1667} 1668 1669% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1670@InBook{ zhanggladwell1, 1671 author = {W. Zhang and I. Gladwell}, 1672 chapter = {Performance of MOL for Surface Motion Driven by a Laplacian of Curvature}, 1673 editor = {Z. Chen and R.E. Ewing and Z.-C. Shi}, 1674 year = {2000}, 1675 title = {Numerical Treatment of Multiphase Flows in Porous Media, Lecture Notes in 1676 Physics, vol. 552}, 1677 publisher = {Springer}, 1678 pages = {4190-}, 1679 petsc_uses = {KSP} 1680} 1681 1682@Article{ wolf1, 1683 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and V. Yamakov}, 1684 title = {Combined Atomistic and Mesoscale simulation of grain growth in nanocrystalline 1685 thin films}, 1686 journal = {Phil. Mag. A}, 1687 year = {2003}, 1688 lab = {ANL}, 1689 petsc_uses = {KSP} 1690} 1691 1692@Article{ wolf2, 1693 author = {A. J. Haslan and D. Moldovan and S. R. Phillpot and H. Gleiter}, 1694 title = {Mesoscopic simulation of two dimensional grain growth with anisotropic 1695 grain-boundary properties}, 1696 journal = {Computational Materials Science}, 1697 year = {2001}, 1698 volume = {23}, 1699 pages = {15--32}, 1700 lab = {ANL}, 1701 petsc_uses = {KSP} 1702} 1703 1704@Article{ wolf3, 1705 author = {D. Moldovan and S. R. Phillpot and A. J. Haslan}, 1706 title = {Role of grain rotation in grain growth by mesoscale simulation}, 1707 journal = {Phil. Mag. A}, 1708 year = {2002}, 1709 volume = {82}, 1710 pages = {1271--1297}, 1711 lab = {ANL}, 1712 petsc_uses = {KSP} 1713} 1714 1715% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1716@Article{ saut, 1717 author = { Olivier Saut}, 1718 title = {Bidimensional Study of the {M}axwell-{B}loch Model in a Nonlinear Crystal}, 1719 journal = {SIAM Journal on Scientific Computing}, 1720 year = {2004}, 1721 note = {submitted}, 1722 url = {http://mip.ups-tlse.fr/\~{ }saut/data/sisc04.pdf}, 1723 petsc_uses = {KSP} 1724} 1725 1726% LiteralHTML: 1727% LiteralHTML: <a name="biology"><H3><center>Biology -- Medical</center></H3> 1728% LiteralHTML: 1729@InBook{ khanallorenziayachepennec2016, 1730 title = {Simulating Patient Specific Multiple Time-Point {MRIs} from a Biophysical Model 1731 of Brain Deformation in {Alzheimer's} Disease}, 1732 booktitle = {Computational Biomechanics for Medicine: Imaging, Modeling and Computing}, 1733 author = {Bishesh Khanal and Marco Lorenzi and Nicholas Ayache and Xavier Pennec}, 1734 editor = {Grand R. Joldes and Barry Doyle and Adam Wittek and Poul M.F. Nielsen and Karol 1735 Miller}, 1736 pages = {167--176}, 1737 isbn = {978-3-319-28329-6}, 1738 doi = {10.1007/978-3-319-28329-6_15}, 1739 publisher = {Springer International Publishing}, 1740 year = {2016}, 1741 petsc_uses = {KSP} 1742} 1743 1744@Article{ ataseven, 1745 author = {Y. Ataseven and Z. Akaliota n-Acar and C.~E. Acar and N. G. Gen\c{c}er}, 1746 title = {Parallel implementation of the accelerated {BEM} approach for {EMSI} of the human 1747 brain}, 1748 journal = {Medical and Biological Engineering and Computing}, 1749 month = feb, 1750 year = {2008}, 1751 doi = {10.1007/s11517-008-0316-0}, 1752 petsc_uses = {KSP} 1753} 1754 1755@Article{ dennis-eberhart-03, 1756 author = {B. H. Dennis and R. C. Eberhart and G. S. Dulikravich and S.W. Radons}, 1757 pages = {832-840}, 1758 volume = {125}, 1759 number = {6}, 1760 title = {Finite-element simulation of cooling of realistic {3-D} human head and neck}, 1761 journal = {J Biomech Eng}, 1762 year = {2003}, 1763 url = {http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=14986408&dopt=Citation}, 1764 petsc_uses = {KSP} 1765} 1766 1767@Conference{ gu7174parallel, 1768 title = {{A parallel reduced-space sequential-quadratic programming algorithm for 1769 frequency-domain small animal optical tomography}}, 1770 author = {Gu, X. and Kim, H.K. and Masciotti, J. and Hielscher, A.H.}, 1771 booktitle = {Proc. of SPIE Vol}, 1772 volume = {7174}, 1773 number = {717406}, 1774 pages = {1}, 1775 petsc_uses = {KSP} 1776} 1777 1778@Article{ barchanski2005using, 1779 title = {{Using domain decomposition techniques for the calculation of low-frequency 1780 electric current densities in high-resolution 3D human anatomy models}}, 1781 author = {Barchanski, A. and Clemens, M. and De Gersem, H. and Steiner, T. and Weiland, 1782 T.}, 1783 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 1784 and Electronic Engineering}, 1785 volume = {24}, 1786 number = {2}, 1787 pages = {458--467}, 1788 issn = {0332-1649}, 1789 year = {2005}, 1790 publisher = {Emerald Group Publishing Limited}, 1791 petsc_uses = {KSP} 1792} 1793 1794@Article{ motrescurienen05, 1795 author = {V. C. Motrescu and U. van Rienen}, 1796 pages = {227--231}, 1797 volume = {3}, 1798 title = {Computation of currents induced by {ELF} electric fields in anisotropic human 1799 tissues using the Finite Integration Technique}, 1800 journal = {Advances in Radio Science}, 1801 year = {2005}, 1802 url = {http://www.copernicus.org/URSI/ars/3/ars-3-227.pdf}, 1803 petsc_uses = {KSP} 1804} 1805 1806@Article{ motrescurienen04, 1807 author = {V. C. Motrescu and U. van Rienen}, 1808 pages = {309--313}, 1809 volume = {2}, 1810 title = {Computation of electrostatic fields in anisotropic human tissues using the Finite 1811 Integration Technique (FIT)}, 1812 journal = {Advances in Radio Science}, 1813 year = {2004}, 1814 url = {http://www.copernicus.org/URSI/ars/ARS_2_1/309.pdf}, 1815 petsc_uses = {KSP} 1816} 1817 1818@InProceedings{ dbl2, 1819 author = {Enzo A. Dari and Mariano I. Cantero and Raul A. Feijoo}, 1820 title = {Computational arterial flow modeling using a parallel {Navier-Stokes} solver}, 1821 booktitle = {ECCOMAS2000}, 1822 year = {2000}, 1823 url = {http://146.134.8.133/Feijoo/CModComplexos/Conferencias/ECCOMAS2000/Darie/eccomas.html}, 1824 petsc_uses = {KSP} 1825} 1826 1827@Unpublished{ cell, 1828 title = {Parallel Simulation Engines for Whole-Cell Models}, 1829 author = {Markus Schwehm and Nils Gehlenborg and Hendrik Post and Amelie Stein and Kirstin 1830 Weber}, 1831 note = {Poster at Second International Conference on Systems Biology (ICSB) 2001}, 1832 url = {http://www.icsb-2001.org/Posters/110_schwehm2.pdf}, 1833 institution = {University of Tubingen, ZBIT - Zentrum fur Bioinformatik Tubingen}, 1834 year = {2001}, 1835 petsc_uses = {KSP} 1836} 1837 1838@Article{ barker2010two, 1839 title = {Two-level {N}ewton and hybrid {S}chwarz preconditioners for fluid-structure 1840 interaction}, 1841 author = {Barker, A.T. and Cai, X.C.}, 1842 journal = {SIAM Journal on Scientific Computing}, 1843 volume = {32}, 1844 number = {4}, 1845 pages = {2395--2417}, 1846 year = {2010}, 1847 publisher = {Society for Industrial and Applied Mathematics}, 1848 petsc_uses = {KSP} 1849} 1850 1851@Article{ barker2010scalable, 1852 title = {Scalable parallel methods for monolithic coupling in fluid-structure interaction 1853 with application to blood flow modeling}, 1854 author = {Barker, A.T. and Cai, X.C.}, 1855 journal = {Journal of Computational Physics}, 1856 volume = {229}, 1857 number = {3}, 1858 pages = {642--659}, 1859 year = {2010}, 1860 publisher = {Elsevier}, 1861 petsc_uses = {KSP} 1862} 1863 1864@Article{ barker2009nks, 1865 title = {{NKS} for fully coupled fluid-structure interaction with application}, 1866 author = {Barker, A.T. and Cai, X.C.}, 1867 journal = {Domain Decomposition Methods in Science and Engineering XVIII}, 1868 pages = {275--282}, 1869 year = {2009}, 1870 publisher = {Springer}, 1871 petsc_uses = {KSP} 1872} 1873 1874@Article{ mirams2013, 1875 author = {Chris Luscombe and Geoff Williams and Jordi Munoz-Muriedas and David J Gavaghan 1876 and Yi Cui and Gary R Mirams}, 1877 title = {Evaluation of an in silico cardiac safety assay: using ion channel screening data 1878 to predict {QT} interval changes in the rabbit ventricular wedge}, 1879 journal = {Journal of pharmacological and toxicological methods}, 1880 volume = {68}, 1881 number = {1}, 1882 pages = {88--96}, 1883 year = {2013}, 1884 doi = {10.1016/j.vascn.2013.04.004}, 1885 petsc_uses = {KSP} 1886} 1887 1888% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1889% LiteralHTML: <center><img alt="" 1890% LiteralHTML: src="images/spine0l.jpg"></center></p> 1891% LiteralHTML: <center><img alt="" 1892% LiteralHTML: src="images/vertebra.jpg"></center></p> 1893% LiteralHTML:<font color="#FF0000"> 1894% LiteralHTML:Treating fractures of the hip and spine is a major medical cost. 1895% LiteralHTML:Understanding bone mechanical properties and how they may lead to 1896% LiteralHTML:fractures is thus an important medical research activity. PETSc and 1897% LiteralHTML:Prometheus have been used for extremely large scale finite element 1898% LiteralHTML:simulation of the solid mechanics of a portion of a human spine by a 1899% LiteralHTML:team of doctors and computational scientists. This computation was 1900% LiteralHTML:a winner of a Gordon Bell Special Prize at SC2004 and ran scalably 1901% LiteralHTML:with over 4000 processors.</p> 1902% LiteralHTML: </font> 1903@Article{ arbenz2008scalable, 1904 title = {A scalable multi-level preconditioner for matrix-free $\mu$-finite element 1905 analysis of human bone structures}, 1906 author = {Arbenz, P. and van Lenthe, G.H. and Mennel, U. and M{\\"u}ller, R. and Sala, M.}, 1907 journal = {International Journal for Numerical Methods in Engineering}, 1908 volume = {73}, 1909 number = {7}, 1910 pages = {927--947}, 1911 year = {2008}, 1912 publisher = {Wiley Online Library}, 1913 petsc_uses = {KSP} 1914} 1915 1916@InProceedings{ adams-04, 1917 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1918 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 1919 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 1920 half a billion degrees of freedom}, 1921 note = {Gordon Bell Award}, 1922 year = {2004}, 1923 petsc_uses = {KSP} 1924} 1925 1926@InProceedings{ adams-03b, 1927 author = {Adams, M.~F. and Bayraktar, H.H. and Keaveny, T.M. and Papadopoulos, P.}, 1928 title = {Applications of Algebraic Multigrid to Large-Scale Finite Element Analysis of 1929 Whole Bone Micro-Mechanics on the {IBM SP}}, 1930 booktitle = {ACM/IEEE Proceedings of SC2003: High Performance Networking and Computing}, 1931 year = {2003}, 1932 petsc_uses = {KSP} 1933} 1934 1935@InProceedings{ oghattas2002, 1936 author = {Volkan Akcelik and George Biros and Omar Ghattas}, 1937 title = {Parallel Multiscale {Gauss-Newton-Krylov} Methods For Inverse Wave Propagation}, 1938 booktitle = {Procceedings of SC2002}, 1939 url = {http://www-2.cs.cmu.edu/\~{ }oghattas/papers/sc2002.pdf}, 1940 note = {Winner of SC2002 Best Paper. A parallel algorithm for inverse problems governed 1941 by time-dependent PDEs, and scalability results for an inverse wave propagation 1942 problem of determining the material field of an acoustic medium. Using the 1943 algorithm, they solved a synthetic inverse wave propagation problem though a 1944 pelvic bone geometry involving 2.1 million inversion parameters in 3 hours on 256 1945 processors.}, 1946 year = {2002}, 1947 petsc_uses = {KSP} 1948} 1949 1950% LiteralHTML: <a name="biology:cardiology"> 1951% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 1952% LiteralHTML: <center><img alt="" 1953% LiteralHTML: src="images/heart.jpg"> 1954% LiteralHTML: <img alt="" 1955% LiteralHTML: src="images/pump.jpg"></center></p> 1956% LiteralHTML: 1957% LiteralHTML:<font color="#FF0000"> 1958% LiteralHTML: Arrhythmias are disorders of the regular rhythmic beating of the 1959% LiteralHTML: heart; they are the cause of the majority of sudden cardiac 1960% LiteralHTML: deaths. The heart beat is controlled by electrical signals moving 1961% LiteralHTML: through the heart. PETSc has been used by several research groups to 1962% LiteralHTML: simulate the electronic behavior of the heart in an attempt to more 1963% LiteralHTML: fully understand the developments of arrhthmias.</p> 1964% LiteralHTML:</font> 1965@InProceedings{ oghattas2000, 1966 author = {J. Antaki and G. Belloch and O. Ghattas and I. Malcevic and G. Miller and N. 1967 Walkington}, 1968 title = {A Parallel Dynamic-Mesh {L}agrangian Method for Simulation of Flows with Dynamic 1969 Interfaces}, 1970 booktitle = {Procceedings of SC2000}, 1971 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc2000/sc2000.pdf}, 1972 note = {Blood flow modeling at the microscale including effects on individual blood 1973 cells, for designing heart assist pumps, etc.}, 1974 year = {2000}, 1975 petsc_uses = {KSP} 1976} 1977 1978@InBook{ cfps2006, 1979 author = {P. Colli Franzone and L. F. Pavarino and G. Savare}, 1980 editor = {A. Quarteroni et al.}, 1981 title = {Complex Systems in Biomedicine}, 1982 chapter = {Computational Electrocardiology: mathematical and numerical modeling}, 1983 publisher = {Springer-Verlag}, 1984 pages = {187--241}, 1985 year = {2006}, 1986 petsc_uses = {KSP} 1987} 1988 1989@InProceedings{ cfpst2007, 1990 author = {P. Colli Franzone and L. F. Pavarino and S. Scacchi and B. Taccardi}, 1991 title = {Determining recovery times from transmembrane action potentials and unipolar 1992 electrograms in normal heart tissue}, 1993 booktitle = {FIMH07}, 1994 publisher = {Springer-Verlag}, 1995 volume = {4466}, 1996 pages = {139--149}, 1997 year = {2007}, 1998 petsc_uses = {KSP} 1999} 2000 2001@Article{ seemann2010framework, 2002 title = {{Framework for Modular, Flexible and Efficient Solving the Cardiac Bidomain 2003 Equations Using PETSc}}, 2004 author = {Seemann, G. and Sachse, FB and Karl, M. and Weiss, DL and Heuveline, V. and 2005 D{\\"o}ssel, O.}, 2006 journal = {Progress in Industrial Mathematics at ECMI 2008}, 2007 pages = {363--369}, 2008 year = {2010}, 2009 publisher = {Springer}, 2010 petsc_uses = {KSP} 2011} 2012 2013@InProceedings{ pft2005, 2014 author = {Luca F. Pavarino and Piero Colli Franzone and Bruno Taccardi}, 2015 title = {Monodomain Simulations of Excitation and Recovery in Cardiac Blocks with 2016 Intramural Heterogeneity}, 2017 booktitle = {Functional Imaging and modeling of the Heart (FIMH05)}, 2018 pages = {267--277}, 2019 editors = {A. Frangi et al.}, 2020 publisher = {Springer, Lecture Notes in Computer Science (LNCS), v. 3504}, 2021 year = {2005}, 2022 petsc_uses = {KSP} 2023} 2024 2025@Article{ bgcp2005, 2026 author = {Boyce E. Griffith and Charles S. Peskin}, 2027 title = {On the order of accuracy of the immersed boundary method: Higher order 2028 convergence rates for sufficiently smooth problems}, 2029 journal = {Journal of Computational Physics}, 2030 year = {2005}, 2031 volume = {208}, 2032 pages = {75--105}, 2033 petsc_uses = {KSP} 2034} 2035 2036@Article{ griffith2007adaptive, 2037 title = {An adaptive, formally second order accurate version of the immersed boundary 2038 method}, 2039 author = {Griffith, B.E. and Hornung, R.D. and McQueen, D.M. and Peskin, C.S.}, 2040 journal = {Journal of Computational Physics}, 2041 volume = {223}, 2042 number = {1}, 2043 pages = {10--49}, 2044 year = {2007}, 2045 publisher = {Elsevier}, 2046 petsc_uses = {KSP} 2047} 2048 2049@PhDThesis{ griffith05, 2050 author = {Boyce Griffith}, 2051 title = {Simulating the blood-muscle-valve mechanics of the heart by an adaptive and 2052 parallel version of the immersed boundary method}, 2053 school = {New York University}, 2054 year = {2005}, 2055 petsc_uses = {KSP} 2056} 2057 2058@PhDThesis{ murillo, 2059 author = {Maria S. Murillo}, 2060 title = {Parallel Algorithms and Software for Time-Dependent System of Nonlinear Partial 2061 Differential Equations with an Application in Computational Biology}, 2062 school = {University of Colorado at Boulder}, 2063 year = {2002}, 2064 petsc_uses = {KSP} 2065} 2066 2067@Article{ spv2004, 2068 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer}, 2069 title = {Parallel multigrid preconditioner for the cardiac bidomain model}, 2070 journal = {IEEE Trans. Biomed. Eng}, 2071 year = {2004}, 2072 volume = {51}, 2073 pages = {1960--1968}, 2074 petsc_uses = {KSP} 2075} 2076 2077@Article{ vphl2003, 2078 author = {E. J. Vigmond and M. Hughes and G. Plank, L.J. Leon}, 2079 title = { Computational Tools for Modeling Electrical Activity in Cardiac Tissue}, 2080 journal = {J. Electrocardiol.}, 2081 year = {2003}, 2082 volume = {36}, 2083 pages = {69--74}, 2084 petsc_uses = {KSP} 2085} 2086 2087@InProceedings{ spbv2003, 2088 author = {Rodrigo Weber Dos Santos and G. Plank and S. Bauer and and E.J. Vigmond}, 2089 title = {Preconditioning Techniques for the Bidomain Equations}, 2090 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2091 Methods}, 2092 pages = {571--580}, 2093 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2094 note = {}, 2095 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2096 year = {2003}, 2097 petsc_uses = {KSP} 2098} 2099 2100@Article{ franz-pavir-04, 2101 author = {P. Colli Franzone and L.~F. Pavarino}, 2102 title = {A parallel solver for reaction-diffusion systems in computational 2103 electrocardiology}, 2104 journal = {Mathematical Models and Methods in Applied Sciences}, 2105 year = {2004}, 2106 volume = {14}, 2107 number = {6}, 2108 pages = {883--912}, 2109 petsc_uses = {KSP} 2110} 2111 2112@Article{ franz-pavir-05, 2113 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2114 title = {Simulating patterns of excitation, repolarization and action potential 2115 durationwith cardiac Bidomain and Monodomain models}, 2116 journal = {Mathematical Biosciences}, 2117 year = {2005}, 2118 volume = {197}, 2119 number = {1}, 2120 pages = {35--66}, 2121 petsc_uses = {KSP} 2122} 2123 2124@Article{ franz-pavir-06, 2125 author = {P. Colli Franzone and L.~F. Pavarino and B. Taccardi}, 2126 title = {Effects of transmural electrical heterogeneities and electrotonic interactions on 2127 the dispersion of cardiac repolarization and action potential duration: a 2128 simulation study}, 2129 journal = {Mathematical Biosciences}, 2130 year = {2006}, 2131 volume = {204}, 2132 number = {1}, 2133 pages = {132--165}, 2134 petsc_uses = {KSP} 2135} 2136 2137@InProceedings{ colli-franz-sim, 2138 author = {P. Colli-Franzone and L.F. Pavarino and B. Taccardi}, 2139 title = {MODELING ANISOTROPIC AND HETEROGENEOUS CARDIAC MODELS: PARALLEL SIMULATIONS}, 2140 booktitle = {MEDICON and HEALTH TELEMATICS 2004, Health in the Information Society, X 2141 Mediterranean Conference on Medical and Biological Engineering}, 2142 url = {http://cluster.mat.unimi.it/doc/Progetti/Pavarino-LF.pdf}, 2143 year = {2004}, 2144 petsc_uses = {KSP} 2145} 2146 2147@InProceedings{ pf2003, 2148 author = {Luca F. Pavarino and Piero Colli Franzone}, 2149 title = {Parallel Solution of Cardiac Reaction-Diffusion Models}, 2150 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 2151 Methods}, 2152 pages = {669--776}, 2153 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 2154 note = {}, 2155 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 2156 year = {2003}, 2157 petsc_uses = {KSP} 2158} 2159 2160@Article{ maria-is04, 2161 author = {Maria Murillo and Xiao-Chuan Cai}, 2162 title = {A fully implicit parallel algorithm for simulating the non-linear electrical 2163 activity of the heart}, 2164 journal = {Numerical Linear Algebra with Applications}, 2165 year = {2004}, 2166 volume = {11}, 2167 pages = {261 - 277}, 2168 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/107632540/ABSTRACT}, 2169 petsc_uses = {KSP} 2170} 2171 2172@Article{ murli2007monitoring, 2173 title = {{Monitoring and Migration of a PETSc-based Parallel Application for Medical 2174 Imaging in a Grid computing PSE}}, 2175 author = {Murli, A. and Boccia, V. and Carracciuolo, L. and D’Amore, L. and Laccetti, G. 2176 and Lapegna, M.}, 2177 journal = {Grid-Based Problem Solving Environments}, 2178 pages = {421--432}, 2179 year = {2007}, 2180 publisher = {Springer}, 2181 petsc_uses = {KSP} 2182} 2183 2184@Article{ carracciuolo:2006:tpc, 2185 author = {Carracciuolo, L. and D'Amore, L. and Murli, A.}, 2186 title = {Towards a parallel component for imaging in {PETSc} programming environment: a case 2187 study in {3-D} echocardiography}, 2188 journal = {Parallel Comput.}, 2189 volume = {32}, 2190 issue = {1}, 2191 month = jan, 2192 year = {2006}, 2193 issn = {0167-8191}, 2194 pages = {67--83}, 2195 numpages = {17}, 2196 doi = {10.1016/j.parco.2005.09.001}, 2197 acmid = {1141218}, 2198 publisher = {Elsevier Science Publishers B. V.}, 2199 address = {Amsterdam, The Netherlands, The Netherlands}, 2200 keywords = {Distributed software environment, Image denoising, Non linear PDE, Parallel 2201 component}, 2202 petsc_uses = {KSP} 2203} 2204 2205@Article{ damore2011integration, 2206 title = {Integration of emerging computer technologies for an efficient image sequences 2207 analysis}, 2208 journal = {Integrated Computer-Aided Engineering }, 2209 volume = {18}, 2210 number = {4}, 2211 pages = {365 - 378}, 2212 year = {2011}, 2213 note = {}, 2214 issn = {1875-8835}, 2215 doi = {10.3233/ICA-2011-0382}, 2216 url = {http://iospress.metapress.com/content/KM614806M50TKVP7}, 2217 author = {L. D'Amore and D. Casaburi and A. Galletti and L. Marcellino and A. Murli}, 2218 keywords = {Image sequence, pipe and filters, parallel computing, multicore processors}, 2219 petsc_uses = {KSP} 2220} 2221 2222@InProceedings{ eth_biwi_00721, 2223 author = {K. Burckhardt and D. Szczerba and J. Brown and K. Muralidhar and and G. 2224 Székely}, 2225 title = {Fast Implicit Simulation of Oscillatory Flow in Human Abdominal Bifurcation using 2226 a {S}chur Complement Preconditioner}, 2227 booktitle = {Euro-Par 2009 Parallel Processing}, 2228 year = {2009}, 2229 month = aug, 2230 pages = {747-759}, 2231 volume = {5704}, 2232 editor = {H. Sips and D. Epema and and H.-X. Lin}, 2233 series = {Lecture Notes in Computer Science}, 2234 publisher = {Springer}, 2235 keywords = {Aortic aneurysm, flow simulation, streamline diffusion FEM, indefinite matrix, 2236 parallel Krylov solver}, 2237 petsc_uses = {KSP} 2238} 2239 2240% LiteralHTML: <a name="biology:imagingandsurgery"> 2241% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 2242% LiteralHTML: <center><img alt="" 2243% LiteralHTML: src="images/brain.jpg"></center> 2244@Article{ ganser2004deformable, 2245 title = {A deformable digital brain atlas system according to Talairach and Tournoux}, 2246 author = {Ganser, K.A. and Dickhaus, H. and Metzner, R. and Wirtz, C.R.}, 2247 journal = {Medical Image Analysis}, 2248 volume = {8}, 2249 number = {1}, 2250 pages = {3--22}, 2251 year = {2004}, 2252 publisher = {Elsevier}, 2253 petsc_uses = {KSP} 2254} 2255 2256@Unpublished{ taccsurgery, 2257 title = {{TACC} supercomputer performs laser cancer surgery on canine}, 2258 url = {http://www.tacc.utexas.edu/research/users/features/dynamic.php?m_b_c=laser}, 2259 note = {In April, the Lonestar supercomputer at the Texas Advanced Computing Center in 2260 Austin performed laser surgery on a dog in Houston without the intervention of a 2261 surgeon. The treatment was developed collaboratively by computational experts from 2262 the Institute for Computational Engineering and Sciences (ICES) at UT-Austin, 2263 leading technologists from the M.D. Anderson Cancer Center in Houston, and 2264 cyberinfrastructure specialists and systems from TACC. Using precise lasers, 2265 state-of-the-art thermal imaging technology, and advanced computational methods, 2266 dynamic, data-driven treatments are being pursued as a minimally invasive 2267 alternative to the standard treatment of cancer.}, 2268 petsc_uses = {KSP} 2269} 2270 2271@Article{ ffhbresso2008, 2272 author = {Yusheng Feng and David Fuentes and Andrea Hawkins and Jon Bass and Marissa 2273 Nichole Rylander and Andrew Elliott and Anil Shetty and R. Jason Stafford and J. 2274 Tinsley Oden}, 2275 title = {Nanoshell-Mediated Laser Surgery Simulation for Prostate Cancer Treatment}, 2276 journal = {Engineering with Computers}, 2277 note = {Special issue on Computational Bioengineering}, 2278 year = {2008}, 2279 url = {http://www.tacc.utexas.edu/research/users/features/laser_surgery.pdf}, 2280 petsc_uses = {KSP} 2281} 2282 2283@TechReport{ dobbhbbbdeffghkkps2008, 2284 author = {K. R. Diller and J. T. Oden and C. Bajaj and J. C. Browne and J. Hazle and I. 2285 Babu{\v{s}}ka and J. Bass and L. Bidaut and L. Demkowicz and A. Elliott and Y. 2286 Feng and D. Fuentes and S. Goswami and A. Hawkins and S. Khoshnevis and B. Kwon 2287 and S. Prudhomme and R. J. Stafford}, 2288 title = {Computational Infrastructure for the Real-Time Patient-Specific Treatment of 2289 Cancer}, 2290 year = {2008}, 2291 institution = {University of Texas at Austin}, 2292 url = {http://www.tacc.utexas.edu/research/users/features/cancer.pdf}, 2293 petsc_uses = {KSP} 2294} 2295 2296@Article{ ogdb2004, 2297 author = {A.A. Oberai and N.H. Gokhale and M.M. Doyley and J.C.Bamber}, 2298 title = {Evaluation of the Adjoint Equation Based Algorithm for Elasticity Imaging}, 2299 journal = {Physics in Medicine and Biology}, 2300 year = {2004}, 2301 volume = {49}, 2302 pages = {2955--2947}, 2303 petsc_uses = {KSP} 2304} 2305 2306@InProceedings{ majumdar11, 2307 author = {A. Majumdar and A. Birnbaum and D. Choi and A. Trivedi and S. K. Warfield and K. 2308 Baldridge and P. Krysl}, 2309 title = {A Dynamic Data Driven Grid System for Intra-Operative Image Guided Neurosurgery}, 2310 booktitle = {ICCS 2005}, 2311 pages = {672--679}, 2312 editor = {V.S. Sunderam et al.}, 2313 year = {2005}, 2314 petsc_uses = {KSP} 2315} 2316 2317@Conference{ sermesant-etal:03, 2318 author = {Sermesant, M. and Clatz, O. and Li, Z. and Lanteri, S. and Delingette, H. and 2319 Ayache, H.}, 2320 title = {A parallel implementation of non-rigid registration using a volumetric 2321 biomechanical model}, 2322 booktitle = {Second International Workshop on Biomedical Image Registration {WBIR'03}}, 2323 address = {Philadelphia, PA, USA}, 2324 publisher = {Springer-Verlag}, 2325 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2326 series = {Lecture Notes in Computer Science}, 2327 volume = {2717}, 2328 pages = {398-407}, 2329 date = {june 23-24}, 2330 year = {2003}, 2331 url = {ftp://ftp-sop.inria.fr/epidaure/Publications/Sermesant/WBIR2003Sermesant.pdf}, 2332 petsc_uses = {KSP} 2333} 2334 2335@Conference{ sermesant-etal:04, 2336 author = {J. Rexilius and S.K. Warfield and C.R.G. Guttmann and X. Wei and R. Benson and L. 2337 Wolfson and M. Shenton and H. Handels and R. Kikinis}, 2338 title = {A Novel Nonrigid Registration Algorithm And Applications}, 2339 booktitle = {Medical Image Computing and Computer-Assisted Intervention - MICCAI 2001}, 2340 address = {Philadelphia, PA, USA}, 2341 publisher = {Springer-Verlag}, 2342 editor = {Gee, J.C. and Maintz, J.B.A. and Vannier, M.W.}, 2343 series = {Lecture Notes in Computer Science}, 2344 volume = {2208}, 2345 pages = {923}, 2346 year = {2003}, 2347 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=6pgwnvthup0amt7g9j4k&referrer=parent&backto=issue,105,251;journal,1191,1949;linkingpublicationresults,1:105633,1}, 2348 petsc_uses = {KSP} 2349} 2350 2351@Article{ warfield-haker-talos-05, 2352 author = {Simon K. Warfield and Steven J. Haker and Ion-Florin Talos and Corey A. Kemper 2353 and Neil Weisenfeld and Andrea U.J. Mewes and Daniel Goldberg-Zimring and Kelly H. 2354 Zou and Carl-Fredrik Westin and William M. Wells and Clare M.C. Tempany and 2355 Alexandra Golby and Peter M. Black and Ferenc A. Jolesz and Ron Kikinis}, 2356 title = {Capturing intraoperative deformations: research experience at {B}righam and {W}omen's 2357 hospital}, 2358 journal = {Medical Image Analysis}, 2359 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/warfield/capturing-intraoperative-deformations-MIA2005.pdf}, 2360 year = {2005}, 2361 petsc_uses = {KSP} 2362} 2363 2364@Article{ brain3, 2365 author = {Simon K. Warfield and Florin Talos and Alida Tei and Arya Nabavi and Matthieu 2366 Ferrant and Peter McL. Black and Ferenc A. Jolesz and Ron Kikinis}, 2367 title = {Real-Time Registration of Volumetic Brain {MRI} by Biomechanical Simulation of 2368 Deformation during Image Guided Neurosurgery}, 2369 journal = {Computing and Visualization in Science}, 2370 url = {http://splweb.bwh.harvard.edu:8000/pages/ppl/warfield/papers/2002/warfield-2002-cvs-appeared.pdf}, 2371 year = {2002}, 2372 petsc_uses = {KSP} 2373} 2374 2375@Article{ brain2, 2376 author = {Matthieu Ferrant and Arya Nabavi and Benoit Macq and Ferenc A. Jolesz and Ron 2377 Kikinis and Simon K. Warfield}, 2378 title = {Registration of {3D} Intraoperative {MR} Images of the Brain using a Finite 2379 Element Biomechanical Model}, 2380 journal = {IEEE Transactions on Medical Imaging}, 2381 url = {http://splweb.bwh.harvard.edu:8000/pages/papers/ferrant/tmi2001.pdf}, 2382 year = {2001}, 2383 petsc_uses = {KSP} 2384} 2385 2386@InProceedings{ brain1, 2387 author = {Simon K. Warfield and Matthieu Ferrant and Xavier Gallez and Arya Nabavi and 2388 Ferenc A. Jolesz and Ron Kikinis}, 2389 title = {Real-Time Biomechanical Simulation of Volumetric Brain Deformation for Image 2390 Guided Neurosurgery}, 2391 booktitle = {Proceedings of SC2000}, 2392 url = {http://www.sc2000.org/techpapr/papers/pap.pap230.pdf}, 2393 year = {2000}, 2394 petsc_uses = {KSP} 2395} 2396 2397@Article{ vanne06, 2398 author = {V. Kolehmainen and A. Vanne and S. Siltanen and S. Jarvenpaa and J.P. Kaipio and 2399 M. Lassas and M. Kalke}, 2400 title = {Parallelized {B}ayesian inversion for three-dimensional dental {X}-ray imaging}, 2401 journal = {IEEE Transactions on Medical Imaging}, 2402 volume = {25}, 2403 number = {2}, 2404 month = feb, 2405 year = {2006}, 2406 pages = {218--228}, 2407 petsc_uses = {KSP} 2408} 2409 2410@InProceedings{ knepleybardhan2015, 2411 title = {Work/Precision Tradeoffs in Continuum Models of Biomolecular Electrostatics}, 2412 author = {Matthew G. Knepley and Jaydeep P. Bardhan}, 2413 booktitle = {Proceedings of ASME 2015 International Mechanical Engineering Congress \& 2414 Exposition}, 2415 volume = {9}, 2416 pages = {V009T12A04}, 2417 doi = {10.1115/IMECE2015-53579}, 2418 year = {2015}, 2419 petsc_uses = {KSP} 2420} 2421 2422@InProceedings{ bardhanknepley2015, 2423 title = {Multiscale models and approximation algorithms for protein electrostatics}, 2424 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 2425 booktitle = {Boundary Elements and Other Mesh Reduction Methods XXXVIII}, 2426 volume = {61}, 2427 pages = {163--174}, 2428 url = {http://www.witpress.com/Secure/elibrary/papers/BEM38/BEM38013FU1.pdf}, 2429 doi = {10.2495/BEM380131}, 2430 publisher = {WIT Press}, 2431 year = {2015}, 2432 petsc_uses = {KSP} 2433} 2434 2435% LiteralHTML: 2436% LiteralHTML: <a name="fusion"><H3><center>Fusion</center></H3> 2437% LiteralHTML: 2438@InProceedings{ adamsbrennanknepleywang2022, 2439 title = {{Landau} collision operator in the {CUDA} programming model applied to thermal 2440 quench plasmas}, 2441 author = {Mark. F. Adams and Dylan P. Brennan and Matthew G. Knepley and Peng Wang}, 2442 booktitle = {36th IEEE International Parallel \& Distributed Processing Symposium Conference 2443 (IPDPS '22)}, 2444 doi = {10.1109/IPDPS53621.2022.00020}, 2445 year = {2022}, 2446 petsc_uses = {DMPlex} 2447} 2448 2449@Misc{ adamsknepleybrennan2021, 2450 title = {Runaway Electron Generation with High-Performance, Structure Preserving 2451 Discretization of {F}okker--{P}lank--{L}andau}, 2452 author = {Mark F. Adams and Matthew G. Knepley and Dylan Brennan}, 2453 year = {2021}, 2454 petsc_uses = {KSP} 2455} 2456 2457@Article{ adamshirvijokiknepleybrownisaacmills2017, 2458 title = {{Landau} Collision Integral Solver with Adaptive Mesh Refinement on Emerging 2459 Architectures}, 2460 author = {Mark F. Adams and Eero Hirvijoki and Matthew G. Knepley and Jed Brown and Tobin 2461 Isaac and Richard Mills}, 2462 journal = {SIAM Journal on Scientific Computing}, 2463 volume = {39}, 2464 number = {6}, 2465 pages = {C452--C465}, 2466 doi = {10.1137/17M1118828}, 2467 eprint = {1702.08880}, 2468 year = {2017}, 2469 petsc_uses = {KSP} 2470} 2471 2472@Article{ pusztayknepleyadams2022, 2473 title = {Conservative Projection Between {FEM} and Particle Bases}, 2474 author = {Joseph V. Pusztay and Matthew G. Knepley and Mark F. Adams}, 2475 journal = {SIAM Journal on Scientific Computing}, 2476 volume = {44}, 2477 number = {4}, 2478 pages = {C310--C319}, 2479 doi = {10.1137/21M145407}, 2480 year = {2022} 2481} 2482 2483@Article{ hirvijoki2017, 2484 author = {Eero Hirvijoki and Mark F. Adams}, 2485 title = {Conservative discretization of the {Landau} collision integral}, 2486 journal = {Physics of Plasmas}, 2487 volume = {24}, 2488 number = {3}, 2489 pages = {032121}, 2490 doi = {10.1063/1.4979122}, 2491 year = {2017}, 2492 petsc_uses = {KSP} 2493} 2494 2495@Article{ mollenadamsknepleyhagerchang2021, 2496 title = {Implementation of higher-order velocity mapping between marker particles and grid 2497 in the particle-in-cell code {XGC}}, 2498 author = {Albert Moll\'en and Mark F. Adams and Matthew G. Knepley and Robert Hager and C. 2499 S. Chang}, 2500 journal = {Journal of Plasma Physics}, 2501 volume = {87}, 2502 number = {2}, 2503 pages = {905870229}, 2504 eprint = {2012.11764}, 2505 doi = {10.1017/S0022377821000441}, 2506 year = {2021}, 2507 petsc_uses = {KSP} 2508} 2509 2510@Article{ lsmh2014, 2511 author = {M. Landreman and H. M. Smith and A. Mollen and P. Helander}, 2512 title = {Comparison of particle trajectories and collision operators for collisional 2513 transport in nonaxisymmetric plasmas}, 2514 journal = { Physics of Plasmas}, 2515 volume = {21}, 2516 year = {2014}, 2517 petsc_uses = {KSP} 2518} 2519 2520@Article{ lpcep2014, 2521 author = {M. Landreman and F. I Parra and P. J. Catto and D. Ernst and I. Pusztai}, 2522 title = {Radially global delta-f computation of neoclassical phenomena in a tokamak 2523 pedestal}, 2524 journal = {Plasma Physics and Controlled Fusion}, 2525 volume = {56}, 2526 year = {2014}, 2527 petsc_uses = {KSP} 2528} 2529 2530@Article{ facets-scidac08, 2531 title = {First Results from Core-Edge Parallel Composition in the {FACETS} Project}, 2532 author = {J. Cary and J. Candy and R. Cohen and S. Krasheninnikov and D. McCune and D. 2533 Estep and J. Larson and A. Malony and A. Pankin and P. Worley and J. Carlsson and 2534 A. Hakim and P. Hamill and S. Kruger and M. Miah and S. Muzsala and A. Pletzer and 2535 S. Shasharina and D. Wade-Stein and N. Wang and S. Balay and L. McInnes and H. 2536 Zhang and T. Casper and L. Diachin and T. Epperly and T. Rognlien and M. Fahey and 2537 J. Cobb and A. Morris and S. Shende and G. Hammett and K. Indireshkumar and D. 2538 Stotler and A. Pigarov}, 2539 journal = {J. Phys.: Conf. Ser.}, 2540 volume = {125}, 2541 year = {2008}, 2542 pages = {012040}, 2543 url = {http://www.iop.org/EJ/abstract/1742-6596/125/1/012040}, 2544 petsc_uses = {KSP} 2545} 2546 2547@Article{ facets-scidac09, 2548 title = {Concurrent, Parallel, Multiphysics Coupling in the {FACETS} Project}, 2549 author = {J. Cary and J. Candy and J. Cobb and R. H. Cohen and T. Epperly and D. Estep and 2550 S. Krasheninnikov and A. Malony and D. McCune and L. McInnes and A. Pankin and S. 2551 Balay and J. Carlsson and M. R. Fahey and R. Groebner and A. Hakim and S. Kruger 2552 and M. Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein 2553 and T. Rognlien and A. Morris and S. Shende and G. W. Hammett and K. Indireshkumar 2554 and A. Pigarov and H. Zhang}, 2555 journal = {J. Phys.: Conf. Ser.}, 2556 volume = {180}, 2557 year = {2009}, 2558 pages = {012056}, 2559 url = {http://iopscience.iop.org/1742-6596/180/1/012056}, 2560 petsc_uses = {KSP} 2561} 2562 2563@InProceedings{ facets-scidac10, 2564 title = {Coupled Whole Device Simulations of Plasma Transport in Tokamaks with the 2565 {FACETS} Code}, 2566 author = {A. Hakim and J. Cary and J. Candy and J. Cobb and R. Cohen and T. Epperly and D. 2567 Estep and S. Krasheninnikov and A. Malony and D McCune and L.C. McInnes and A. 2568 Pankin and S. Balay J. Carlsson and M. Fahey and R. Groebner and S. Kruger and M. 2569 Miah and A. Pletzer and S. Shasharina and S. Vadlamani and D. Wade-Stein and T. 2570 Rognlein and A. Morris and S. Shende and G. Hammett and K. Indareshkumar and A. 2571 Pigarov and H. Zhang}, 2572 booktitle = {Proceedings of SciDAC 2010 Conference}, 2573 year = {2010}, 2574 url = {http://computing.ornl.gov/workshops/scidac2010/papers/fusion_a_hakim.pdf}, 2575 petsc_uses = {KSP} 2576} 2577 2578@InProceedings{ facets-fec2010, 2579 title = {Concurrent, Parallel, Coupled Core-Edge Simulations of Pedestal Formation Using 2580 the {FACETS} Framework}, 2581 author = {J. Cary and A. Hakim and A. Pletzer and M. Miah and S. Kruger and S. Shasharina 2582 and S. Vadlamani and J. Carlsson and A. Pankin and T. Rognlien and R. Cohen and D. 2583 McCune and K. Indireshkumar and A. Pigarov and L.C. McInnes and H. Zhang}, 2584 booktitle = {Proceedings of the 23rd annual IAEA Fusion Energy Conference (FEC 2010), Daejon, 2585 Republic of Korea}, 2586 year = {2010}, 2587 petsc_uses = {KSP} 2588} 2589 2590@InProceedings{ facets-epdp2010, 2591 title = {{FACETS}: A Framework for Parallel Coupling of Fusion Components}, 2592 author = {J. Cary and A. Hakim and M. Miah and S. Kruger and A. Pletzer and S. Shasharina 2593 and S. Vadlamani and A. Pankin and R. Cohen and T. Epperly and T. Rognlien and R. 2594 Groebner and S. Balay and L. McInnes and H. Zhang}, 2595 booktitle = {Proceedings of Euromicro PDP 2010 (The 18th Euromicro International Conference on 2596 Parallel, Distributed and Network-Based Computing), Pisa, Italy}, 2597 year = {2010}, 2598 petsc_uses = {KSP} 2599} 2600 2601@Article{ carlssoncary09, 2602 author = {Johan Carlsson, John R. Cary}, 2603 title = {The hypersecant {J}acobian approximation for quasi-{N}ewton solves of sparse 2604 nonlinear systems}, 2605 journal = {arXiv}, 2606 year = {2009}, 2607 note = {http://arxiv.org/abs/0905.1054}, 2608 url = {http://arxiv.org/pdf/0905.1054v1}, 2609 petsc_uses = {KSP} 2610} 2611 2612@InProceedings{ oshahjs2006, 2613 author = {F. Ogando and A. Signell and J.A. Heikkinen and M. Aspn\"as and S. Henriksson and 2614 S.J. Janhunen and T.P. Kiviniemi}, 2615 title = {Performance enhancements to {ELMFIRE} gyrokinetic code leading to new ranges of 2616 application}, 2617 booktitle = {33rd EPS Conference on Plasma Phys.}, 2618 year = {2006}, 2619 url = {http://epsppd.epfl.ch/Roma/pdf/P4_153.pdf}, 2620 note = {European fusion code}, 2621 petsc_uses = {KSP} 2622} 2623 2624@Article{ zhu2006, 2625 author = {P. Zhu and A. Bhattacharjee and K. Germaschewski}, 2626 title = {Intermediate nonlinear evolution of the {P}arker instability: Formation of 2627 convection-induced discontinuities and absence of finite-time singularities}, 2628 journal = {Phys. Rev. Lett.}, 2629 volume = {96}, 2630 number = {065001}, 2631 year = {2006}, 2632 doi = {10.1103/PhysRevLett.96.065001}, 2633 petsc_uses = {KSP} 2634} 2635 2636@InProceedings{ ppc2005, 2637 author = {B. Philip and M. Pernice and L.Chacon}, 2638 title = {Solution of Reduced Resistive Magnetohydrodynamics using Implicit Adaptive Mesh 2639 Refinement}, 2640 booktitle = {Proceedings of the 16th International Conference on Domain Decomposition 2641 methods}, 2642 year = {2005}, 2643 lab = {LANL}, 2644 petsc_uses = {KSP} 2645} 2646 2647@Article{ pp2005, 2648 author = {M. Pernice and B. Philip}, 2649 title = {Solution of Equilibrium Radiation Diffusion Problems using Adaptive Mesh 2650 Refinement}, 2651 year = {2005}, 2652 journal = {SIAM J. of Sci. Comput.}, 2653 lab = {LANL}, 2654 petsc_uses = {KSP} 2655} 2656 2657@Article{ gt2004, 2658 author = {A. H. Glasser and X. Z. Tang}, 2659 title = {The {SEL} macroscopic modeling code}, 2660 year = {2004}, 2661 journal = {Computer Physics Communications}, 2662 pages = {237--243}, 2663 volume = {164}, 2664 lab = {LANL}, 2665 petsc_uses = {KSP} 2666} 2667 2668@Article{ nl2006, 2669 author = {Y. Nishimura and Z.Lin}, 2670 title = {A finite element mesh in a tokamak edge geometry}, 2671 year = {2006}, 2672 journal = {Contributions to Plasma Physics}, 2673 volume = {22}, 2674 lab = {PPPL}, 2675 petsc_uses = {KSP} 2676} 2677 2678@Article{ nlle2004, 2679 author = {Y. Nishimura and Z.Lin and J.Lewandowski and S.Ethier}, 2680 title = {A finite element {P}oisson solver for gyrokinetic particle simulations in a global 2681 field aligned mesh}, 2682 year = {2006}, 2683 journal = {J. Comput. Phys.}, 2684 volume = {214}, 2685 pages = {657}, 2686 lab = {PPPL}, 2687 petsc_uses = {KSP} 2688} 2689 2690@InProceedings{ lnlle2004, 2691 author = {J.L.V Lewandowski and Y.Nishimura and W.W.Lee and Z.Lin and S. Ethier}, 2692 title = {Global gyrokinetic Particle-in-cell Simulations with Trapped Electrons}, 2693 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2694 year = {2004}, 2695 url = {http://www.sherwoodtheory.org/sherwood04/program/1e15.pdf}, 2696 lab = {PPPL}, 2697 petsc_uses = {KSP} 2698} 2699 2700@InProceedings{ nlclew2004, 2701 author = {Y. Nishimura and Z.Lin and L.Chen and J.Lewandowski and S.Ethier and W. Wang}, 2702 title = {Electromagnetic gyrokinetic simulation with a fluid-kinetic hybrid electron 2703 model}, 2704 booktitle = {Sherwood Fusion Theory Conference, Missoula, MT}, 2705 year = {2004}, 2706 url = {http://www.sherwoodtheory.org/sherwood04/program/1C32.pdf}, 2707 lab = {PPPL}, 2708 petsc_uses = {KSP} 2709} 2710 2711@Article{ tb1, 2712 author = {X.~Z.~Tang and A.~H.~Boozer}, 2713 title = {Numerical studies of a steady state axisymmetric co-axial helicity injection 2714 plasma}, 2715 journal = {Physics of Plasmas}, 2716 year = {2004}, 2717 pages = {171--185}, 2718 volume = {11}, 2719 lab = {LANL}, 2720 petsc_uses = {KSP} 2721} 2722 2723@Unpublished{ nlcw, 2724 title = {Inclusion of electromagnetic effects into gyrokinetic particle simulations}, 2725 author = {Y. Nishimura and Z.Lin and L.Chen and W. Wang}, 2726 note = {American Physical Society 45th Annual Meeting Division of Plasma Physics, 2727 Albuquerque, New Mexico, October 2003}, 2728 year = {2003}, 2729 petsc_uses = {KSP} 2730} 2731 2732@TechReport{ tang2001, 2733 author = {X. Z. Tang and G. Y. Fu and S. C. Jardin and L. L. Lowe and W. Park and H. R. 2734 Strauss}, 2735 title = {Resistive Magnetohydrodynamics Simulation of Fusion Plasmas}, 2736 year = {2001}, 2737 institution = {Princeton Plasma Physics Laboratory}, 2738 number = {PPPL-3532}, 2739 url = {http://www.pppl.gov/pub_report/2001/PPPL-3532.pdf}, 2740 note = {Presented at 10th Society for Industrial and Applied Mathematics (SIAM) 2741 Conference on Parallel Processing for Scientific Computing, Portsmouth, Virginia, 2742 March 12-14, 2001.}, 2743 lab = {PPPL}, 2744 petsc_uses = {KSP} 2745} 2746 2747% LiteralHTML: 2748% LiteralHTML: <a name="geosciences"><H3><center>Geosciences</center></H3> 2749% LiteralHTML: 2750@Article{ valerathomasgarciacastillo2019, 2751 author = {Manuel Valera and Mary P. Thomas and Mariangel Garcia and Jose E. Castillo}, 2752 title = {Parallel Implementation of a {PETSc-Based} Framework for the General Curvilinear 2753 Coastal Ocean Model}, 2754 journal = {Journal of Marine Science and Engineering}, 2755 volume = {7}, 2756 number = {6}, 2757 article-number= {185}, 2758 url = {https://www.mdpi.com/2077-1312/7/6/185}, 2759 issn = {2077-1312}, 2760 doi = {10.3390/jmse7060185}, 2761 year = {2019}, 2762 petsc_uses = {KSP} 2763} 2764 2765@Article{ furuichimat2015, 2766 title = {Implicit solution of the material transport in Stokes flow simulation: Toward 2767 thermal convection simulation surrounded by free surface}, 2768 author = {Mikito Furuichi and Dave A May}, 2769 journal = {Computer Physics Communications}, 2770 volume = {192}, 2771 pages = {1--11}, 2772 year = {2015}, 2773 petsc_uses = {KSP} 2774} 2775 2776@Article{ sharplesmoresivelicjadamecmay2016, 2777 title = {Simulating faults and plate boundaries with a transversely isotropic plasticity 2778 model}, 2779 author = {Wendy Sharples and Louis N Moresi and Mirko Velic and Margarete A Jadamec and 2780 Dave A May}, 2781 journal = {Physics of the Earth and Planetary Interiors}, 2782 volume = {252}, 2783 pages = {77--90}, 2784 year = {2016}, 2785 petsc_uses = {KSP} 2786} 2787 2788@Article{ spiegelmanmaywilson2016, 2789 title = {On the solvability of incompressible {S}tokes with viscoplastic rheologies in 2790 geodynamics}, 2791 author = {Marc Spiegelman and Dave A May and Cian R Wilson}, 2792 journal = {Geochemistry, Geophysics, Geosystems}, 2793 volume = {17}, 2794 number = {6}, 2795 pages = {2213--2238}, 2796 year = {2016}, 2797 petsc_uses = {KSP} 2798} 2799 2800@Article{ buiteretal2016, 2801 title = {Benchmarking numerical models of brittle thrust wedges}, 2802 author = {Susanne JH Buiter and Guido Schreurs and Markus Albertz and Taras V Gerya and 2803 Boris Kaus and Walter Landry and Laetitia {Le Pourhiet} and Yury Mishin and David 2804 L Egholm and Michele Cooke and Bertrand Maillot and Cedric Thieulot and Tony Crook 2805 and Dave May and Pauline Souloumiac and Christopher Beaumont}, 2806 journal = {Journal of structural geology}, 2807 volume = {92}, 2808 pages = {140--177}, 2809 year = {2016}, 2810 petsc_uses = {KSP} 2811} 2812 2813@Article{ afanasievboehmdrielkrischerrietmannmayknepleyfichtner2019, 2814 title = {Modular and flexible spectral-element waveform modelling in two and three 2815 dimensions}, 2816 author = {Michael Afanasiev and Christian Boehm and Martin van Driel and Lion Krischer and 2817 Max Rietmann and Dave A. May and Matthew G. Knepley and Andreas Fichtner}, 2818 journal = {Geophysical Journal International}, 2819 volume = {216}, 2820 number = {3}, 2821 pages = {1675--1692}, 2822 doi = {10.1093/gji/ggy469}, 2823 year = {2019}, 2824 petsc_uses = {KSP} 2825} 2826 2827@Article{ haplaknepleyafanasievboehmdrielkrischerfichtner2020, 2828 title = {Fully Parallel Mesh {I/O} using {PETSc} {DMPlex} with an Application to Waveform 2829 Modeling}, 2830 author = {Vaclav Hapla and Matthew G. Knepley and Michael Afanasiev and Christian Boehm and 2831 Martin van Driel and Lion Krischer and Andreas Fichtner}, 2832 journal = {SIAM Journal on Scientific Computing}, 2833 volume = {43}, 2834 number = {2}, 2835 pages = {C127--C153}, 2836 eprint = {http://arxiv.org/abs/2004.08729}, 2837 doi = {10.1137/20M1332748}, 2838 year = {2021}, 2839 petsc_uses = {KSP} 2840} 2841 2842@Article{ parsani2021, 2843 title = {High-order accurate entropy-stable discontinuous collocated {G}alerkin methods with 2844 the summation-by-parts property for compressible {CFD} frameworks: Scalable {SSDC} 2845 algorithms and flow solver}, 2846 author = {Matteo Parsani and Radouan Boukharfane and Irving Reyna Nolasco and David C. {Del 2847 Rey Fernández} and Stefano Zampini and Bilel Hadri and Lisandro Dalcin}, 2848 journal = {Journal of Computational Physics}, 2849 volume = {424}, 2850 pages = {109844}, 2851 issn = {0021-9991}, 2852 doi = {https://doi.org/10.1016/j.jcp.2020.109844}, 2853 url = {http://www.sciencedirect.com/science/article/pii/S0021999120306185}, 2854 year = {2021}, 2855 petsc_uses = {KSP} 2856} 2857 2858@Article{ ambartsumyanbouakaramthanhghattaskeyesstadlerturkiyyahzampini2020, 2859 title = {Hierarchical matrix approximations of {Hessians} arising in inverse problems 2860 governed by {PDEs}}, 2861 author = {I. Ambartsumyan and W. Bouakaram and Than Bui-Thanh and Omar Ghattas and David 2862 Keyes and Georg Stadler and George Turkiyyah and Stefano Zampini}, 2863 journal = {SIAM Journal of Scientific Computing}, 2864 volume = {42}, 2865 number = {5}, 2866 pages = {A3397--A3426}, 2867 year = {2020} 2868} 2869 2870@Article{ zampinibouakaramturkiyyahkniokeyes2022, 2871 title = {H2Opus: a distributed memory {multi-GPU} software for non-local operators}, 2872 author = {Stefano Zampini and W. Bouakaram and George Turkiyyah and O. Knio and David E. 2873 Keyes}, 2874 journal = {Advances on Computational Mathematics}, 2875 note = {In press}, 2876 year = {2022} 2877} 2878 2879@Article{ dassizampiniscacchi2022, 2880 title = {Robust and scalable adaptive {BDDC} preconditioners for virtual element 2881 discretizations of elliptic equations in mixed form}, 2882 author = {F. Dassi and Stefano Zampini and S. Scacchi}, 2883 journal = {Computer Methods in Applied Mechanics and Engineering}, 2884 volume = {391}, 2885 pages = {114620}, 2886 year = {2022} 2887} 2888 2889@Article{ youngoppenheimdimant2017, 2890 author = {Matthew A. Young and Meers M. Oppenheim and Yakov S. Dimant}, 2891 title = {Hybrid simulations of coupled {F}arley-{B}uneman/gradient drift instabilities in the 2892 equatorial E region ionosphere}, 2893 journal = {Journal of Geophysical Research: Space Physics}, 2894 volume = {122}, 2895 number = {5}, 2896 issn = {2169-9402}, 2897 doi = {10.1002/2017JA024161}, 2898 pages = {5768--5781}, 2899 year = {2017}, 2900 petsc_uses = {KSP} 2901} 2902 2903@Article{ rioussetpatylillisfillingimenglandwithershale2013, 2904 title = {Three-dimensional multifluid modeling of atmospheric electrodynamics in {M}ars' 2905 dynamo region}, 2906 author = {Jeremy A Riousset and Carol S Paty and Robert J Lillis and Matthew O Fillingim 2907 and Scott L England and Paul G Withers and John P M Hale}, 2908 journal = {Journal of Geophysical Research: Space Physics}, 2909 volume = {118}, 2910 number = {6}, 2911 pages = {3647--3659}, 2912 year = {2013}, 2913 publisher = {Wiley Online Library}, 2914 petsc_uses = {KSP} 2915} 2916 2917@Article{ chien2016representation, 2918 title = {Representation of topography by partial steps using the immersed boundary method 2919 in a vector vorticity equation model (VVM)}, 2920 author = {Chien, Mu-Hua and Wu, Chien-Ming}, 2921 journal = {Journal of Advances in Modeling Earth Systems}, 2922 year = {2016}, 2923 publisher = {Wiley Online Library}, 2924 petsc_uses = {KSP} 2925} 2926 2927@Article{ berger2015parallel, 2928 title = {Parallel preconditioners for monolithic solution of shear bands}, 2929 author = {Berger-Vergiat, Luc and McAuliffe, Colin and Waisman, Haim}, 2930 journal = {Journal of Computational Physics}, 2931 year = {2015}, 2932 publisher = {Elsevier}, 2933 petsc_uses = {KSP} 2934} 2935 2936@Article{ may2015496, 2937 title = {A scalable, matrix-free multigrid preconditioner for finite element 2938 discretizations of heterogeneous {S}tokes flow }, 2939 journal = {Computer Methods in Applied Mechanics and Engineering }, 2940 volume = {290}, 2941 number = {0}, 2942 pages = {496--523}, 2943 year = {2015}, 2944 issn = {0045-7825}, 2945 doi = {10.1016/j.cma.2015.03.014}, 2946 author = {D.A. May and J. Brown and L. {Le Pourhiet}}, 2947 petsc_uses = {KSP} 2948} 2949 2950@Article{ isaacknepley2017, 2951 title = {Support for Non-conformal Meshes in {PETSc}'s {DMPlex} Interface}, 2952 author = {Tobin Isaac and Matthew G. Knepley}, 2953 journal = {ArXiv e-prints}, 2954 eprint = {1508.02470}, 2955 year = {2017}, 2956 note = {\url{http://arxiv.org/abs/1508.02470}}, 2957 petsc_uses = {DMPlex} 2958}} 2959 2960@Article{ knepleylangegorman2017, 2961 title = {Unstructured Overlapping Mesh Distribution in Parallel}, 2962 author = {Matthew G. Knepley and Michael Lange and Gerard J. Gorman}, 2963 journal = {ArXiv e-prints}, 2964 eprint = {1506.06194}, 2965 year = {2017}, 2966 note = {\url{http://arxiv.org/abs/1506.06194}}, 2967 petsc_uses = {DMPlex} 2968} 2969 2970@Article{ langemitchellknepleygorman2015, 2971 title = {Efficient mesh management in {Firedrake} using {PETSc-DMPlex}}, 2972 author = {Michael Lange and Lawrence Mitchell and Matthew G. Knepley and Gerard J. Gorman}, 2973 journal = {SIAM Journal on Scientific Computing}, 2974 volume = {38}, 2975 number = {5}, 2976 pages = {S143--S155}, 2977 eprint = {http://arxiv.org/abs/1506.07749}, 2978 doi = {10.1137/15M1026092}, 2979 year = {2016}, 2980 petsc_uses = {DMPlex} 2981} 2982 2983@InProceedings{ langeknepleygorman2015, 2984 title = {Flexible, Scalable Mesh and Data Management using {PETSc DMPlex}}, 2985 author = {Michael Lange and Matthew G. Knepley and Gerard J. Gorman}, 2986 booktitle = {Proceedings of the Exascale Applications and Software Conference}, 2987 month = apr, 2988 url = {http://www.easc2015.ed.ac.uk/sites/default/files/attachments/EASC15Proceedings.pdf}, 2989 year = {2015}, 2990 petsc_uses = {DMPlex} 2991} 2992 2993@InProceedings{ wallworkknepleybarralpiggott2022, 2994 title = {Parallel Metric-Based Mesh Adaptation in {PETSc} using {ParMmg}}, 2995 author = {Joseph G. Wallwork and Matthew G. Knepley and Nicolas Barral and Matthew D. 2996 Piggott}, 2997 booktitle = {SIAM International Meshing Roundtable Workshop 2022}, 2998 editor = {Trevor Robinson}, 2999 month = jan, 3000 address = {Seattle, WA}, 3001 pages = {1--5}, 3002 url = {http://imr.sandia.gov/papers/imr31/2026_imr31RJ_Wallwork.pdf}, 3003 year = {2022}, 3004 petsc_uses = {DMPlex} 3005} 3006 3007@InProceedings{ timalsinaknepley2023, 3008 title = {Tetrahedralization of a Hexahedral Mesh}, 3009 author = {Aman Timalsina and Matthew G. Knepley}, 3010 booktitle = {SIAM International Meshing Roundtable Workshop 2023}, 3011 year = {2023}, 3012 petsc_uses = {DMPlex} 3013} 3014 3015@Article{ farrellknepleywechsungmitchell2020, 3016 title = {{PCPATCH}: software for the topological construction of multigrid relaxation 3017 methods}, 3018 author = {Patrick E Farrell and Matthew G Knepley and Lawrence Mitchell and Florian 3019 Wechsung}, 3020 journal = {ACM Transaction on Mathematical Software}, 3021 eprint = {http://arxiv.org/abs/1912.08516}, 3022 volume = {47}, 3023 number = {3}, 3024 pages = {1--22}, 3025 year = {2021}, 3026 petsc_uses = {KSP,DMPlex} 3027} 3028 3029@Article{ farrellmitchellscottwechsung2022, 3030 title = {Robust multigrid methods for nearly incompressible elasticity using macro 3031 elements}, 3032 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 3033 Wechsung}, 3034 journal = {IMA Journal of Numerical Analysis}, 3035 issn = {0272-4979}, 3036 doi = {10.1093/imanum/drab083}, 3037 url = {https://doi.org/10.1093/imanum/drab083}, 3038 year = {2022}, 3039 petsc_uses = {KSP,DMPlex} 3040} 3041 3042@Misc{ firedrakeproject, 3043 title = {{The {F}iredrake project}}, 3044 author = {David A Ham and Firedrake Team}, 3045 url = {http://firedrakeproject.org}, 3046 year = {2022}, 3047 petsc_uses = {KSP} 3048} 3049 3050@Article{ rathgeberhammitchelllangeluporinimcraeberceamarkallkelly2016, 3051 title = {Firedrake: automating the finite element method by composing abstractions}, 3052 author = {Florian Rathgeber and David A Ham and Lawrence Mitchell and Michael Lange and 3053 Fabio Luporini and Andrew TT McRae and Gheorghe-Teodor Bercea and Graham R Markall 3054 and Paul HJ Kelly}, 3055 journal = {ACM Transactions on Mathematical Software (TOMS)}, 3056 volume = {43}, 3057 number = {3}, 3058 pages = {24}, 3059 year = {2016}, 3060 petsc_uses = {KSP} 3061} 3062 3063@Article{ mitchellmuller2016, 3064 title = {High level implementation of geometric multigrid solvers for finite element 3065 problems: Applications in atmospheric modelling}, 3066 author = {Lawrence Mitchell and Eike Hermann M{\"u}ller}, 3067 journal = {Journal of Computational Physics}, 3068 volume = {327}, 3069 pages = {1--18}, 3070 year = {2016}, 3071 petsc_uses = {KSP} 3072} 3073 3074@Article{ mcraeberceamitchellhamcotter2016, 3075 title = {Automated generation and symbolic manipulation of tensor product finite 3076 elements}, 3077 author = {Andrew TT McRae and Gheorghe-Teodor Bercea and Lawrence Mitchell and David A Ham 3078 and Colin J Cotter}, 3079 journal = {SIAM Journal on Scientific Computing}, 3080 volume = {38}, 3081 number = {5}, 3082 pages = {S25--S47}, 3083 year = {2016}, 3084 petsc_uses = {KSP} 3085} 3086 3087@Article{ berceamcraehammitchellrathgebernardiluporinikelly2016, 3088 title = {A structure-exploiting numbering algorithm for finite elements on extruded 3089 meshes, and its performance evaluation in {Firedrake}}, 3090 author = {Gheorghe-Teodor Bercea and Andrew TT McRae and David A Ham and Lawrence Mitchell 3091 and Florian Rathgeber and L. Nardi and Fabio Luporini and Paul HJ Kelly}, 3092 journal = {Geoscientific Model Development}, 3093 volume = {9}, 3094 number = {10}, 3095 pages = {3803--3815}, 3096 doi = {10.5194/gmd-9-3803-2016}, 3097 year = {2016}, 3098 petsc_uses = {KSP} 3099} 3100 3101@InProceedings{ markallrathgebermitchellloriantbertollihamkelly2013, 3102 author = {Graham R. Markall and Florian Rathgeber and Lawrence Mitchell and Nicolas Loriant 3103 and Carlo Bertolli and David A. Ham and Paul HJ Kelly}, 3104 editor = {Julian Martin Kunkel and Thomas Ludwig and Hans Werner Meuer}, 3105 title = {Performance-Portable Finite Element Assembly Using {PyOP2} and {FEniCS}}, 3106 booktitle = {Proceedings of 28th International Supercomputing Conference, ISC 2013}, 3107 publisher = {Springer Berlin Heidelberg}, 3108 pages = {279--289}, 3109 isbn = {978-3-642-38750-0}, 3110 doi = {10.1007/978-3-642-38750-0_21}, 3111 year = {2013}, 3112 petsc_uses = {KSP} 3113} 3114 3115@Article{ kirbymitchell2017, 3116 title = {Solver composition across the {PDE}/linear algebra barrier}, 3117 author = {Robert C Kirby and Lawrence Mitchell}, 3118 journal = {arXiv preprint arXiv:1706.01346}, 3119 year = {2017}, 3120 petsc_uses = {KSP} 3121} 3122 3123@Article{ saibaba2012application, 3124 title = {Application of hierarchical matrices to linear inverse problems in 3125 geostatistics}, 3126 author = {Saibaba, Arvind Krishna and Ambikasaran, Sivaram and Yue Li, J and Kitanidis, 3127 Peter K and Darve, Eric F}, 3128 journal = {Oil and Gas Science and Technology-Revue de l'IFP-Institut Francais du Petrole}, 3129 volume = {67}, 3130 number = {5}, 3131 pages = {857}, 3132 year = {2012}, 3133 petsc_uses = {KSP} 3134} 3135 3136@Article{ collignonkausmayfernandez14, 3137 author = {Collignon, M. and Kaus, B. and May, D.A. and Fern\'andez, N.}, 3138 title = {Influences of surface processes on fold growth during {3-D} detachment folding}, 3139 journal = {Geochem Geophy Geosy}, 3140 year = {2014}, 3141 petsc_uses = {KSP} 3142} 3143 3144@Article{ fernandezkaus14, 3145 author = {Fern\'andez, N. and Kaus, B.}, 3146 title = {Fold interaction and wavelength selection in {3D} models of multilayer detachment 3147 folding}, 3148 journal = {Tectonophysics}, 3149 year = {2014}, 3150 petsc_uses = {KSP} 3151} 3152 3153@Article{ baumannkauspopov14, 3154 author = {Baumann, T. and Kaus, B. J. P. and Popov, A.}, 3155 title = {Constraining effective rheology through parallel joint geodynamic inversion}, 3156 journal = {Tectonophysics}, 3157 year = {2014}, 3158 petsc_uses = {KSP} 3159} 3160 3161@Article{ lechmannschmalholzhetenyimaykaus14, 3162 author = {Lechmann, S. M. and Schmalholz, S. M. and Hetenyi, G. and May, D. A. and Kaus, B. 3163 J. P.}, 3164 title = {Quantifying the impact of mechanical layering and underthrusting on the dynamics 3165 of the modern {India-Asia} collisional system with {3-D} numerical models}, 3166 journal = { Journal of Geophysical Research - Solid Earth}, 3167 year = {2014}, 3168 petsc_uses = {KSP} 3169} 3170 3171@InBook{ fernandezkaus14b, 3172 author = {Fern\'andez N. and Kaus B.J.P.}, 3173 title = {Analytical and numerical investigation of {3D} multilayer detachment}, 3174 booktitle = {Mathematics of Planet Earth}, 3175 editor = {Pardo-Ig\'uzquiza E. and Guardiola-Albert C. and Heredia J. and Moreno-Merino L. 3176 and Dur\'an J.J. and Vargas-Guzman J.A.}, 3177 publisher = {Springer}, 3178 year = {2014}, 3179 petsc_uses = {KSP} 3180} 3181 3182@Article{ hossein-hsueh-etal-2014a, 3183 author = {Hossein, M.Z. and Hsueh, C.-J. and Bourdin, B. and Bhattacharya, K.}, 3184 journal = {J. Mech. Phys. Solids}, 3185 pages = {320--348}, 3186 title = {Effective toughness of heterogeneous media}, 3187 volume = {71}, 3188 year = {2014}, 3189 petsc_uses = {KSP} 3190} 3191 3192@Unpublished{ leon-baldelli-bourdin-2014a, 3193 author = {Le\'{o}n Baldelli, A.A. and Bourdin, B.}, 3194 month = aug, 3195 note = {Submitted.}, 3196 title = {On the asymptotic derivation of Winkler-type energies from {3D} elasticity}, 3197 year = {2014}, 3198 petsc_uses = {KSP} 3199} 3200 3201@Article{ leon-baldelli-babadjian-etal-2013a, 3202 author = {Leòn-Baldelli, A. A. and Babadjian, J.-F. and Bourdin, B. and Henao, D. and 3203 Maurini, C.}, 3204 journal = {J. Mech. Phys. Solids}, 3205 pages = {15-32}, 3206 title = {A Variational Model For Fracture And Delamination Of Thin Films}, 3207 volume = {70}, 3208 year = {2014}, 3209 petsc_uses = {KSP} 3210} 3211 3212@Article{ mesgarnejad-bourdin-etal-2014a, 3213 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M. M.}, 3214 journal = {Comp. Methods Appl. Mech. Engng.}, 3215 title = {Validation simulations for the variational approach to fracture}, 3216 volume = {Submitted}, 3217 year = {2014}, 3218 petsc_uses = {KSP} 3219} 3220 3221@InProceedings{ bourdin-chukwudozie-etal-2013a, 3222 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3223 booktitle = {Proceedings of the 38th Workshop on Geothermal Reservoir Engineering Stanford 3224 University, Stanford, CA}, 3225 title = {A Variational Approach To The Modeling And Numerical Simulation Of Hydraulic 3226 Fracturing Under In-Situ Stresses}, 3227 year = {2013}, 3228 petsc_uses = {KSP} 3229} 3230 3231@Article{ maurini-bourdin-etal-2012a, 3232 author = {Maurini, C. and Bourdin, B. and Gauthier, G. and Lazarus, V.}, 3233 journal = {Int. J. Fracture}, 3234 number = {1-2}, 3235 pages = {75-91}, 3236 title = {Crack patterns obtained by unidirectional drying of a colloidal suspension in a 3237 capillary tube: experiments and numerical simulations using a two-dimensional 3238 variational approach}, 3239 volume = {184}, 3240 year = {2013}, 3241 petsc_uses = {KSP} 3242} 3243 3244@Article{ mesgarnejad-bourdin-etal-2013a, 3245 author = {Mesgarnejad, A. and Bourdin, B. and Khonsari, M.M.}, 3246 journal = {J. Mech. Phys Solids}, 3247 number = {11}, 3248 pages = {2360--2379}, 3249 title = {A variational approach to the fracture of brittle thin films under out of plane 3250 loading}, 3251 volume = {61}, 3252 year = {2013}, 3253 petsc_uses = {KSP} 3254} 3255 3256@InProceedings{ bourdin-chukwudozie-etal-2012a, 3257 author = {Bourdin, B. and Chukwudozie, C. and Yoshioka, K.}, 3258 booktitle = {Proceedings of the 2012 SPE Annual Technical Conference and Exhibition}, 3259 title = {A Variational Approach to the Numerical Simulation of Hydraulic Fracturing}, 3260 volume = {SPE 159154}, 3261 year = {2012}, 3262 petsc_uses = {KSP} 3263} 3264 3265@Article{ millerdawsonfarthinghouhuangkeeskelleylangtangen13, 3266 author = {Cass T. Miller and Clint N. Dawson and Matthew W. Farthing and Thomas Y. Hou and 3267 Jingfang Huang and Christopher E. Kees and C.T. Kelley and Hans Petter 3268 Langtangen}, 3269 title = {Numerical simulation of water resources problems: Models, methods, and trends}, 3270 journal = {Advances in Water Resources}, 3271 volume = {51}, 3272 number = {0}, 3273 pages = {405--437}, 3274 year = {2013}, 3275 note = {35th Year Anniversary Issue}, 3276 issn = {0309-1708}, 3277 doi = {10.1016/j.advwatres.2012.05.008}, 3278 petsc_uses = {KSP} 3279} 3280 3281@Article{ scheltingamyerspietrzak10, 3282 author = {Terwisscha van Scheltinga, ArjenD. and Myers, PaulG. and Pietrzak, JulieD.}, 3283 title = {A finite element sea ice model of the {C}anadian Arctic Archipelago}, 3284 journal = {Ocean Dynamics}, 3285 volume = {60}, 3286 number = {6}, 3287 pages = {1539-1558}, 3288 year = {2010}, 3289 issn = {1616-7341}, 3290 doi = {10.1007/s10236-010-0356-5}, 3291 publisher = {Springer-Verlag}, 3292 keywords = {Ocean modelling; Unstructured meshes; Sea ice; Arctic Ocean; Canadian Arctic 3293 Archipelago; Freshwater flux}, 3294 language = {English}, 3295 petsc_uses = {KSP} 3296} 3297 3298@InBook{ destefanoandreasisecchi13, 3299 author = {M. De Stefano and F. Golfré Andreasi and A. Secchi}, 3300 title = {Towards preconditioned nonlinear conjugate gradients for generic geophysical 3301 inversions}, 3302 booktitle = {SEG Technical Program Expanded Abstracts 2013}, 3303 chapter = {626}, 3304 pages = {3226--3230}, 3305 doi = {10.1190/segam2013-0244.1}, 3306 url = {http://library.seg.org/doi/abs/10.1190/segam2013-0244.1}, 3307 eprint = {http://library.seg.org/doi/pdf/10.1190/segam2013-0244.1}, 3308 petsc_uses = {KSP} 3309} 3310 3311@Article{ pourhiethuetmaylabroussejolivet12, 3312 author = {L. {Le Pourhiet} and B. Huet and D. A. May and L. Labrousse and L. Jolivet}, 3313 title = {Kinematic interpretation of the {3D} shapes of metamorphic core complexes}, 3314 journal = {Geochem. Geophys. Geosyst.}, 3315 volume = {13}, 3316 pages = {Q09002}, 3317 year = {2012}, 3318 doi = {10.1029/2012GC004271}, 3319 petsc_uses = {KSP} 3320} 3321 3322@Article{ lechmannmaykausschmalholz11, 3323 author = {S. M. Lechmann and D. A. May and B. J. P. Kaus and S. M. Schmalholz}, 3324 title = {Comparing thin-sheet models with {3-D} multilayer models for continental 3325 collision}, 3326 journal = {Geophysical Journal International}, 3327 volume = {187}, 3328 pages = {10--33}, 3329 year = {2011}, 3330 doi = {10.1111/j.1365-246X.2011.05164.x}, 3331 petsc_uses = {KSP} 3332} 3333 3334@Article{ stefano:r69, 3335 author = {Michele De Stefano and Federico Golfr\'{e} Andreasi and Simone Re and Massimo 3336 Virgilio and Fred F. Snyder}, 3337 collaboration = {}, 3338 title = {Multiple-domain, simultaneous joint inversion of geophysical data with 3339 application to subsalt imaging}, 3340 publisher = {SEG}, 3341 year = {2011}, 3342 journal = {Geophysics}, 3343 volume = {76}, 3344 number = {3}, 3345 pages = {R69-R80}, 3346 keywords = {geophysical image processing; inverse problems; seismology}, 3347 doi = {10.1190/1.3554652}, 3348 petsc_uses = {KSP} 3349} 3350 3351@Article{ stefano:806, 3352 author = {Michele De Stefano}, 3353 collaboration = {}, 3354 title = {Simultaneous joint inversion for susceptibility and velocity}, 3355 publisher = {SEG}, 3356 year = {2011}, 3357 journal = {SEG Technical Program Expanded Abstracts}, 3358 volume = {30}, 3359 number = {1}, 3360 pages = {806-810}, 3361 keywords = {3D; imaging; inversion; magnetics; multiparameter}, 3362 doi = {10.1190/1.3628198}, 3363 petsc_uses = {KSP} 3364} 3365 3366@Article{ mayknepley2011, 3367 author = {Dave A. May and Matthew G. Knepley}, 3368 title = {Optimal, scalable forward models for computing gravity anomalies}, 3369 journal = {Geophysical Journal International}, 3370 volume = {187}, 3371 number = {1}, 3372 pages = {161--177}, 3373 url = {http://arxiv.org/abs/1107.5951}, 3374 note = {\url{http://arxiv.org/abs/1107.5951}}, 3375 year = {2011}, 3376 petsc_uses = {KSP} 3377} 3378 3379@InProceedings{ bourdinknepleymaurini2010, 3380 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3381 title = {Numerical Simulation of Reservoir Stimulation - A Variational Approach}, 3382 booktitle = {Proceedings of the 37th Stanford Geothermal Workshop}, 3383 url = {https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}, 3384 note = {\url{https://es.stanford.edu/ERE/pdf/IGAstandard/SGW/2011/bourdin.pdf}}, 3385 address = {Stanford, CA}, 3386 year = {2010}, 3387 petsc_uses = {KSP} 3388} 3389 3390@InProceedings{ bourdinknepleymaurini2010b, 3391 author = {Blaise Bourdin and Matthew G. Knepley and C. Maurini}, 3392 title = {Secondary Thermal Cracks in {EGS}: a Variational Approach}, 3393 booktitle = {Proceedings of the 34th Annual Meeting of the Geothermal Resources Council}, 3394 url = {https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}, 3395 note = {\url{https://www.math.lsu.edu/~bourdin/Biography_assets/Bourdin-Knepley-Maurini-2010.pdf}}, 3396 address = {Sacramento, CA}, 3397 year = {2010}, 3398 petsc_uses = {KSP} 3399} 3400 3401@Article{ chen2007full, 3402 title = {Full {3D} tomography for the crustal structure of the {Los Angeles} region}, 3403 author = {Chen, P. and Zhao, L. and Jordan, T.H.}, 3404 journal = {Bulletin of the Seismological Society of America}, 3405 volume = {97}, 3406 number = {4}, 3407 pages = {1094}, 3408 year = {2007}, 3409 publisher = {Seismol Soc America}, 3410 petsc_uses = {KSP} 3411} 3412 3413@Article{ brown2010ens, 3414 author = {Brown, Jed}, 3415 affiliation = {Versuchsanstalt für Wasserbau, Hydrologie und Glaziologie (VAW), ETH Zürich, 3416 Zürich, Switzerland}, 3417 title = {Efficient Nonlinear Solvers for Nodal High-Order Finite Elements in {3D}}, 3418 journal = {Journal of Scientific Computing}, 3419 publisher = {Springer Netherlands}, 3420 issn = {0885-7474}, 3421 keyword = {Mathematics and Statistics}, 3422 pages = {48-63}, 3423 volume = {45}, 3424 issue = {1}, 3425 doi = {10.1007/s10915-010-9396-8}, 3426 year = {2010}, 3427 petsc_uses = {KSP} 3428} 3429 3430@PhDThesis{ brown2011, 3431 title = {Computational methods for ice flow simulation}, 3432 author = {Jed Brown}, 3433 school = {ETH Z{\"u}rich}, 3434 year = {2011}, 3435 petsc_uses = {KSP} 3436} 3437 3438@Article{ brown2013tmeice, 3439 title = {Achieving textbook multigrid efficiency for hydrostatic ice flow}, 3440 author = {Jed Brown and Barry F. Smith and Aron Ahmadia}, 3441 journal = {SIAM Journal on Scientific Computing}, 3442 volume = {35}, 3443 number = {2}, 3444 year = {2013}, 3445 pages = {359--375}, 3446 doi = {10.1137/110834512}, 3447 note = {Also preprint ANL/MCS-P743-1298}, 3448 petsc_uses = {KSP} 3449} 3450 3451@InProceedings{ brown2013quasinewton, 3452 author = {Jed Brown and Peter Brune}, 3453 title = {Low-rank quasi-{N}ewton updates for robust {J}acobian lagging in {N}ewton-type 3454 methods}, 3455 year = {2013}, 3456 booktitle = {International Conference on Mathematics and Computational Methods Applied to 3457 Nuclear Science and Engineering}, 3458 pages = {2554--2565}, 3459 petsc_uses = {KSP} 3460} 3461 3462@Misc{ spiegelman-siampp10, 3463 title = {Block Preconditioners and Advanced Software for Multiphysics Problems in Solid 3464 Earth Geodynamics}, 3465 author = {Marc Spiegelman}, 3466 note = {presentation at the 2010 SIAM Conference on Parallel Processing for Scientific 3467 Computing}, 3468 year = {2010}, 3469 petsc_uses = {KSP} 3470} 3471 3472@Article{ schauer2011a, 3473 author = {Marco Schauer and Sabine Langer and Jose E. Roman and Enrique S. 3474 Quintana-Ort\'{\i}}, 3475 title = {Large scale simulation of wave propagation in soils interacting with structures 3476 using {FEM} and {SBFEM}}, 3477 journal = {Journal of Computational Acoustics}, 3478 volume = {19}, 3479 number = {1}, 3480 pages = {75--93}, 3481 year = {2011}, 3482 doi = {10.1142/S0218396X11004316}, 3483 petsc_uses = {KSP} 3484} 3485 3486@Misc{ bsa2010, 3487 author = {J. Brown and B. Smith and A. Ahmadia}, 3488 title = {Achieving textbook multigrid efficiency for hydrostatic ice sheet flow}, 3489 note = {submitted to SIAM Journal on Scientific Computing}, 3490 year = {2012}, 3491 petsc_uses = {KSP} 3492} 3493 3494@Article{ kellerkatz2016, 3495 title = {The Role of Volatiles in Reactive Melt Transport in the Asthenosphere}, 3496 author = {Tobias Keller and Richard F. Katz}, 3497 journal = {Journal of Petrology}, 3498 doi = {10.1093/petrology/egw030}, 3499 url = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.abstract}, 3500 eprint = {http://petrology.oxfordjournals.org/content/early/2016/07/15/petrology.egw030.full.pdf+html}, 3501 year = {2016}, 3502 petsc_uses = {KSP} 3503} 3504 3505@Article{ weatherley12, 3506 author = {S. Weatherley and R.F. Katz}, 3507 title = {Melting and channelized magmatic flow in chemically heterogeneous, upwelling 3508 mantle}, 3509 journal = {Geochem.\ Geophys.\ Geosys.}, 3510 year = {2012}, 3511 volume = {13}, 3512 number = {1}, 3513 pages = {Q0AC18}, 3514 doi = {10.1029/2011GC003989}, 3515 petsc_uses = {KSP} 3516} 3517 3518@Article{ katz12, 3519 author = {R.F. Katz and S. Weatherley}, 3520 title = {Consequences of mantle heterogeneity for melt extraction at mid-ocean ridges}, 3521 journal = {Earth\ Planet.\ Sci.\ Lett.}, 3522 year = {2012}, 3523 doi = {10.1016/j.epsl.2012.04.042}, 3524 volume = {335-336}, 3525 pages = {226-237}, 3526 petsc_uses = {KSP} 3527} 3528 3529@Article{ katz10b, 3530 author = {R.F. Katz}, 3531 title = {Porosity-driven convection and asymmetry beneath mid-ocean ridges}, 3532 journal = {Geochem.\ Geophys.\ Geosys.}, 3533 volume = {10}, 3534 number = {Q0AC07}, 3535 year = {2010}, 3536 doi = {10.1029/2010GC003282}, 3537 petsc_uses = {KSP} 3538} 3539 3540@Article{ england10, 3541 author = {P.C. England and R.F. Katz}, 3542 title = {Melting above the anhydrous solidus controls the location of volcanic arcs}, 3543 journal = {Nature}, 3544 year = {2010}, 3545 volume = {467}, 3546 pages = {700--703}, 3547 doi = {10.1038/nature09417}, 3548 petsc_uses = {KSP} 3549} 3550 3551@Article{ weatherley10, 3552 author = {S. Weatherley and R.F. Katz}, 3553 title = {Plate-Driven Mantle Dynamics and Global Patterns of Mid-Ocean Ridge Bathymetry}, 3554 journal = {Geochem.\ Geophys.\ Geosys.}, 3555 year = {2010}, 3556 volume = {11}, 3557 number = {10}, 3558 doi = {10.1029/2010GC003192}, 3559 petsc_uses = {KSP} 3560} 3561 3562@Article{ katz10, 3563 author = {R.F. Katz and M.G. Worster}, 3564 title = {The stability of ice-sheet grounding lines}, 3565 journal = {Proc.~Roy.~Soc.~A}, 3566 year = {2010}, 3567 volume = {466}, 3568 pages = {1597--1620}, 3569 doi = {10.1098/rspa.2009.0434}, 3570 url = {http://www.earth.ox.ac.uk/~richardk/publications/Katz_Worster_PRSA10.pdf}, 3571 petsc_uses = {KSP} 3572} 3573 3574@Article{ kyrkesmith2013stress, 3575 title = {Stress balances of ice streams in a vertically integrated, higher-order 3576 formulation}, 3577 author = {Kyrke-Smith, T.M. and Katz, R.F. and Fowler, A.C.}, 3578 journal = {Journal of Glaciology}, 3579 volume = {59}, 3580 number = {215}, 3581 pages = {449--466}, 3582 year = {2013}, 3583 doi = {10.3189/2013JoG12J140}, 3584 petsc_uses = {KSP} 3585} 3586 3587@Article{ takei2013anisotropy1, 3588 author = {Takei Y. and R.F. Katz}, 3589 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 1. 3590 Governing equations and linearised analysis}}, 3591 journal = {J.\ Fluid\ Mech.}, 3592 year = {2013}, 3593 volume = {734}, 3594 pages = {424-455}, 3595 doi = {10.1017/jfm.2013.482}, 3596 petsc_uses = {KSP} 3597} 3598 3599@Article{ katz2013anisotropy2, 3600 author = {Katz R.F. and Y. Takei}, 3601 title = {{Consequences of viscous anisotropy in a deforming, two-phase aggregate: 2. 3602 Numerical solutions of the full equations}}, 3603 journal = {J.\ Fluid\ Mech.}, 3604 year = {2013}, 3605 volume = {734}, 3606 pages = {456-485}, 3607 doi = {10.1017/jfm.2013.483}, 3608 petsc_uses = {KSP} 3609} 3610 3611@Article{ kyrke-smith2014subglacial, 3612 author = {Kyrke-Smith, T.M. and R.F. Katz and A.C. Fowler}, 3613 title = {Subglacial hydrology and the formation of ice streams}, 3614 journal = {Proc.\ Roy.\ Soc.\ A}, 3615 year = {2014}, 3616 volume = {470}, 3617 number = {2161}, 3618 doi = {10.1098/rspa.2013.0494}, 3619 petsc_uses = {KSP} 3620} 3621 3622@Article{ spiegelmanwilsonvankeken2013, 3623 author = {{Spiegelman}, M.~W. and {Wilson}, C.~R. and {Van Keken}, P.~E. }, 3624 title = {{TerraFERMA: The Transparent Finite Element Rapid Model Assembler for 3625 multi-physics problems in the solid Earth sciences}}, 3626 journal = {AGU Fall Meeting Abstracts}, 3627 keywords = {0560 COMPUTATIONAL GEOPHYSICS Numerical solutions, 1902 INFORMATICS Community 3628 modeling frameworks, 1906 INFORMATICS Computational models, algorithms}, 3629 year = {2013}, 3630 month = dec, 3631 pages = {A2208}, 3632 adsurl = {http://adsabs.harvard.edu/abs/2013AGUFMDI31A2208S}, 3633 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 3634 petsc_uses = {KSP} 3635} 3636 3637@Article{ bueler2009shallow, 3638 title = {{Shallow shelf approximation as a ``sliding law'' in a thermomechanically coupled 3639 ice sheet model}}, 3640 author = {Ed Bueler and Jed Brown}, 3641 journal = {Journal of Geophysical Research-Earth Surface}, 3642 volume = {114}, 3643 number = {F3}, 3644 pages = {F03008}, 3645 year = {2009}, 3646 publisher = {American Geophysical Union}, 3647 petsc_uses = {KSP} 3648} 3649 3650@Article{ bueler2007est, 3651 title = {{Exact solutions to the thermomechanically coupled shallow ice approximation: 3652 effective tools for verification}}, 3653 author = {Ed Bueler and Jed Brown and Craig Lingle}, 3654 journal = {J. Glaciol}, 3655 volume = {53}, 3656 pages = {499--516}, 3657 year = {2007}, 3658 petsc_uses = {KSP} 3659} 3660 3661@Article{ bueler2007fcv, 3662 title = {{Fast computation of a viscoelastic deformable Earth model for ice-sheet 3663 simulations}}, 3664 author = {Ed Bueler and Craig S. Lingle and Jed Brown}, 3665 journal = {Ann. Glaciol}, 3666 volume = {46}, 3667 pages = {97--105}, 3668 year = {2007}, 3669 petsc_uses = {KSP} 3670} 3671 3672@Article{ bueler2005iso, 3673 author = {Ed Bueler and Craig S. Lingle and Jed A. Kallen-Brown and David N. Covey and 3674 Latrice N. Bowman}, 3675 title = {Exact solutions and numerical verification for isothermal ice sheets}, 3676 journal = {J. Glaciol.}, 3677 volume = {51}, 3678 number = {173}, 3679 pages = {291--306}, 3680 year = {2005}, 3681 petsc_uses = {KSP} 3682} 3683 3684@Article{ chao2008programming, 3685 title = {{Programming on Numerical Simulation of Tsunami with PETSc and FEPG}}, 3686 author = {Chao-fan, Z. and Yao-lin, S.}, 3687 journal = {Earthquake}, 3688 year = {2008}, 3689 petsc_uses = {KSP} 3690} 3691 3692@Article{ marti2014, 3693 author = {Marti, P. and Schaeffer, N. and Hollerbach, R. and Cébron, D. and Nore, C. and 3694 Luddens, F. and Guermond, J.-L. and Aubert, J. and Takehiro, S. and Sasaki, Y. and 3695 Hayashi, Y.-Y. and Simitev, R. and Busse, F. and Vantieghem, S. and Jackson, A.}, 3696 title = {Full sphere hydrodynamic and dynamo benchmarks}, 3697 journal = {Geophysical Journal International}, 3698 year = {2014}, 3699 doi = {10.1093/gji/ggt518}, 3700 url = {http://gji.oxfordjournals.org/content/early/2014/01/26/gji.ggt518.abstract}, 3701 petsc_uses = {KSP} 3702} 3703 3704@InProceedings{ ganfulukyangxueyang2013, 3705 author = {Gan, Lin and Fu, Haohuan and Luk, Wayne and Yang, Chao and Xue, Wei and Yang, 3706 Guangwen}, 3707 title = {Global Atmospheric Simulation on a Reconfigurable Platform}, 3708 booktitle = {Proceedings of the 2013 IEEE 21st Annual International Symposium on 3709 Field-Programmable Custom Computing Machines}, 3710 series = {FCCM '13}, 3711 pages = {230--}, 3712 year = {2013}, 3713 isbn = {978-0-7695-4969-9}, 3714 doi = {10.1109/FCCM.2013.26}, 3715 acmid = {2495688}, 3716 publisher = {IEEE Computer Society}, 3717 petsc_uses = {KSP} 3718} 3719 3720@InProceedings{ ganfuchaolukxuemencerhuangyang2014, 3721 author = {Lin Gan and Haohuan Fu and Chao Yang and Luk, W. and Wei Xue and Mencer, O. and 3722 Xiaomeng Huang and Guangwen Yang}, 3723 booktitle = {Field Programmable Logic and Applications (FPL), 2014 24th International 3724 Conference on}, 3725 title = {A highly-efficient and green data flow engine for solving {E}uler atmospheric 3726 equations}, 3727 year = {2014}, 3728 month = sep, 3729 pages = {1-6}, 3730 doi = {10.1109/FPL.2014.6927462}, 3731 petsc_uses = {KSP} 3732} 3733 3734%Aagaard, B., Williams, C., Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), EarthScope National Meeting, Austin, Texas, May 17–20. 3735%Aagaard, B., Williams, C., and Knepley, M. (2011). PyLith: A finite-element code for modeling quasi-static and dynamic crustal deformation (abstract), Southern California Earthquake Center Annual Meeting, Palm Springs, California, September 11–14. 3736%Aagaard, B., Williams, C., and Knepley, M. (2012). PyLith: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal Deformation (abstract), Seismological Society of America Annual Meeting, San Diego, California, April 17-19. 3737@Article{ aagaardknepleywilliams13, 3738 title = {A Domain Decomposition Approach to Implementing Fault Slip in Finite-Element 3739 Models of Quasi-static and Dynamic Crustal Deformation}, 3740 author = {Brad T. Aagaard and Matthew G. Knepley and Charles A. Williams}, 3741 journal = {Journal of Geophysical Research: Solid Earth}, 3742 volume = {118}, 3743 number = {6}, 3744 pages = {3059--3079}, 3745 issn = {2169-9356}, 3746 doi = {10.1002/jgrb.50217}, 3747 keywords = {fault slip, finite-element modeling, crustal deformation, earthquake physics}, 3748 year = {2013}, 3749 petsc_uses = {KSP} 3750} 3751 3752@InProceedings{ aagaardknepleywilliams11, 3753 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3754 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3755 Deformation}, 3756 booktitle = {Eos Transactions of the AGU}, 3757 organization = {American Geophysical Union}, 3758 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 3759 year = {2011}, 3760 petsc_uses = {KSP} 3761} 3762 3763@InProceedings{ knepley10b, 3764 author = {Matthew G. {Knepley}}, 3765 title = {Acceleration of low order finite element computation with {GPUs} (Invited)}, 3766 booktitle = {Eos Transactions of the AGU}, 3767 organization = {American Geophysical Union}, 3768 note = {Fall Meeting Supplemental, Abstract IN44A-01}, 3769 year = {2010}, 3770 petsc_uses = {KSP} 3771} 3772 3773@InProceedings{ mayknepleygurnis09, 3774 author = {Dave A. May and Matthew G. Knepley and Michael Gurnis}, 3775 title = {{CitcomSX}: Robust preconditioning in {CitcomS} via {PETSc}}, 3776 booktitle = {Eos Transactions of the AGU}, 3777 organization = {American Geophysical Union}, 3778 note = {Fall Meeting Supplemental, Abstract P31A-A1241}, 3779 year = {2009}, 3780 petsc_uses = {KSP} 3781} 3782 3783@InProceedings{ yuenknepleyerlebacherwright09, 3784 author = {David A. Yuen and Matthew G. Knepley and Gordon Erlebacher and Grady B. Wright}, 3785 title = {The Coming Role of {GPU} in Computational Geodynamics}, 3786 booktitle = {Eos Transactions of the AGU}, 3787 organization = {American Geophysical Union}, 3788 note = {Fall Meeting Supplemental, Abstract DI22A-05}, 3789 year = {2009}, 3790 petsc_uses = {KSP} 3791} 3792 3793@InProceedings{ aagaardknepleywilliams08, 3794 author = {Brad Aagaard and Charles A. Williams and Matthew G. Knepley}, 3795 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3796 Deformation}, 3797 booktitle = {Eos Transactions of the AGU}, 3798 organization = {American Geophysical Union}, 3799 volume = {89}, 3800 number = {53}, 3801 note = {Fall Meeting Supplemental, Abstract T41A-1925}, 3802 year = {2007}, 3803 petsc_uses = {KSP} 3804} 3805 3806@InProceedings{ aagaardknepleywilliams07, 3807 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3808 title = {{PyLith}: A Finite-Element Code for Modeling Quasi-Static and Dynamic Crustal 3809 Deformation}, 3810 booktitle = {Eos Transactions of the AGU}, 3811 organization = {American Geophysical Union}, 3812 volume = {88}, 3813 number = {52}, 3814 note = {Fall Meeting Supplemental, Abstract T21B-1798}, 3815 year = {2007}, 3816 petsc_uses = {KSP} 3817} 3818 3819@InProceedings{ aagaardknepleywilliams05, 3820 author = {Charles A. Williams and Brad Aagaard and Matthew G. Knepley}, 3821 title = {Development of software for studying earthquakes across multiple spatial and 3822 temporal scales by coupling quasi-static and dynamic simulations}, 3823 booktitle = {Eos Transactions of the AGU}, 3824 organization = {American Geophysical Union}, 3825 volume = {86}, 3826 number = {52}, 3827 note = {Fall Meeting Supplemental, Abstract S53A-1072}, 3828 year = {2005}, 3829 petsc_uses = {KSP} 3830} 3831 3832@InProceedings{ williamsgablehagermeadeaagaardknepley08, 3833 author = {Charles A. Williams and Carl Gable and Bradford H. Hager and Brendan Meade and 3834 Brad Aagaard and Matthew G. Knepley}, 3835 title = {Modeling of Multiple Earthquake Cycles in {S}outhern {C}alifornia Using the {SCEC} 3836 Community Fault Model}, 3837 booktitle = {Proceedings of Geosciences '08}, 3838 address = {Wellington, NZ}, 3839 month = nov, 3840 year = {2008}, 3841 petsc_uses = {KSP} 3842} 3843 3844@TechReport{ zhang07, 3845 title = {Two New Approaches in Solving the Nonlinear Shallow Water Equations for 3846 Tsunamis}, 3847 author = {C. Zhang and M. G. Knepley and D. A. Yuen and Y. Shi}, 3848 type = {Preprint}, 3849 number = {ANL/MCS-P1459-0907}, 3850 institution = {ANL}, 3851 month = sep, 3852 year = {2007}, 3853 petsc_uses = {KSP} 3854} 3855 3856@Article{ katz08b, 3857 author = {Richard F. Katz}, 3858 title = {Magma dynamics with the enthalpy method: {B}enchmark solutions and magmatic 3859 focusing at mid-ocean ridges}, 3860 journal = {J. Petrology}, 3861 year = {2008}, 3862 volume = {49}, 3863 pages = {2099--2121}, 3864 doi = {10.1093/petrology/egn058}, 3865 petsc_uses = {KSP} 3866} 3867 3868@Article{ hgrhkjvv2008, 3869 title = {On preconditioning for a parallel solution of the {R}ichards equation}, 3870 author = {Michael Herbst and Swen Gottschalk and Martin Reissel and Horst Hardelauf and Roy 3871 Kasteel and Matthieu Javaux and Jan Vanderborght and Harry Vereeckena}, 3872 journal = {Computers and Geosciences}, 3873 volume = {34}, 3874 pages = {1958--1963}, 3875 year = {2008}, 3876 petsc_uses = {KSP} 3877} 3878 3879@Article{ maymoresi2008, 3880 title = {Preconditioned iterative methods for {Stokes} flow problems arising in 3881 computational geodynamics}, 3882 journal = {Physics of the Earth and Planetary Interiors}, 3883 volume = {171}, 3884 number = {1-4}, 3885 pages = {33--47}, 3886 year = {2008}, 3887 note = {{R}ecent Advances in Computational Geodynamics: Theory, Numerics and 3888 Applications}, 3889 issn = {0031-9201}, 3890 doi = {10.1016/j.pepi.2008.07.036}, 3891 author = {Dave A. May and Louis Moresi}, 3892 keywords = {Stokes flow, Krylov, Preconditioner, Schur complement, BFBt}, 3893 petsc_uses = {KSP} 3894} 3895 3896@Article{ kausmuhlhausmay2010, 3897 title = {A stabilization algorithm for geodynamic numerical simulations with a free 3898 surface}, 3899 author = {Boris JP Kaus and Hans M{\"u}hlhaus and Dave A May}, 3900 journal = {Physics of the Earth and Planetary Interiors}, 3901 volume = {181}, 3902 number = {1}, 3903 pages = {12--20}, 3904 year = {2010}, 3905 petsc_uses = {KSP} 3906} 3907 3908@Article{ duretzmaygeryatackley2011, 3909 title = {Discretization errors and free surface stabilization in the finite difference and 3910 marker-in-cell method for applied geodynamics: A numerical study}, 3911 author = {Thibault Duretz and David Alexander May and Taras V Gerya and Paul J Tackley}, 3912 journal = {Geochemistry, Geophysics, Geosystems}, 3913 volume = {12}, 3914 number = {7}, 3915 year = {2011}, 3916 petsc_uses = {KSP} 3917} 3918 3919@Article{ furuichimaytackley2011, 3920 title = {Development of a {Stokes} flow solver robust to large viscosity jumps using a 3921 {Schur} complement approach with mixed precision arithmetic}, 3922 author = {Mikito Furuichi and Dave A May and Paul J Tackley}, 3923 journal = {Journal of Computational Physics}, 3924 volume = {230}, 3925 number = {24}, 3926 pages = {8835--8851}, 3927 year = {2011}, 3928 petsc_uses = {KSP} 3929} 3930 3931@Article{ kellermaykaus2013, 3932 title = {Numerical modelling of magma dynamics coupled to tectonic deformation of 3933 lithosphere and crust}, 3934 author = {Tobias Keller and Dave A May and Boris JP Kaus}, 3935 journal = {Geophysical Journal International}, 3936 volume = {195}, 3937 number = {3}, 3938 pages = {1406--1442}, 3939 year = {2013}, 3940 petsc_uses = {KSP} 3941} 3942 3943@Article{ schellartfreemanstegmanmoresimay2007, 3944 title = {Evolution and diversity of subduction zones controlled by slab width}, 3945 author = {WP Schellart and Justin Freeman and David R Stegman and Louis Moresi and David A 3946 May}, 3947 journal = {Nature}, 3948 volume = {446}, 3949 number = {7133}, 3950 pages = {308--311}, 3951 year = {2007}, 3952 petsc_uses = {KSP} 3953} 3954 3955@Article{ cramerischmelinggolabekduretzorendtbuitermaykausgeryatackley2012, 3956 title = {A comparison of numerical surface topography calculations in geodynamic 3957 modelling: an evaluation of the sticky air method}, 3958 author = {F Crameri and H Schmeling and GJ Golabek and T Duretz and R Orendt and SJH Buiter 3959 and David A May and Boris JP Kaus and Taras V Gerya and Paul J Tackley}, 3960 journal = {Geophysical Journal International}, 3961 volume = {189}, 3962 number = {1}, 3963 pages = {38--54}, 3964 year = {2012}, 3965 petsc_uses = {KSP} 3966} 3967 3968@Article{ stegmanfreemanschellartmoresimay2006, 3969 title = {Influence of trench width on subduction hinge retreat rates in {3-D} models of slab 3970 rollback}, 3971 author = {David R Stegman and Justin Freeman and WP Schellart and Louis Moresi and David A 3972 May}, 3973 journal = {Geochemistry, Geophysics, Geosystems}, 3974 volume = {7}, 3975 number = {3}, 3976 year = {2006}, 3977 petsc_uses = {KSP} 3978} 3979 3980@InProceedings{ may2014ptatin, 3981 title = {{pTatin3D}: {H}igh-performance methods for long-term lithospheric dynamics}, 3982 author = {Dave A May and Jed Brown and Laetitia {Le Pourhiet}}, 3983 booktitle = {Proceedings of {SC14}: The {International Conference for High Performance 3984 Computing, Networking, Storage and Analysis}}, 3985 organization = {ACM}, 3986 pages = {274--284}, 3987 year = {2014}, 3988 doi = {10.1109/SC.2014.28}, 3989 petsc_uses = {KSP} 3990} 3991 3992@Article{ maybrownpourhiet2015, 3993 title = {A scalable, matrix-free multigrid preconditioner for finite element 3994 discretizations of heterogeneous {Stokes} flow}, 3995 author = {David A May and Jed Brown and Laetitia {Le Pourhiet}}, 3996 journal = {Computer Methods in Applied Mechanics and Engineering}, 3997 volume = {290}, 3998 pages = {496--523}, 3999 year = {2015}, 4000 doi = {10.1016/j.cma.2015.03.014}, 4001 petsc_uses = {KSP} 4002} 4003 4004@Article{ duretzmayyamato2016, 4005 title = {A free surface capturing discretization for the staggered grid finite difference 4006 scheme}, 4007 author = {Thibault Duretz and Dave A May and Philippe Yamato}, 4008 journal = {Geophysical Journal International}, 4009 volume = {204}, 4010 number = {3}, 4011 pages = {1518--1530}, 4012 year = {2016}, 4013 petsc_uses = {KSP} 4014} 4015 4016@Article{ rhebergenwellskatzwathen2014, 4017 author = {Sander Rhebergen and Garth N. Wells and Richard F. Katz and Andrew J. Wathen}, 4018 title = {Analysis of block-preconditioners for models of coupled magma/mantle dynamics}, 4019 journal = {SIAM J. Sci. Comput.}, 4020 volume = {36}, 4021 pages = {A1960--A1977}, 4022 year = {2014}, 4023 petsc_uses = {KSP} 4024} 4025 4026@Article{ katz08a, 4027 author = {R.F. Katz and M.G. Worster}, 4028 title = {Simulation of directional solidification, thermochemical convection, and chimney 4029 formation in a {H}ele-{S}haw cell}, 4030 journal = {J. Comp. Phys.}, 4031 volume = {227}, 4032 pages = {9823-9840}, 4033 year = {2008}, 4034 doi = {10.1016/j.jcp.2008.06.039}, 4035 petsc_uses = {KSP} 4036} 4037 4038@Article{ aabg2007, 4039 author = {A. Askan and V. Akcelik and J. Bielak and O. Ghattas}, 4040 title = {Full waveform inversion for seismic velocity and anelastic losses in 4041 heterogeneous structures}, 4042 journal = {Bulletin of Seismological Society of America}, 4043 year = {2007}, 4044 volume = {97}, 4045 pages = {1990--2008}, 4046 petsc_uses = {KSP} 4047} 4048 4049@Article{ katz2006, 4050 author = {Richard F. Katz and Marc Spiegelman and Benjamin Holtzman}, 4051 title = {The dynamics of melt and shear localization in partially molten aggregates}, 4052 journal = {Nature}, 4053 year = {2006}, 4054 volume = {442}, 4055 pages = {676--679}, 4056 month = aug, 4057 day = {10}, 4058 url = {http://www.nature.com/nature/journal/v442/n7103/abs/nature05039.html}, 4059 petsc_uses = {KSP} 4060} 4061 4062@InProceedings{ mqrs2003, 4063 author = {Roland Masson and Philippe Quandalle and Stephane Requena and Robert Scheichl}, 4064 year = {2003}, 4065 title = {Parallel Preconditioning for Sedimentary Basin Simulations}, 4066 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003, 4067 Sozopol, Bulgaria, June 4-8, 2003}, 4068 petsc_uses = {KSP} 4069} 4070 4071@InProceedings{ lichtner1, 4072 author = {Chuan Lu and Peter C. Lichtner}, 4073 year = {2005}, 4074 title = {{PFLOTRAN}: Massively Parallel {3-D} Simulator for {CO2} Sequestration in 4075 Geologic Media}, 4076 booktitle = {Fourth Annual Conference on Carbon Capture and Sequestration DOE/NETL}, 4077 lab = {LANL}, 4078 petsc_uses = {KSP} 4079} 4080 4081@Article{ hammondlichtnermills2014, 4082 title = {Evaluating the Performance of Parallel Subsurface Simulators: An Illustrative 4083 Example with {PFLOTRAN}}, 4084 author = {Glenn E. Hammond and Peter C. Lichtner and Richard Tran Mills}, 4085 journal = {Water Resources Research}, 4086 volume = {50}, 4087 number = {1}, 4088 pages = {208--228}, 4089 doi = {10.1002/2012WR013483}, 4090 year = {2014}, 4091 petsc_uses = {KSP} 4092} 4093 4094@Article{ smw2003, 4095 author = {R. Scheichl and R. Masson and J. Wendebourg}, 4096 title = {Decoupling and Block Preconditioning for Sedimentary Basin Simulations}, 4097 journal = {Computational Geosciences}, 4098 year = {2003}, 4099 volume = {7}, 4100 pages = {295--318}, 4101 url = {http://www.maths.bath.ac.uk/MATHEMATICS/preprints.html}, 4102 petsc_uses = {KSP} 4103} 4104 4105@Article{ kees-miller-03, 4106 author = {C. E. Kees and C.T. Miller and E.W. Jenkins and C.T. Kelley}, 4107 title = {Versatile multilevel Schwarz preconditioners for multiphase flow}, 4108 journal = {Computational Geosciences}, 4109 year = {2003}, 4110 volume = {7}, 4111 pages = {91--114}, 4112 petsc_uses = {KSP} 4113} 4114 4115@Article{ bk2003, 4116 author = {JN Buur and T Kuehnel}, 4117 title = {Improving depth imaging by automated model updating}, 4118 journal = {The Leading Edge}, 4119 year = {2003}, 4120 volume = {22}, 4121 pages = {310-318}, 4122 petsc_uses = {KSP} 4123} 4124 4125@Article{ frederickbuffett2016, 4126 title = {Submarine groundwater discharge as a possible formation mechanism for 4127 permafrost-associated gas hydrate on the circum-Arctic continental shelf}, 4128 author = {Jennifer M. Frederick and Bruce A. Buffett}, 4129 journal = {Journal of Geophysical Research: Solid Earth}, 4130 volume = {121}, 4131 number = {3}, 4132 pages = {1383--1404}, 4133 issn = {2169-9356}, 4134 doi = {10.1002/2015JB012627}, 4135 year = {2016}, 4136 petsc_uses = {KSP} 4137} 4138 4139% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4140% LiteralHTML:<font color="#FF0000"> 4141% LiteralHTML:Simulation of the earth's mantle and crust is valuable to 4142% LiteralHTML:understanding earthquakes, volcanos, etc. PETSc has been used for a 4143% LiteralHTML:variety of these simulations.</p> 4144% LiteralHTML:</font> 4145% LiteralHTML: 4146@InProceedings{ appelbe1, 4147 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4148 year = {2003}, 4149 title = {Mantle convection modeling with viscoelastic/brittle lithosphere: Numerical and 4150 computational methodology}, 4151 page = {781}, 4152 booktitle = {Lecture Notes in Computer Science, volume 2659, part of the ICCS Conference 4153 Proceedings}, 4154 publisher = {Springer-Verlag}, 4155 url = {http://vpac.org/VDT/SNARK/Presentations/RD0201-paper-20030602-ICCS03_ACES03_LNCS-mantle_convection_modelling.pdf}, 4156 petsc_uses = {KSP} 4157} 4158 4159% LiteralHTML:<a name="katz"> 4160@InProceedings{ gd1, 4161 author = {Guillaume Dumont and Michel Kern}, 4162 title = {Parallelization of a {3D} Seismic Migration Code with {PETSc}}, 4163 year = {1999}, 4164 booktitle = {Proceedings of the Ninth SIAM Conference on Parallel Processing for Scientific 4165 Computing}, 4166 petsc_uses = {KSP} 4167} 4168 4169% LiteralHTML: <center><img alt="" src="images/katz1.jpg"> <img alt="" src="images/katz3.jpg"> 4170% LiteralHTML: <img alt="" src="images/katz2.jpg"></center></p> 4171% LiteralHTML:<font color="#FF0000"> 4172% LiteralHTML: Figures from the work of Richard Katz 4173@PhDThesis{ katzthesis, 4174 author = {R.F. Katz}, 4175 title = {The deep roots of volcanoes: models of magma dynamics with applications to 4176 subduction zones}, 4177 school = {Columbia University}, 4178 year = {2005}, 4179 url = {http://www.ldeo.columbia.edu/\~{ }katz/thesis/Katz_Dissertation_Columbia05.pdf}, 4180 petsc_uses = {KSP} 4181} 4182 4183@InCollection{ knepleykatzsmith06, 4184 author = {Knepley, Matthew G. and Katz, Richard F. and Smith, Barry}, 4185 affiliation = {Argonne National Laboratory Mathematics and Computer Science Division Argonne IL 4186 USA}, 4187 title = {Developing a Geodynamics Simulator with {PETSc}}, 4188 booktitle = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 4189 series = {Lecture Notes in Computational Science and Engineering}, 4190 editor = {Bruaset, Are Magnus and Tveito, Aslak}, 4191 publisher = {Springer Berlin Heidelberg}, 4192 isbn = {978-3-540-31619-0}, 4193 keyword = {Mathematics and Statistics}, 4194 pages = {413-438}, 4195 volume = {51}, 4196 doi = {10.1007/3-540-31619-1_12}, 4197 year = {2006}, 4198 petsc_uses = {KSP} 4199} 4200 4201@Article{ katz04, 4202 author = {Richard F. Katz and Marc Spiegelman and S.M. Carbotte}, 4203 title = {Ridge migration, asthenospheric flow and the origin of magmatic segmentation in 4204 the global mid-ocean ridge system}, 4205 journal = {Geophys.\ Res.\ Letts.}, 4206 year = {2004}, 4207 volume = {31}, 4208 pages = {L15605}, 4209 petsc_uses = {KSP} 4210} 4211 4212@Article{ katz07, 4213 author = {Richard F. Katz and Matthew G. Knepley and Barry Smith and Marc Spiegelman and 4214 Ethan Coon}, 4215 title = {Numerical simulation of geodynamic processes with the {Portable Extensible 4216 Toolkit for Scientific Computation}}, 4217 journal = {Phys. Earth Planet. In.}, 4218 volume = {163}, 4219 pages = {52--68}, 4220 year = {2007}, 4221 petsc_uses = {KSP} 4222} 4223 4224@Article{ williams2006development, 4225 title = {{Development of a package for modeling stress in the lithosphere}}, 4226 author = {Williams, CA}, 4227 journal = {Eos Trans. AGU}, 4228 volume = {87}, 4229 pages = {36}, 4230 year = {2006}, 4231 petsc_uses = {KSP} 4232} 4233 4234@Article{ goverswortel05, 4235 author = {R. Govers and M.J.R. Wortel}, 4236 title = {Lithosphere tearing at STEP faults: response to edges of subduction zones}, 4237 journal = {Earth and Planetary Science Letters}, 4238 volume = {236/1-2}, 4239 pages = {505-523}, 4240 year = {2005}, 4241 petsc_uses = {KSP} 4242} 4243 4244@InProceedings{ snark2, 4245 author = {B. Appelbe and D. May and S. Quenette and S. Tang and F. Wang and L. Moresi}, 4246 year = {2002}, 4247 title = {Towards Rapid Geoscience Model Development - The {Snark} Project}, 4248 booktitle = {Proceedings of 3rd ACES (APEC Cooperation for Earthquake Simulation) Workshop}, 4249 petsc_uses = {KSP} 4250} 4251 4252@Article{ snark1, 4253 author = {Bill Appelbe and David May and Louis Moresi and Steve Quenette and Siew-Chiang 4254 Tan and Feng Wang}, 4255 title = {Snark - A Reusable Framwork for Geoscience Computational Models}, 4256 journal = {Submitted to Pure and Applied Geosciences}, 4257 petsc_uses = {KSP} 4258} 4259 4260@InProceedings{ earthquake2003, 4261 author = {Volkan Akcelik and Jacobo Bielak and George Biros and Ioannis Epanomeritakis and 4262 Antonio Fernandez and Omar Ghattas and Eui Joong Kim and David O'Hallaron and 4263 Tiankai Tu}, 4264 year = {2003}, 4265 title = {High Resolution Forward and Inverse Earthquake Modeling on Terascale Computers}, 4266 booktitle = {Proceedings of SC2003}, 4267 note = {A winner of the Gordon Bell Prize for special achievement at SC2003}, 4268 petsc_uses = {KSP} 4269} 4270 4271@InProceedings{ stefano12, 4272 author = {Michele De Stefano}, 4273 title = {Simultaneous Joint Inversion of Refraction Tomography and Magnetic Data}, 4274 booktitle = {PIERS Proceedings}, 4275 month = aug, 4276 address = {Moscow, RUSSIA}, 4277 pages = {491--495}, 4278 year = {2012}, 4279 petsc_uses = {KSP} 4280} 4281 4282%http://www.piers.org/piersproceedings/download.php?file=cGllcnMyMDEyTW9zY293fDJBN18wNDkxLnBkZnwxMjAzMTUwNDE2MDY= 4283 4284% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4285% LiteralHTML: <center><img alt="" 4286% LiteralHTML: src="images/ocean.jpg"></center></p> 4287@Article{ khatiwala07, 4288 author = {Khatiwala, S.}, 4289 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 4290 journal = {Glob. Biogeochem. Cycles}, 4291 volume = {21}, 4292 doi = {10.1029/2007GB002923}, 4293 year = {2007}, 4294 url = { http://www.ldeo.columbia.edu/\~{ }spk/Papers/KhatiwalaMatrixBiogeochemGBC07.pdf} 4295} 4296 4297@Article{ dks2004, 4298 author = {Sergey Danilov, Gennady Kivman and Jens Schroeter}, 4299 journal = {Ocean Modelling}, 4300 year = {2004}, 4301 volume = {6(2)}, 4302 pages = {125-150}, 4303 title = {A finite-element Ocean Model: Principles and Evaluation}, 4304 url = {http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%236214%232004%23999939997%231%23FLA%23Volume_6,_Issue_2,_Pages_101-190_(2004)&_auth=y&view=c&_acct=C000007278&_version=1&_urlVersion=0&_userid=97338&md5=c3a50a31c599d8d38c8ce1f29117f267}, 4305 petsc_uses = {KSP} 4306} 4307 4308@Article{ danilov1, 4309 author = {S. Danilov and G. Kivman and J. Schroter}, 4310 year = {2004}, 4311 title = {Evaluation of an eddy-permitting finite-element ocean model in the {N}orth 4312 {A}tlantic}, 4313 journal = {Ocean Modelling}, 4314 petsc_uses = {KSP} 4315} 4316 4317@Article{ nerger1, 4318 author = {L. Nerger and S. Danilov and G. Kivman and W. Hiller and J. Schroter}, 4319 year = {2004}, 4320 title = {Data Assimilation with the Ensemble {K}alman Filter and the {SEIK} Filter applied to 4321 a Finite Element Model of the {N}orth {A}tlantic}, 4322 journal = {Journal of marine systems}, 4323 petsc_uses = {KSP} 4324} 4325 4326@Conference{ rakowsky2003self, 4327 title = {{A self-adaptive finite element model of the atmosphere}}, 4328 author = {Rakowsky, N. and Frickenhaus, S. and Hiller, W. and L{\\"a}uter, M. and Handorf, 4329 D. and Dethloff, K. and Zwieflhofer, W. and Kreitz, N.}, 4330 booktitle = {Realizing teracomputing: proceedings of the tenth ECMWF Workshop on the Use of 4331 High Performance Computing in Meteorology: Reading, UK, 4-8 November, 2002}, 4332 pages = {279}, 4333 isbn = {981238376X}, 4334 year = {2003}, 4335 organization = {World Scientific Pub Co}, 4336 petsc_uses = {KSP} 4337} 4338 4339@Article{ lauter3, 4340 author = {M. Lauter}, 4341 year = {2004}, 4342 title = {GrossrAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4343 AtmosphArenmodell}, 4344 journal = {Berichte zur Polar- und Meeresforschung}, 4345 petsc_uses = {KSP} 4346} 4347 4348@Article{ lauter2, 4349 author = {M. Lauter and D. Handorf and K. Dethloff}, 4350 year = {2004}, 4351 title = {Unsteady analytical solutions of the spherical shallow water equations}, 4352 journal = {Journal of computational physics}, 4353 petsc_uses = {KSP} 4354} 4355 4356@PhDThesis{ lauter1, 4357 author = {M. Lauter}, 4358 year = {2004}, 4359 title = {GrossAumige Zirkulationsstrukturen in einem nichtlinearen adaptiven 4360 AtmosphArenmodell}, 4361 institution = {UniversitAt Potsdam, 134 P., UniversitAt Potsdam}, 4362 petsc_uses = {KSP} 4363} 4364 4365@Article{ frickenhaus1, 4366 author = {S. Frickenhaus and W. Hiller and M. Best}, 4367 year = {2005}, 4368 title = {FoSSI : The Family of Simplified Solver Interfaces for the rapid development of 4369 parallel numerical atmosphere and ocean models}, 4370 journal = {Ocean Modelling}, 4371 volume = {10}, 4372 pages = {185--191}, 4373 petsc_uses = {KSP} 4374} 4375 4376@Article{ 0266-5611-24-3-034015, 4377 author = {I Epanomeritakis and V Ak\c{c}elik and O Ghattas and J Bielak}, 4378 title = {A {N}ewton-{CG} method for large-scale three-dimensional elastic full-waveform 4379 seismic inversion}, 4380 journal = {Inverse Problems}, 4381 volume = {24}, 4382 number = {3}, 4383 pages = {034015 (26pp)}, 4384 url = {http://stacks.iop.org/0266-5611/24/034015}, 4385 year = {2008}, 4386 abstract = {We present a nonlinear optimization method for large-scale 3D elastic 4387 full-waveform seismic inversion. The method combines outer Gauss-Newton nonlinear 4388 iterations with inner conjugate gradient linear iterations, globalized by an 4389 Armijo backtracking line search, solved on a sequence of finer grids and higher 4390 frequencies to remain in the vicinity of the global optimum, inexactly terminated 4391 to prevent oversolving, preconditioned by L-BFGS/Frankel, regularized by a total 4392 variation operator to capture sharp interfaces, finely discretized by finite 4393 elements in the Lam\'{e} parameter space to provide flexibility and avoid bias, 4394 implemented in matrix-free fashion with adjoint-based computation of reduced 4395 gradient and reduced Hessian-vector products, checkpointed to avoid full spacetime 4396 waveform storage, and partitioned spatially across processors to parallelize the 4397 solutions of the forward and adjoint wave equations and the evaluation of 4398 gradient-like information. Several numerical examples demonstrate the grid 4399 independence of linear and nonlinear iterations, the effectiveness of the 4400 preconditioner, the ability to solve inverse problems with up to 17 million 4401 inversion parameters on up to 2048 processors, the effectiveness of multiscale 4402 continuation in keeping iterates in the basin of attraction of the global minimum, 4403 and the ability to fit the observational data while reconstructing the model with 4404 reasonable resolution and capturing sharp interfaces.}, 4405 petsc_uses = {KSP} 4406} 4407 4408% LiteralHTML: 4409% LiteralHTML: <a name="environmental"><H3><center>Environmental -- Subsurface Flow</center></H3> 4410% LiteralHTML: 4411% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4412% LiteralHTML:<font color="#FF0000"> 4413% LiteralHTML:Modeling surface flow of water is valuable for both flood control and 4414% LiteralHTML:agricultural and environmental reasons. For example, regenerating the 4415% LiteralHTML:Florida Everglades requires extensive understanding of the surface water 4416% LiteralHTML:characteristics over thousands of square miles. PETSc has been used 4417% LiteralHTML:for a variety of these simulations.</p> 4418% LiteralHTML:</font> 4419% LiteralHTML: 4420@Article{ mills2009modeling, 4421 title = {Modeling subsurface reactive flows using leadership-class computing}, 4422 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4423 Mahinthakumar, G.K. and Smith, B.F.}, 4424 journal = {Journal of Physics: Conference Series}, 4425 volume = {180}, 4426 pages = {012062}, 4427 year = {2009}, 4428 publisher = {IOP Publishing}, 4429 petsc_uses = {KSP} 4430} 4431 4432@Conference{ mills2007simulating, 4433 title = {{Simulating subsurface flow and transport on ultrascale computers using 4434 PFLOTRAN}}, 4435 author = {Mills, R.T. and Lu, C. and Lichtner, P.C. and Hammond, G.E.}, 4436 booktitle = {Journal of Physics: Conference Series}, 4437 volume = {78}, 4438 pages = {012051}, 4439 year = {2007}, 4440 organization = {IOP Publishing}, 4441 petsc_uses = {KSP} 4442} 4443 4444@InProceedings{ mills2009, 4445 title = {Modeling subsurface reactive flows using leadership-class computing}, 4446 author = {Mills, R.T. and Hammond, G.E. and Lichtner, P.C. and Sripathi, V. and 4447 Mahinthakmuar, G. and Smith, B.}, 4448 booktitle = {Journal of Physics: Conference Series}, 4449 volume = {180}, 4450 pages = {102062}, 4451 year = {2009}, 4452 organization = {IOP Publishing}, 4453 petsc_uses = {KSP} 4454} 4455 4456@Article{ guo2013parallel, 4457 title = {A parallel, fully coupled, fully implicit solution to reactive transport in 4458 porous media using the preconditioned {J}acobian-{F}ree {N}ewton-{K}rylov Method 4459 }, 4460 journal = {Advances in Water Resources }, 4461 volume = {53}, 4462 number = {0}, 4463 pages = {101 - 108}, 4464 year = {2013}, 4465 note = {}, 4466 issn = {0309-1708}, 4467 doi = {10.1016/j.advwatres.2012.10.010}, 4468 author = {Luanjing Guo and Hai Huang and Derek R. Gaston and Cody J. Permann and David 4469 Andrs and George D. Redden and Chuan Lu and Don T. Fox and Yoshiko Fujita}, 4470 keywords = {Reactive transport, Jacobian-Free Newton-Krylov, Physics-based block 4471 preconditioner}, 4472 petsc_uses = {KSP} 4473} 4474 4475@Unpublished{ stomp, 4476 title = {STOMP (Subsurface Transport Over Multiple Phases) webpage}, 4477 url = {http://stomp.pnl.gov/}, 4478 petsc_uses = {KSP} 4479} 4480 4481@InProceedings{ htfc2003, 4482 author = {L. Hluchy and V.D. Tran and D.Froehlich and W.Castaings}, 4483 title = {Methods and Experiences For Parallelizing Flood Models}, 4484 year = {2003}, 4485 booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface: 10th 4486 European PVM/MPI User's Group Meeting}, 4487 note = {Springer Lecture Notes in Computer Science, Volume 2840}, 4488 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=2e9afcba8f614cd9a6f94a5294d1cbb0&referrer=parent&backto=issue,93,95;journal,588,1972;linkingpublicationresults,1:105633,1}, 4489 petsc_uses = {KSP} 4490} 4491 4492@InProceedings{ hulchy-tran-astalos-fmsip, 4493 author = {L. Hluchy and V.D. Tran and J. Astalos and M. Dobrucky and G. T. Nguyen and 4494 D.Froehlich}, 4495 title = {Flood Modeling System and Its Parallelization}, 4496 year = {2002}, 4497 booktitle = {Proceedings of the International Conference on Parallel Computing in Electrical 4498 Engineering}, 4499 url = {http://portal.acm.org/citation.cfm?id=824476.825951}, 4500 petsc_uses = {KSP} 4501} 4502 4503@InProceedings{ gy1, 4504 author = {J. P. Gwo and G. T. Yeh}, 4505 title = {High-Performance Simulation of Surface-Subsurface Coupled Flow and Reactive 4506 Transport at Watershed Scale}, 4507 year = {2004}, 4508 booktitle = {The International Conference on Computational Methods}, 4509 url = {http://www.sfwmd.gov/org/era/uncertainty_wkshp/GwoYeh.pdf}, 4510 petsc_uses = {KSP} 4511} 4512 4513@Conference{ cheng2009efficient, 4514 title = {{An efficient parallel method for large-scale groundwater flow equation based on 4515 PETSc}}, 4516 author = {Cheng, T. and Ji, X. and Wang, Q.}, 4517 booktitle = {Information, Computing and Telecommunication, 2009. YC-ICT'09. IEEE Youth 4518 Conference on}, 4519 pages = {190--193}, 4520 organization = {IEEE}, 4521 petsc_uses = {KSP} 4522} 4523 4524@Unpublished{ sfrsm, 4525 title = {The South Florida Regional Simulation Model and Hydrologic Simulation Engine}, 4526 url = {http://www.sfwmd.gov/org/pld/hsm/cerp_pres/hse_num.pdf}, 4527 note = {Simulates overland, groundwater and canal flows for south Florida. Uses PETSc for 4528 its linear solves}, 4529 petsc_uses = {KSP} 4530} 4531 4532% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4533@InProceedings{ bart_omar:sc05, 4534 author = {Volkan Ak{\c c}elik and George Biros and Andrei Dr{\u{a}}g{\u{a}}nescu and Omar 4535 Ghattas and Judith~C. Hill and Gart~G. van Bloemen Waanders}, 4536 title = {Dynamic data driven inversion for terascale simulations: real-time 4537 indentification of airborne contaminants}, 4538 booktitle = {Proceedings of SC2005}, 4539 organization = {IEEE/ACM}, 4540 address = {Seattle, WA}, 4541 year = {2005}, 4542 month = nov, 4543 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/sc05-inverse.pdf}, 4544 lab = {SNL}, 4545 petsc_uses = {KSP} 4546} 4547 4548@InProceedings{ anton-krassimir-lscc, 4549 author = {Anton Antonov and Krassimir Georgiev and Emilia Komsalova and Zahari Zlatev}, 4550 title = {Comparison of Two Local Refinement Methods for Large Scale Air Pollution 4551 Simulations}, 4552 booktitle = {Large-Scale Scientific Computing: 4th International Conference, LSSC 2003}, 4553 volume = {2907}, 4554 year = {2003}, 4555 publisher = {Springer-Verlag}, 4556 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=65dfaebc36f6453d9120b8f9f86fecc5&referrer=parent&backto=issue,32,55;journal,618,2072;linkingpublicationresults,1:105633,1}, 4557 petsc_uses = {KSP} 4558} 4559 4560@InProceedings{ aa2001, 4561 author = {Anton Antonov}, 4562 title = {Object-Oriented Framework for Large Scale Air Pollution Modeling}, 4563 year = {2001}, 4564 booktitle = {Large-Scale Scientific Computing : Third International Conference, LSSC 2001, 4565 Sozopol, Bulgaria}, 4566 note = {Springer Lecture Notes in Computer Science, Volume 2179}, 4567 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=3699c48fdb764bc7a3aa0539c7bf9f1d&referrer=parent&backto=issue,25,52;journal,1243,1972;linkingpublicationresults,1:105633,1}, 4568 petsc_uses = {KSP} 4569} 4570 4571% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4572@Article{ grassley-simmons-kercher-00, 4573 author = {William E. Glassley and Ardyth M. Simmons and James R. Kercher}, 4574 year = {2000}, 4575 title = {Mineralogical heterogeneity in fractured, porous media and its representation in 4576 reactive transport models}, 4577 journal = {Applied Geochemistry}, 4578 volume = {17}, 4579 pages = {699--708}, 4580 lab = {LLNL} 4581} 4582 4583@Article{ glassey-nitao-03, 4584 author = {William E. Glassley and John J. Nitao and Charles W. Grant and James W. Johnson 4585 and Carl I. Steefel and James R. Kercher}, 4586 year = {2003}, 4587 title = {The impact of climate change on vadose zone pore waters and its implication for 4588 long-term monitoring}, 4589 journal = {Computers and Geosciences}, 4590 volume = {29}, 4591 pages = {399-411}, 4592 lab = {LLNL}, 4593 petsc_uses = {KSP} 4594} 4595 4596@Article{ steefel-depaolo-lichtner-05, 4597 author = {Carl I. Steefel and Donald J. DePaolo and Peter C. Lichtner}, 4598 year = {2005}, 4599 title = {Reactive transport modeling: An essential tool and a new research approach for 4600 the Earth sciences}, 4601 journal = {Earth and Planetary Science Letters}, 4602 lab = {LLNL,LANL}, 4603 petsc_uses = {KSP} 4604} 4605 4606% LiteralHTML:<a name="scalinglarge"> 4607% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4608% LiteralHTML: <center><img alt="" 4609% LiteralHTML: src="images/scalinglarge.jpg"></center></p> 4610% LiteralHTML:<font color="#FF0000"> 4611% LiteralHTML: Sample <strong>strong scaling</strong> for the LANL PFLOTRAN flow and geochemical transport suite. (Courtesy of Richard Mills, ORNL) 4612@InProceedings{ kongstognergastonpetersonpermannslaughtermartineau2018, 4613 title = {A General-Purpose Hierarchical Mesh Partitioning Method with Node Balancing 4614 Strategies for Large-Scale Numerical Simulations}, 4615 author = {Fande Kong and Roy H. Stogner and Derek R. Gaston and John W. Peterson and Cody 4616 J. Permann and Andrew E. Slaughter and Richard C. Martineau}, 4617 booktitle = {2018 IEEE/ACM 9th Workshop on Latest Advances in Scalable Algorithms for 4618 Large-Scale Systems (scalA)}, 4619 pages = {65-72}, 4620 doi = {10.1109/ScalA.2018.00012}, 4621 month = nov, 4622 year = {2018}, 4623 petsc_uses = {KSP} 4624} 4625 4626@Article{ km2004, 4627 author = {A. Keese and H. G. Matthies}, 4628 journal = {Computers and Structures}, 4629 year = {2005}, 4630 volume = {83}, 4631 pages = {1033--1047}, 4632 title = {Hierarchical parallelisation for the solution of stochastic finite element 4633 equations}, 4634 url = {http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V28-4FPDPWM-1&_user=1722207&_rdoc=1&_fmt=&_orig=search&_sort=d&_docanchor=&view=c&_acct=C000053990&_version=1&_urlVersion=0&_userid=1722207&md5=89d48cd6fd5e80989372246d8dda400f}, 4635 petsc_uses = {KSP} 4636} 4637 4638@Unpublished{ hvl2002, 4639 title = {Numerical Modeling of {NAPL} Source Zone Treatment}, 4640 author = {Hammond, G.E., A.J. Valocchi and P.C. Lichtner}, 4641 note = {Poster at American Geophysical Union Fall 2002 Meeting, San Francisco, CA.}, 4642 url = {http://cee.uiuc.edu/transport/hammond/agu_2002.pdf}, 4643 year = {2002}, 4644 lab = {LANL}, 4645 petsc_uses = {KSP} 4646} 4647 4648@PhDThesis{ hammond2003, 4649 author = {Glenn E. Hammond}, 4650 title = {Innovative Methods for Solving Multicomponent Biogeochemical Groundwater 4651 Transport on Supercomputers}, 4652 school = {University of Illinois at Urbana-Champaign}, 4653 year = {2003}, 4654 url = {http://cee.uiuc.edu/transport/hammond/dissertation.pdf}, 4655 petsc_uses = {KSP} 4656} 4657 4658@Unpublished{ uk, 4659 title = {Parallel Least-Squares Finite Element Method for Large Eddy Simulation of Large 4660 Scale Environmental Flows and Transport Processes}, 4661 url = {http://es.epa.gov/ncer/progress/grants/96/high/tsang99.html}, 4662 note = {EPA funded work to simulate turbulent dispersion of toxic chemicals around 4663 buildings and in Green Bay. Used PETSc for its linear solvers}, 4664 year = {1999}, 4665 petsc_uses = {KSP} 4666} 4667 4668@InProceedings{ hammond2002, 4669 author = {Glenn E. Hammond and Albert J. Valocchi and Peter C. Lichtner}, 4670 title = {Modeling Multicomponent Reactive Transport on Parallel Computers Using 4671 {J}acobian-Free {N}ewton {K}rylov with Operator-Split Preconditioners}, 4672 year = {2002}, 4673 url = {http://www.cee.uiuc.edu/transport/publications/hammond/CMWR_2002.pdf}, 4674 booktitle = {Proceedings of the XIV International Conference on Computational Methods in Water 4675 Resources, Delft, The Netherlands.}, 4676 lab = {LANL}, 4677 petsc_uses = {KSP} 4678} 4679 4680@TechReport{ steefel1, 4681 author = {C. I. Steefel}, 4682 title = {Software for modeling multicomponent, multidimensional reactive transport}, 4683 year = {2001}, 4684 institution = {Lawrence Livermore National Laboratory}, 4685 number = {UCRL-MA-143182}, 4686 lab = {LLNL}, 4687 petsc_uses = {KSP} 4688} 4689 4690@Article{ steefel2, 4691 author = {C. I. Steefel and A. C. Lasaga}, 4692 title = {A coupled model for transport of multiple chemical-species and kinetic 4693 precipitation dissolution reactions with application to reactive flow in 4694 single-phase hydrothermal systems}, 4695 journal = {Americal Journal of Science}, 4696 year = {1994}, 4697 pages = {529-592}, 4698 volume = {294}, 4699 number = {5}, 4700 petsc_uses = {KSP} 4701} 4702 4703@TechReport{ steefel3, 4704 author = {C. I. Steefel and S. B. Yabusaki}, 4705 title = {{OS3D/GIMRT}, Software for Multicomponent-Multidimensional reactive transport: 4706 User's manual and programmer's guide}, 4707 year = {1996}, 4708 institution = {Pacific Northwest National Laboratory}, 4709 number = {PNNL-11166}, 4710 lab = {PNNL}, 4711 petsc_uses = {KSP} 4712} 4713 4714@Article{ 2005hvl, 4715 author = {G. E. Hammond and A.J. Valocchi and P.C. Lichtner}, 4716 title = {Application of {J}acobian-free {N}ewton-{K}rylov with physics-based 4717 preconditioning to biogeochemical transport}, 4718 journal = {Advances in Water Resources}, 4719 year = {2005}, 4720 pages = {359--376}, 4721 volume = {28}, 4722 url = { 4723 http://www.sciencedirect.com/science?_ob=IssueURL&_tockey=%23TOC%235953%232005%23999719995%23576651%23FLA%23Volume_28,_Issue_4,_Pages_315-427_(April_2005)&_auth=y&view=c&_acct=C000059129&_version=1&_urlVersion=0&_userid=2914253&md5=0d485527443c6192356cc508e1621002}, 4724 lab = {LANL}, 4725 petsc_uses = {KSP} 4726} 4727 4728@Article{ wang-zabar-05, 4729 author = {J Wang and N Zabaras}, 4730 journal = {Int. J. Heat and Mass Transfer}, 4731 title = {A Markov random field model of contamination source identification in porous 4732 media flow}, 4733 year = {2005}, 4734 petsc_uses = {KSP} 4735} 4736 4737@InBook{ kp1, 4738 author = {Jong G. Kim and Hyoung W. Park}, 4739 chapter = {Advanced Simulation Technique for Modeling Multiphase Fluid Flow in Porous 4740 Media}, 4741 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=m5uc84pqrh1qrg8clyuh&referrer=parent&backto=issue,1,117;journal,206,1787;linkingpublicationresults,1:105633,1}, 4742 title = {Lecture Notes in Computer Science}, 4743 publisher = {Springer-Verlag}, 4744 volume = {3044}, 4745 year = {2004}, 4746 petsc_uses = {KSP} 4747} 4748 4749@Article{ 2001agusm...h32a06k, 4750 author = {{Kim}, J.~G. and {Kim}, J.}, 4751 title = {Parallel Implementation of Finite Element Groundwater Flow Model}, 4752 journal = {AGU Spring Meeting Abstracts}, 4753 year = {2001}, 4754 pages = {32-+}, 4755 petsc_uses = {KSP} 4756} 4757 4758@Article{ lzb2005, 4759 author = {A. M. Wasantha Lal and Randy Van Zee and Mark Belnap}, 4760 title = {CASE STUDY: A MODEL TO SIMULATE REGIONAL FLOW IN SOUTH FLORIDA}, 4761 journal = {Journal of Hydraulic Engineering}, 4762 year = {2005}, 4763 volume = {131}, 4764 number = {4}, 4765 pages = {247--258}, 4766 petsc_uses = {KSP} 4767} 4768 4769@Article{ rao2005, 4770 author = {Prasada Rao}, 4771 title = {A parallel {RMA2} model for simulating large-scale free surface flows}, 4772 journal = {Environmental Modelling and Software}, 4773 year = {2005}, 4774 pages = {47--53}, 4775 petsc_uses = {KSP} 4776} 4777 4778@InProceedings{ pr1, 4779 author = {Prasada Rao}, 4780 title = {An Efficient Scalable Finite Element Model for Simulating Large Scale 4781 Hydrodynamic Flows}, 4782 year = {2003}, 4783 booktitle = {Proceedings of the American Society of Civil Engineers 16th Engineering Mechanics 4784 Conference}, 4785 url = {http://www.ce.washington.edu/em03/proceedings/papers/477.pdf}, 4786 petsc_uses = {KSP} 4787} 4788 4789@InProceedings{ lichtner2004, 4790 author = {Peter C. Lichtner and Andrew Wolfsberg}, 4791 title = {Modeling Thermal-Hydrological-Chemical ({THC}) Coupled Processes with 4792 Applications to Underground Nuclear Tests at the Nevada Test Site; A Grand 4793 Challenge Supercomputing Problem}, 4794 year = {2004}, 4795 booktitle = {MPU Workshop: Conceptual Model Development for Subsurface Reactive Transport 4796 Modeling of Inorganic Contaminants, Radionuclides and Nutrients}, 4797 note = {Also Los Alamos National Laboratory report: LA-UR-04-1826}, 4798 lab = {LANL}, 4799 petsc_uses = {KSP} 4800} 4801 4802% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 4803@Article{ aba01:petsc-app, 4804 author = {Jason Abate and Peng Wang and Kamy Sepehrnoori}, 4805 title = {Parallel Compositional Reservior Simulation on Clusters of {PC}s}, 4806 journal = {Int. J. High Performance Computing Applications}, 4807 year = {2001}, 4808 volume = {15}, 4809 number = {1}, 4810 pages = {13--21}, 4811 petsc_uses = {KSP} 4812} 4813 4814@PhDThesis{ tjb200, 4815 author = {Thomas James Byer}, 4816 title = {Preconditioned Newton Methods for Simulation of Reservoirs with Surface 4817 Facilities}, 4818 school = {Stanford}, 4819 year = {2000}, 4820 petsc_uses = {KSP} 4821} 4822 4823@InProceedings{ puchyr2006, 4824 author = {Peter J. Puchyr}, 4825 title = {Experience with Parallel Computing for Reservoir and Geomechanics Simulation on a 4826 {Win32} Cluster}, 4827 booktitle = {Proceedings of the Canadian International Petroleum Conference}, 4828 note = {Paper number CIPC2006-207}, 4829 year = {2006}, 4830 petsc_uses = {KSP} 4831} 4832 4833@InProceedings{ texas98, 4834 author = {P. Wang and S. Balay and K. Seperhrnoori and J. Wheeler and J. Abate and B. Smith 4835 and G. A. Pope}, 4836 title = {A Fully Implicit Parallel {EOS} Compositional Simulator for Large Scale Reservoir 4837 Simulation}, 4838 booktitle = {Proceedings of the 1999 Society of Petroleum Engineers 15th Reservoir Simulation 4839 Symposium}, 4840 note = {also available as Argonne preprint ANL/MCS-P743-1298}, 4841 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P743.pdf}, 4842 year = {1998}, 4843 petsc_uses = {KSP} 4844} 4845 4846% LiteralHTML: 4847% LiteralHTML: <a name="cfd"><H3><center>CFD</center></H3> 4848% LiteralHTML: 4849@Article{ farrellmitchellscottwechsung2021, 4850 title = {A {Reynolds-robust} preconditioner for the {Scott-Vogelius} discretization of the 4851 stationary incompressible {Navier-Stokes} equations}, 4852 author = {Patrick E Farrell and Lawrence Mitchell and L Ridgway Scott and Florian 4853 Wechsung}, 4854 journal = {The SMAI journal of computational mathematics}, 4855 volume = {7}, 4856 pages = {75--96}, 4857 year = {2021}, 4858 petsc_uses = {KSP} 4859} 4860 4861@Article{ adlerbensoncyrfarrellmaclachlantuminaro2021, 4862 title = {Monolithic Multigrid Methods for Magnetohydrodynamics}, 4863 author = {James H Adler and Thomas R Benson and Eric C Cyr and Patrick E Farrell and Scott 4864 P MacLachlan and Ray S Tuminaro}, 4865 journal = {SIAM Journal on Scientific Computing}, 4866 number = {0}, 4867 pages = {S70--S91}, 4868 year = {2021}, 4869 petsc_uses = {KSP} 4870} 4871 4872@Article{ farrellgaticalamichhaneoyarzuaruizbaier2021, 4873 title = {Mixed Kirchhoff stress–displacement–pressure formulations for incompressible 4874 hyperelasticity}, 4875 author = {Patrick E. Farrell and Luis F. Gatica and Bishnu P. Lamichhane and Ricardo 4876 Oyar\'ua and Ricardo Ruiz-Baier}, 4877 journal = {Computer Methods in Applied Mechanics and Engineering}, 4878 volume = {374}, 4879 pages = {113562}, 4880 issn = {0045-7825}, 4881 doi = {https://doi.org/10.1016/j.cma.2020.113562}, 4882 url = {https://www.sciencedirect.com/science/article/pii/S0045782520307477}, 4883 year = {2021}, 4884 petsc_uses = {KSP} 4885} 4886 4887@Article{ farrellmitchellwechsung2018, 4888 title = {An augmented {Lagrangian} preconditioner for the {3D} stationary incompressible 4889 {Navier-Stokes} equations at high {Reynolds} number}, 4890 author = {Patrick E Farrell and Lawrence Mitchell and Florian Wechsung}, 4891 journal = {SIAM Journal on Scientific Computing}, 4892 volume = {41}, 4893 number = {5}, 4894 eprint = {1810.03315}, 4895 pages = {A3073-A3096}, 4896 year = {2019}, 4897 petsc_uses = {KSP} 4898} 4899 4900@Article{ hevuikklaij2017, 4901 title = {Block-preconditioners for the incompressible {Navier}--{Stokes} equations 4902 discretized by a finite volume method}, 4903 author = {Xin He and Cornelis Vuik and Christiaan Klaij}, 4904 journal = {Journal of Numerical Mathematics}, 4905 volume = {25}, 4906 number = {2}, 4907 pages = {89--105}, 4908 year = {2017}, 4909 petsc_uses = {KSP} 4910} 4911 4912@InProceedings{ zou2015newton, 4913 title = {Newton--Krylov methods in applications of two-phase flow problems with phase 4914 appearance/disappearance}, 4915 author = {Zou, L and Zhao, H and Zhang, H}, 4916 booktitle = {ANS 2015 Annual Meeting, June}, 4917 volume = {7}, 4918 number = {11}, 4919 year = {2015}, 4920 petsc_uses = {KSP} 4921} 4922 4923@Article{ guermond2009nonlinear, 4924 title = {Nonlinear magnetohydrodynamics in axisymmetric heterogeneous domains using a 4925 Fourier/finite element technique and an interior penalty method}, 4926 author = {Guermond, J-L and Laguerre, Raphael and L{\'e}orat, Jacques and Nore, Caroline}, 4927 journal = {Journal of computational physics}, 4928 volume = {228}, 4929 number = {8}, 4930 pages = {2739--2757}, 4931 year = {2009}, 4932 publisher = {Elsevier}, 4933 petsc_uses = {KSP} 4934} 4935 4936@Article{ erzincanlisahin2015, 4937 title = {The numerical simulation of the wing kinematics effects on near wake topology and 4938 aerodynamic performance in hovering {D}rosophila flight}, 4939 author = {Belkis Erzincanli and Mehmet Sahin}, 4940 journal = {Computers \& Fluids}, 4941 volume = {122}, 4942 pages = {90--110}, 4943 year = {2015}, 4944 publisher = {Elsevier}, 4945 petsc_uses = {KSP} 4946} 4947 4948@Article{ ekensahin2015, 4949 title = {A parallel monolithic algorithm for the numerical simulation of large-scale fluid 4950 structure interaction problems}, 4951 author = {Ali Eken and Mehmet Sahin}, 4952 journal = {International Journal for Numerical Methods in Fluids}, 4953 year = {2015}, 4954 publisher = {Wiley Online Library}, 4955 petsc_uses = {KSP} 4956} 4957 4958@Article{ hwangsucai2015, 4959 title = {A parallel adaptive nonlinear elimination preconditioned inexact {Newton} method 4960 for transonic full potential equation}, 4961 author = {Feng-Nan Hwang and Yi-Cheng Su and Xiao-Chuan Cai}, 4962 journal = {Computers \& Fluids}, 4963 volume = {110}, 4964 number = {30}, 4965 pages = {96--107}, 4966 year = {2015}, 4967 doi = {10.1016/j.compfluid.2014.04.005}, 4968 petsc_uses = {KSP} 4969} 4970 4971@Article{ yanghwangcai2016, 4972 title = {Nonlinear Preconditioning Techniques for Full-Space {L}agrange--{N}ewton Solution of 4973 {PDE}-Constrained Optimization Problems}, 4974 author = {Haijian Yang and Feng-Nan Hwang and Xiao-Chuan Cai}, 4975 journal = {SIAM Journal on Scientific Computing}, 4976 volume = {38}, 4977 number = {5}, 4978 pages = {A2756--A2778}, 4979 year = {2016}, 4980 petsc_uses = {KSP} 4981} 4982 4983@Article{ khanaidun2011, 4984 author = {Irfan Khan and Cyrus K. Aidun}, 4985 title = {Direct numerical simulation of saturated deformable porous media using parallel 4986 hybrid Lattice-{B}oltzmann and finite element method}, 4987 journal = {Int. J. Numer. Meth. Eng.}, 4988 volume = {86}, 4989 pages = {1379--1395}, 4990 year = {2011}, 4991 petsc_uses = {KSP} 4992} 4993 4994@Article{ khanaidun2014, 4995 author = {Irfan Khan and Cyrus K. Aidun}, 4996 title = {Modeling the deformation of saturate porous media using direct numerical 4997 simulation}, 4998 journal = {Int. J. Multiphase Flow}, 4999 doi = {10.1016/j.ijmultiphaseflow.2014.12.003}, 5000 year = {2014}, 5001 petsc_uses = {KSP} 5002} 5003 5004@Article{ mofidi2014simulations, 5005 author = {A. Mofidi and P. M. Carrica}, 5006 title = {Simulations of Zigzag Maneuvers for a Container Ship with Direct Moving Rudder 5007 and Propeller}, 5008 journal = {Computers and Fluids}, 5009 pages = {191--203}, 5010 year = {2014}, 5011 petsc_uses = {KSP} 5012} 5013 5014@Article{ paik2014fluidstructure, 5015 author = {K. Paik and P. M. Carrica}, 5016 title = {Fluid-Structure Interaction for an Elastic Structure Interacting with Free 5017 Surface in a Rolling Tank}, 5018 journal = {Ocean Engineering}, 5019 pages = {201--212}, 5020 year = {2014}, 5021 petsc_uses = {KSP} 5022} 5023 5024@Article{ castro2013bubble, 5025 author = {A. M. Castro and P. M. Carrica}, 5026 title = {Bubble size distribution prediction for large-scale ship flows: {Model} 5027 evaluation and numerical issues}, 5028 journal = {International Journal of Multiphase Flow 57}, 5029 pages = {131--150}, 5030 year = {2013}, 5031 petsc_uses = {KSP} 5032} 5033 5034@Article{ carrica2013turn, 5035 author = {P. M. Carrica and F. Ismail and M. Hyman and S. Bhushan and F. Stern}, 5036 title = {Turn and Zigzag Maneuvers of a Surface Combatant Using a {URANS} Approach with 5037 Dynamic Overset Grids}, 5038 journal = {Journal of Marine Science and Technology}, 5039 pages = {166--181}, 5040 year = {2013}, 5041 petsc_uses = {KSP} 5042} 5043 5044@Article{ castro2013eulerian, 5045 author = {A. M. Castro and P. M. Carrica}, 5046 title = {Eulerian polydispersed modeling of bubbly flows around ships with application to 5047 {Athena} {R}/V,}, 5048 journal = {International Shipbuilding Progress}, 5049 pages = {403--433}, 5050 year = {2013}, 5051 petsc_uses = {KSP} 5052} 5053 5054@Article{ chase2013overset, 5055 author = {N. Chase and T. Michael and P. M. Carrica}, 5056 title = {Overset simulations of a {Submarine} in {Towed}, {Self}-{Propelled} and 5057 {Maneuvering} {Conditions}}, 5058 journal = {International Shipbuilding Progress}, 5059 pages = {171--205}, 5060 year = {2013}, 5061 petsc_uses = {KSP} 5062} 5063 5064@Article{ sadathosseini2013wu, 5065 author = {H. Sadat-Hosseini and P. -C. Wu and P. M. Carrica and H. Kim and Y. Toda and F. 5066 Stern}, 5067 title = {{CFD} Simulation and Validation of Added Resistance of {KVLCC}2 with Fixed and 5068 Free Surge Conditions in Short and Long Head Waves}, 5069 journal = {Ocean Engineering}, 5070 volume = {59}, 5071 pages = {240--273}, 5072 year = {2013}, 5073 petsc_uses = {KSP} 5074} 5075 5076@Article{ chase2013cfd, 5077 author = {N. Chase and P. M. Carrica}, 5078 title = {{CFD} Simulations of a Submarine Propeller and Application to Self-Propulsion of a 5079 Submarine}, 5080 journal = {Ocean Engineering}, 5081 pages = {68--80}, 5082 year = {2013}, 5083 petsc_uses = {KSP} 5084} 5085 5086@Article{ carrica2012cfd, 5087 author = {P. M. Carrica and H. Sadat-Hosseini and F. Stern}, 5088 title = {{CFD} Analysis of Broaching for a Model Surface Combatant with Explicit Simulation 5089 of Moving Rudders and Rotating Propellers}, 5090 journal = {Computers and Fluids 53}, 5091 pages = {117--132}, 5092 year = {2012}, 5093 petsc_uses = {KSP} 5094} 5095 5096@Article{ sakamoto2012urans, 5097 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5098 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 1: 5099 Verification and Validation for Forces, Moment, and Hydrodynamic Derivatives}, 5100 publisher = {Journal of Marine Science and Technology}, 5101 pages = {422--445}, 5102 year = {2012}, 5103 petsc_uses = {KSP} 5104} 5105 5106@Article{ sakamoto2012uransb, 5107 author = {N. Sakamoto and P. M. Carrica and F. Stern}, 5108 title = {{URANS} Simulations of Static and Dynamic Maneuvering for Surface Combatant-Part 2: 5109 Analysis and Validation of Local Flow Characteristics}, 5110 journal = {Journal of Marine Science and Technology}, 5111 pages = {446--468}, 5112 year = {2012}, 5113 petsc_uses = {KSP} 5114} 5115 5116@Article{ li2012dynamic, 5117 author = {Y. Li and T. Xing and K. Paik and P. M. Carrica}, 5118 title = {Dynamic Overset {CFD} Simulations of Wind Turbine Aerodynamics}, 5119 journal = {Renewable Energy}, 5120 pages = {285--298}, 5121 year = {2012}, 5122 petsc_uses = {KSP} 5123} 5124 5125@Article{ huang2012a, 5126 author = {J. Huang and P. M. Carrica and F. Stern}, 5127 title = {A Method to Compute Ship Exhaust Plumes with Waves and Wind}, 5128 journal = {International Journal for Numerical Methods in Fluids}, 5129 pages = {160--180}, 5130 year = {2012}, 5131 petsc_uses = {KSP} 5132} 5133 5134@Article{ huang2012b, 5135 author = {J. Huang and P. M. Carrica and F. Stern}, 5136 title = {A geometry-based level set method for curvilinear overset grids with application 5137 to ship hydrodynamics}, 5138 journal = {International Journal for Numerical Methods in Fluids}, 5139 pages = {494--521}, 5140 year = {2012}, 5141 petsc_uses = {KSP} 5142} 5143 5144@Article{ carrica2011computations, 5145 author = {P. M. Carrica and H. Fu and F. Stern}, 5146 title = {Computations of self-propulsion free to sink and trim and of motions in head 5147 waves of the {KRISO} {Container} {Ship} ({KCS}) model}, 5148 journal = {Applied Ocean Research}, 5149 pages = {309--320}, 5150 year = {2011}, 5151 petsc_uses = {KSP} 5152} 5153 5154@Article{ bhushan2011scalability, 5155 author = {S. Bhushan and P. M. Carrica and J. Yang and F. Stern}, 5156 title = {Scalability and Validation Study for Large Scale Surface Combatant Computations 5157 Using {CFDShip}-Iowa}, 5158 journal = {International Journal of High Performance Computing Applications}, 5159 pages = {466--487}, 5160 year = {2011}, 5161 petsc_uses = {KSP} 5162} 5163 5164@Article{ castro2011full, 5165 author = {A. M. Castro and P. M. Carrica and F. Stern}, 5166 title = {Full scale self-propulsion computations using discretized propeller for the 5167 {KRISO} container ship {KCS}}, 5168 journal = {Computers and Fluids}, 5169 pages = {35--47}, 5170 year = {2011}, 5171 petsc_uses = {KSP} 5172} 5173 5174@Article{ kandasamy2011multifidelity, 5175 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5176 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5177 title = {Multi-fidelity Optimization of a High-speed Foil-assisted Semi-planing {C}atamaran 5178 for Low Wake}, 5179 journal = {Journal of Marine Science and Technology}, 5180 pages = {143--156}, 5181 year = {2011}, 5182 petsc_uses = {KSP} 5183} 5184 5185@Article{ kandasamy2011cfd, 5186 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern and E. F. Campana and 5187 D. Peri and P. Osborne and J. Cote and N. Macdonald and N. de Waal}, 5188 title = {{CFD} Validation Studies for a High-speed Foil-assisted Semi-planing {C}atamaran}, 5189 journal = {Journal of Marine Science and Technology}, 5190 pages = {157--167}, 5191 year = {2011}, 5192 petsc_uses = {KSP} 5193} 5194 5195@Article{ sadathosseini2011cfd, 5196 author = {H. Sadat-Hosseini and P. M. Carrica and F. Stern and N. Umeda and H. Hashimoto 5197 and S. Yamamura and A. Mastuda}, 5198 title = {{CFD} System-Based and {EFD} Study of Ship Dynamic Instability Events: Surf Riding, 5199 Periodic Motion and Broaching}, 5200 journal = {Ocean Engineering}, 5201 pages = {88--110}, 5202 year = {2011}, 5203 petsc_uses = {KSP} 5204} 5205 5206@Article{ mosaviraad2010development, 5207 author = {M. Mosaviraad and P. M. Carrica and F. Stern}, 5208 title = {Development and Validation of Harmonic Wave Group Single-Run Procedure for {RAO} 5209 with Comparison to Regular Wave and Transient Wave Group Procedures Using 5210 {URANS}}, 5211 journal = {Ocean Engineering}, 5212 pages = {653--666}, 5213 year = {2010}, 5214 petsc_uses = {KSP} 5215} 5216 5217@Article{ carrica2010largescale, 5218 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5219 Stern}, 5220 title = {Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5221 Heave Problems for a Surface Combatant}, 5222 journal = {Computers and Fluids}, 5223 pages = {1095--1111}, 5224 year = {2010}, 5225 petsc_uses = {KSP} 5226} 5227 5228@Article{ carrica2010selfpropulsion, 5229 author = {P. M. Carrica and A. M. Castro and F. Stern}, 5230 title = {Self-Propulsion Computations Using Speed Controller and Discretized Propeller 5231 with Dynamic Overset Grids}, 5232 journal = {Journal of Marine Science and Technology}, 5233 pages = {316--330}, 5234 year = {2010}, 5235 petsc_uses = {KSP} 5236} 5237 5238@Article{ ismail2010evaluation, 5239 author = {F. Ismail and P. M. Carrica and T. Xing and F. Stern}, 5240 title = {Evaluation of Linear and Non-Linear Convection Schemes on Multidimensional 5241 Non-Orthogonal Grids with Applications to {KVLCC}2 Tanker}, 5242 journal = {International Journal of Numerical Methods in Fluids}, 5243 pages = {850--886}, 5244 year = {2010}, 5245 petsc_uses = {KSP} 5246} 5247 5248@Article{ kandasamy2010integral, 5249 author = {M. Kandasamy and S. K. Ooi and P. M. Carrica and F. Stern}, 5250 title = {Integral Force/Moment Waterjet Model for {CFD} Simulations}, 5251 journal = {Journal of Fluids Engineering}, 5252 pages = {101103}, 5253 year = {2010}, 5254 petsc_uses = {KSP} 5255} 5256 5257@Article{ kirk:2014de, 5258 author = {Kirk, Benjamin S and Stogner, Roy H and Bauman, Paul T and Oliver, Todd A}, 5259 title = {{Modeling hypersonic entry with the fully-implicit {N}avier--{S}tokes (FIN-S) 5260 stabilized finite element flow solver}}, 5261 journal = {Computers {\&} Fluids}, 5262 year = {2014}, 5263 volume = {92}, 5264 number = {0}, 5265 pages = {281--292}, 5266 month = mar, 5267 petsc_uses = {KSP} 5268} 5269 5270@Article{ carracciuolo20111382, 5271 title = {Computational simulations of {3D} large-scale time-dependent viscoelastic flows 5272 in high performance computing environment}, 5273 journal = {Journal of Non-Newtonian Fluid Mechanics }, 5274 volume = {166}, 5275 number = {23--24}, 5276 pages = {1382--1395}, 5277 year = {2011}, 5278 issn = {0377-0257}, 5279 doi = {10.1016/j.jnnfm.2011.08.014}, 5280 author = {L. Carracciuolo and D. Casaburi and L. D’Amore and G. D’Avino and P.L. 5281 Maffettone and A. Murli}, 5282 keywords = {Parallel computations, Viscoelastic flows, DEVSS-G, \{PETSc\}, Finite element 5283 method, High performance computing}, 5284 petsc_uses = {KSP} 5285} 5286 5287@Article{ bungartzgatzhammerliebmehlneckel11, 5288 author = {Bungartz, Hans-Joachim and Gatzhammer, Bernhard and Lieb, Michael and Mehl, 5289 Miriam and Neckel, Tobias}, 5290 title = {Towards multi-phase flow simulations in the PDE framework Peano}, 5291 journal = {Computational Mechanics}, 5292 volume = {48}, 5293 number = {3}, 5294 pages = {365-376}, 5295 year = {2011}, 5296 issn = {0178-7675}, 5297 doi = {10.1007/s00466-011-0626-1}, 5298 publisher = {Springer-Verlag}, 5299 keywords = {PDE framework; Octree-like Cartesian grids; Computational fluid dynamics; 5300 Thermohydraulics; Two-phase flow}, 5301 language = {English}, 5302 petsc_uses = {KSP} 5303} 5304 5305@Article{ bpr:cfl, 5306 author = {H.~M. B{\"u}cker and B. Pollul and A. Rasch}, 5307 title = {{On {CFL} Evolution Strategies for Implicit Upwind Methods in Linearized {E}uler 5308 Equations}}, 5309 journal = {International Journal for Numerical Methods in Fluids}, 5310 year = {2009}, 5311 volume = {59}, 5312 number = {1}, 5313 pages = {1--18}, 5314 doi = {10.1002/fld.1798}, 5315 petsc_uses = {KSP} 5316} 5317 5318@InBook{ bonfiglioli_campobasso_carpentieri_2010, 5319 author = {Bonfiglioli, A and Campobasso, M S and Carpentieri, B}, 5320 title = {Parallel unstructured three-dimensional turbulent flow analyses using efficiently 5321 preconditioned newton-krylov solver}, 5322 publisher = {Curran Associates}, 5323 year = {2010}, 5324 url = {http://www.proceedings.com/05932.html}, 5325 petsc_uses = {KSP} 5326} 5327 5328@Article{ bonfiglioli_rans_2005, 5329 author = {Paciorri, Renato and Bonfiglioli, Aldo and Di Mascio, Andrea and Favini, 5330 Bernardo}, 5331 title = {RANS simulations of a junction flow}, 5332 journal = {International Journal of Computational Fluid Dynamics}, 5333 volume = {19}, 5334 number = {2}, 5335 pages = {179-189}, 5336 year = {2005}, 5337 doi = {10.1080/10618560410001729126}, 5338 petsc_uses = {KSP} 5339} 5340 5341@InCollection{ bonfiglioli__carpentieri_rans_2008, 5342 author = {Bonfiglioli, A. and Carpentieri, B. and Sosonkina, M.}, 5343 affiliation = {University of Basilicata Dip.to di Ingegneria e Fisica dell’Ambiente Potenza 5344 Italy}, 5345 title = {Performance Analysis of Parallel Algebraic Preconditioners for Solving the RANS 5346 Equations Using Fluctuation Splitting Schemes}, 5347 booktitle = {Numerical Mathematics and Advanced Applications}, 5348 editor = {Kunisch, Karl and Of, Günther and Steinbach, Olaf}, 5349 publisher = {Springer Berlin Heidelberg}, 5350 isbn = {978-3-540-69777-0}, 5351 pages = {151-158}, 5352 doi = {10.1007/978-3-540-69777-0_17}, 5353 year = {2008}, 5354 petsc_uses = {KSP} 5355} 5356 5357@InCollection{ bonfiglioli__carpentieri_ens_2007, 5358 author = {Bonfiglioli, Aldo and Carpentieri, Bruno and Sosonkina, Masha}, 5359 affiliation = {Dip.to di Ingegneria e Fisica dell’Ambiente, University of Basilicata, Potenza, 5360 Italy}, 5361 title = {EulFS: A Parallel {CFD} Code for the Simulation of {Euler and Navier-Stokes} 5362 Problems on Unstructured Grids}, 5363 booktitle = {Applied Parallel Computing. State of the Art in Scientific Computing}, 5364 series = {Lecture Notes in Computer Science}, 5365 editor = {Kågström, Bo and Elmroth, Erik and Dongarra, Jack and Wasniewski, Jerzy}, 5366 publisher = {Springer Berlin / Heidelberg}, 5367 isbn = {978-3-540-75754-2}, 5368 pages = {676-685}, 5369 volume = {4699}, 5370 doi = {10.1007/978-3-540-75755-9_83}, 5371 year = {2007}, 5372 petsc_uses = {KSP} 5373} 5374 5375@Article{ terrelscottknepleykirby08, 5376 author = {Andy R. Terrel and L. Ridgway Scott and Matthew G. Knepley and Robert C. Kirby}, 5377 title = {Automated {FEM} Discretizations for the {Stokes} Equation}, 5378 journal = {BIT}, 5379 volume = {48}, 5380 number = {2}, 5381 year = {2008}, 5382 petsc_uses = {KSP} 5383} 5384 5385@Article{ martamadermartinsweidealonso07, 5386 author = {A. C. Marta and C. A. Mader and J. R. R. A. Martins and E. {Van der Weide} and J. 5387 J. Alonso}, 5388 title = {A methodology for the development of discrete adjoint solvers using automatic 5389 differentiation tools}, 5390 journal = {Computational Fluid Dyanmics}, 5391 volume = {21}, 5392 pages = {307--327}, 5393 year = {2007}, 5394 petsc_uses = {KSP} 5395} 5396 5397@TechReport{ avb2008, 5398 author = {V.R. Ambati and J.J.W. van der Vegt and O. Bokhove}, 5399 title = {Variational Space-time (Dis)continuous {G}alerkin Method for Linear Free Surface 5400 Waves}, 5401 year = {2008}, 5402 institution = {University of Twente, the Netherlands}, 5403 url = {http://eprints.eemcs.utwente.nl/11714/01/memo1863.pdf}, 5404 petsc_uses = {KSP} 5405} 5406 5407@InProceedings{ bdsm2005, 5408 author = {M. Bozkurttas and H. Dong and V. Seshadri and R. Mittal}, 5409 title = {Towards Numerical Simulation of Flapping Foils on Fixed Cartesian Grids}, 5410 booktitle = {43rd AIAA Aerospace Sciences Meeting and Exhibit}, 5411 year = {2005}, 5412 url = {http://project.seas.gwu.edu/~fsagmae/papers/AIAA_2005_0079.pdf}, 5413 petsc_uses = {KSP} 5414} 5415 5416@InProceedings{ ms2006, 5417 author = {S. Muller and Y. Stiriba}, 5418 title = {A MULTILEVEL FINITE VOLUME METHOD WITH MULTISCALE-BASED GRID ADAPTATION FOR 5419 STEADY COMPRESSIBLE FLOWS}, 5420 booktitle = {European Conference on Computational Fluid Dynamics: ECCOMAS CFD 2006}, 5421 year = {2006}, 5422 url = {http://www.numerical.rl.ac.uk/people/marioli/Archives/ECCOMAS-CFD-2006/documents/197.pdf}, 5423 petsc_uses = {KSP} 5424} 5425 5426@Article{ araujoteixeiracunhagroth08, 5427 author = {B. J. Ara\'ujo and J. C. F. Teixeira and A. M. Cunha and C. P. T. Groth}, 5428 title = {Parallel three-dimensional simulation of the injection molding process}, 5429 journal = {International Journal for Numerical Methods in Fluids}, 5430 year = {2008}, 5431 url = {http://www3.interscience.wiley.com/journal/119876958/abstract?CRETRY=1&SRETRY=0}, 5432 petsc_uses = {KSP} 5433} 5434 5435@PhDThesis{ a2008, 5436 author = {A. Cubero}, 5437 title = {a parallel coupled algorithm for collocated grids and its application to Large 5438 Eddy Simulation of a turbulent wake}, 5439 school = {University of Zaragoza (Spain)}, 5440 year = {2008}, 5441 petsc_uses = {KSP} 5442} 5443 5444@Article{ afa2007, 5445 author = {A. Cubero and N. Fueyo}, 5446 title = {A Compact Momentum Interpolation Method for unsteady flows and relaxation}, 5447 journal = {Numerical Heat Transfer, part B-Fundamentals}, 5448 volume = {56}, 5449 number = {6}, 5450 pages = {507--529}, 5451 year = {2007}, 5452 url = {http://www.informaworld.com/smpp/content~content=a782025305~db=all~order=page}, 5453 petsc_uses = {KSP} 5454} 5455 5456@TechReport{ af2007, 5457 title = {Preconditioning based on a partially implicit implementation of Momentum 5458 Interpolation for coupled solvers}, 5459 institution = {Fluid Mechanics Group of the University of Zaragoza (Spain)}, 5460 year = {2007}, 5461 author = {A. Cubero and N. Fueyo}, 5462 petsc_uses = {KSP} 5463} 5464 5465@InCollection{ dwight2004, 5466 author = {Richard Dwight}, 5467 title = {Robust Mesh Deformation using the Linear Elasticity Equations}, 5468 booktitle = {Computational Fluid Dynamics 2006}, 5469 editor = {H. Deconinck and E. Dick}, 5470 publisher = {Springer}, 5471 year = {2006}, 5472 url = {http://www.maths.man.ac.uk/\~{ 5473 }rdwight/pub/rdwight-ICCFD4-LinElastDeformation-2006.pdf}, 5474 petsc_uses = {KSP} 5475} 5476 5477@InProceedings{ dwight2006, 5478 author = {Richard Dwight and Joel Brezillon}, 5479 title = {Effect of Various Approximations of the Discrete Adjoint on Gradient-Based 5480 Optimization}, 5481 booktitle = {Proceedings of the 44th AIAA Aerospace Sciences Meeting and Exhibit, Reno NV. 5482 AIAA-2006-0690}, 5483 year = {2006}, 5484 url = {http://www.maths.man.ac.uk/\~{ }rdwight/pub/rdwight-AIAAReno-ApproxAdjoint.pdf}, 5485 petsc_uses = {KSP} 5486} 5487 5488@PhDThesis{ dwight2006a, 5489 author = {Richard Dwight}, 5490 title = {Efficiency Improvements of {RANS}-Based Analysis and Optimization using Implicit 5491 and Adjoint Methods on Unstructured Grids}, 5492 school = {School of Mathematics, University of Manchester}, 5493 year = {2006}, 5494 url = {http://www.maths.man.ac.uk/\~{ 5495 }rdwight/pub/rdwight-PhDThesis-ImplicitAndAdjoint.pdf}, 5496 petsc_uses = {KSP} 5497} 5498 5499@InProceedings{ lhdfrh, 5500 author = {M. Lauter and D. Handorf and K. Dethloff and S. Frickenhaus and N. Rakowsky and 5501 W. Hiller}, 5502 title = {An adaptive Lagrange-Galerkin shallow-water model on the sphere}, 5503 booktitle = {Workshop Proceedings Current Development in Shallow Water Models on the Sphere 5504 March, 10-14, 2003, Munich University of Technology, German}, 5505 year = {2003}, 5506 petsc_uses = {KSP} 5507} 5508 5509@InProceedings{ brios-ying-2002, 5510 author = {George Biros and Lexing Ying and Denis Zorin}, 5511 title = {The Embedded Boundary Integral Method (EBI) for the Incompressible 5512 {Navier-Stokes} equations}, 5513 booktitle = {IABEM 2002, International Association for Boundary Element Methods, UT Austin}, 5514 year = {2002}, 5515 petsc_uses = {KSP} 5516} 5517 5518@InProceedings{ mohsen-straatman-ins, 5519 author = {S.A. Mohsen Karimian and Anthony G. Straatman}, 5520 title = {Benchmarking of a {3D}, unstructured, finite volume code for incompressible 5521 {Navier-Stokes} equation on a cluster of distributed-memory computers}, 5522 booktitle = {Proceedings of the 19th International Symposium on High Performance Computing 5523 Systems and Applications}, 5524 pages = {11--16}, 5525 year = {2005}, 5526 url = { http://ieeexplore.ieee.org/search/wrapper.jsp?arnumber=1430046}, 5527 petsc_uses = {KSP} 5528} 5529 5530@TechReport{ bonglioli-icnmfd98, 5531 title = {Multidimensional Residual Distribution Schemes for the Pseudo-Compressible 5532 {Euler} and {Navier-Stokes} equations on Unstructured Meshes}, 5533 institution = {Universita della Basilicata via della Tecnica 3}, 5534 year = {1996}, 5535 author = {A. Bonglioli}, 5536 url = {http://www.unibas.it/utenti/bonfiglioli/icnmfd98.ps.gz}, 5537 petsc_uses = {KSP} 5538} 5539 5540@Article{ deng-piquet-ctf, 5541 author = {G. B. Deng and J. Piquet and X. Vasseur and M. Visonneau"}, 5542 title = {A new fully coupled method for computing turbulent flows}, 5543 journal = {Computers and Fluids}, 5544 volume = {30}, 5545 pages = {445--472}, 5546 year = {2001}, 5547 petsc_uses = {KSP} 5548} 5549 5550@InProceedings{ knepleysarinsameh99b, 5551 title = {Multilevel Preconditioning for Parallel {CFD}}, 5552 author = {Matthew G. Knepley and Vivek Sarin and Ahmed H. Sameh}, 5553 booktitle = {International Conference On Preconditioning Techniques For Large Sparse Matrix 5554 Problems In Industrial Applications}, 5555 address = {Minneapolis, MN}, 5556 year = {1999}, 5557 petsc_uses = {KSP} 5558} 5559 5560@InProceedings{ garbey1, 5561 author = {M. Garbey and B. Hadri and W. Shyy.}, 5562 title = {Fast Elliptic Solver for Incompressible {Navier Stokes} Flow and Heat Transfer 5563 Problems on the Grid}, 5564 booktitle = {Aerospace Sciences Meeting and Exhibit}, 5565 note = {Paper No. 2005-1386}, 5566 year = {2005}, 5567 petsc_uses = {KSP} 5568} 5569 5570@Article{ carrica2007unsteady, 5571 title = {An unsteady single-phase level set method for viscous free surface flows}, 5572 author = {Carrica, PM and Wilson, RV and Stern, F.}, 5573 journal = {International Journal for Numerical Methods in Fluids}, 5574 volume = {53}, 5575 number = {2}, 5576 pages = {229--256}, 5577 year = {2007}, 5578 publisher = {Chichester; New York: Wiley, c1981-}, 5579 petsc_uses = {KSP} 5580} 5581 5582@Article{ pctw2004, 5583 author = {M. S. Politano and P. M. Carrica and C. Turan and L. Weber}, 5584 title = {A Multidimensional Two-Phase Flow Model for the Total Dissolved Gas Downstream of 5585 Spillways}, 5586 journal = {Journal of Hydraulic Research}, 5587 note = {accepted for publication}, 5588 year = {2004}, 5589 petsc_uses = {KSP} 5590} 5591 5592@Article{ wcs2004, 5593 author = {R. V. Wilson and P. M. Carrica and F. Stern}, 5594 title = {Unsteady RANS Method for Ship Motions with Application to Roll for a Surface 5595 Combatant}, 5596 journal = {Computers and Fluids}, 5597 note = {in press}, 5598 year = {2004}, 5599 petsc_uses = {KSP} 5600} 5601 5602@Article{ cws2005, 5603 author = {P. M. Carrica and R. V. Wilson and F. Stern}, 5604 title = {Unsteady RANS Simulation of the Ship Forward Speed Diffraction Problem}, 5605 journal = {Computers and Fluids}, 5606 note = {accepted for publication}, 5607 year = {2005}, 5608 petsc_uses = {KSP} 5609} 5610 5611@Article{ chndss2010, 5612 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5613 Stern}, 5614 title = { Large-Scale {DES} Computations of the Forward Speed Diffraction and Pitch and 5615 Heave Problems for a Surface Combatant}, 5616 journal = {Computers and Fluids}, 5617 year = {2010}, 5618 volume = {39}, 5619 number = {7}, 5620 pages = {1095--1111}, 5621 petsc_uses = {KSP} 5622} 5623 5624@InProceedings{ chnkss2008, 5625 author = {P. M. Carrica and J. Huang and R. Noack and D. Kaushik and B. Smith and F. 5626 Stern}, 5627 title = {Toward Large-Scale Computations of Ship Motions with Dynamic Overset Curvilinear 5628 Grids}, 5629 booktitle = {Proceedings of the 27th Symposium on Naval Hydrodynamics, Seoul, Korea}, 5630 year = {2008}, 5631 petsc_uses = {KSP} 5632} 5633 5634@MastersThesis{ mtj, 5635 author = {M. T. Jozkowski}, 5636 title = {Application of Algebraic Multigrid Methods to the Solution of Stratified Flows 5637 About Submerged Bodies}, 5638 school = {The Pennsylvania State University}, 5639 year = {2005}, 5640 petsc_uses = {KSP} 5641} 5642 5643@Article{ pp, 5644 author = {E. G. Paterson and L. J. Peltier}, 5645 title = {Detached-Eddy Simulation of High Reynolds Number Beveled-Trailing-Edge Flows and 5646 Wakes}, 5647 journal = {ASME Journal of Fluids Engineering}, 5648 note = {In press}, 5649 year = {2005}, 5650 petsc_uses = {KSP} 5651} 5652 5653@Article{ eps, 5654 author = {B. A. Edge and E. G. Paterson and G. Settles}, 5655 title = {Computational Study of the Wake and Contaminant Transport of a Walking Human}, 5656 journal = {ASME Journal of Fluids Engineering}, 5657 note = {In press}, 5658 year = {2005}, 5659 petsc_uses = {KSP} 5660} 5661 5662@InProceedings{ rp, 5663 author = {B. Racine and E. G. Paterson}, 5664 title = {Computation of Maneuvering Coefficients for Non-Body-of-Revolution Submarines 5665 Using Unsteady {RANS} {CFD}}, 5666 booktitle = {35th AIAA Fluid Dynamics Conference and Exhibit}, 5667 year = {2005}, 5668 petsc_uses = {KSP} 5669} 5670 5671@InProceedings{ etpp, 5672 author = {B. A. Edge and M. F. Trujillo and E. G. Paterson and L. J. Peltier}, 5673 title = {Prediction of Forces and Moments on a Sonobuoy Configuration Using Overset Grids 5674 and DES}, 5675 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5676 year = {2004}, 5677 petsc_uses = {KSP} 5678} 5679 5680@InProceedings{ pp8, 5681 author = {E. G. Paterson and L. J. Peltier}, 5682 title = {Localized turbulence simulation for naval hydrodynamics: issues in using overset 5683 refinement grids and detached-eddy simulation}, 5684 booktitle = {7th Overset Composite Grid and Solution Technology Symposium}, 5685 year = {2004}, 5686 petsc_uses = {KSP} 5687} 5688 5689@InProceedings{ mzwp, 5690 author = {R. Meyer and F. J. Zajackowski and W. A. Straka,and E. G. Paterson}, 5691 title = {Experimental and Computational Study of Cavitation Inception on Co-Flow Nozzles}, 5692 booktitle = {25th Symposium on Naval Hydrodynamics}, 5693 year = {2004}, 5694 petsc_uses = {KSP} 5695} 5696 5697@InProceedings{ ppph, 5698 author = {E. G. Paterson and J. E. Poremba and L. J. Peltier and S. A. Hambric}, 5699 title = {A Physics-Based Simulation Methodology for Predicting Trailing-Edge Singing}, 5700 booktitle = {25th Symposium on Naval Hydrodynamics}, 5701 year = {2004}, 5702 petsc_uses = {KSP} 5703} 5704 5705@InProceedings{ ppd, 5706 author = {E. G. Paterson and L. J. Peltier}, 5707 title = {Detached-Eddy Simulation of High Reynolds Number Trailing-Edge Flows and Wakes}, 5708 booktitle = {Symposium on LES Advancements and Applications, ASME FED Summer Meeting}, 5709 year = {2004}, 5710 petsc_uses = {KSP} 5711} 5712 5713@InProceedings{ bp, 5714 author = {W. J. Baker and E. G. and Paterson}, 5715 title = {Simulation of Steady Circulation Control for the General Aviation Circulation 5716 Control Wing}, 5717 booktitle = {NASA/ONR Workshop on Circulation Control}, 5718 year = {2004}, 5719 petsc_uses = {KSP} 5720} 5721 5722@InProceedings{ pb, 5723 author = {E. G. Paterson and W. J. Baker}, 5724 title = {RANS and Detached-Eddy Simulation of the NCCR airfoil}, 5725 booktitle = {NASA/ONR Workshop on Circulation Control}, 5726 year = {2004}, 5727 petsc_uses = {KSP} 5728} 5729 5730@InProceedings{ pb3, 5731 author = {E. G. Paterson and W. J. Baker}, 5732 title = {Simulation of Steady and Pulsed Circulation Controlfor Marine-Vehicle Control 5733 Surfaces}, 5734 booktitle = {42nd AIAA Aerospace Sciences Meeting}, 5735 year = {2004}, 5736 petsc_uses = {KSP} 5737} 5738 5739@InProceedings{ gid1, 5740 author = {G. Frank and J. D'Elia}, 5741 title = {{CFD} Modelling of the Flow Around the {Ahmed} Vehicle Model}, 5742 year = {2004}, 5743 booktitle = {Proceedings of the 2nd Conference on Advances and Applications of GiD}, 5744 url = {http://www.gid.cimne.upc.es/2004/papers/p216.pdf}, 5745 petsc_uses = {KSP} 5746} 5747 5748@InBook{ b1, 5749 author = {A.Bonfiglioli}, 5750 chapter = {On the use of the PETSc library for unstructured {CFD} applications}, 5751 year = {2001}, 5752 title = {Science and Supercomputing at CINECA}, 5753 pages = {397--400}, 5754 petsc_uses = {KSP} 5755} 5756 5757@InProceedings{ b2004, 5758 author = {L. A. Barba}, 5759 title = {Computing high-Reynolds number vortical flows: a highly accurate method with a 5760 fully meshless formulation}, 5761 year = {2004}, 5762 booktitle = {International Conference on Parallel CFD, Grand Canary, May 2004}, 5763 note = {Submitted}, 5764 petsc_uses = {KSP} 5765} 5766 5767@InProceedings{ bl2004, 5768 author = {L. A. Barba and A. Leonard}, 5769 title = {Computation of Viscous Vortices with Fully Meshless Method}, 5770 year = {2004}, 5771 booktitle = {Proceedings of ICTAM meeting in Warsaw, August 2004}, 5772 note = {Submitted}, 5773 petsc_uses = {KSP} 5774} 5775 5776@Article{ vws1, 5777 author = {B. G. M. Van Wachem and J. C. Schouten}, 5778 title = {Experimental Validation of 3-D Lagrangian VOF Model: Bubble Shape and Rise 5779 Velocity}, 5780 institution = {Laboratory of Chemical Reactor Engineering, Department of Chemical Engineering 5781 and Chemistry, Eindhoven University of Technology, 5600 MB Eindhoven, The 5782 Netherlands}, 5783 journal = {AIChE}, 5784 volumne = {48}, 5785 number = {12}, 5786 month = dec, 5787 year = {2002}, 5788 petsc_uses = {KSP} 5789} 5790 5791@TechReport{ lbam1, 5792 author = {P. Leggiero and A. Bonfiglioli and P. Amodio and F. Mazzi}, 5793 title = {Precondizionatori paralleli per la fluidodinamica computazionale}, 5794 institution = {Dipartimento Interuniversitario di Matematica Universiti degli Studi-Politecnico 5795 di Bari Italy}, 5796 year = {2002}, 5797 number = {25/02}, 5798 petsc_uses = {KSP} 5799} 5800 5801@Article{ kees_miller_02, 5802 author = {C. E. Kees and C. T. Miller}, 5803 title = {Higher Order Time Integration Methods for Two-Phase Flow}, 5804 journal = {Advances in Water Resources}, 5805 year = {2002}, 5806 volume = {25}, 5807 number = {2}, 5808 pages = {159-177.}, 5809 petsc_uses = {KSP} 5810} 5811 5812@InProceedings{ lepotmeersessers2001, 5813 author = {I. Lepot and F. Meers and J.A. Essers}, 5814 title = {Multilevel Parallel High Order Schemes for Invisid Flow Computations on 3D 5815 Unstructured Meshes}, 5816 year = {2001}, 5817 booktitle = {ECCOMAS Computational Fluid Dynamics Conference 2001}, 5818 url = {http://www.ulg.ac.be/aerodyn}, 5819 petsc_uses = {KSP} 5820} 5821 5822@InProceedings{ knepley98, 5823 author = {Matthew Knepley and Denis Vanderstraeten}, 5824 title = {Parallel Building Blocks for Finite Element Simulations: Application to 5825 Solid-Liquid Mixture Flows}, 5826 booktitle = {Proceedings of Parallel CFD'97}, 5827 publisher = {Elsevier}, 5828 pages = {281--287}, 5829 year = {1998}, 5830 petsc_uses = {KSP} 5831} 5832 5833@InProceedings{ pcfd97, 5834 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 5835 title = {Parallel Implicit {PDE} Computations: Algorithms and Software}, 5836 publisher = {Elsevier}, 5837 year = {1998}, 5838 booktitle = {Proceedings of Parallel CFD'97}, 5839 pages = {333-344}, 5840 petsc_uses = {KSP} 5841} 5842 5843@InProceedings{ knepleysamehsari98, 5844 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 5845 title = {Parallel Simulation of Particulate Flows}, 5846 booktitle = {Solving Irregularly Structured Problems in Parallel}, 5847 editors = {A. Ferreira et al}, 5848 year = {1998}, 5849 series = {Lecture Notes in Computer Science}, 5850 volume = {1457}, 5851 pages = {226--237}, 5852 petsc_uses = {KSP} 5853} 5854 5855@Article{ gkmt98, 5856 author = {William D. Gropp and David E. Keyes and Lois Curfman McInnes and M. D. Tidriri}, 5857 title = {Globalized {N}ewton-{K}rylov-{S}chwarz Algorithms and Software for Parallel 5858 Implicit {CFD}}, 5859 journal = {Int. J. High Performance Computing Applications}, 5860 year = {2000}, 5861 volume = {14}, 5862 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P788.ps.Z}, 5863 pages = {102-136}, 5864 petsc_uses = {KSP} 5865} 5866 5867@InProceedings{ agkks-sc99, 5868 author = {W. K. Anderson and W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. 5869 Smith}, 5870 title = {Achieving High Sustained Performance in an Unstructured Mesh {CFD} Application}, 5871 booktitle = {ACM/IEEE Proc. of SC 99: High Performance Networking and Computing}, 5872 editor = {}, 5873 publisher = {}, 5874 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P776.ps.Z}, 5875 year = {1999}, 5876 note = {Winner of Gordon Bell Special Prize at SC 99}, 5877 petsc_uses = {KSP} 5878} 5879 5880@Article{ gkks01, 5881 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5882 title = {High Performance Parallel Implicit {CFD}}, 5883 journal = {Journal of Parallel Computing}, 5884 year = {2001}, 5885 volume = {27}, 5886 pages = {337-362}, 5887 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/manke.pdf}, 5888 petsc_uses = {KSP} 5889} 5890 5891@Article{ cristea-sofonea-02, 5892 author = {Artur Cristea and Victor Sofonea}, 5893 title = {Finite Difference lattice Boltzmann model for Liquid Vapour Systems}, 5894 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 5895 Sciences, Information Sciences}, 5896 volume = {3}, 5897 number = {3}, 5898 year = {2002}, 5899 petsc_uses = {KSP} 5900} 5901 5902@Article{ cristea2, 5903 author = {Artur Cristea and Victor Sofonea}, 5904 title = {Two component lattice Boltzmann model with flux limiter techniques}, 5905 journal = {Proceedings of the Romanian Academy, Series A: Mathematics, Physics, Technical 5906 Sciences, Information Sciences}, 5907 volume = {4}, 5908 number = {1}, 5909 year = {2003}, 5910 pages = {59--64}, 5911 petsc_uses = {KSP} 5912} 5913 5914@Article{ cristea1, 5915 author = {Artur Cristea and Victor Sofonea}, 5916 title = {Two component lattice Boltzmann model with flux limiters}, 5917 journal = {Central European Journal of Physics}, 5918 volume = {2}, 5919 number = {2}, 5920 year = {2004}, 5921 pages = {382--396}, 5922 petsc_uses = {KSP} 5923} 5924 5925@Article{ sofnea-lamura1, 5926 author = {Victor Sofonea and Antonio Lamura and Giuseppe Gonnella and Artur Cristea}, 5927 title = {Finite-difference lattice Boltzmann model with flux limiters for liquid-vapor 5928 systems}, 5929 journal = {Physical Review E}, 5930 volume = {70}, 5931 number = {4}, 5932 year = {2004}, 5933 pages = {046702-1 / 046702-9}, 5934 petsc_uses = {KSP} 5935} 5936 5937@InProceedings{ gkks01b, 5938 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5939 title = {Latency, Bandwidth, and Concurrent Issue Limitations in High-Performance {CFD}}, 5940 booktitle = {Proceedings of the First MIT Conference on Computational Fluid and Solid 5941 Mechanics}, 5942 editor = {}, 5943 location = {Cambridge, MA}, 5944 year = {2001}, 5945 month = jun, 5946 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/mit01.pdf}, 5947 petsc_uses = {KSP} 5948} 5949 5950@InProceedings{ gkks00, 5951 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5952 title = {Understanding the Parallel Scalability of An Implicit Unstructured Mesh {CFD} 5953 Code}, 5954 booktitle = {Proceedings of the 7th International Conference on High Performance Computing 5955 (HiPC '2000)}, 5956 editor = {}, 5957 location = {Bangalore, India}, 5958 year = {2000}, 5959 pages = {395--404}, 5960 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/hipc00.pdf}, 5961 petsc_uses = {KSP} 5962} 5963 5964@InProceedings{ gkks-sc00, 5965 author = {W. D. Gropp and D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5966 title = {Performance Modeling and Tuning of an Unstructured Mesh {CFD} Application}, 5967 booktitle = {Proceedings of SC2000}, 5968 editor = {}, 5969 publisher = {IEEE Computer Society}, 5970 year = {2000}, 5971 url = {http://www.mcs.anl.gov/petsc-fun3d/Papers/sc00.pdf}, 5972 petsc_uses = {KSP} 5973} 5974 5975@InProceedings{ knepleysamehsarin99, 5976 author = {Matthew Knepley and Ahmed H. Sameh and Vivek Sarin}, 5977 title = {Design of Large Scale Parallel Simulations}, 5978 booktitle = {Proceedings of Parallel CFD'99}, 5979 editors = {A. {Ecer et al.}}, 5980 publisher = {Elsevier}, 5981 year = {1999}, 5982 petsc_uses = {KSP} 5983} 5984 5985@InProceedings{ gkks-pcfd99, 5986 author = {William D. Gropp and Dinesh K. Kaushik and David E. Keyes and Barry F. Smith}, 5987 title = {Towards Realistic Performance Bounds for Implicit {CFD} codes}, 5988 booktitle = {Proceedings of Parallel CFD'99}, 5989 editors = {A. {Ecer et al.}}, 5990 publisher = {Elsevier}, 5991 url = {http://www.cs.odu.edu/~keyes/papers/pcfd99_gkks.pdf}, 5992 year = {1999}, 5993 petsc_uses = {KSP} 5994} 5995 5996@InProceedings{ kks97, 5997 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 5998 title = {On the Interaction of Architecture and Algorithm in the Domain-Based 5999 Parallelization of an Unstructured Grid Incompressible Flow Code}, 6000 booktitle = {Proceedings of the 10th International Conference on Domain Decomposition 6001 Methods}, 6002 editor = {J. Mandel et al.}, 6003 pages = {311--319}, 6004 publisher = {Wiley}, 6005 note = {}, 6006 year = {1997}, 6007 petsc_uses = {KSP} 6008} 6009 6010@InProceedings{ kks99, 6011 author = {D. K. Kaushik and D. E. Keyes and B. F. Smith}, 6012 title = {{N}ewton-{K}rylov-{S}chwarz Methods for Aerodynamic Problems: Compressible and 6013 Incompressible Flows on Unstructured Grids}, 6014 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 6015 Methods}, 6016 editors = {C.-H. {Lai et al.}}, 6017 publisher = {Domain Decomposition Press, Bergen}, 6018 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P745.ps.Z}, 6019 year = {1999}, 6020 petsc_uses = {KSP} 6021} 6022 6023@InCollection{ kks97_cfd, 6024 author = {D. E. Keyes and D. K. Kaushik and B. F. Smith}, 6025 title = {Perspectives for {CFD} on Petaflops Systems}, 6026 booktitle = {CFD Review 1998}, 6027 editor = {M. Hafez and K. Oshima}, 6028 publisher = {World Scientific, Singapore}, 6029 pages = {1079--1096}, 6030 note = {}, 6031 year = {1998}, 6032 petsc_uses = {KSP} 6033} 6034 6035@Article{ hm99, 6036 author = {P. D. Hovland and L. C. McInnes}, 6037 title = {Parallel Simulation of Compressible Flow Using Automatic Differentiation and 6038 {PETSc}}, 6039 year = {2000}, 6040 journal = {Parallel Computing}, 6041 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P796.ps.Z}, 6042 note = {special issue of Parallel Computing on ``Parallel Computing in Aerospace''}, 6043 petsc_uses = {KSP} 6044} 6045 6046@InProceedings{ cruzbarbaknepley08, 6047 author = {Felipe A. Cruz and Lorena A. Barba and Matthew G. Knepley}, 6048 title = {Fast Multipole Method for particle interactions: an open source parallel library 6049 component}, 6050 booktitle = {Proceedings of ParCFD2008}, 6051 year = {2008}, 6052 editor = {Tromeur-Dervout et. al.}, 6053 publisher = {Elsevier}, 6054 petsc_uses = {KSP} 6055} 6056 6057@Article{ hwangcai05, 6058 author = {F.-N. Hwang and X.-C. Cai}, 6059 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 6060 for incompressible {Navier-Stokes} equations}, 6061 journal = {J. Comput. Phys.}, 6062 volume = {204}, 6063 year = {2005}, 6064 pages = {666--691}, 6065 petsc_uses = {KSP} 6066} 6067 6068@Article{ barbaleonard07, 6069 author = {Lorena A Barba and Anthony Leonard}, 6070 title = {Emergence and evolution of tripole vortices from net-circulation initial 6071 conditions}, 6072 journal = {Phys. Fluids}, 6073 volume = {19}, 6074 pages = {017101}, 6075 year = {2007}, 6076 doi = {10.1063/1.2409734}, 6077 petsc_uses = {KSP} 6078} 6079 6080@Article{ barba07, 6081 author = {Lorena A Barba}, 6082 title = {Non-shielded multipolar vortices at high Reynolds number}, 6083 journal = {Phys. Rev. E}, 6084 volume = {73}, 6085 pages = {065303}, 6086 year = {2006}, 6087 doi = {10.1103/PhysRevE.73.065303}, 6088 petsc_uses = {KSP} 6089} 6090 6091@Article{ schofield2010multi, 6092 title = {Multi-material incompressible flow simulation using the moment-of-fluid method}, 6093 author = {Schofield, S.P. and Christon, M.A. and Dyadechko, V. and Garimella, R.V. and 6094 Lowrie, R.B. and Swartz, B.K.}, 6095 journal = {International Journal for Numerical Methods in Fluids}, 6096 volume = {63}, 6097 number = {8}, 6098 pages = {931--952}, 6099 year = {2010}, 6100 publisher = {Wiley Online Library}, 6101 petsc_uses = {KSP} 6102} 6103 6104% LiteralHTML: 6105% LiteralHTML: <a name="wave"><H3><center>Wave propagation and the Helmholtz equation</center></H3> 6106% LiteralHTML: 6107% LiteralHTML: article{DeGersem99, 6108% LiteralHTML: author = {Ji Wng and Yu Wang and Wen-ke Hu and Jian-ke Du}, 6109% LiteralHTML: title = {The high performance of finite element analysis and applications of surface acoustic waves in finite elastic solids}, 6110% LiteralHTML: } 6111@Article{ nagler2014, 6112 title = {Sound transmission through a poroelastic layered panel}, 6113 author = {Loris Nagler and Ping Rong and Martin Schanz and Otto von Estorff}, 6114 journal = {Computational Mechanics}, 6115 volume = {53}, 6116 number = {4}, 6117 pages = {549--560}, 6118 issn = {1432-0924}, 6119 doi = {10.1007/s00466-013-0916-x}, 6120 year = {2014}, 6121 petsc_uses = {KSP} 6122} 6123 6124@Article{ sheikh2013, 6125 author = {Sheikh, A. H. and Lahaye, D. and Vuik, C.}, 6126 title = {On the convergence of shifted {L}aplace preconditioner combined with multilevel 6127 deflation}, 6128 journal = {Numerical Linear Algebra with Applications}, 6129 volume = {20}, 6130 number = {4}, 6131 issn = {1099-1506}, 6132 doi = {10.1002/nla.1882}, 6133 pages = {645--662}, 6134 keywords = {Helmholtz equation, shifted Laplace preconditioner, multigrid deflation, Fourier 6135 analysis}, 6136 year = {2013}, 6137 petsc_uses = {KSP} 6138} 6139 6140@InProceedings{ silence, 6141 author = {J.M. and Alonso and G. Garcia and V. Hernandez and F.D. Denia and F.J. 6142 Fuenmayor}, 6143 title = {A parallel computing approach for solving the Helmholtz equation in 3D domains: 6144 Application to the study of acoustic behaviour of silencers}, 6145 year = {2004}, 6146 booktitle = {Eurppean Congress on Computational Methods in Applied Sciences and Engineering 6147 (ECCOMAS)}, 6148 petsc_uses = {KSP} 6149} 6150 6151@Article{ degersem99, 6152 author = {H. De Gersem and Domenico Lahaye and S. Vandewalle and K. Hameyer}, 6153 title = {Comparison of Quasi Minimal Residual and Bi-Conjugate Gradient Iterative Methods 6154 to Solve Complex Symmetric Systems Arising from Time-Harmonic Simulations}, 6155 journal = {COMPEL}, 6156 year = {1999}, 6157 volume = {18}, 6158 number = {3}, 6159 pages = {298--310}, 6160 bibdate = {}, 6161 petsc_uses = {KSP} 6162} 6163 6164@InProceedings{ widlund-wave-98, 6165 author = {Olof B. Widlund}, 6166 title = {Schwarz Methods for {H}elmholtz's Equation}, 6167 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6168 editor = {John A. DeSanto}, 6169 year = {1998}, 6170 publisher = {SIAM}, 6171 pages = {620--622}, 6172 address = {Philadelphia}, 6173 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6174 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6175 petsc_uses = {KSP} 6176} 6177 6178@InProceedings{ toselli-wave-98, 6179 author = {Andrea Toselli}, 6180 title = {Overlapping {S}chwarz Methods for {M}axwell's Equations in Conductive Media}, 6181 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6182 editor = {John A. DeSanto}, 6183 year = {1998}, 6184 publisher = {SIAM}, 6185 address = {Philadelphia}, 6186 pages = {540--542}, 6187 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6188 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6189 petsc_uses = {KSP} 6190} 6191 6192@InProceedings{ mcinnes-wave-98, 6193 author = {L. C. McInnes and R. Susan-Resiga and H. M. Atassi and D. E. Keyes}, 6194 title = {Parallel Solution of {H}elmholtz Problems using Additive {S}chwarz Methods}, 6195 booktitle = {Mathematical and Numerical Aspects of Wave Propagation}, 6196 editor = {John A. DeSanto}, 6197 year = {1998}, 6198 publisher = {SIAM}, 6199 address = {Philadelphia}, 6200 pages = {623--625}, 6201 note = {Proceedings of the Fourth International Conference on Mathematical and Numerical 6202 Aspects of Wave Propagation, Golden, Colorado, June 1--5}, 6203 petsc_uses = {KSP} 6204} 6205 6206@InProceedings{ mska98, 6207 author = {L. C. McInnes and R. Susan-Resiga and D. E. Keyes and H. M. Atassi}, 6208 title = {Additive {S}chwarz Methods with Nonreflecting Boundary Conditions for the 6209 Parallel Computation of {H}elmholtz Problems}, 6210 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6211 editor = {J. Mandel et al.}, 6212 publisher = {AMS}, 6213 pages = {349--357}, 6214 year = {1998}, 6215 petsc_uses = {KSP} 6216} 6217 6218@InProceedings{ ccew98, 6219 author = {X.-C. Cai and M. A. Casarin, Jr. and F. W. Elliott, Jr. and O. B. Widlund}, 6220 title = {Overlapping {S}chwarz Algorithms for Solving {H}elmholtz's Equation}, 6221 booktitle = {Proceedings of the 10th Intl. Conf. on Domain Decomposition Methods}, 6222 editor = {J. Mandel et al.}, 6223 publisher = {AMS}, 6224 pages = {437-445}, 6225 year = {1998}, 6226 petsc_uses = {KSP} 6227} 6228 6229@InProceedings{ ra98a, 6230 author = {R. Susan-Resiga and H. M. Atassi}, 6231 title = {Parallel Computing Using {S}chwarz Domain Decomposition Method for Aeroacoustic 6232 Problems}, 6233 booktitle = {Proceedings of the 4th AIAA/CEAS Aeroacoustics Conference}, 6234 publisher = {AIAA}, 6235 pages = {86-96}, 6236 note = {AIAA paper 98-2218}, 6237 year = {1998}, 6238 petsc_uses = {KSP} 6239} 6240 6241@InProceedings{ ar98c, 6242 author = {H. M. Atassi and R. Susan-Resiga}, 6243 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {I}: 6244 General Formulation}, 6245 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6246 publisher = {ASME}, 6247 note = {NCA-25}, 6248 pages = {375-379}, 6249 year = {1998}, 6250 petsc_uses = {KSP} 6251} 6252 6253@InProceedings{ ra98b, 6254 author = {R. Susan-Resiga and H. M. Atassi}, 6255 title = {Parallel Computation of Harmonic Waves using Domain Decomposition, Part {II}: 6256 Numerical Implementation and Applications}, 6257 booktitle = {Proceedings of the ASME Noise Control and Acoustics Division}, 6258 publisher = {ASME}, 6259 note = {NCA-25}, 6260 pages = {381 -388}, 6261 year = {1998}, 6262 petsc_uses = {KSP} 6263} 6264 6265@InProceedings{ cai-dd10-98, 6266 author = {Xiao-Chuan Cai and Mario A. Casarin and Frank W. Elliott, Jr. and Olof B. 6267 Widlund}, 6268 title = {Overlapping {S}chwarz methods for solving {H}elmholtz's Equation}, 6269 booktitle = {Domain Decomposition Methods 10}, 6270 editors = {Jan Mandel and Charbel Farhat and Xiao-Chuan Cai}, 6271 series = {Contemporary Mathematics}, 6272 volume = {218}, 6273 publisher = {American Mathematical Society}, 6274 address = {Providence, Rhode Island}, 6275 year = {1998}, 6276 pages = {437--445}, 6277 petsc_uses = {KSP} 6278} 6279 6280@InProceedings{ alghamdi2011petclaw, 6281 title = {Pet{C}law: A Scalable Parallel Nonlinear Wave Propagation Solver for {P}ython}, 6282 booktitle = {Proceedings of SpringSim 2011}, 6283 publisher = {ACM}, 6284 author = {Amal Alghamdi and Aron Ahmadia and David I. Ketcheson and Matthew G. Knepley and 6285 Kyle T. Mandli and Lisandro Dalcin}, 6286 year = {2011}, 6287 petsc_uses = {KSP} 6288} 6289 6290@Article{ pyclaw2012, 6291 author = {David I. Ketcheson and Kyle T. Mandli and Aron J. Ahmadia and Amal Alghamdi and 6292 Manuel Quezada de Luna and Matteo Parsani and Matthew G. Knepley and Matthew 6293 Emmett}, 6294 title = {{PyClaw}: Accessible, Extensible, Scalable Tools for Wave Propagation Problems}, 6295 journal = {SIAM Journal on Scientific Computing}, 6296 volume = {34}, 6297 number = {4}, 6298 pages = {C210--C231}, 6299 note = {\url{http://arxiv.org/abs/1111.6583}}, 6300 year = {2012}, 6301 petsc_uses = {KSP} 6302} 6303 6304% LiteralHTML: 6305% LiteralHTML: <a name="optimization"><H3><center>Optimization</center></H3> 6306% LiteralHTML: 6307@Article{ sojkahorakhaplacermak2018, 6308 title = {The impact of enabling multiple subdomains per MPI process in the TFETI domain 6309 decomposition method}, 6310 author = {Radim Sojka and David Hor{\'a}k and V{\'a}clav Hapla and Martin {\v{C}}erm{\'a}k}, 6311 journal = {Applied Mathematics and Computation}, 6312 volume = {319}, 6313 pages = {586--597}, 6314 year = {2018}, 6315 petsc_uses = {KSP} 6316} 6317 6318@Article{ chencai2014, 6319 title = {A parallel two-level domain decomposition based one-shot method for shape 6320 optimization problems}, 6321 author = {Rongliang Chen and Xiao‐Chuan Cai}, 6322 journal = {International Journal for Numerical Methods in Engineering}, 6323 volume = {99}, 6324 number = {13}, 6325 year = {2014}, 6326 doi = {10.1002/nme.4711}, 6327 petsc_uses = {KSP} 6328} 6329 6330@PhDThesis{ prudencio2005, 6331 author = {Ernesto Prudencio}, 6332 title = {Parallel Fully Coupled {Lagrange-Newton-Krylov-Schwarz} Algorithms and Software 6333 for Optimization Problems Constrained by Partial Differential Equations}, 6334 school = {University of Colorado, Boulder}, 6335 year = {2005}, 6336 petsc_uses = {KSP} 6337} 6338 6339@Article{ prudenciocai2007, 6340 title = {Parallel multilevel restricted {Schwarz} preconditioners with pollution removing 6341 for {PDE}-constrained optimization}, 6342 author = {Ernesto Prudencio and X. C. Cai}, 6343 journal = {SIAM J. Sci. Comp.}, 6344 volume = {29}, 6345 number = {3}, 6346 pages = {964--985}, 6347 year = {2007}, 6348 petsc_uses = {KSP} 6349} 6350 6351@Article{ prudenciobyrdcai2006, 6352 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6353 title = {Parallel full space {SQP Lagrange-Newton-Krylov-Schwarz} algorithms for 6354 {PDE}-constrained Optimization Problems}, 6355 journal = {SIAM J. Sci. Comp.}, 6356 volume = {27}, 6357 pages = {1305--1328}, 6358 year = {2006}, 6359 petsc_uses = {KSP} 6360} 6361 6362@InProceedings{ prudenciobyrdcai2004, 6363 title = {Domain decomposition methods for {PDE}-constrained optimization problems}, 6364 author = {Ernesto Prudencio and R. Byrd and X. C. Cai}, 6365 booktitle = {VECPAR 2004}, 6366 editor = {M. Dayde and J. Dongarra and V. Hernandex and J. Palma}, 6367 publisher = {Springer}, 6368 pages = {569--582}, 6369 year = {2004}, 6370 petsc_uses = {KSP} 6371} 6372 6373@Article{ belhamadia-fortin-pcp, 6374 author = {Youssef Belhamadia and Andre Fortin and Eric Chamberland}, 6375 title = {Three-dimensional anisotropic mesh adaptation for phase change problems}, 6376 journal = {Journal of Computational Physics}, 6377 volume = {201}, 6378 pages = {753-770}, 6379 year = {2004}, 6380 url = {http://portal.acm.org/citation.cfm?id=1055817.1055834#references}, 6381 petsc_uses = {KSP} 6382} 6383 6384@Article{ biros00, 6385 author = {George Biros and Omar Ghattas}, 6386 title = {A {Lagrange-Newton-Krylov-Schur} Method for {PDE} Constrained Optimization}, 6387 journal = {SIAG-Opt Views and News}, 6388 volume = {11}, 6389 number = {2}, 6390 year = {2000}, 6391 month = aug, 6392 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/siag-opt/siag-opt.pdf}, 6393 petsc_uses = {KSP} 6394} 6395 6396@Article{ bmm01, 6397 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 6398 journal = {ACM Transactions on Mathematical Software}, 6399 title = {A case study in the performance and scalability of optimization algorithms}, 6400 year = {2001}, 6401 volume = {27}, 6402 number = {3}, 6403 pages = {361--376}, 6404 petsc_uses = {KSP} 6405} 6406 6407@InProceedings{ oghattas1999, 6408 author = {George Biros and Omar Ghattas}, 6409 title = {Parallel preconditioners for {KKT} systems arising in optimal control of viscous 6410 incompressible flows}, 6411 booktitle = {Proceedings of Parallel CFD '99, Williamsburg, Virginia, USA, May 23-26, 1999}, 6412 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/pcfd99/pcfd99.pdf}, 6413 year = {1999}, 6414 petsc_uses = {KSP} 6415} 6416 6417@InProceedings{ hkms00, 6418 title = {Using Automatic Differentiation for Second-order Matrix-free Methods in 6419 PDE-constrained Optimization}, 6420 author = {P. D. Hovland and D. E. Keyes and L. C. McInnes and W. Samyono}, 6421 url = {http://www.icase.edu/\~{ }keyes/papers/ad2000.ps}, 6422 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 6423 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 6424 Hasco\"{e}t and Uwe Naumann}, 6425 publisher = {Springer}, 6426 year = {2002}, 6427 petsc_uses = {KSP} 6428} 6429 6430% old version: replace with biros2005pln1 6431@TechReport{ bg011, 6432 author = {George Biros and Omar Ghattas}, 6433 title = {Parallel Lagrange-Newton-Krylov-Schur Methods for PDE-Constrained Optimization. 6434 Part I: The Krylov-Schur Solver}, 6435 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6436 year = {2001}, 6437 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks1.pdf}, 6438 petsc_uses = {KSP} 6439} 6440 6441% old version: replace with biros2005pln2 6442@TechReport{ bg012, 6443 author = {George Biros and Omar Ghattas}, 6444 title = {Parallel {Lagrange-Newton-Krylov-Schur} Methods for {PDE}-Constrained 6445 Optimization. Part II: The {Lagrange-Newton} Solver, and its Application to 6446 Optimal Control of Steady Viscous Flows}, 6447 institution = {Laboratory for Mechanics, Algorithms, and Computing, Carnegie Mellon University}, 6448 year = {2001}, 6449 url = {http://www.cs.cmu.edu/\~{ }oghattas/papers/lnks/lnks2.pdf}, 6450 petsc_uses = {KSP} 6451} 6452 6453% LiteralHTML: 6454% LiteralHTML: <a name="fastmethods"><H3><center>Fast Algorithms</center></H3> 6455% LiteralHTML: 6456@InProceedings{ ly2003, 6457 author = {Lexing Ying and G. Biros and D. Zorin and H. Langston}, 6458 title = {A New Parallel Kernel-independent Fast Multipole Method}, 6459 booktitle = {Proceedings of the ACM/IEEE conference on Supercomputing 2003}, 6460 year = {2003}, 6461 note = {Winner of the Best Student Paper at SC2003}, 6462 petsc_uses = {KSP} 6463} 6464 6465@Article{ yokotabarbaknepley10, 6466 author = {Rio Yokota and L A Barba and Matthew G Knepley}, 6467 title = {{PetRBF} -- A parallel {O(N)} algorithm for radial basis function interpolation}, 6468 journal = {Computer Methods in Applied Mechanics and Engineering}, 6469 volume = {199}, 6470 number = {25-28}, 6471 pages = {1793--1804}, 6472 url = {http://arxiv.org/abs/0909.5413v1}, 6473 note = {\url{http://arxiv.org/abs/0909.5413v1}}, 6474 year = {2010}, 6475 petsc_uses = {KSP} 6476} 6477 6478@Article{ cruzknepleybarba10, 6479 author = {Felipe A. Cruz and Matthew G Knepley and L A Barba}, 6480 title = {{PetFMM} -- A dynamically load-balancing parallel fast multipole library}, 6481 journal = {International Journal of Numerical Methods in Engineering}, 6482 volume = {85}, 6483 number = {4}, 6484 pages = {403--428}, 6485 url = {http://arxiv.org/abs/0905.2637}, 6486 note = {\url{http://arxiv.org/abs/0905.2637}}, 6487 year = {2010}, 6488 petsc_uses = {KSP} 6489} 6490 6491% LiteralHTML: 6492% LiteralHTML: <a name="otherapps"><H3><center>Other Application Areas</center></H3> 6493% LiteralHTML: 6494@Article{ buchanpainumplebysmedleystevenson2012, 6495 title = {A sub-grid scale finite element agglomeration multigrid method with application 6496 to the Boltzmann transport equation}, 6497 author = {AG Buchan and CC Pain and AP Umpleby and RP Smedley-Stevenson}, 6498 journal = {International Journal for Numerical Methods in Engineering}, 6499 volume = {92}, 6500 number = {3}, 6501 pages = {318--342}, 6502 year = {2012}, 6503 publisher = {Wiley Online Library}, 6504 petsc_uses = {KSP} 6505} 6506 6507@Article{ magoulesahamedsuzuki2015, 6508 title = {Green computing on graphics processing units}, 6509 author = {Fr{\'e}d{\'e}ric Magoul{\`e}s and Abal-Kassim Cheik Ahamed and Atsushi Suzuki}, 6510 journal = {Concurrency and Computation: Practice and Experience}, 6511 year = {2015}, 6512 publisher = {Wiley Online Library}, 6513 petsc_uses = {KSP} 6514} 6515 6516@InProceedings{ yanrhodes11, 6517 author = {Yan, Baoqiang and Rhodes, Philip J.}, 6518 title = {IDEA -- An API for Parallel Computing with Large Spatial Datasets}, 6519 booktitle = {Proceedings of the 2011 International Conference on Parallel Processing}, 6520 series = {ICPP '11}, 6521 pages = {355--364}, 6522 year = {2011}, 6523 isbn = {978-0-7695-4510-3}, 6524 numpages = {10}, 6525 doi = {10.1109/ICPP.2011.70}, 6526 acmid = {2066965}, 6527 publisher = {IEEE Computer Society}, 6528 address = {Washington, DC, USA}, 6529 keywords = {cluster, parallelization, spatial dataset, dependency, data partitioning}, 6530 petsc_uses = {KSP} 6531} 6532 6533@Article{ hakansson2013mdstochasticliouville, 6534 author = {Hakansson, Par and Nguyen, ThaoNguyen and Nair, Prasanth B. and Edge, Ruth and 6535 Stulz, Eugen}, 6536 title = {Cu(ii)-porphyrin molecular dynamics as seen in a novel EPR/Stochastic Liouville 6537 equation study}, 6538 journal = {Phys. Chem. Chem. Phys.}, 6539 year = {2013}, 6540 volume = {15}, 6541 issue = {26}, 6542 pages = {10930-10941}, 6543 publisher = {The Royal Society of Chemistry}, 6544 doi = {10.1039/C3CP50788B}, 6545 petsc_uses = {KSP} 6546} 6547 6548@Article{ hakansson2011stochasticliouville, 6549 author = {Hakansson, Par and Nair, Prasanth B.}, 6550 title = {Implicit numerical schemes for the stochastic Liouville equation in Langevin 6551 form}, 6552 journal = {Phys. Chem. Chem. Phys.}, 6553 year = {2011}, 6554 volume = {13}, 6555 issue = {20}, 6556 pages = {9578-9589}, 6557 publisher = {The Royal Society of Chemistry}, 6558 doi = {10.1039/C1CP20400A}, 6559 petsc_uses = {KSP} 6560} 6561 6562@InProceedings{ wang:lee:scidac2011, 6563 author = {Lei Wang and Jungho Lee and Mihai Anitescu and Anter El Azab and Lois Curfman 6564 McInnes and Todd Munson and Barry Smith}, 6565 title = {A Differential Variational Inequality Approach for the Simulation of 6566 Heterogeneous Materials}, 6567 booktitle = {Proceedings of SciDAC 2011 Conference}, 6568 year = {2011}, 6569 petsc_uses = {KSP} 6570} 6571 6572@Article{ bourdinlarsenrichardson2011, 6573 author = {Blaise Bourdin and Christopher Larsen and Casey Richardson}, 6574 title = {A time-discrete model for dynamic fracture based on crack regularization}, 6575 journal = {International Journal of Fracture}, 6576 volume = {168}, 6577 issue = {2}, 6578 pages = {133--143}, 6579 doi = {10.1007/s10704-010-9562-x}, 6580 year = {2011}, 6581 petsc_uses = {KSP} 6582} 6583 6584@Article{ bourdinfrancfortmarigo2008, 6585 author = {Blaise Bourdin and Gilles Francfort and Jean-Jacques Marigo}, 6586 title = {The Variational Approach to Fracture}, 6587 journal = {J. Elasticity}, 6588 volume = {91}, 6589 issue = {1}, 6590 pages = {1--148}, 6591 doi = {10.1007/s10659-007-9107-3}, 6592 year = {2008}, 6593 petsc_uses = {KSP} 6594} 6595 6596@Article{ lahtinen2008spectrum, 6597 title = {Spectrum of the non-abelian phase in Kitaev's honeycomb lattice model}, 6598 author = {Lahtinen, V. and Kells, G. and Carollo, A. and Stitt, T. and Vala, J. and Pachos, 6599 J.K.}, 6600 journal = {Annals of Physics}, 6601 volume = {323}, 6602 number = {9}, 6603 pages = {2286--2310}, 6604 year = {2008}, 6605 publisher = {Elsevier}, 6606 petsc_uses = {KSP} 6607} 6608 6609@InProceedings{ roark2004discriminative, 6610 title = {Discriminative language modeling with conditional random fields and the 6611 perceptron algorithm}, 6612 author = {Roark, B. and Saraclar, M. and Collins, M. and Johnson, M.}, 6613 booktitle = {Proceedings of the 42nd Annual Meeting on Association for Computational 6614 Linguistics}, 6615 pages = {47}, 6616 year = {2004}, 6617 organization = {Association for Computational Linguistics}, 6618 petsc_uses = {KSP} 6619} 6620 6621@Article{ roark2007discriminative, 6622 title = {Discriminative n-gram language modeling}, 6623 author = {Roark, B. and Saraclar, M. and Collins, M.}, 6624 journal = {Computer Speech \& Language}, 6625 volume = {21}, 6626 number = {2}, 6627 pages = {373--392}, 6628 year = {2007}, 6629 publisher = {Elsevier}, 6630 petsc_uses = {KSP} 6631} 6632 6633@Conference{ garcia2011parallel, 6634 title = {{Parallel performance of the PETSc Krylov methods applied to linear systems of 3D 6635 nanodevice simulators}}, 6636 author = {Garcia-Rivera, A. and Valin, R. and Seoane, N. and Garcia-Loureiro, A. and 6637 Aldegunde, M.}, 6638 booktitle = {Electron Devices (CDE), 2011 Spanish Conference on}, 6639 pages = {1--4}, 6640 organization = {IEEE}, 6641 petsc_uses = {KSP} 6642} 6643 6644@Conference{ wesley2006parallel, 6645 title = {{A parallel artificial neural network implementation}}, 6646 author = {Wesley-Smith, I.}, 6647 booktitle = {Proceedings of The National Conference On Undergraduate Research (NCUR)}, 6648 year = {2006}, 6649 petsc_uses = {KSP} 6650} 6651 6652@Article{ hcsw1, 6653 author = {F.-N. Hwang and S.-R. Cai and Y.-L. Shao and J.-S. Wu}, 6654 title = {Parallel {N}ewton--{K}rylov--{S}chwarz algorithms for the three-dimensional 6655 {P}oisson--{B}oltzmann equation in numerical simulation of colloidal particle 6656 interactions}, 6657 journal = {Computer Physics Communications}, 6658 volumne = {181}, 6659 year = {2010}, 6660 pages = {1529--1537}, 6661 petsc_uses = {KSP} 6662} 6663 6664@Article{ hh1, 6665 author = {C.-Y. Huang and F.-N. Hwang}, 6666 title = {Parallel pseudo-transient Newton-Krylov-Schwarz continuation algorithms for 6667 bifurcation analysis of incompressible sudden expansion flows}, 6668 journal = {Applied Numerical Mathematics}, 6669 volume = {60}, 6670 year = {2010}, 6671 pages = {738--751}, 6672 petsc_uses = {KSP} 6673} 6674 6675@Article{ hwhw1, 6676 author = {F.-N. Hwang and Z.-H. Wei and T.-M. Huang and W. Wang}, 6677 title = {A parallel additive Schwarz preconditioned Jacobi-Davidson algorithm for 6678 polynomial eigenvalue problems in quantum dot simulation}, 6679 journal = {Journal of Computational Physics}, 6680 volume = {229}, 6681 year = {2010}, 6682 pages = {2932--2947}, 6683 petsc_uses = {KSP} 6684} 6685 6686@Article{ wei2011parallel, 6687 title = {{A Parallel Scalable PETSc-Based Jacobi-Davidson Polynomial Eigensolver with 6688 Application in Quantum Dot Simulation}}, 6689 author = {Wei, Z.H. and Hwang, F.N. and Huang, T.M. and Wang, W.}, 6690 journal = {Domain Decomposition Methods in Science and Engineering XIX}, 6691 pages = {157--164}, 6692 year = {2011}, 6693 publisher = {Springer}, 6694 petsc_uses = {KSP} 6695} 6696 6697@Article{ flores2007sequential, 6698 title = {{Sequential and parallel resolution of the two-group transient neutron diffusion 6699 equation using second-degree iterative methods}}, 6700 author = {Flores-S{\'a}nchez, O. and Vidal, V. and Garc{\'\i}a, V. and Flores-S{\'a}nchez, P.}, 6701 journal = {High Performance Computing for Computational Science-VECPAR 2006}, 6702 pages = {426--438}, 6703 year = {2007}, 6704 publisher = {Springer}, 6705 petsc_uses = {KSP} 6706} 6707 6708@InProceedings{ gordonbell09, 6709 author = {Dinesh Kaushik and Michael Smith and Allan Wollaber and Barry Smith and Andrew 6710 Siegel and Won Sik Yang}, 6711 title = {Enabling High Fidelity Neutron Transport Simulations on Petascale Architectures}, 6712 booktitle = {ACM/IEEE Proceedings of SC2009: High Performance Networking and Computing}, 6713 note = {{SC'09 Gordon Bell} Prize Finalist}, 6714 year = {2009}, 6715 petsc_uses = {KSP} 6716} 6717 6718@Article{ knepleykarpeevdavidovitseisenberggillespie10, 6719 author = {Matthew G. Knepley and Dmitry A. Karpeev and Seth Davidovits and Robert~S. 6720 Eisenberg and Dirk Gillespie}, 6721 title = {An Efficient Algorithm for Classical Density Functional Theory in Three 6722 Dimensions: Ionic Solutions}, 6723 journal = {Journal of Physical Chemistry}, 6724 volume = {132}, 6725 number = {12}, 6726 pages = {124101--124111}, 6727 url = {http://arxiv.org/abs/0910.1531}, 6728 year = {2010}, 6729 petsc_uses = {KSP} 6730} 6731 6732@Article{ knepleykarpeeveisenberggillespie09, 6733 author = {{Knepley}, M.~G. and {Karpeev}, D.~A. and {Eisenberg}, R.~S. and {Gillespie}, 6734 D.}, 6735 title = {{Energetics of Calcium Selectivity: A Three-Dimensional Classical Density 6736 Functional Theory Approach}}, 6737 journal = {Biophysical Journal}, 6738 month = feb, 6739 volume = {96}, 6740 pages = {661}, 6741 doi = {10.1016/j.bpj.2008.12.3494}, 6742 year = {2009}, 6743 petsc_uses = {KSP} 6744} 6745 6746@Article{ scx2008, 6747 author = {SUWITO AND XIAO-CHUAN CAI AND YUNPING XI}, 6748 title = {PARALLEL FINITE ELEMENT METHOD FOR COUPLED CHLORIDE MOISTURE DIFFUSION IN 6749 CONCRETE}, 6750 journal = {INTERNATIONAL JOURNAL OF NUMERICAL ANALYSIS AND MODELING}, 6751 volume = {3}, 6752 number = {4}, 6753 year = {2006}, 6754 url = {http://www.math.ualberta.ca/ijnam/Volume-3-2006/No-4-06/2006-04-06.pdf}, 6755 petsc_uses = {KSP} 6756} 6757 6758@TechReport{ kdgs2008, 6759 year = {2008}, 6760 school = {Centro Internacional de Methodos Numericos en Ingenieria, Argentina}, 6761 title = {High Performance Simulations of Electrokinetic Flow and Transport in Microfluidic 6762 Chips}, 6763 author = {Pablo A. Klera and Lisandro D. Dalcin and Fabio A. Guarnieria and Mario A. 6764 Stortia}, 6765 url = {http://www.cimec.org.ar/ojs/index.php/cmm/article/view/1383}, 6766 petsc_uses = {KSP} 6767} 6768 6769@Article{ springerlink:10.1007/s10915-011-9551-x, 6770 author = {Schauer, Marco and Roman, Jose and Quintana-Ortí, Enrique and Langer, Sabine}, 6771 affiliation = {Institut für Angewandte Mechanik, Technische Universität Carolo-Wilhelmina zu 6772 Braunschweig, Spielmannstraße 11, 38106 Braunschweig, Germany}, 6773 title = {Parallel Computation of 3-D Soil-Structure Interaction in Time Domain with a 6774 Coupled FEM/SBFEM Approach}, 6775 journal = {Journal of Scientific Computing}, 6776 publisher = {Springer Netherlands}, 6777 issn = {0885-7474}, 6778 keyword = {Mathematics and Statistics}, 6779 pages = {1-22}, 6780 doi = {10.1007/s10915-011-9551-x}, 6781 petsc_uses = {KSP} 6782} 6783 6784@TechReport{ jj2007, 6785 author = {Boris Jeremic and Guanzhou Jie}, 6786 title = {Parallel Finite Element Computations for Soil-Foundation-Structure Interaction 6787 Problems Report}, 6788 institution = {UCD CompGeoMech 02--2007}, 6789 year = {2007}, 6790 url = {http://sokocalo.engr.ucdavis.edu/~jeremic/wwwpublications/CV-R23.pdf}, 6791 petsc_uses = {KSP} 6792} 6793 6794@Unpublished{ kuiper08, 6795 title = {Fast 3D frequency-dependent Radiative Transfer for Magneto-Hydrodynamics}, 6796 author = {Rolf Kuiper}, 6797 institution = {Max-Planck-Institute for Astronomy}, 6798 url = {http://www.mpia.de/~kuiper/MAKEMAKE.html}, 6799 year = {2008}, 6800 petsc_uses = {KSP} 6801} 6802 6803@Article{ williamson2012multidimensional, 6804 title = {Multidimensional multiphysics simulation of nuclear fuel behavior}, 6805 author = {Williamson, R.L. and Hales, J.D. and Novascone, S.R. and Tonks, M.R. and Gaston, 6806 D.R. and Permann, C.J. and Andrs, D. and Martineau, R.C.}, 6807 journal = {Journal of Nuclear Materials}, 6808 volume = {423}, 6809 number = {1}, 6810 pages = {149--163}, 6811 year = {2012}, 6812 publisher = {Elsevier}, 6813 petsc_uses = {KSP} 6814} 6815 6816@InProceedings{ kucukboyaci2015cobra, 6817 title = {COBRA-TF parallelization and application to PWR reactor core subchannel DNB 6818 analysis}, 6819 author = {Kucukboyaci, Vefa and Sung, Yixing and Salko, Robert}, 6820 booktitle = {Joint International Conference on Mathematics and Computation, Supercomputing in 6821 Nuclear Applications and the Monte Carlo Method}, 6822 pages = {1--18}, 6823 year = {2015}, 6824 petsc_uses = {KSP} 6825} 6826 6827@Article{ hales2012solving, 6828 title = {Solving Nonlinear Solid Mechanics Problems with the {J}acobian-{F}ree {N}ewton 6829 {K}rylov Method}, 6830 author = {Hales, J.D. and Novascone, S.R. and Williamson, R.L. and Gaston, D.R. and Tonks, 6831 M.R.}, 6832 journal = {Computer Modeling in Engineering \& Sciences(CMES)}, 6833 volume = {84}, 6834 number = {2}, 6835 pages = {123--153}, 6836 year = {2012}, 6837 publisher = {Tech Science Press}, 6838 petsc_uses = {KSP} 6839} 6840 6841@InProceedings{ srksyp2008, 6842 author = {M. A. Smith and C. Rabiti and D. Kaushik and B. Smith and W. S. Yang and G. 6843 Palmiotti}, 6844 title = {Fast reactor core simulations using the {UNIC} code}, 6845 booktitle = {Proceedings of the International Conference on the Physics of Reactors, Nuclear 6846 Power: A Sustainable Resource}, 6847 year = {2008}, 6848 petsc_uses = {KSP} 6849} 6850 6851@InProceedings{ psrlkssl2007, 6852 author = {G. Palmiotti and M. A. Smith and C. Rabiti and M. Leclere and D. Kaushik and A. 6853 Siegel and B. Smith and E. E. Lewis}, 6854 title = {{UNIC}: Ultimate Neutronic Investigation Code}, 6855 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 6856 Supercomputing in Nuclear Applications}, 6857 year = {2007}, 6858 petsc_uses = {KSP} 6859} 6860 6861@InProceedings{ sprkssl2007, 6862 author = {M. A. Smith and G. Palmiotti and C. Rabiti and D. Kaushik and A. Siegel and B. 6863 Smith and E. E. Lewis}, 6864 title = {{PNFE} Component of the {UNIC} Code}, 6865 booktitle = {Joint International Topical Meeting on Mathematics and Computation and 6866 Supercomputing in Nuclear Applications}, 6867 year = {2007}, 6868 petsc_uses = {KSP} 6869} 6870 6871@InProceedings{ dc-oop-03, 6872 author = {H. Digonnet and T. Coupez}, 6873 title = {Object-oriented programming for fast-and-easy development of parallel 6874 applications in forming processes simulation}, 6875 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 6876 Mechanics}, 6877 year = {2003}, 6878 petsc_uses = {KSP} 6879} 6880 6881@InProceedings{ dc-cfm-03, 6882 author = {H. Digonnet and T. Coupez}, 6883 title = {Calcul parallele en mise en forme des materiaux}, 6884 booktitle = {XVIeme Congres Francais de Mecanique}, 6885 year = {2003}, 6886 petsc_uses = {KSP} 6887} 6888 6889@InProceedings{ dsc-pcsev-04, 6890 author = {H. Digonnet and L. Silva and T. Coupez}, 6891 title = {Parallel computation for solving efficiently viscoelastic fluid flow problems}, 6892 booktitle = {Proceedings of ECCOMAS 2004}, 6893 year = {2004}, 6894 petsc_uses = {KSP} 6895} 6896 6897@InProceedings{ dsc-pca3fs-04, 6898 author = {H. Digonnet and L. Silva and T. Coupez}, 6899 title = {Parallel computation applied to 3D FE simulation of polymer injection molding}, 6900 booktitle = {Proceedings of WCCM VI}, 6901 year = {2004}, 6902 petsc_uses = {KSP} 6903} 6904 6905@InProceedings{ dbcs-cpaac-05, 6906 author = {H. Digonnet and O. Basset and T. Coupez and L. Silva}, 6907 title = {Calcul parallele appliqu aux coulements de fluides complexe}, 6908 booktitle = {Proceedings of Eme Congres Francais de Mecanique}, 6909 year = {2005}, 6910 petsc_uses = {KSP} 6911} 6912 6913@Article{ sz2010, 6914 author = {B. Smith and H. Zhang}, 6915 title = {Sparse Triangular Solves for {ILU} Revisited: Data Layout Crucial to Better 6916 Performance}, 6917 journal = {International Journal of High Performance Computing Applications}, 6918 volume = {25}, 6919 number = {4}, 6920 pages = {386--391}, 6921 year = {2011}, 6922 petsc_uses = {KSP} 6923} 6924 6925@Article{ zssz2006, 6926 author = {H. Zhang and B. Smith and M. Sternberg and P. Zapol}, 6927 title = {{SIPs}: Shift-and-Invert Parallel Spectral Transformations}, 6928 journal = {TOMS}, 6929 url = {http://math.nist.gov/toms/Current.html#v33n2}, 6930 volumne = {33}, 6931 number = {2}, 6932 year = {2007}, 6933 petsc_uses = {KSP} 6934} 6935 6936@Article{ gs2006, 6937 author = {Fang Jin and Nivedita R. Gupta and Kathleen J. Stebe}, 6938 title = {The detachment of a viscous drop in a viscous solution in the presence of a 6939 soluble surfactant}, 6940 journal = {Phys. Fluids}, 6941 volume = {18}, 6942 year = {2006}, 6943 url = {http://scitation.aip.org/dbt/dbt.jsp?KEY=PHFLE6&Volume=LASTVOL&Issue=LASTISS}, 6944 petsc_uses = {KSP} 6945} 6946 6947@Article{ jmemsci, 6948 author = {Bo Zhou and Adam Powell}, 6949 title = {Phase Field Simulations of Liquid-Liquid Demixing During Immersion Precipitation 6950 of Polymeric Membranes in 2D and 3D}, 6951 journal = {J. Membrane Sci.}, 6952 volume = {268}, 6953 number = {2}, 6954 pages = {150--164}, 6955 year = {2006}, 6956 month = jan, 6957 day = {15}, 6958 doi = {10.1016/j.memsci.2005.05.030}, 6959 petsc_uses = {KSP} 6960} 6961 6962@InProceedings{ vbde2002, 6963 author = {Anke Veser and Wolfgang Breitung and Sergey Dorofeev and Alexander Efimenko}, 6964 title = {Flame Acceleration Distance in Obstacle-Laden Tubes}, 6965 booktitle = {Proceedings of the NINTH INTERNATIONAL CONFERENCE ON NUMERICAL COMBUSTION}, 6966 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 6967 year = {2002}, 6968 petsc_uses = {KSP} 6969} 6970 6971@InProceedings{ wid2005, 6972 author = {Alexander I. Bobenko and Peter Schrader}, 6973 title = {Discrete Willmore Flow}, 6974 booktitle = {Eurographics Symposium on Geometry Processing}, 6975 url = {http://www.math.tu-berlin.de/\~{ }bobenko/Papers/Willmore.pdf}, 6976 year = {2005}, 6977 editor = {M. Desbrun and H. Pottmann}, 6978 petsc_uses = {KSP} 6979} 6980 6981@Article{ stj2003, 6982 author = {A. Scascighini and A. Troxler and R. Jeltsch}, 6983 journal = {International Journal for Numerical Methods in Fluids}, 6984 volume = {41}, 6985 issue = {4}, 6986 title = {A numerical method for inverse design based on the inverse Euler equations}, 6987 year = {2003}, 6988 pages = {339--355}, 6989 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/102521480/ABSTRACT}, 6990 petsc_uses = {KSP} 6991} 6992 6993@PhDThesis{ as2001, 6994 author = {ANDREA SCASCIGHINI}, 6995 title = {A Numerical Method for the Design of Internal Flow Configurations Based on the 6996 Inverse Euler Equations}, 6997 school = {SWISS FEDERAL INSTITUTE OF TECHNOLOGY, ZURICH}, 6998 year = {2001}, 6999 url = {http://www.sam.math.ethz.ch/\~{ }andrea/}, 7000 petsc_uses = {KSP} 7001} 7002 7003@Article{ hb2005, 7004 author = {E. McKay Hyde and Oscar P. Bruno}, 7005 journal = {Journal of Computational Physics}, 7006 volume = {202}, 7007 title = {A fast, higher-order solver for scattering by penetrable bodies in three 7008 dimensions}, 7009 year = {2005}, 7010 pages = {236--261}, 7011 url = {http://www.acm.caltech.edu/\~{ }bruno/hyde_bruno_3d_jcp.pdf}, 7012 petsc_uses = {KSP} 7013} 7014 7015@MastersThesis{ d2002, 7016 author = {Matthew F Dixon}, 7017 title = {PARALLEL SOLUTION OF HIGH ORDER FINITE DIFFERENCE SCHEMES FOR PRICING 7018 MULTI-DIMENSIONAL AMERICAN OPTIONS}, 7019 school = {READING UNIVERSITY}, 7020 year = {2002}, 7021 url = {http://www.ma.ic.ac.uk/\~{ }mdixion/papers/MScThesis.pdf.gz}, 7022 petsc_uses = {KSP} 7023} 7024 7025@TechReport{ gzb, 7026 author = {David Gleich and Leonid Zhukov and Pavel Berkhin}, 7027 title = {Fast Parallel PageRank: A Linear System Approach}, 7028 institution = {Stanford University}, 7029 year = {2004}, 7030 url = {http://www.gg.caltech.edu/\~{ }zhukov/papers/ParallelPageRank-paper.pdf}, 7031 petsc_uses = {KSP} 7032} 7033 7034@PhDThesis{ yergeau-99, 7035 author = {Daniel W. Yergeau}, 7036 title = {A DIAL-AN-OPERATOR APPROACH TO SIMULATION OF IMPURITY DIFFUSION IN 7037 SEMICONDUCTORS}, 7038 school = {Stanford}, 7039 year = {1999}, 7040 url = {http://www-tcad.stanford.edu/tcad/pubs/theses/yergeau.pdf}, 7041 petsc_uses = {KSP} 7042} 7043 7044@InProceedings{ rathkopf-miller-00, 7045 author = {J.A. Rathkopf and D.S. Miller and J.M. Owen and L.M. Stuart and M.R. Zika and 7046 P.G. Eltgroth and N.K. Madsen and K.P. McCandless and P.F. Nowak and M.K. Nemanic 7047 and N.A. Gentile and N.D. Keen and T.S. Palmer}, 7048 title = {{KULL}: {LLNL}'s {ASCI} Inertial Confinement Fusion Simulation Code}, 7049 year = {2000}, 7050 booktitle = {Physor 2000 American Nuclear Society Topical Meeting on Advances in Reactor 7051 Physics and Mathematics and Computation into the Next Millennium}, 7052 url = {http://www.llnl.gov/tid/lof/documents/pdf/237860.pdf}, 7053 lab = {LLNL}, 7054 petsc_uses = {KSP} 7055} 7056 7057@Article{ bonfi-palma-pas-05, 7058 author = {A. Bonfiglioli and P. De Palma and G. Pascazio and M. Napolitano}, 7059 journal = {Journal of Turbomachinery}, 7060 volume = {127}, 7061 title = {An Implicit Fluctuation Splitting Scheme for Turbomachinery Flows}, 7062 year = {2005}, 7063 pages = {395-401}, 7064 petsc_uses = {KSP} 7065} 7066 7067@InProceedings{ fettig-sobh-05, 7068 author = {John Fettig and Nahil Sobh and Dmitriy V. Melnikov and Jean-Pierre Leburton}, 7069 title = {High Performance Algorithms for Scalable Spin-Qubit Circuits with Quantum Dots}, 7070 year = {2005}, 7071 booktitle = {Proceedings of the 5th International Conference on Linux Clusters}, 7072 url = {http://www.linuxclustersinstitute.org/Linux-HPC-Revolution/Archive/PDF05/28-Fettig_J.pdf}, 7073 petsc_uses = {KSP} 7074} 7075 7076@TechReport{ melnikov-matagne-05, 7077 author = {Dmitriy V. Melnikov and Philippe Matagne and Jean-Pierre Leburton and D.G. 7078 Austing and G. Yu and S. Tarucha and John Fettig and Nahil Sobh}, 7079 title = {Spin configurations in circular and rectangular vertical quantum dots in a 7080 magnetic field: Three-dimensional self-consistent simulation}, 7081 year = {2005}, 7082 number = {Arxiv preprint cond-mat/0506585}, 7083 url = {http://arxiv.org/pdf/cond-mat/0506585}, 7084 petsc_uses = {KSP} 7085} 7086 7087@InProceedings{ richard-smedley-03, 7088 author = {Richard P. Smedley-Stevenson}, 7089 title = {PARALLEL THERMAL RADIATION TRANSPORT IN TWO DIMENSIONS}, 7090 year = {2003}, 7091 booktitle = {18th International Conference on Transport Theory (18 ICTT)}, 7092 url = {http://www.iprj.uerj.br/\~{ }ricardob/Evento_Cientifico_html/poster03j.pdf}, 7093 petsc_uses = {KSP} 7094} 7095 7096@Article{ guan-godoy-ravaioli-03, 7097 author = {D. Guan and A. Godoy and U. Ravaioli and F. Gamiz}, 7098 journal = {Journal of Computational Electronics}, 7099 volume = {2}, 7100 title = {Comparison Between Non-Equilibrium Green's Function and Monte Carlo Simulations 7101 for Transport in a Silicon Quantum Wire Structure}, 7102 year = {2003}, 7103 pages = {335--339}, 7104 petsc_uses = {KSP} 7105} 7106 7107@Article{ ovtchinnikovcai04, 7108 author = {S. Ovtchinnikov and X.-C. Cai}, 7109 journal = {Numer. Lin. Alg. Applics}, 7110 volume = {11}, 7111 title = {One-level {N}ewton--{K}rylov--{S}chwarz algorithm for unsteady nonlinear radiation 7112 diffusion problem}, 7113 year = {2004}, 7114 pages = {867--881}, 7115 petsc_uses = {KSP} 7116} 7117 7118@Article{ mixedstress, 7119 title = {Floating Solids: Combining Phase Field and Fluid-Structure Interactions}, 7120 author = {Adam Powell and David Dussault}, 7121 journal = {Appl. Numer. Anal. Comp. Math.}, 7122 volume = {2}, 7123 number = {1}, 7124 year = {2005}, 7125 pages = {157--166}, 7126 petsc_uses = {KSP} 7127} 7128 7129@Article{ dhh2005, 7130 author = {G. Deli\'ege and F. Henrotte and K. Hameyer}, 7131 title = {Accuracy analysis of the thrust force in 2D-3D finite element models}, 7132 journal = {International Journal for Computation and Mathematics in Electrical and 7133 Electronic Engineering (COMPEL)}, 7134 year = {2005}, 7135 petsc_uses = {KSP} 7136} 7137 7138@Article{ dhh2004, 7139 author = {G. Deli\'ege and F. Henrotte and W. Deprez and K. Hameyer}, 7140 title = {Finite element modelling of ion convection by electrostatic forces}, 7141 journal = {IEE Proceedings Science, Measurement and Technology}, 7142 year = {2004}, 7143 volume = {151}, 7144 number = {6}, 7145 petsc_uses = {KSP} 7146} 7147 7148@Article{ adams-07b, 7149 author = {Adams M.F.}, 7150 title = {Algebraic Multigrid Techniques for Strongly Indefinite Linear Systems from Direct 7151 Frequency Response Analysis in Solid Mechanics}, 7152 journal = {Computional Mechanics}, 7153 year = {2007}, 7154 volume = {39}, 7155 number = {4}, 7156 pages = {497-507}, 7157 petsc_uses = {KSP} 7158} 7159 7160@InProceedings{ wc2004, 7161 author = {A. Wheelock and D. Cooke}, 7162 title = {Computational Modeling of Ion Beam-Neutralizer Interactions in Two and Three 7163 Dimensions}, 7164 year = {2004}, 7165 booktitle = {40th AIAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit}, 7166 url = {http://www.aiaa.org/content.cfm?pageid=406&gTable=Paper&gID=19282}, 7167 petsc_uses = {KSP} 7168} 7169 7170@InProceedings{ allard-gouranton-ipts2002, 7171 author = {Jeremie Allard and Valerie Gouranton and Emmanuel Melin and Bruno Raffin}, 7172 title = {Parallelizing Pre-rendering Computations on a Net Juggler PC Cluster}, 7173 year = {2002}, 7174 booktitle = {Immersive Projection Technology Symposium}, 7175 url = {http://www-id.imag.fr/\~{ }allardj/files/ipts2002.pdf}, 7176 petsc_uses = {KSP} 7177} 7178 7179@Article{ icc, 7180 author = {D Ioan and G Ciuprina and C Ciobotaru}, 7181 title = {Hybrid and concurrent algorithms for nonlinear magnetic field problems}, 7182 journal = {IEEE Transactions on Magnetics}, 7183 year = {2000}, 7184 url = {http://ieeexplore.ieee.org/Xplore/login.jsp?url=/iel5/20/19005/00877735.pdf}, 7185 petsc_uses = {KSP} 7186} 7187 7188@InProceedings{ hs1, 7189 author = {Brian J. Henz and Dale R. Shires}, 7190 title = {Development and Performance Analysis of a Parallel Finite Element Application 7191 Implemented in an Object-Oriented Programming Framework}, 7192 year = {2003}, 7193 booktitle = {PDPTA 2003}, 7194 pages = {1286-1292}, 7195 note = {Resin Transfer Modeling}, 7196 petsc_uses = {KSP} 7197} 7198 7199@TechReport{ b2000, 7200 author = {Rickard Bergstrom}, 7201 title = {Least-Squares Finite Element Methods for Electromagnetic Applications}, 7202 year = {2000}, 7203 institution = {Chalmers}, 7204 number = {2000-05}, 7205 url = {http://www.phi.chalmers.se/pub/preprints/ps/phiprint-2000-05.ps}, 7206 petsc_uses = {KSP} 7207} 7208 7209@Article{ fs2004, 7210 author = {Petri Fast and Michael J. Shelley}, 7211 title = {A Moving Overset Grid Method for Interface Dynamics Applied to Non-Newtonian Hele 7212 Shaw Flow}, 7213 journal = {Journal of Computational Physics}, 7214 year = {2004}, 7215 volume = {195}, 7216 url = {http://www.math.nyu.edu/faculty/shelley/papers/FS2004.pdf}, 7217 pages = {117-142}, 7218 petsc_uses = {KSP} 7219} 7220 7221@MastersThesis{ wallach, 7222 author = {Hanna Wallach}, 7223 title = {Efficient Training of Conditional Random Fields}, 7224 school = {University of Edinburgh}, 7225 year = {2002}, 7226 url = {http://scholar.google.com/url?sa=U&q=http://www.hcrc.ed.ac.uk/\~{ 7227 }osborne/msc-projects/wallach.ps.gz}, 7228 petsc_uses = {KSP} 7229} 7230 7231@Article{ something, 7232 author = {T Rylander and A Bondeson}, 7233 title = {Stability of explicit-implicit hybrid time-stepping schemes for Maxwells 7234 equations}, 7235 journal = {Journal of Computational Physics}, 7236 year = {2002}, 7237 volume = {179}, 7238 pages = {426-438}, 7239 petsc_uses = {KSP} 7240} 7241 7242@TechReport{ uf1, 7243 author = {Uwe Fabricius}, 7244 title = {Comparison of two implementations of {AMG}-preconditioned {CG} considering an 7245 electrostatic problem}, 7246 year = {2004}, 7247 institution = {Friedrich Alexander Universitat Erlangen Nurnberg Germany}, 7248 url = {http://www10.informatik.uni-erlangen.de/de/Publications/TechnicalReports/TechRep04-1.pdf}, 7249 number = {04-1}, 7250 petsc_uses = {KSP} 7251} 7252 7253@InBook{ sg1, 7254 author = {Natalia Seoane and A.J.Garca-Loureiro}, 7255 chapter = {Analysis of Parallel Numerical Libraries to Solve the 3D Electron Continuity 7256 Equation}, 7257 url = {http://www.springerlink.com/app/home/contribution.asp?wasp=h0xlulyhugck3y2gnt2l&referrer=parent&backto=issue,79,112;journal,212,1787;linkingpublicationresults,1:105633,1}, 7258 title = {Lecture Notes in Computer Science}, 7259 publisher = {Springer-Verlag}, 7260 volume = {3037}, 7261 year = {2004}, 7262 petsc_uses = {KSP} 7263} 7264 7265@Article{ nikyilmazgivisheikhipope10, 7266 author = {M. B. Nik and S. L. Yilmaz and P. Givi and M. R. H. Sheikhi and S. B. Pope}, 7267 title = {Simulation of Sandia Flame D Using Velocity-Scalar Filtered Density Function}, 7268 journal = {AIAA Journal}, 7269 volume = {48}, 7270 number = {7}, 7271 pages = {1513--1522}, 7272 year = {2010}, 7273 petsc_uses = {KSP} 7274} 7275 7276@Article{ nikyilmazsheikhigivi10, 7277 author = {Mehdi B. Nik and Server L. Yilmaz and Mohammad Reza H. Sheikhi and Peyman Givi}, 7278 title = {Grid Resolution Effects on VSFMDF/LES}, 7279 journal = {Flow, Turbulence and Combustion}, 7280 doi = {10.1007/s10494-010-9272-5}, 7281 year = {2010}, 7282 petsc_uses = {KSP} 7283} 7284 7285@Article{ idema2013towards, 7286 title = {Towards faster solution of large power flow problems}, 7287 author = {Idema, Reijer and Papaefthymiou, Georgios and Lahaye, Domenico and Vuik, Cornelis 7288 and van der Sluis, Lou}, 7289 journal = {Power Systems, IEEE Transactions on}, 7290 volume = {28}, 7291 number = {4}, 7292 pages = {4918--4925}, 7293 year = {2013}, 7294 publisher = {IEEE}, 7295 petsc_uses = {KSP} 7296} 7297 7298@Article{ 6026245, 7299 author = {Idema, R. and Lahaye, D.J.P. and Vuik, C. and Van der Sluis, L.}, 7300 journal = {Power Systems, IEEE Transactions on}, 7301 title = {Scalable Newton-Krylov Solver for Very Large Power Flow Problems}, 7302 year = {2012}, 7303 month = feb, 7304 volume = {27}, 7305 number = {1}, 7306 pages = {390-396}, 7307 doi = {10.1109/TPWRS.2011.2165860}, 7308 issn = {0885-8950}, 7309 petsc_uses = {KSP} 7310} 7311 7312@Book{ idema2014computational, 7313 title = {Computational Methods in Power System Analysis}, 7314 author = {Idema, Reijer and Lahaye, Domenico JP}, 7315 year = {2014}, 7316 publisher = {Springer}, 7317 petsc_uses = {KSP} 7318} 7319 7320@PhDThesis{ abhyankar2011thesis, 7321 author = {Shrirang Abhyankar}, 7322 title = {Development of an implicitly coupled electromechanical and electromagnetic 7323 transients simulator for power systems}, 7324 school = {Illinois Institute of Technology}, 7325 year = {2011}, 7326 petsc_uses = {KSP} 7327} 7328 7329@InProceedings{ abhyankarhipcna11-1, 7330 author = {Shrirang Abhyankar and Barry Smith and Hong Zhang and A. Flueck}, 7331 title = {Using {PETSc} to develop scalable applications for next-generation power grid}, 7332 year = {2011}, 7333 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7334 Networking and Analytics for the Power Grid}, 7335 url = {http://www.mcs.anl.gov/uploads/cels/papers/P1957-0911.pdf}, 7336 publisher = {ACM}, 7337 petsc_uses = {KSP} 7338} 7339 7340@InProceedings{ abhyankarhipcna11-2, 7341 author = {Shrirang Abhyankar and Alexander Flueck and Xu Zhang and Hong Zhang}, 7342 title = {Development of a parallel three-phase transient stability simulator for power 7343 systems}, 7344 year = {2011}, 7345 booktitle = {Proceedings of the 1st International Workshop on High Performance Computing, 7346 Networking and Analytics for the Power Grid}, 7347 publisher = {ACM}, 7348 petsc_uses = {KSP} 7349} 7350 7351@InProceedings{ abhyankarpesgeneral2012, 7352 author = {Shrirang Abhyankar and A. Flueck}, 7353 title = {An implicitly-coupled solution approach for combined electromechanical and 7354 electromagnetic transients simulation}, 7355 year = {2012}, 7356 booktitle = {Proceedings of the IEEE PES General Meeting}, 7357 publisher = {IEEE}, 7358 petsc_uses = {KSP} 7359} 7360 7361@Article{ idemalahayevuiksluis2012, 7362 author = {Reijer Idema and Domenico Lahaye and Cornelis Vuik and Lou van der Sluis}, 7363 title = {Scalable Newton-Krylov solver for very large Power Flow problems}, 7364 journal = {IEEE Transactions on Power Systems}, 7365 year = {2012}, 7366 volume = {27}, 7367 pages = {390-396}, 7368 petsc_uses = {KSP} 7369} 7370 7371@Article{ korrestzavellasgalinas2013, 7372 author = {George N. Korres and Anastasios Tzavellas and Evangelos Galinas}, 7373 title = {A distributed implementation of multi-area power system state estimation on a 7374 cluster of computers }, 7375 journal = {Electric Power Systems Research }, 7376 volume = {102}, 7377 number = {0}, 7378 pages = {20 - 32}, 7379 year = {2013}, 7380 issn = {0378-7796}, 7381 doi = {10.1016/j.epsr.2013.04.002}, 7382 petsc_uses = {KSP} 7383} 7384 7385% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7386% LiteralHTML:<font color="#FF0000"> 7387% LiteralHTML: Material failure, for example, cracking of steel beams resulting 7388% LiteralHTML: in bridge collapse and corrosion, is a little understood phenomena. Thus simulations 7389% LiteralHTML: are important for prediction and prevention. PETSc has been used 7390% LiteralHTML: in a variety of studies of material failure.</p> 7391% LiteralHTML:</font> 7392% LiteralHTML: 7393@InProceedings{ gray2, 7394 author = {Yuan He and Joshua Gray and Richard Braatz and Richard Alkire}, 7395 title = {Modulized Coupled Simulation of Localized Pit Initiation in Stainless Steel}, 7396 year = {2004}, 7397 booktitle = {American Institute of Chemical Engineers 2004 Annual Meeting}, 7398 petsc_uses = {KSP} 7399} 7400 7401@InProceedings{ gray1, 7402 author = {J. Gray and and C. Homescu and L. Petzold and Richard Alkire}, 7403 title = {Algorithms and Computing Architectures for Solving Differential-Algebraic 7404 Equation Systems Typically Encountered in Models of Corrosion Pit Initiation}, 7405 year = {2003}, 7406 booktitle = {Abstracts of the Electrochemical Society 204th meeting}, 7407 petsc_uses = {KSP} 7408} 7409 7410@InProceedings{ crack2, 7411 author = {Erin Lesulauro and Anthony R. Ingraffea and Gerd Heber and Paul A. Wawrzynek}, 7412 title = {A multiscale modeling approach to crack initiation in metallic polycrystals}, 7413 booktitle = {44th AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials 7414 Conference}, 7415 url = {http://md1.csa.com/partners/viewrecord.php?requester=gs&collection=TRD&recid=A0325099AH}, 7416 year = {2003}, 7417 petsc_uses = {KSP} 7418} 7419 7420@TechReport{ hdams1, 7421 author = {Gerd Heber and Andrew J. Dolgert and Maxirn Alt and Karen A. Mazurkiewicz and 7422 Lynd Stringer}, 7423 title = {Fracture Mechanics on the Intel Itanium Architecture}, 7424 year = {2001}, 7425 institution = {Intel Corporation}, 7426 url = {http://cedar.intel.com/media/pdf/scs/cptconitanium.pdf}, 7427 petsc_uses = {KSP} 7428} 7429 7430@InProceedings{ ihwi, 7431 author = {E. Iesulauro and G. Heber and P. A. Wawrzynek and A. R. Ingraffea}, 7432 title = {Modeling of 3D Metallic Polycrystals and Simulation of Crack Initiation}, 7433 booktitle = {International Conference ON Computational Engineering and Sciences}, 7434 year = {2002}, 7435 url = {http://www.cfg.cornell.edu/\~{ }erin/erin/ices02_iesulauro.pdf}, 7436 petsc_uses = {KSP} 7437} 7438 7439@InProceedings{ crack, 7440 author = {Bruce Carter and Chuin-Shan Chen and L. Paul Chew and Nikos Chrisochoides and 7441 Guang R. Gao and Gerd Heber and Antony R. Ingraffea and Roland Krause and Chris 7442 Myers and Demian Nave and Keshav Pingali and Paul Stodghill and Stephen Vavasis 7443 and Paul A. Wawrzynek}, 7444 title = {Parallel FEM Simulation of Crack Propagation}, 7445 booktitle = {Proceedings of Irregular 2000}, 7446 url = {http://www.cs.cornell.edu/stodghil/papers/irregular00.ps}, 7447 year = {2000}, 7448 petsc_uses = {KSP} 7449} 7450 7451@InProceedings{ beaudoin98, 7452 author = {A. J. Beaudoin}, 7453 title = {Use of Polycrystal Plasticity Theory in Assessing Material Performance}, 7454 booktitle = {Simulation of materials processing: Theory, methods, and applications - 7455 Proceedings of the Sixth International Conference, NUMIFORM'98}, 7456 editor = {J. Hu\'etink and F. P. T. Baaijens}, 7457 optvolume = {}, 7458 optnumber = {}, 7459 optseries = {}, 7460 year = {1998}, 7461 optorganization={}, 7462 publisher = {A. A. Balkema Publishers}, 7463 address = {Rotterdam, Netherlands}, 7464 month = jun, 7465 optpages = {}, 7466 petsc_uses = {KSP} 7467} 7468 7469% LiteralHTML: <td width="100%" colspan="2"><hr size="4" color="#FF5B5B"> </td> 7470@TechReport{ defordheld1, 7471 author = {JF DeFord and BL Held}, 7472 title = {RF3P-A New Parallel Driven Frequency Electromagnetic Solver}, 7473 year = {2002}, 7474 institution = {Simulation Technology and Applied Research}, 7475 url = {http://www.staarinc.com/support/papers/aces2002.pdf}, 7476 note = {Discusses their parallel commercial solver that uses PETSc}, 7477 petsc_uses = {KSP} 7478} 7479 7480@PhDThesis{ sande2003, 7481 author = {Hans Vande Sande}, 7482 title = {Modelling and Finite Element Simulation of Non-Linear and Anisotropic 7483 Quasi-Static Electromagnetic Systems}, 7484 school = {Katholieke Universiteit Leuven, Belgium}, 7485 year = {2003}, 7486 petsc_uses = {KSP} 7487} 7488 7489@Article{ sdchh2004, 7490 author = {H. Vande Sande and W. Deprez and J. De Coster and F. Henrotte and K. Hameyer}, 7491 title = {Reducing the Computation Time of Non-Linear Problems by an Adaptive Linear System 7492 Tolerance}, 7493 journal = {IEEE Transactions on Magnetics}, 7494 year = {2004}, 7495 volume = {40}, 7496 pages = {1306--1309}, 7497 petsc_uses = {KSP} 7498} 7499 7500@Article{ holst-lindblom-etal:2004, 7501 author = {Michael Holst and Lee Lindblom and Robert Owen and Harald P. Pfeiffer and Mark A. 7502 Scheel and Lawrence E. Kidder}, 7503 title = {Optimal constraint projection for hyperbolic evolution systems, }, 7504 journal = {Phys. Rev. D}, 7505 year = {2004}, 7506 volume = {70}, 7507 pages = {084017}, 7508 petsc_uses = {KSP} 7509} 7510 7511@Article{ marm2005, 7512 author = {Matthew Anderson and Richard A. Matzner}, 7513 title = {Extended Lifetime in Computational Evolution of Isolated Black Holes}, 7514 journal = {Foundations of Physics}, 7515 volume = {35}, 7516 pages = {1572--9516}, 7517 year = {2005}, 7518 petsc_uses = {KSP} 7519} 7520 7521@Article{ cook-pfeiffer:2004, 7522 author = {Cook, Gregory B. and Pfeiffer, Harald P.}, 7523 title = {Excision boundary conditions for black hole initial data}, 7524 journal = {Phys. Rev. D}, 7525 volume = {70}, 7526 pages = {104016--24}, 7527 year = {2004}, 7528 petsc_uses = {KSP} 7529} 7530 7531@Article{ pfeiffer-kidder-etal:2005, 7532 author = {Harald P. Pfeiffer and Lawrence E. Kidder and Mark A. Scheel and Deirdre 7533 Shoemaker}, 7534 title = {Initial data for {E}instein's equations with superposed gravitational waves}, 7535 journal = {Phys. Rev. D}, 7536 year = {2005}, 7537 volume = {71}, 7538 pages = {024020}, 7539 petsc_uses = {KSP} 7540} 7541 7542@Article{ pfeiffer-kidder-etal:2003, 7543 author = {Pfeiffer, Harald P. and Kidder, Lawrence E. and Scheel, Mark A. and Teukolsky, 7544 Saul A.}, 7545 title = {A multidomain spectral method for solving elliptic equations}, 7546 journal = {CPC}, 7547 year = {2003}, 7548 volume = {152}, 7549 pages = {253--273}, 7550 note = {Solves nonlinear coupled 3-D elliptic equations that arise in general relativity. 7551 For a related online version, see arXiv:gr-qc/0202096}, 7552 petsc_uses = {KSP} 7553} 7554 7555@Article{ pfeiffer-cook-teukolsky:2002, 7556 author = {Pfeiffer, Harald P. and Cook, Gregory B. and Teukolsky, Saul A.}, 7557 title = {Comparing initial-data sets for binary black hole}, 7558 journal = {PRD}, 7559 year = {2002}, 7560 volume = {66}, 7561 pages = {024047}, 7562 note = {for a related online version, seearXiv:gr-qc/0203085}, 7563 petsc_uses = {KSP} 7564} 7565 7566@PhDThesis{ pfeiffer:2003, 7567 author = {Pfeiffer, Harald P.}, 7568 title = {Initial Data for Black Hole Evolutions}, 7569 school = {Cornell University}, 7570 year = {2003}, 7571 petsc_uses = {KSP} 7572} 7573 7574@TechReport{ h1, 7575 author = {Erik Schnetter}, 7576 title = {A fast apparent horizon algorithm}, 7577 year = {2002}, 7578 number = {Arxiv preprint gr-qc/0206003}, 7579 url = {http://arxiv.org/pdf/gr-qc/0206003}, 7580 petsc_uses = {KSP} 7581} 7582 7583@Article{ h2, 7584 author = {Erik Schnetter}, 7585 title = {Finding apparent horizons and other 2-surfaces of constant expansion}, 7586 year = {2003}, 7587 journal = {Class. Quantum Grav.}, 7588 pages = {4719-4737}, 7589 volume = {20}, 7590 url = {http://www.iop.org/EJ/article/0264-9381/20/22/001/cqg3_22_001.pdf}, 7591 petsc_uses = {KSP} 7592} 7593 7594@Article{ adams-03a, 7595 author = {Adams, M.~F.}, 7596 journal = {Numerical Linear Algebra with Applications}, 7597 number = {2-3}, 7598 pages = {141-153}, 7599 title = {Algebraic multigrid methods for constrained linear systems with applications to 7600 contact problems in solid mechanics}, 7601 volume = {11}, 7602 year = {2004}, 7603 petsc_uses = {KSP} 7604} 7605 7606@Article{ vandesande1, 7607 author = {H. Vande Sande and H. De Gersem and F. Henrotte and K. Hameyer}, 7608 journal = {IEEE TRANSACTIONS ON MAGNETICS}, 7609 year = {2003}, 7610 volume = {39}, 7611 pages = {1709--1712}, 7612 title = {Solving Nonlinear Magnetic Problems Using {N}ewton Trust Region Methods}, 7613 petsc_uses = {KSP} 7614} 7615 7616@InProceedings{ vbde1, 7617 author = {Rajesh Rawat and Jennifer P. Spinti and Wing Yee and Philip J. Smith}, 7618 year = {2002}, 7619 title = {Parallelization and Integration of a Large Scale Hydrocarbon Pool Fire in the 7620 Uintah PSE}, 7621 booktitle = {In Proceedings of Ninth Internation Conference on Numerical Combustion - ICNC 7622 2002}, 7623 pages = {49-55}, 7624 url = {http://web.ing.unisannio.it/icnc2002/CP21Turbulent_Combustion-Deflagrations_Jets_&_Fires.pdf}, 7625 note = {Extended abstract}, 7626 petsc_uses = {KSP} 7627} 7628 7629@Unpublished{ ep1, 7630 title = {An Inherently-Parallel Method for Solving Discretized Diffusion Equations}, 7631 author = {Bradley R. Eccleston and Todd S. Palmer}, 7632 institution = {Department of Nuclear Engineering, Oregon State University}, 7633 url = {http://www.physics.orst.edu/\~{ }bertrand/stuff/Year_Two_Report.pdf}, 7634 note = {Funded under the ASCI Level III: Computational Transport Issues for Large-Scale 7635 Parallel Simulations}, 7636 year = {1999}, 7637 petsc_uses = {KSP} 7638} 7639 7640@InProceedings{ teo2007scalable, 7641 title = {A scalable modular convex solver for regularized risk minimization}, 7642 author = {Teo, C.H. and Smola, A. and Vishwanathan, SVN and Le, Q.V.}, 7643 booktitle = {Proceedings of the 13th ACM SIGKDD international conference on Knowledge 7644 discovery and data mining}, 7645 pages = {727--736}, 7646 year = {2007}, 7647 organization = {ACM}, 7648 petsc_uses = {KSP} 7649} 7650 7651@InProceedings{ rm02, 7652 author = {Robert Malouf}, 7653 year = {2002}, 7654 title = {A comparison of algorithms for maximum entropy Parameter estimation}, 7655 booktitle = {In Proceedings of the Sixth Conference on Natural Language Learning 7656 (CoNLL-2002)}, 7657 pages = {49-55}, 7658 url = {http://bulba.sdsu.edu/malouf/papers/conll02.pdf}, 7659 petsc_uses = {KSP} 7660} 7661 7662@Unpublished{ hrv02, 7663 title = {Computing the Lambda Modes of a Nuclear Reactor with {SLEPc} and {PETSc}}, 7664 author = {V. Hernandex and J. E. Roman and V. Vidal}, 7665 note = {Submitted to CMMSE}, 7666 petsc_uses = {KSP} 7667} 7668 7669@Article{ tmh2001, 7670 author = {Manfred Gilli and Evis Kellezi and Giorgio Pauletto}, 7671 journal = {Journal of Economic Dynamics and Control}, 7672 year = {2002}, 7673 volume = {26}, 7674 pages = {1499-1515}, 7675 title = {Solving finite difference schemes arising in trivariate option pricing}, 7676 petsc_uses = {KSP} 7677} 7678 7679@InProceedings{ a2, 7680 author = {C.J.Palansuriya and C-H.Lai and C.S.Ierotheou and K.A.Pericleous and D.E.Keyes}, 7681 title = {Comparison of three algorithms for nonlinear metal cutting problems}, 7682 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 7683 Methods}, 7684 editor = {C.-H. Lai et al.}, 7685 publisher = {Domain Decomposition Press, Bergen}, 7686 url = {http://www.ddm.org/DD11/Palansuriya.ps.gz}, 7687 year = {1999}, 7688 petsc_uses = {KSP} 7689} 7690 7691@Unpublished{ mmmdcmaa-web-page, 7692 title = {{M}ulti-{M}odel {M}ulti-{D}omain {C}omputational {M}ethods in {A}erodynamics and 7693 {A}coustics {W}eb Page}, 7694 url = {http://www.cs.odu.edu/\~{ }keyes/nsf}, 7695 author = {David E. Keyes}, 7696 institution = {Old Dominion University}, 7697 petsc_uses = {KSP} 7698} 7699 7700@Conference{ liu2010parallelization, 7701 title = {{Parallelization of Thermal Recovery Simulation Based on PETSc}}, 7702 author = {Liu, L. and Xue, W. and Shu, J. and Ma, L.}, 7703 booktitle = {International Symposium on Parallel and Distributed Processing with 7704 Applications}, 7705 pages = {528--535}, 7706 year = {2010}, 7707 organization = {IEEE}, 7708 petsc_uses = {KSP} 7709} 7710 7711@Unpublished{ oil-reservoir-sim-web-page, 7712 title = {{N}ew {G}eneration {F}ramework for {P}etroleum, {R}eservoir {S}imulation}, 7713 url = {http://www.pe.utexas.edu/CPGE/new_generation}, 7714 institution = {University of Texas at Austin and Argonne National Laboratory}, 7715 key = {University of Texas at Austin and Argonne National Laboratory}, 7716 petsc_uses = {KSP} 7717} 7718 7719@Article{ tmh2001b, 7720 author = {V. Thiagarajan and K. Milfeld and KT. Milfeld}, 7721 journal = {IEEE TRANSACTIONS ON MAGNETICS }, 7722 year = {2001}, 7723 volume = {37}, 7724 pages = {143--146}, 7725 title = {Adapting EMAP3D to parallel processing}, 7726 petsc_uses = {KSP} 7727} 7728 7729@Article{ harbury98, 7730 author = {HK Harbury and W Porod}, 7731 journal = {VLSI Design}, 7732 year = {1998}, 7733 volume = {6}, 7734 pages = {47--51}, 7735 title = {Parallel computation for electronic waves in quantum corrals}, 7736 petsc_uses = {KSP} 7737} 7738 7739@Article{ bludszuwei98, 7740 author = {Mark Bludszuweit}, 7741 journal = {Journal of Lightwave Technology}, 7742 year = {1998}, 7743 volume = {16}, 7744 number = {7}, 7745 pages = {1336--42}, 7746 title = {Mixed Finite Element Beam Propagation Method}, 7747 petsc_uses = {KSP} 7748} 7749 7750@Article{ s1, 7751 author = {J. L. Friedman and N. Stergioulas}, 7752 journal = {Astrophysics Journal}, 7753 year = {1998}, 7754 volume = {492}, 7755 number = {301}, 7756 pages = {}, 7757 title = {}, 7758 petsc_uses = {KSP} 7759} 7760 7761@Article{ s1a, 7762 author = {S. M. Morsink and N. Stergioulas and S. Blattnig}, 7763 journal = {Astrophysics Journal}, 7764 year = {1999}, 7765 volume = {510}, 7766 number = {854}, 7767 pages = {}, 7768 title = {}, 7769 petsc_uses = {KSP} 7770} 7771 7772@PhDThesis{ s2, 7773 author = {N. Stergioulas}, 7774 title = {Ph. D. thesis}, 7775 year = {1996}, 7776 institution = {University of Wisconsin-Milwaukee}, 7777 petsc_uses = {KSP} 7778} 7779 7780@InProceedings{ coral1, 7781 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7782 title = {Solutions of TEAM Problem \#13 Using Integral Equations in a Sequential and 7783 Parallel Computing Environment}, 7784 booktitle = {Proceedings of the Miami TEAM Workshop}, 7785 location = {Florida International University, Department of Electrical Engineering and 7786 Computing Science}, 7787 month = nov, 7788 year = {1993}, 7789 petsc_uses = {KSP} 7790} 7791 7792@InProceedings{ coral2, 7793 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7794 title = {Solutions of TEAM Problems 13 and 20 Using a Volume Integral Formulation}, 7795 booktitle = {Proceedings of Aix-les-Bains TEAM Workshop}, 7796 month = dec, 7797 year = {1994}, 7798 petsc_uses = {KSP} 7799} 7800 7801@InProceedings{ coral3, 7802 author = {L. Kettunen and K. Forsman and D. Levine and W. Gropp}, 7803 title = {Computational Electromagnetics and Parallel Dense Matrix Computations}, 7804 booktitle = {Proceedings of the SIAM Parallel Processing for Scientific Computing Conference}, 7805 location = {Florida International University, Department of Electrical Engineering and 7806 Computing Science}, 7807 year = {1995}, 7808 petsc_uses = {KSP} 7809} 7810 7811@InProceedings{ mijalkovic, 7812 author = {Slobodan Mijalkovi\'{c}}, 7813 title = {Evaluation of Multigrid as a Solver for Stress Analysis Problems in Semiconductor 7814 Process Simulation}, 7815 booktitle = {Multigrid Methods VI: Proceedings of the Sixth European Multigrid Conference Held 7816 Gent, Belgium, September 27--30, 1999.}, 7817 editor = {Erik Dick, Kris Riemslagh, Jan Vierendeels}, 7818 optvolume = {14}, 7819 optseries = {Lecture Notes in Computational Science and Engineering}, 7820 year = {2000}, 7821 publisher = {Springer}, 7822 address = {Berlin}, 7823 optpages = {179--184}, 7824 petsc_uses = {KSP} 7825} 7826 7827@Article{ bludszuwei98a, 7828 author = {Mark Bludszuweit}, 7829 journal = {Journal of Lightwave Technology}, 7830 year = {1998}, 7831 volume = {16}, 7832 number = {7}, 7833 pages = {1336--42}, 7834 title = {Mixed Finite Element Beam Propagation Method}, 7835 petsc_uses = {KSP} 7836} 7837 7838@Article{ gilli-pauletto-1998, 7839 author = {Manfred Gilli and Giorgio Pauletto}, 7840 title = {Parallel {K}rylov Methods for Econometric Model Simulation}, 7841 journal = {Computational Economics}, 7842 year = {2000}, 7843 volume = {16}, 7844 pages = {173--186}, 7845 petsc_uses = {KSP} 7846} 7847 7848% LiteralHTML: 7849% LiteralHTML: <a name="packages"></a><H3><center>Software Packages that use or interface to PETSc</center></H3> 7850% LiteralHTML: 7851@Article{ collierdalcincalo2013, 7852 title = {{PetIGA}: High-Performance Isogeometric Analysis}, 7853 author = {Nathan Collier and Lisandro Dalcin and Victor M. Calo}, 7854 journal = {arxiv}, 7855 year = {2013}, 7856 number = {1305.4452}, 7857 note = {\url{http://arxiv.org/abs/1305.4452}}, 7858 petsc_uses = {KSP} 7859} 7860 7861@Article{ collierdalcinvignalcortescalo2016, 7862 title = {PetIGA: A framework for high-performance isogeometric analysis}, 7863 author = {Lisandro Dalcin and Nathan Collier and Philippe Vignal and AMA C{\^o}rtes and 7864 Victor M. Calo}, 7865 journal = {Computer Methods in Applied Mechanics and Engineering}, 7866 year = {2016}, 7867 petsc_uses = {KSP} 7868} 7869 7870@Misc{ petiga-web-page, 7871 author = {N. Collier and L. Dalcin and V.M. Calo}, 7872 title = {{PetIGA} {W}eb page}, 7873 url = {https://bitbucket.org/dalcinl/petiga/}, 7874 howpublished = {\url{https://bitbucket.org/dalcinl/petiga/}}, 7875 year = {2014}, 7876 petsc_uses = {KSP} 7877} 7878 7879@Article{ logg07, 7880 author = {Logg, Anders}, 7881 title = {Automating the Finite Element Method}, 7882 journal = {Archives of Computational Methods in Engineering}, 7883 volume = {14}, 7884 number = {2}, 7885 pages = {93-138}, 7886 year = {2007}, 7887 doi = {10.1007/s11831-007-9003-9}, 7888 publisher = {Kluwer Academic Publishers}, 7889 issn = {1134-3060}, 7890 language = {English}, 7891 petsc_uses = {KSP} 7892} 7893 7894@Article{ jezequelcouturierdenis12, 7895 author = {Jezequel, Fabienne and Couturier, Rapha\"el and Denis, Christophe}, 7896 title = {Solving large sparse linear systems in a grid environment: the GREMLINS code 7897 versus the PETSc library}, 7898 journal = {The Journal of Supercomputing}, 7899 volume = {59}, 7900 number = {3}, 7901 pages = {1517-1532}, 7902 year = {2012}, 7903 issn = {0920-8542}, 7904 doi = {10.1007/s11227-011-0563-y}, 7905 publisher = {Springer US}, 7906 keywords = {Asynchronous iterations; Grid computing; Iterative method; Multisplitting method; 7907 Sparse linear solver}, 7908 language = {English}, 7909 petsc_uses = {KSP} 7910} 7911 7912@Unpublished{ feap-web-page, 7913 title = {FEAP: A Finite Element Analysis Program}, 7914 url = {http://www.ce.berkeley.edu/projects/feap/}, 7915 author = {FEAP Team}, 7916 note = {Uses PETSc linear solvers - iterative and direct}, 7917 petsc_uses = {KSP} 7918} 7919 7920@Unpublished{ parpre-web-page, 7921 title = {{ParPre} {W}eb {P}age}, 7922 url = {http://www.cs.utk.edu/\~{ }eijkhout/parpre.html}, 7923 institution = {University of Tennessee}, 7924 author = {Victor Eijkhout}, 7925 note = {This is no longer supported. A set of preconditioners built on PETSc}, 7926 petsc_uses = {KSP} 7927} 7928 7929@Unpublished{ pism, 7930 title = {{PISM}: a Parallel Ice Sheet Model}, 7931 author = {{PISM Team}}, 7932 abstract = {We have developed a numerical model of ice sheets called PISM (a Parallel Ice 7933 Sheet Model). The thickness, temperature, velocity and age of the ice are all 7934 simulated, as is the deformation of the earth underneath the ice. New techniques 7935 for fast ice dynamics, earth deformation, and verification have are included.}, 7936 note = {\url{http://www.pism-docs.org/}}, 7937 petsc_uses = {KSP} 7938} 7939 7940@Unpublished{ oofem, 7941 title = {OOFEM - an object oriented finite element package}, 7942 author = {Borek Patzak}, 7943 url = {http://www.oofem.org}, 7944 petsc_uses = {KSP} 7945} 7946 7947@Unpublished{ dks2openfvm, 7948 title = {OpenFVM - a finite volume based general purpose CFD solver}, 7949 author = {Open source development}, 7950 url = {http://openfvm.sourceforge.net/}, 7951 petsc_uses = {KSP} 7952} 7953 7954@Unpublished{ sundar-2008w, 7955 title = {DENDRO: a parallel geometric multigrid library for trilinear finite elements on 7956 octree meshes}, 7957 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 7958 institution = {University of Pennsylvania}, 7959 url = {http://www.seas.upenn.edu/~csela/dendro/html/index.html}, 7960 petsc_uses = {KSP} 7961} 7962 7963@Unpublished{ khatiwala07-software, 7964 title = {A computational framework for simulation of biogeochemical tracers in the ocean}, 7965 author = {Khatiwala, S.}, 7966 institution = {Columbia University}, 7967 url = {http://www.ldeo.columbia.edu/\~{ }spk}, 7968 petsc_uses = {KSP} 7969} 7970 7971@InBook{ jiaolima99, 7972 author = {Xiangmin Jiao and Xiang-Yang Li and Xiaosong Ma}, 7973 chapter = {{SIFFEA}:Scalable Integrated Framework for Finite Element Analysis}, 7974 url = {http://portal.acm.org/citation.cfm?id=646895.709725}, 7975 title = {Lecture Notes in Computer Science}, 7976 publisher = {Springer-Verlag}, 7977 volume = {1732}, 7978 year = {1999}, 7979 petsc_uses = {KSP} 7980} 7981 7982@Article{ crow1, 7983 author = {C. S. Crow IV}, 7984 title = {DistSolve: An Open Source Web Service for Solving Sparse Systems of Equations}, 7985 journal = {Hopkins Undergraduate Research Journal}, 7986 year = {2003}, 7987 url = {http://www.jhu.edu/hurj/issue2/09D%20Crow%20DistSolve.pdf}, 7988 petsc_uses = {KSP} 7989} 7990 7991@Unpublished{ petsc-python, 7992 title = {PETSc for Python}, 7993 author = {L. Dalcin}, 7994 url = {https://petsc.org/main/petsc4py}, 7995 note = {Provides Python bindings for PETSc}, 7996} 7997 7998@Unpublished{ cfdship, 7999 title = {{CFDShip-Iowa}}, 8000 author = {Pablo M. Carrica and Robert V. Wilson and Fred Stern}, 8001 institution = {University of Iowa}, 8002 url = {http://www.iihr.uiowa.edu/\~{ }cfdship/}, 8003 note = {CFDShip-Iowa is a multiblock free surface flow solver that uses overset 8004 structured grids, designed for ship applications}, 8005 petsc_uses = {KSP} 8006} 8007 8008@Unpublished{ bvw, 8009 title = {Multiflow}, 8010 author = {Berend van Wachem}, 8011 institution = {Mechanical Engineering - Chalmers University of Technology}, 8012 url = {http://www.tfd.chalmers.se/\~{ }berend/page3.html}, 8013 note = {MultiFlow is a curvlinear, multiblock, multiprocessor flowsolver for multiphase 8014 flows.}, 8015 petsc_uses = {KSP} 8016} 8017 8018@Unpublished{ dks2, 8019 title = {FENA - A Finite Element Model for the North Atlantic}, 8020 author = {Jens Schroeter}, 8021 institution = {Alfred-Wegener-Institute for Polar and Marine Research}, 8022 url = {http://www.awi-bremerhaven.de/Modelling/INVERSE/FENAdesc/FENAdesc.html}, 8023 petsc_uses = {KSP} 8024} 8025 8026@TechReport{ piwonski2010idea, 8027 title = {The Idea and Concept of {Metos3D}: {A} Marine Ecosystem Toolkit for Optimization 8028 and Simulation in {3-D}}, 8029 author = {Piwonski, J. and Slawig, T.}, 8030 year = {2010}, 8031 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8032 url = {http://www.informatik.uni-kiel.de/uploads/tx_publication/tr_1016_01.pdf}, 8033 petsc_uses = {KSP} 8034} 8035 8036@Unpublished{ metos3d-web, 8037 title = {{Metos3D}: {A} Marine Ecosystem Toolkit for Optimization and Simulation in 3-D}, 8038 author = {Piwonski, J. and Slawig, T.}, 8039 institution = {Christian-Albrechts-Universit\"at zu Kiel}, 8040 url = {http://www.informatik.uni-kiel.de/en/algorithmic-optimal-control/software/metos3d/}, 8041 petsc_uses = {KSP} 8042} 8043 8044@Unpublished{ magpar, 8045 author = {W. Scholz}, 8046 title = {Magpar: Parallel Micromagnetics Code}, 8047 institution = {Vienna University of Technology}, 8048 url = {http://magnet.atp.tuwien.ac.at/scholz/magpar/}, 8049 petsc_uses = {KSP} 8050} 8051 8052@Misc{ libmesh:sourceforge, 8053 author = {}, 8054 title = {{libMesh}:a C++ framework for the numerical simulation of partial differential 8055 equations on serial and parallel platforms}, 8056 note = {[Online]}, 8057 url = {http://libmesh.github.io}, 8058 petsc_uses = {KSP} 8059} 8060 8061@Misc{ moose-web-page, 8062 title = {Multiphysics {O}bject-{O}riented {S}imulation {E}nvironment ({MOOSE})}, 8063 author = {David Andrs and Cody Permann and Andrew Slaughter and Richard Martineau and Derek 8064 Gaston and John Peterson and Jason Miller}, 8065 institution = {Idaho National Laboratory}, 8066 howpublished = {\url{http://mooseframework.org}}, 8067 petsc_uses = {KSP} 8068} 8069 8070@Article{ gaston2009moose, 8071 title = {MOOSE: {A} parallel computational framework for coupled systems of nonlinear 8072 equations}, 8073 author = {Gaston, D. and Newman, C. and Hansen, G. and Lebrun-Grandi{\'e}, D.}, 8074 journal = {Nuclear Engineering and Design}, 8075 volume = {239}, 8076 number = {10}, 8077 pages = {1768--1778}, 8078 year = {2009}, 8079 publisher = {Elsevier}, 8080 petsc_uses = {KSP} 8081} 8082 8083@Article{ tonks2012object, 8084 title = {An object-oriented finite element framework for multiphysics phase field 8085 simulations}, 8086 author = {Tonks, M.R. and Gaston, D. and Millett, P.C. and Andrs, D. and Talbot, P.}, 8087 journal = {Computational Materials Science}, 8088 volume = {51}, 8089 number = {1}, 8090 pages = {20--29}, 8091 year = {2012}, 8092 publisher = {Elsevier}, 8093 petsc_uses = {KSP} 8094} 8095 8096@Misc{ pylithmanual, 8097 author = {Brad Aagaard and Sue Kientz and Matthew G. Knepley and Surendra Somala and Leif 8098 Strand and Charles Williams}, 8099 title = {{PyLith} User Manual Version 2.0.0}, 8100 year = {2014}, 8101 url = {http://geodynamics.org/cig/software/github/pylith/v2.0.0/pylith-2.0.0_manual.pdf}, 8102 petsc_uses = {KSP} 8103} 8104 8105@Misc{ pylith-web-page, 8106 author = {Brad Aagaard and Matthew G. Knepley and Charles Williams}, 8107 title = {{PyLith}}, 8108 year = {2012}, 8109 url = {http://geodynamics.org/resources/pylith/}, 8110 howpublished = {\url{http://geodynamics.org/resources/pylith/}}, 8111 petsc_uses = {KSP} 8112} 8113 8114@Misc{ galemanual, 8115 author = {Walter Landry and Luke Hodkinson and Susan Kientz}, 8116 title = {Gale User Manual Version 2.0.0}, 8117 year = {2011}, 8118 url = {http://geodynamics.org/cig/software/gale/gale.pdf}, 8119 petsc_uses = {KSP} 8120} 8121 8122@Unpublished{ underworld, 8123 author = {Louis Moresi}, 8124 title = {{UnderWorld}: A Geodynamics Modelling Code}, 8125 institution = {Monash University}, 8126 url = {http://www.mcc.monash.edu/twiki/view/Codes}, 8127 petsc_uses = {KSP} 8128} 8129 8130@Article{ moresi2007computational, 8131 title = {Computational approaches to studying non-linear dynamics of the crust and 8132 mantle}, 8133 author = {Moresi, L. and Quenette, S. and Lemiale, V. and Meriaux, C. and Appelbe, B. and 8134 M{\"u}hlhaus, H.B.}, 8135 journal = {Physics of the Earth and Planetary Interiors}, 8136 volume = {163}, 8137 number = {1-4}, 8138 pages = {69--82}, 8139 year = {2007}, 8140 publisher = {Elsevier}, 8141 petsc_uses = {KSP} 8142} 8143 8144@Article{ pitt2009chaste, 8145 title = {Chaste: a test-driven approach to software development for biological modelling}, 8146 author = {Pitt-Francis, J. and Pathmanathan, P. and Bernabeu, M.O. and Bordas, R. and 8147 Cooper, J. and Fletcher, A.G. and Mirams, G.R. and Murray, P. and Osborne, J.M. 8148 and Walter, A. and others}, 8149 journal = {Computer Physics Communications}, 8150 volume = {180}, 8151 number = {12}, 8152 pages = {2452--2471}, 8153 year = {2009}, 8154 publisher = {Elsevier}, 8155 petsc_uses = {KSP} 8156} 8157 8158@Misc{ fenicsproject, 8159 title = {{The FEniCS project}}, 8160 author = {Logg, A. and {\O}lgaard, K. and Rognes, M.E. and Wells, G.N. and Jansson, J. and 8161 Kirby, R.C. and Knepley, M.G. and Lindbo, D. and Skavhaug, O.}, 8162 note = {A continually updated technical report. \url{http://fenicsproject.org}}, 8163 url = {http://fenicsproject.org}, 8164 year = {2011}, 8165 petsc_uses = {KSP} 8166} 8167 8168@Unpublished{ snark, 8169 title = {Snark: A suite of software for geoscientific applications and a philosophy of 8170 scientific software development}, 8171 institution = {Victorian Partnership for Advanced Computing}, 8172 url = {http://vpac.org/Snark}, 8173 petsc_uses = {KSP} 8174} 8175 8176@Misc{ imoose:sourceforge, 8177 author = {Guido Arians and Thomas Bauer and Christian Kaehler and Wolfgang Mai and 8178 Christoph Monzel and Dirk {van Riesen} and Christoph Schlensok}, 8179 title = {Innovative Modern Object-Oriented Solving Environment - {iMOOSE}}, 8180 note = {[Online]}, 8181 url = {http://imoose.sourceforge.net}, 8182 petsc_uses = {KSP} 8183} 8184 8185@Unpublished{ fossi, 8186 author = {Stephan Frickenhaus}, 8187 title = {FoSSI: Family of Simplified Solver Interfaces, offers scalable access to 8188 MPI-parallel solvers from CSR-matrix format frequently used in sequential/vector 8189 codes}, 8190 institution = {AWI-Bremerhaven, Germanny}, 8191 url = {http://www.awi.de/en/research/scientific_computing/research_topics_of_scientific_computing/fossi/}, 8192 petsc_uses = {KSP} 8193} 8194 8195@Unpublished{ fun3dweb, 8196 author = {Dinesh Kaushik}, 8197 title = {PETSC-FUN3D Benchmark Page}, 8198 institution = {ODU/ANL}, 8199 url = {http://www.mcs.anl.gov/petsc-fun3d}, 8200 note = {CFD Benchmark of some solvers in PETSc}, 8201 petsc_uses = {KSP} 8202} 8203 8204@Unpublished{ scirun, 8205 author = {SCIRun Development Team}, 8206 title = {SCIRun}, 8207 institution = {University of Utah}, 8208 url = {http://www.sci.utah.edu/stories/2001/jul_scirun120.html}, 8209 note = {SCIRun now uses PETSc linear solvers}, 8210 petsc_uses = {KSP} 8211} 8212 8213@Misc{ prometheus, 8214 author = {Mark F. Adams}, 8215 title = {Prometheus - A scalable unstructured finite element solver}, 8216 institution = {Berkeley}, 8217 howpublished = {\url{http://www.cs.berkeley.edu/~madams/prometheus}}, 8218 url = {http://www.cs.berkeley.edu/\~{ }madams/prometheus}, 8219 petsc_uses = {KSP} 8220} 8221 8222@Unpublished{ illuminator, 8223 author = {Adam C. Powell, IV}, 8224 title = {Illuminator Distributed Visualization Library}, 8225 url = {http://lyre.mit.edu/\~{ }powell/Illuminator.html}, 8226 petsc_uses = {KSP} 8227} 8228 8229@Unpublished{ rheoplast, 8230 title = {RheoPlast Phase Field Multi-Physics Code}, 8231 author = {Adam Powell and David Dussault and Bo Zhou}, 8232 url = {http://lyre.mit.edu/\~{ }powell/rheoplast.html}, 8233 petsc_uses = {KSP} 8234} 8235 8236@Misc{ tao-web-page, 8237 title = {{Toolkit for Advanced Optimization ({TAO})} {W}eb Page}, 8238 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8239 and Steve Benson and Lois Curfman McInnes and Jorge Mor{\'e}}, 8240 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8241 howpublished = {\url{http://www.mcs.anl.gov/tao}}, 8242 petsc_uses = {KSP} 8243} 8244 8245@TechReport{ tao-user-ref, 8246 title = {{Toolkit for Advanced Optimization ({TAO}) users manual}}, 8247 author = {Alp Dener and Adam Denchfield and Todd Munson and Jason Sarich and Stefan Wild 8248 and Steve Benson and Lois Curfman McInnes}, 8249 institution = {Argonne National Laboratory}, 8250 year = {2019}, 8251 number = {ANL/MCS-TM-322 - Rev 3.12}, 8252 petsc_uses = {KSP} 8253} 8254 8255% url = "http://www.mcs.anl.gov/tao", 8256@Unpublished{ mefpp-web-page, 8257 title = {{MEF++} {W}eb {P}age}, 8258 url = {http://www.giref.ulaval.ca/ressources/projets/mefpp.html}, 8259 institution = {Groupe Interdisiplinaire de Recherche en Elements Finis}, 8260 author = {Eric Chamberland}, 8261 note = {A finite element code for fluid dynamics, solid mechanics, thermal and 8262 multiphysics}, 8263 petsc_uses = {KSP} 8264} 8265 8266@Unpublished{ tipetsc-titanium, 8267 title = {Ti-PETSc - an interface to PETSc from Titanium}, 8268 institution = {Berkeley}, 8269 author = {He, Yun and Liblit, Bun and Lin, Chang}, 8270 url = {https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=9f7959be13337c735d52e5c0b0994bdea6d75a96}, 8271 year = {1999}, 8272 petsc_uses = {KSP}, 8273} 8274 8275@Unpublished{ ptatin-web-page, 8276 title = {ptatin3d}, 8277 author = {Jed Brown and Laetitia {Le Pourhiet} and Dave A. May and Patrick Sanan}, 8278 url = {https://bitbucket.org/jedbrown/ptatin3d}, 8279 year = {2018}, 8280 petsc_uses = {KSP} 8281} 8282 8283@Misc{ multiphase-web-page, 8284 author = {Q. Zou}, 8285 title = {Multiphase flow with {PETSc}}, 8286 institution = {LANL}, 8287 howpublished = {\url{http://cnls-www.lanl.gov/~qzou}}, 8288 url = {http://cnls-www.lanl.gov/\~{ }qzou}, 8289 lab = {LANL}, 8290 petsc_uses = {KSP} 8291} 8292 8293@Misc{ electromag-web-page, 8294 title = {{EMSolve Web} page}, 8295 institution = {LLNL}, 8296 howpublished = {http://www.llnl.gov/casc/emsolve}, 8297 url = {http://www.Llnl.gov/casc/emsolve}, 8298 author = {Daniel {White et al.}}, 8299 lab = {LLNL}, 8300 petsc_uses = {KSP} 8301} 8302 8303@Unpublished{ fe-software-web-page, 8304 institution = {Kuleuven}, 8305 title = {Finite element software}, 8306 url = {http://www.esat.kuleuven.ac.be/elen/research/software-development}, 8307 petsc_uses = {KSP} 8308} 8309 8310@Misc{ petsc-web-page, 8311 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8312 Brown and Peter Brune and Kris Buschelman and Emil~M. Constantinescu and Lisandro 8313 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8314 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8315 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8316 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8317 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8318 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8319 Zhang}, 8320 title = {{PETS}c {W}eb page}, 8321 url = {https://petsc.org/}, 8322 howpublished = {\url{https://petsc.org/}}, 8323 year = {2023} 8324} 8325 8326@Unpublished{ petsc-debian-package, 8327 author = {Adam C. Powell, IV}, 8328 title = {Debian package for PETSc}, 8329 url = {http://lyre.mit.edu/\~{ }powell/petsc.html}, 8330 petsc_uses = {KSP} 8331} 8332 8333@Unpublished{ cactus, 8334 title = {Cactus Website}, 8335 url = {http://www.cactuscode.org/}, 8336 note = {Provides two interface to the PETSc solvers}, 8337 petsc_uses = {KSP} 8338} 8339 8340@Unpublished{ petsc-fem, 8341 author = {Mario Storti and Norberto Nigro}, 8342 title = {PETSc-FEM: A General Purpose, Parallel, Multi-Physics FEM Program}, 8343 institution = {Centro Internacional de Metodos Computacionales en Ingenieria (CIMEC)}, 8344 url = {http://www.cimec.org.ar/petscfem}, 8345 petsc_uses = {KSP} 8346} 8347 8348@Misc{ fidap, 8349 title = {FIDAP 8.5}, 8350 howpublished = {\url{http://www.fluent.com}}, 8351 url = {http://www.fluent.com}, 8352 note = {Fluent's commercial finite element fluid code uses PETSc for parallel linear 8353 solves.}, 8354 key = {FIDAP 8.5}, 8355 petsc_uses = {KSP} 8356} 8357 8358@Unpublished{ slepc, 8359 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8360 Vicente Hern\'andez and Vicent Vidal}, 8361 title = {{SLEPc} Website}, 8362 url = {http://slepc.upv.es/}, 8363 note = {Scalable Library for Eigenvalue Problem Computations}, 8364 petsc_uses = {KSP} 8365} 8366 8367@TechReport{ slepc-users-manual, 8368 author = {Carmen Campos and Jos\'e E. Rom\'an and Eloy Romero and Andr\'es Tom\'as and 8369 Vicente Hern\'andez and Vicent Vidal}, 8370 title = {{SLEPc} Users Manual}, 8371 number = {DISC-II/24/02}, 8372 url = {http://slepc.upv.es/}, 8373 note = {Scalable Library for Eigenvalue Problem Computations}, 8374 petsc_uses = {KSP} 8375} 8376 8377@Misc{ deal.ii, 8378 title = {deal.II}, 8379 howpublished = {\url{http://www.dealii.org}}, 8380 url = {http://www.dealii.org}, 8381 note = {deal.II is a C++ library targeting adaptive finite elements and error estimation. 8382 It allows PETSc linear algebra and solvers to be used underneath.}, 8383 key = {deal.II 5.0}, 8384 petsc_uses = {KSP} 8385} 8386 8387@Article{ bangerth2007deal, 8388 title = {{deal.II---A general-purpose object-oriented finite element library}}, 8389 author = {Bangerth, W. and Hartmann, R. and Kanschat, G.}, 8390 journal = {ACM Transactions on Mathematical Software (TOMS)}, 8391 volume = {33}, 8392 number = {4}, 8393 pages = {24--es}, 8394 issn = {0098-3500}, 8395 year = {2007}, 8396 publisher = {ACM}, 8397 petsc_uses = {KSP} 8398} 8399 8400@Misc{ globalarrays, 8401 author = {Jarek {Nieplocha et al.}}, 8402 title = {Global Arrays}, 8403 institution = {Pacific Northwest National Laboratories}, 8404 howpublished = {\url{http://www.emsl.pnl.gov/docs/global}}, 8405 url = {http://www.emsl.pnl.gov/docs/global}, 8406 note = {Global arrays can use PETSc linear solvers}, 8407 lab = {PNNL}, 8408 petsc_uses = {KSP} 8409} 8410 8411% LiteralHTML: 8412% LiteralHTML: <a name="software"><H3><center>Software Engineering</center></H3> 8413% LiteralHTML: 8414@Article{ petsccommunity2022, 8415 title = {The Community is the Infrastructure: A Short Discussion of the {PETSc} User 8416 Community}, 8417 author = {Mark Adams and Satish Balay and Jed Brown and Victor Eijkhout and Jacob 8418 Faibussowitsch and Fande Kong and Matthew Knepley and Scott Kruger and Oana Marin 8419 and Richard Mills and Todd Munson and Patrick Sanan and Barry Smith and Hong Zhang 8420 and Hong Zhang and Junchao Zhang}, 8421 journal = {Computing in Science and Engineering}, 8422 volume = {24}, 8423 number = {03}, 8424 pages = {6--15}, 8425 issn = {1558-366X}, 8426 doi = {10.1109/MCSE.2022.3169974}, 8427 publisher = {IEEE Computer Society}, 8428 address = {Los Alamitos, CA, USA}, 8429 month = may, 8430 year = {2022}, 8431 url = {https://figshare.com/articles/conference_contribution/The_Community_is_the_Infrastructure_A_Short_Discussion_of_the_PETSc_User_Community/16523043}, 8432 petsc_uses = {KSP} 8433} 8434 8435@Article{ brownknepleysmith14, 8436 author = {Jed Brown and Matthew G. Knepley and Barry Smith}, 8437 title = {Run-time extensibility and librarization of simulation software}, 8438 journal = {IEEE Computing in Science and Engineering}, 8439 month = jan, 8440 volume = {17}, 8441 number = {1}, 8442 pages = {38--45}, 8443 doi = {10.1109/MCSE.2014.95}, 8444 year = {2015}, 8445 petsc_uses = {KSP} 8446} 8447 8448@TechReport{ ass2012, 8449 author = {Shrirang Abhyankar and Barry Smith and Kerry Stevens}, 8450 title = {Preliminary implementation of Hybrid {MPI}/pthread programming model in {PETSc}}, 8451 institution = {Argonne National Laboratory}, 8452 type = {Preprint}, 8453 year = {2012}, 8454 number = {ANL/MCS-P2011-0112}, 8455 petsc_uses = {KSP} 8456} 8457 8458@TechReport{ clearyknepley99, 8459 author = {Andrew Cleary and Matthew G. Knepley}, 8460 title = {Solvers as Operators}, 8461 institution = {Lawrence Livermore National Laboratory}, 8462 type = {Technical Report}, 8463 number = {UCRL-ID-135342}, 8464 year = {1999}, 8465 petsc_uses = {KSP} 8466} 8467 8468@TechReport{ smcabbkz2012, 8469 author = {Barry Smith and Lois Curfman McInnes and Emil Constantinescu and Mark Adams and 8470 Satish Balay and Jed Brown and Matthew Knepley and Hong Zhang}, 8471 title = {{PETSc's} software strategy for the design space of composable extreme-scale 8472 solvers}, 8473 institution = {Argonne National Laboratory}, 8474 type = {Preprint}, 8475 note = {{DOE} Exascale Research Conference, April 16-18, 2012, Portland, OR}, 8476 year = {2012}, 8477 number = {ANL/MCS-P2059-0312}, 8478 petsc_uses = {KSP} 8479} 8480 8481@InProceedings{ mhwpmhs2009, 8482 author = {R. T. Mills and F. M. Hoffman and P. H. Worley and K. S. Pwerumalla and A. Mirin 8483 and G. E. Hammond and B. Smith}, 8484 title = {Coping at the User-Level with Resource Limitations in the {Cray} Message Passing 8485 Toolkit {MPI} at Scale}, 8486 booktitle = {Cray Users Group Conference}, 8487 year = {2009}, 8488 petsc_uses = {KSP} 8489} 8490 8491@InProceedings{ msmhls2010, 8492 author = {R. T. Mills and V. Sripathi and G. Mahinthakumar and G. Hammond and P. C. 8493 Lichtner and B. F. Smith}, 8494 title = {Engineering {PFLOTRAN} for Scalable Performance on {Cray} {XT} and {IBM} 8495 {BlueGene} Architectures}, 8496 booktitle = {Proceedings of SciDAC 2010 Annual Meeting}, 8497 year = {2010}, 8498 petsc_uses = {KSP} 8499} 8500 8501@InCollection{ msk2013, 8502 author = {Victor Minden and Barry F. Smith and Matthew G. Knepley}, 8503 title = {Preliminary Implementation of {PETSc} Using {GPUs}}, 8504 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8505 series = {Lecture Notes in Earth System Sciences}, 8506 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8507 Yaolin Shi}, 8508 doi = {10.1007/978-3-642-16405-7_7}, 8509 publisher = {Springer Berlin Heidelberg}, 8510 pages = {131--140}, 8511 year = {2013}, 8512 isbn = {978-3-642-16404-0}, 8513 petsc_uses = {KSP} 8514} 8515 8516@InCollection{ knepleyyuen13, 8517 author = {Matthew G. Knepley and David A. Yuen}, 8518 title = {Why Scientists and Engineers need {GPU}s today}, 8519 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8520 series = {Lecture Notes in Earth System Sciences}, 8521 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8522 Yaolin Shi}, 8523 doi = {10.1007/978-3-642-16405-7_1}, 8524 publisher = {Springer Berlin Heidelberg}, 8525 pages = {131--140}, 8526 year = {2013}, 8527 isbn = {978-3-642-16404-0}, 8528 petsc_uses = {KSP} 8529} 8530 8531@InCollection{ karpeevknepleybrune13, 8532 author = {Dmitry A. Karpeev and Matthew G. Knepley and Peter R. Brune}, 8533 title = {Accurate Evaluation of Local Averages on {GPGPUs}}, 8534 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8535 series = {Lecture Notes in Earth System Sciences}, 8536 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8537 Yaolin Shi}, 8538 doi = {10.1007/978-3-642-16405-7_30}, 8539 publisher = {Springer Berlin Heidelberg}, 8540 pages = {487--501}, 8541 year = {2013}, 8542 isbn = {978-3-642-16404-0}, 8543 petsc_uses = {KSP} 8544} 8545 8546@InCollection{ zhengetal13, 8547 title = {{GPU} Implementation of Multigrid Solver for {S}tokes Equation with Strongly 8548 Variable Viscosity}, 8549 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8550 Zhang and Yaolin Shi}, 8551 booktitle = {GPU Solutions to Multi-scale Problems in Science and Engineering}, 8552 series = {Lecture Notes in Earth System Sciences}, 8553 editor = {David A. Yuen and Long Wang and Xuebin Chi and Lennart Johnsson and Wei Ge and 8554 Yaolin Shi}, 8555 doi = {10.1007/978-3-642-16405-7_21}, 8556 publisher = {Springer Berlin Heidelberg}, 8557 pages = {321--333}, 8558 year = {2013}, 8559 isbn = {978-3-642-16404-0}, 8560 petsc_uses = {KSP} 8561} 8562 8563@Article{ zhengetal13b, 8564 title = {Implementation of a multigrid solver on {GPU} for {S}tokes equations with 8565 strongly variable viscosity based on {M}atlab and {CUDA}}, 8566 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 8567 Zhang and Yaolin Shi}, 8568 journal = {IJHPCA}, 8569 volume = {28}, 8570 number = {1}, 8571 pages = {50--60}, 8572 doi = {10.1177/1094342013478640}, 8573 year = {2013}, 8574 petsc_uses = {KSP} 8575} 8576 8577@InBook{ s2011, 8578 author = {B. Smith}, 8579 chapter = {PETSc, the Portable, Extensible Toolkit for Scientific computing}, 8580 title = {Encyclopedia of Parallel Computing}, 8581 bookeditor = {D. Padua}, 8582 publisher = {Springer}, 8583 year = {2011}, 8584 petsc_uses = {KSP} 8585} 8586 8587@Article{ acostamejia06, 8588 author = {Carlos D. Acosta and Carlos E. Mej\'ia}, 8589 title = {Computaci\'on cient\'ifica en paralelo con interfaz MATLAB a PETSc}, 8590 journal = {Lecturas Matem\'aticas}, 8591 volume = {27}, 8592 year = {2006}, 8593 pages = {213--224}, 8594 petsc_uses = {KSP} 8595} 8596 8597@InProceedings{ quenettemoresisunterappelbe07, 8598 author = {Steve Quenette and Louis Moresi and {P. D.} Sunter and Bill F. Appelbe}, 8599 title = {Explaining StGermain: An aspect oriented environment for building extensible 8600 computational mechanics modeling software}, 8601 booktitle = {Parallel and Distributed Processing Symposium, IPDPS 2007}, 8602 publisher = {IEEE}, 8603 pages = {1--8}, 8604 yerar = {2007}, 8605 petsc_uses = {KSP} 8606} 8607 8608@Article{ dfm1, 8609 title = {Vectorized sparse matrix multiply for compressed row storage format}, 8610 author = {E. F. D'Azevedo and M. R. Fahey and R. T. Mills}, 8611 journal = {Lecture Notes in Computer Science}, 8612 year = {2005}, 8613 pages = {99--106}, 8614 volume = {3514}, 8615 lab = {ORNL}, 8616 petsc_uses = {KSP} 8617} 8618 8619@InProceedings{ laniquintinokimpedeconinckvandewallepoedts05, 8620 author = {Andrea Lani and Tiago Quintino and Dries Kimpe and Herman Deconinck and Stefan 8621 Vandewalle and Stefaan Poedts}, 8622 title = {The COOLFluiD Framework: Design Solutions for High Performance Object Oriented 8623 Scientific Computing Software}, 8624 booktitle = {Computational Science ICCS 2005: 5th International Conference}, 8625 year = {2005}, 8626 note = {Lecture Notes in Computer Science}, 8627 volume = {3514}, 8628 publisher = {Springer-Verlag GmbH}, 8629 petsc_uses = {KSP} 8630} 8631 8632@InProceedings{ dalcin-paz-storti, 8633 author = {L. Dalcin and R. Paz and M. Storti}, 8634 title = {Desarrollo de Aplicaciones Paralelas en Python}, 8635 booktitle = {Proceedings of *XIV Congress on Numerical Methods and its Applications (ENIEF). 8636 Bariloche, Argentina}, 8637 year = {2004}, 8638 petsc_uses = {KSP} 8639} 8640 8641@Article{ mpi-python, 8642 author = {L. Dalcin and R. Paz and M. Storti}, 8643 title = {MPI for Python}, 8644 journal = {Journal of Parallel and Distributed Computing}, 8645 year = {2005}, 8646 petsc_uses = {KSP} 8647} 8648 8649@Unpublished{ hrv02a, 8650 title = {{SLEPc}: Scalable Library for Eigenvalue Problem Computations}, 8651 author = {V. Hernandex and J. E. Roman and V. Vidal}, 8652 note = {Submited to VecPar 2002}, 8653 year = {2002}, 8654 petsc_uses = {KSP} 8655} 8656 8657@Article{ knyazev2007block, 8658 title = {Block Locally Optimal Preconditioned Eigenvalue Xolvers {(BLOPEX)} in {Hypre} and 8659 {PETSc}}, 8660 author = {Knyazev, A. V. and Argentati, M. E. and Lashuk, I. and Ovtchinnikov, E. E.}, 8661 journal = {SIAM Journal on Scientific Computing}, 8662 volume = {29}, 8663 pages = {2224-2239}, 8664 doi = {10.1137/060661624}, 8665 year = {2007}, 8666 petsc_uses = {KSP} 8667} 8668 8669@MastersThesis{ aarrestad-master, 8670 author = {Asbjorn Hoiland Aarrestad}, 8671 title = {Time Dependent Solution of the Schrodinger Equation for Parallel Computers}, 8672 school = {University of Bergen}, 8673 month = aug, 8674 year = {2003}, 8675 url = {http://www.parallab.uib.no/projects/molecul/matrix/}, 8676 note = {Implemented Runge-Kutta methods using PETSc}, 8677 petsc_uses = {KSP} 8678} 8679 8680@PhDThesis{ kaushik-phd, 8681 author = {D. K. Kaushik}, 8682 title = {Performance Modeling and Prediction for the Scalable Solution of Partial 8683 Differential Equations on Unstructured Grids}, 8684 school = {Old Dominion University}, 8685 month = dec, 8686 year = {2002}, 8687 url = {http://www.mcs.anl.gov/\~{ }kaushik/Papers/thesis.ps}, 8688 petsc_uses = {KSP} 8689} 8690 8691@TechReport{ rb1, 8692 author = {Rickard Bergstrom}, 8693 title = {Object Oriented Implementation of a General Finite Element Code}, 8694 number = {2002-13}, 8695 institution = {Chalmers Finite Element Center, Chalmers University of Technology}, 8696 year = {2002}, 8697 url = {http://www.phi.chalmers.se/pub/preprints/pdf/phiprint-2002-13.pdf}, 8698 note = {Discribes a finite element software package that uses PETSc for its solvers}, 8699 petsc_uses = {KSP} 8700} 8701 8702@InProceedings{ dbl1, 8703 author = {Enzo A. Dari and Gustavo C. Buscaglia and Adrian J. Lew}, 8704 title = {A Parallel General Purpose Finite Element System}, 8705 booktitle = {IX SIAM Conference on Parallel Processing for Scientific Computing}, 8706 publisher = {SIAM}, 8707 year = {1999}, 8708 url = {http://cabmec1.cnea.gov.ar/papers/apgpfes.ps.gz}, 8709 note = {Describes software that uses PETSc for its parallel linear solves}, 8710 petsc_uses = {KSP} 8711} 8712 8713@Article{ p1, 8714 title = {Parallel Components for PDEs and Optimization: Some Issues and Experiences}, 8715 author = {B. Norris and S. Balay and S. Benson and L. Freitag and P. Hovland and L. McInnes 8716 and B. Smith}, 8717 journal = {Parallel Computing}, 8718 year = {2002}, 8719 pages = {1811--1831}, 8720 volume = {28 (12)}, 8721 petsc_uses = {KSP} 8722} 8723 8724@Article{ automatic-ad, 8725 author = {Paul Hovland and Boyana Norris and Barry Smith}, 8726 title = {Making Automatic Differentiation Truly Automatic: Coupling {PETSc} with {ADIC}}, 8727 year = {2005}, 8728 journal = {Future Generation Computer Systems}, 8729 volume = {21}, 8730 number = {8}, 8731 pages = {1426--1438}, 8732 petsc_uses = {KSP} 8733} 8734 8735@TechReport{ remote-math, 8736 author = {Elizabeth Dolan and Paul Hovland and Jorge Mor\'e and Boyana Norris and Barry 8737 Smith}, 8738 title = {Remote Access to Mathematical Software}, 8739 number = {ANL/MCS-P889-0601}, 8740 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8741 month = jun, 8742 year = {2001}, 8743 url = {http://icm.mcs.kent.edu/research/iamc01proceedings.html}, 8744 petsc_uses = {KSP} 8745} 8746 8747@InProceedings{ gropp98, 8748 author = {William D. Gropp}, 8749 title = {Exploiting Existing Software in Libraries: Successes, Failures, and Reasons Why}, 8750 publisher = {SIAM}, 8751 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8752 Scientific and Engineering Computing}, 8753 year = {1999}, 8754 pages = {21-29}, 8755 petsc_uses = {KSP} 8756} 8757 8758@InProceedings{ knepleysarin99, 8759 author = {Matthew Knepley and Vivek Sarin}, 8760 title = {Algorithm Development for Large Scale Computing}, 8761 publisher = {SIAM}, 8762 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8763 Scientific and Engineering Computing}, 8764 note = {\url{http://books.google.com/books?id=2Da5OcnjPSgC&lpg=PA58&ots=TJCK64BUeg&dq=Bill%20Gropp%20Science%20Engineering%20Object%20Oriented&pg=PA138#v=onepage&q&f=false}}, 8765 year = {1999}, 8766 petsc_uses = {KSP} 8767} 8768 8769@InBook{ bgms00, 8770 author = {S. Balay and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8771 chapter = {Software for the Scalable Solution of {PDEs}}, 8772 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P834.ps.Z}, 8773 title = {CRPC Handbook of Parallel Computing}, 8774 editor = {J. Dongarra and I. Foster and G. Fox and B. Gropp and K. Kennedy and L. Torczon 8775 and A. White}, 8776 publisher = {Morgan Kaufmann Publishers}, 8777 year = {2002}, 8778 petsc_uses = {KSP} 8779} 8780 8781@InProceedings{ hovland_norris_smith98, 8782 author = {Paul Hovland and Boyana Norris and Lucas Roh and Barry Smith}, 8783 title = {Developing a Derivative-Enhanced Object-Oriented Toolkit for Scientific 8784 Computations}, 8785 publisher = {SIAM}, 8786 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8787 Scientific and Engineering Computing}, 8788 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P731.ps.Z}, 8789 note = {also available as Argonne preprint ANL/MCS-P731-1098}, 8790 year = {1999}, 8791 pages = {129-137}, 8792 petsc_uses = {KSP} 8793} 8794 8795@InProceedings{ efficient, 8796 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8797 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 8798 Libraries}, 8799 booktitle = {Modern Software Tools in Scientific Computing}, 8800 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 8801 publisher = {Birkhauser Press}, 8802 pages = {163--202}, 8803 year = {1997}, 8804 petsc_uses = {KSP} 8805} 8806 8807% url = "ftp://info.mcs.anl.gov/pub/tech_reports/reports/P634.ps.Z" 8808@TechReport{ petsc-user-ref, 8809 author = {Satish Balay and Shrirang Abhyankar and Mark~F. Adams and Steven Benson and Jed 8810 Brown and Peter Brune and Kris Buschelman and Emil Constantinescu and Lisandro 8811 Dalcin and Alp Dener and Victor Eijkhout and Jacob Faibussowitsch and William~D. 8812 Gropp and V\'{a}clav Hapla and Tobin Isaac and Pierre Jolivet and Dmitry Karpeev 8813 and Dinesh Kaushik and Matthew~G. Knepley and Fande Kong and Scott Kruger and 8814 Dave~A. May and Lois Curfman McInnes and Richard Tran Mills and Lawrence Mitchell 8815 and Todd Munson and Jose~E. Roman and Karl Rupp and Patrick Sanan and Jason Sarich 8816 and Barry~F. Smith and Stefano Zampini and Hong Zhang and Hong Zhang and Junchao 8817 Zhang}, 8818 title = {{PETSc/TAO} Users Manual}, 8819 institution = {Argonne National Laboratory}, 8820 number = {ANL-21/39 - Revision 3.20}, 8821 doi = {10.2172/2205494}, 8822 year = {2023} 8823} 8824 8825% url = {https://petsc.org/release} 8826@TechReport{ petsc-developers, 8827 author = {Scott Kruger and Patrick Sanan and Barry~F. Smith}, 8828 title = {{PETS}c Developers Guide}, 8829 institution = {Argonne National Laboratory}, 8830 number = {ANL-18/18}, 8831 year = {2018}, 8832 url = {https://petsc.org/release/developers}, 8833 petsc_uses = {KSP} 8834} 8835 8836@Unpublished{ alice-memory-snooper, 8837 author = {Ibrahima Ba and Barry~F. Smith}, 8838 title = {The {ALICE} Memory Snooper}, 8839 year = {1999}, 8840 petsc_uses = {KSP} 8841} 8842 8843@TechReport{ petsc-user-ref-polish, 8844 author = {Marcin Bojko and Piotr Krzyzanowski}, 8845 title = {Rozwiazywanie ukladow rownan przy pomocy pakietu PETSc}, 8846 institution = {Instytut Matematyki, Stosowanej i Mechaniki, Uniwersytet Warszawski}, 8847 year = {1998}, 8848 note = {An introduction to PETSc in Polish}, 8849 petsc_uses = {KSP} 8850} 8851 8852@InProceedings{ abghmn00, 8853 title = {Integrating Automatic Differentiation with Object-Oriented Toolkits for 8854 High-Performance Scientific Computing}, 8855 author = {J. Abate and S. Benson and L. Grignon and P. Hovland and L. C. McInnes and B. 8856 Norris}, 8857 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P820.ps.Z}, 8858 booktitle = {Automatic Differentiation of Algorithms: From Simulation to Optimization}, 8859 editor = {George Corliss and Christ\`{e}le Faure and Andreas Griewank and Laurent 8860 Hasco\"{e}t and Uwe Naumann}, 8861 publisher = {Springer}, 8862 year = {2002}, 8863 petsc_uses = {KSP} 8864} 8865 8866@Unpublished{ petsc-mpi-paper, 8867 author = {Lois Curfman McInnes and Barry F. Smith}, 8868 title = {{PETS}c 2.0: A Case Study of Using {MPI} to Develop Numerical Software 8869 Libraries}, 8870 note = {Proceedings of the MPI Developers Conference, Notre Dame, IN}, 8871 month = jun, 8872 year = {1995}, 8873 petsc_uses = {KSP} 8874} 8875 8876@InProceedings{ miss-paper, 8877 author = {William D. Gropp and Barry F. Smith}, 8878 title = {Scalable, Extensible, and Portable Numerical Libraries}, 8879 publisher = {IEEE}, 8880 year = {1994}, 8881 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 8882 address = {Mississippi State University}, 8883 pages = {87--93}, 8884 keyword = {numerical libraries, scientific computing, parallel computing}, 8885 petsc_uses = {KSP} 8886} 8887 8888@InProceedings{ snes-paper, 8889 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8890 title = {Scalable Libraries for Solving Systems of Nonlinear Equations and Unconstrained 8891 Minimization Problems}, 8892 publisher = {IEEE}, 8893 year = {1995}, 8894 booktitle = {Proceedings of the Scalable Parallel Libraries Conference}, 8895 address = {Mississippi State University}, 8896 pages = {60-67}, 8897 keyword = {nonlinear equations, optimization, superconductivity, parallel computing}, 8898 petsc_uses = {KSP} 8899} 8900 8901@Article{ dsneutral, 8902 author = {Barry F. Smith and William D. Gropp}, 8903 title = {The Design of Data-structure-neutral Libraries for the Iterative Solution of 8904 Sparse Linear Systems}, 8905 journal = {Scientific Programming}, 8906 volume = {5}, 8907 pages = {329--336}, 8908 key = {GroppSmith96 ! KSP design}, 8909 year = {1996}, 8910 petsc_uses = {KSP} 8911} 8912 8913@InProceedings{ bgms98, 8914 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 8915 title = {A Microkernel Design for Component-based Parallel Numerical Software Systems}, 8916 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 8917 Scientific and Engineering Computing}, 8918 publisher = {SIAM}, 8919 pages = {58-67}, 8920 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P727.ps.Z}, 8921 year = {1998}, 8922 petsc_uses = {KSP} 8923} 8924 8925@Article{ hkm98, 8926 author = {M. E. Hayder and D. E. Keyes and P. Mehrotra}, 8927 title = {A Comparison of the {PETSc} Library and {HPF} Implementations of an Archetypal 8928 {PDE} Computation}, 8929 journal = {Advances in Engineering Software}, 8930 volume = {29}, 8931 pages = {415-424}, 8932 year = {1998}, 8933 petsc_uses = {KSP} 8934} 8935 8936@TechReport{ pdpta99, 8937 author = {L. A. Freitag and W. D. Gropp and P. D. Hovland and L. C. McInnes and B. F. 8938 Smith}, 8939 title = {Infrastructure and Interfaces for Large-Scale Numerical Software}, 8940 note = {to appear in the Proceedings of the 1999 International Conference on Parallel and 8941 Distributed Processing Techniques and Applications, June 28 - July 1, 1999, Las 8942 Vegas, Nevada}, 8943 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8944 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P751.ps.Z}, 8945 number = {ANL/MCS-P751-0599}, 8946 year = {1999}, 8947 petsc_uses = {KSP} 8948} 8949 8950@InProceedings{ bbh:com, 8951 author = {C. H. Bischof and H. M. B{\"u}cker and P. D. Hovland}, 8952 title = {{On Combining Computational Differentiation and Toolkits for Parallel Scientific 8953 Computing}}, 8954 booktitle = {Euro-Par 2000 -- Parallel Processing, Proceedings of the 6th International 8955 Euro-Par Conference, Munich, Germany, August/September 2000}, 8956 year = {2000}, 8957 editor = {A. Bode and T. Ludwig and W. Karl and R. Wism{\"u}ller}, 8958 volume = {1900}, 8959 series = {Lecture Notes in Computer Science}, 8960 pages = {86--94}, 8961 address = {Berlin}, 8962 publisher = {Springer}, 8963 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P797.ps.Z}, 8964 petsc_uses = {KSP} 8965} 8966 8967@InProceedings{ overture00, 8968 author = {K. R. Buschelman and W. D. Gropp and L. C. McInnes and B. F. Smith}, 8969 title = { {PETSc and Overture}: Lessons Learned Developing an Interface between 8970 Components}, 8971 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P858.ps.Z}, 8972 booktitle = {Proceedings of the International Federation for Information Processing Working 8973 Conference on Software Architectures for Scientific Computing, Kluwer}, 8974 year = {2000}, 8975 pages = {57--68}, 8976 petsc_uses = {KSP} 8977} 8978 8979@TechReport{ smith97, 8980 title = {An Interface for Efficient Vector Scatters and Gathers on Parallel Machines}, 8981 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P701.ps.Z}, 8982 number = {ANL/MCS-P701}, 8983 author = {Barry F. Smith}, 8984 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 8985 petsc_uses = {KSP} 8986} 8987 8988@Article{ smith98, 8989 author = {Barry Smith}, 8990 title = {The Transition of Numerical Software: From Nuts-and-Bolts to Abstraction}, 8991 journal = {SIGNUM Newsletter}, 8992 year = {1998}, 8993 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P712.ps.Z}, 8994 petsc_uses = {KSP} 8995} 8996 8997@TechReport{ ad-petsc-tm, 8998 title = {Using {ADIFOR} and {ADIC} to Provide a {J}acobian for the {SNES} Component of 8999 {PETSc}}, 9000 author = {Christian Bischof and Paul Hovland and Po-Ting Wu}, 9001 year = {1997}, 9002 type = {Technical Memorandum}, 9003 institution = {ANL}, 9004 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/TM233.ps.Z}, 9005 number = {ANL/MCS-TM-233}, 9006 petsc_uses = {KSP} 9007} 9008 9009% LiteralHTML: 9010% LiteralHTML: <a name="algorithm"><H3><center>Algorithm design and analysis</center></H3> 9011% LiteralHTML: 9012@PhDThesis{ klotzthesis2019, 9013 author = {Thomas S. Klotz}, 9014 title = {Numerical Analysis of Nonlinear Boundary Integral Equations Arising in Molecular 9015 Biology}, 9016 school = {Rice University}, 9017 year = {2019}, 9018 petsc_uses = {KSP} 9019} 9020 9021@Article{ klotzbardhanknepley2018, 9022 title = {Efficient Evaluation of Ellipsoidal Harmonics for Potential Modeling}, 9023 author = {Thomas S. Klotz and Jaydeep Bardhan and Matthew G. Knepley}, 9024 journal = {arXiv e-prints}, 9025 eprint = {1708.06028}, 9026 archiveprefix = {arXiv}, 9027 primaryclass = {math.na}, 9028 year = {2018}, 9029 note = {\url{http://arxiv.org/abs/1708.06028}}, 9030 petsc_uses = {KSP} 9031} 9032 9033@Misc{ brown2016, 9034 title = {Threading Tradeoffs in Domain Decomposition}, 9035 author = {Jed Brown}, 9036 note = {SIAM Parallel Processing Conference, To Thread or Not To Thread Minisymposium, 9037 \url{https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}}, 9038 url = {https://www.cse.buffalo.edu/~knepley/presentations/SIAMPP2016_1.pdf}, 9039 year = {2016}, 9040 petsc_uses = {KSP} 9041} 9042 9043@Article{ changnakshatralaknepleyjohnsson2017, 9044 title = {A performance spectrum for parallel computational frameworks that solve {PDEs}}, 9045 author = {Justin Chang and Kalyana B. Nakshatrala and Matthew G. Knepley and Lennart 9046 Johnsson}, 9047 journal = {Concurency: Practice and Experience}, 9048 volume = {30}, 9049 number = {11}, 9050 eprint = {1705.03625}, 9051 doi = {10.1002/cpe.4401}, 9052 year = {2017}, 9053 petsc_uses = {KSP} 9054} 9055 9056@Article{ changfabienknepleymills2018, 9057 title = {Comparative study of finite element methods using the Time-Accuracy-Size {(TAS)} 9058 spectrum analysis}, 9059 author = {Justin Chang and Maurice S. Fabien and Matthew G. Knepley and Richard T. Mills}, 9060 journal = {SIAM Journal on Scientific Computing}, 9061 volume = {40}, 9062 number = {6}, 9063 pages = {C779--C802}, 9064 eprint = {1802.07832}, 9065 doi = {10.1137/18M1172260}, 9066 year = {2018}, 9067 petsc_uses = {KSP} 9068} 9069 9070@Article{ joshaghanichangnakshatralaknepley2019, 9071 title = {Composable solvers for the four-field double porosity/permeability model}, 9072 author = {M. S. Joshaghani and Justin Chang and Kalyana B. Nakshatrala and Matthew G. 9073 Knepley}, 9074 journal = {Journal of Computational Physics}, 9075 volume = {386}, 9076 pages = {428--466}, 9077 doi = {10.1016/j.jcp.2019.02.020}, 9078 year = {2019}, 9079 petsc_uses = {KSP} 9080} 9081 9082@InProceedings{ barralknepleylangepiggottgorman2016, 9083 title = {Anisotropic mesh adaptation in {Firedrake} with {PETSc} {DMPlex}}, 9084 author = {Nicolas Barral and Matthew G. Knepley and Michael Lange and Matthew D. Piggott 9085 and Gerard J. Gorman}, 9086 booktitle = {25th International Meshing Roundtable}, 9087 editor = {Steve Owen and Hang Si}, 9088 month = sep, 9089 address = {Washington, DC}, 9090 pages = {1--5}, 9091 url = {http://imr.sandia.gov/papers/imr25/2026_imr25RN_Barral.pdf}, 9092 year = {2016}, 9093 petsc_uses = {KSP} 9094} 9095 9096@Article{ adamsbrownknepleysamtaney2016, 9097 title = {Segmental Refinement: A Multigrid Technique for Data Locality}, 9098 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley and Ravi Samtaney}, 9099 journal = {SIAM Journal on Scientific Computing}, 9100 url = {http://epubs.siam.org/toc/sjoce3/38/4 }, 9101 epub = {http://arxiv.org/abs/1406.7808}, 9102 volume = {8}, 9103 number = {4}, 9104 pages = {C426--C440}, 9105 doi = {10.1137/140975127}, 9106 year = {2016}, 9107 petsc_uses = {KSP} 9108} 9109 9110@InProceedings{ maysananruppknepleysmith2016, 9111 title = {Extreme-Scale Multigrid Components within {PETSc}}, 9112 author = {Dave A. May and Patrick Sanan and Karl Rupp and Matthew G. Knepley and Barry F. 9113 Smith}, 9114 booktitle = {Proceedings of the {Platform for Advanced Scientific Computing Conference}}, 9115 series = {PASC '16}, 9116 isbn = {978-1-4503-4126-4}, 9117 location = {Lausanne, Switzerland}, 9118 pages = {5:1--5:12}, 9119 articleno = {5}, 9120 numpages = {12}, 9121 doi = {10.1145/2929908.2929913}, 9122 acmid = {2929913}, 9123 publisher = {ACM}, 9124 address = {New York, NY, USA}, 9125 keywords = {GPU, HPC, agglomeration, coarse-level solver, multigrid, parallel computing, 9126 preconditioning}, 9127 year = {2016}, 9128 petsc_uses = {KSP} 9129} 9130 9131@Article{ liu2015field, 9132 title = {Field-Split Preconditioned Inexact Newton Algorithms}, 9133 author = {Lulu Liu and David E Keyes}, 9134 journal = {SIAM Journal on Scientific Computing}, 9135 volume = {37}, 9136 number = {3}, 9137 pages = {A1388--A1409}, 9138 year = {2015}, 9139 publisher = {SIAM}, 9140 petsc_uses = {KSP} 9141} 9142 9143@Article{ lujiaomissirlis2014, 9144 title = {A hybrid geometric+ algebraic multigrid method with semi-iterative smoothers}, 9145 author = {Cao Lu and Xiangmin Jiao and Nikolaos Missirlis}, 9146 journal = {Numerical Linear Algebra with Applications}, 9147 volume = {21}, 9148 number = {2}, 9149 pages = {221--238}, 9150 year = {2014}, 9151 publisher = {Wiley Online Library}, 9152 petsc_uses = {KSP} 9153} 9154 9155@Article{ badiamartinprincipe2013, 9156 title = {Enhanced balancing Neumann-Neumann preconditioning in computational fluid and 9157 solid mechanics}, 9158 author = {Santiago Badia and Alberto F. Mart\'in and Javier Principe}, 9159 journal = {International Journal for Numerical Methods in Engineering}, 9160 volume = {96}, 9161 number = {4}, 9162 pages = {203--230}, 9163 year = {2013}, 9164 petsc_uses = {KSP} 9165} 9166 9167@Article{ morganknepleysananscott2016, 9168 title = {A Stochastic Performance Model for Pipelined {Krylov} Methods}, 9169 author = {Hannah Morgan and Matthew G. Knepley and Patrick Sanan and L. Ridgway Scott}, 9170 journal = {Concurrency and Computation: Practice and Experience}, 9171 volume = {28}, 9172 pages = {4532--4542}, 9173 year = {2016}, 9174 url = {http://arxiv.org/abs/1602.04873}, 9175 doi = {10.1002/cpe.3820}, 9176 petsc_uses = {KSP} 9177} 9178 9179@Article{ morgansananknepleymills2020, 9180 title = {Understanding performance variability in standard and pipelined parallel {Krylov} 9181 solvers}, 9182 author = {Hannah Morgan and Patrick Sanan and Matthew G. Knepley and Richard Tran Mills}, 9183 journal = {The International Journal of High Performance Computing Applications}, 9184 volume = {35}, 9185 issue = {1}, 9186 doi = {10.1177/1094342020966835}, 9187 url = {https://doi.org/10.1177/1094342020966835}, 9188 eprint = {https://doi.org/10.1177/1094342020966835}, 9189 year = {2020}, 9190 petsc_uses = {KSP} 9191} 9192 9193@Article{ msz2013, 9194 title = {Efficient Sparse Matrix-Matrix Products Using Colorings}, 9195 author = {M. McCourt and B. F. Smith and H. Zhang}, 9196 journal = {SIAM Journal on Matrix Analysis and Applications}, 9197 year = {2015}, 9198 note = {To appear}, 9199 petsc_uses = {KSP} 9200} 9201 9202@Article{ bassi2014agglomeration, 9203 title = {Agglomeration-based physical frame d{G} discretizations: {A}n attempt to be mesh 9204 free}, 9205 author = {Bassi, Francesco and Botti, Lorenzo and Colombo, Alessandro}, 9206 journal = {Mathematical Models and Methods in Applied Sciences}, 9207 volume = {24}, 9208 number = {08}, 9209 pages = {1495--1539}, 9210 year = {2014}, 9211 publisher = {World Scientific}, 9212 petsc_uses = {KSP} 9213} 9214 9215@Article{ jhuranidemkowicz12, 9216 author = {{Jhurani}, C. and {Demkowicz}, L.}, 9217 title = {{Multiscale modeling using goal-oriented adaptivity and numerical homogenization. 9218 Part II: Algorithms for the Moore-Penrose pseudoinverse}}, 9219 journal = {Computer Methods in Applied Mechanics and Engineering}, 9220 volume = {213}, 9221 pages = {418-426}, 9222 year = {2012}, 9223 month = mar, 9224 doi = {10.1016/j.cma.2011.06.003}, 9225 adsurl = {http://adsabs.harvard.edu/abs/2012CMAME.213..418J}, 9226 petsc_uses = {KSP} 9227} 9228 9229@Article{ yangcai11, 9230 author = {Yang, Haijian and Cai, Xiao-Chuan}, 9231 title = {Parallel Two-Grid Semismooth {N}ewton--{K}rylov--{S}chwarz Method for Nonlinear 9232 Complementarity Problems}, 9233 journal = {J. Sci. Comput.}, 9234 issue_date = {May 2011}, 9235 volume = {47}, 9236 number = {2}, 9237 month = may, 9238 pages = {258--280}, 9239 year = {2011}, 9240 issn = {0885-7474}, 9241 numpages = {23}, 9242 doi = {10.1007/s10915-010-9436-4}, 9243 acmid = {1971246}, 9244 publisher = {Plenum Press}, 9245 address = {New York, NY, USA}, 9246 keywords = {Complementarity problem, Grid sequencing, Parallel computing, Schwarz 9247 preconditioners, Semismooth Newton, Two-level methods}, 9248 petsc_uses = {KSP} 9249} 9250 9251@Article{ rheinbach09, 9252 author = {Rheinbach, Oliver}, 9253 title = {Parallel Iterative Substructuring in Structural Mechanics}, 9254 journal = {Archives of Computational Methods in Engineering}, 9255 volume = {16}, 9256 number = {4}, 9257 pages = {425-463}, 9258 year = {2009}, 9259 issn = {1134-3060}, 9260 doi = {10.1007/s11831-009-9035-4}, 9261 publisher = {Springer Netherlands}, 9262 language = {English}, 9263 petsc_uses = {KSP} 9264} 9265 9266@Article{ knepleyterrel2013, 9267 author = {Matthew G. Knepley and Andy R. Terrel}, 9268 title = {Finite Element Integration on {GPUs}}, 9269 journal = {{ACM} Transactions on Mathematical Software}, 9270 volume = {39}, 9271 number = {2}, 9272 accepted = {17 April 2012}, 9273 year = {2013}, 9274 abstract = {We present a novel finite element integration method for low order elements on 9275 GPUs. We achieve more than 100GF for element integration on first order 9276 discretizations of both the Laplacian and Elasticity operators on an NVIDIA 9277 GTX285, which has a nominal single precision peak flop rate of 1 TF/s and 9278 bandwidth of 159 GB/s, corresponding to a bandwidth limited peak of 40 GF/s.}, 9279 url = {http://arxiv.org/abs/1103.0066}, 9280 note = {no. 10, \url{http://arxiv.org/abs/1103.0066}}, 9281 petsc_uses = {KSP} 9282} 9283 9284@Article{ knepleyruppterrel2016, 9285 title = {Finite Element Integration with Quadrature on the GPU}, 9286 journal = {ArXiv e-prints}, 9287 author = {Matthew G. Knepley and Karl Rupp and Andy R. Terrel}, 9288 version = {1}, 9289 date = {2016-07-14}, 9290 eprinttype = {arxiv}, 9291 eprintclass = {cs.MS}, 9292 eprint = {1607.04245v1}, 9293 petsc_uses = {KSP} 9294} 9295 9296@Article{ klawonnlanserrheinbach2014, 9297 title = {Nonlinear {FETI-DP} and {BDDC} Methods}, 9298 author = {Axel Klawonn and Martin Lanser and Oliver Rheinbach}, 9299 journal = {SIAM Journal on Scientific Computing}, 9300 volume = {36}, 9301 number = {2}, 9302 pages = {A737--A765}, 9303 year = {2014}, 9304 petsc_uses = {KSP} 9305} 9306 9307@Article{ bruneknepleysmithtu15, 9308 title = {Composing Scalable Nonlinear Algebraic Solvers}, 9309 author = {Peter R. Brune and Matthew G. Knepley and Barry F. Smith and Xuemin Tu}, 9310 journal = {SIAM Review}, 9311 volume = {57}, 9312 number = {4}, 9313 pages = {535--565}, 9314 note = {\url{http://www.mcs.anl.gov/papers/P2010-0112.pdf}}, 9315 url = {http://www.mcs.anl.gov/papers/P2010-0112.pdf}, 9316 doi = {10.1137/130936725}, 9317 year = {2015}, 9318 petsc_uses = {KSP} 9319} 9320 9321@Article{ mszm2014, 9322 title = {Hierarchical {Krylov} and nested {Krylov} methods for extreme-scale computing}, 9323 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9324 volume = {40}, 9325 pages = {17--31}, 9326 year = {2014}, 9327 journal = {Parallel Computing}, 9328 doi = {10.1016/j.parco.2013.10.001}, 9329 petsc_uses = {KSP} 9330} 9331 9332@TechReport{ mszm2012, 9333 title = {Hierarchical {Krylov} and Nested {Krylov} Methods for Extreme-Scale Computing}, 9334 author = {Lois Curfman McInnes and Barry Smith and Hong Zhang and Richard Tran Mills}, 9335 year = {2012}, 9336 number = {ANL/MCS-P2097-0512}, 9337 institution = {Argonne National Laboratory}, 9338 petsc_uses = {KSP} 9339} 9340 9341@InProceedings{ bkmms2012, 9342 author = {Jed Brown and Matthew G. Knepley and David A. May and Lois C. McInnes and Barry 9343 F. Smith}, 9344 title = {Composable linear solvers for multiphysics}, 9345 booktitle = {Proceeedings of the 11th {International Symposium on Parallel and Distributed 9346 Computing} ({ISPDC} 2012)}, 9347 year = {2012}, 9348 doi = {10.1109/ISPDC.2012.16}, 9349 publisher = {IEEE Computer Society}, 9350 pages = {55--62}, 9351 petsc_uses = {KSP} 9352} 9353 9354@Article{ bourdinbucuroudet2009, 9355 author = {Blaise Bourdin and D. Bucur and E. Oudet}, 9356 title = {Optimal Partitions for Eigenvalues}, 9357 journal = {SIAM J. Sci. Comput.}, 9358 volume = {31}, 9359 number = {6}, 9360 pages = {4100--4114}, 9361 year = {2009}, 9362 petsc_uses = {KSP} 9363} 9364 9365@InBook{ kimnbourdin2007, 9366 author = {J.-H. Kimn and Blaise Bourdin}, 9367 title = {Numerical implementation of overlapping balancing domain decomposition methods on 9368 unstructured meshes}, 9369 editor = {O. B. Widlund and D. E. Keyes}, 9370 booktitle = {Domain Decomposition Methods in Science and Engineering XVI}, 9371 series = {Lecture Notes in Computational Science and Engineering}, 9372 number = {55}, 9373 publisher = {Springer-Verlag}, 9374 pages = {309--315}, 9375 url = {http://www.cims.nyu.edu/dd16/proceedings/kimn_bourdin_mini_6.pdf}, 9376 year = {2007}, 9377 petsc_uses = {KSP} 9378} 9379 9380@Article{ bjm2005, 9381 author = {AH Baker and ER Jessup and T Manteuffel}, 9382 title = {A Technique for Accelerating the Convergence of Restarted GMRES}, 9383 journal = {SIAM JOURNAL ON MATRIX ANALYSIS AND APPLICATIONS}, 9384 year = {2005}, 9385 petsc_uses = {KSP} 9386} 9387 9388@Unpublished{ sundar-2008a, 9389 author = {R.S. Sampath and G. Biros}, 9390 title = {A parallel geometric multigrid method for finite elements on octree meshes}, 9391 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9392 petsc_uses = {KSP} 9393} 9394 9395@Article{ sundar-2008, 9396 author = {H. Sundar and R.S. Sampath and G. Biros}, 9397 title = {Bottom-up construction and 2:1 balance refinement of linear octrees in parallel}, 9398 journal = {SIAM Journal on Scientific Computing}, 9399 year = {2008}, 9400 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9401 petsc_uses = {KSP} 9402} 9403 9404@InProceedings{ sundar-2007, 9405 author = {H. Sundar and R.S. Sampath and S.S. Adavani and C. Davatzikos and G. Biros}, 9406 title = {Low-constant parallel algorithms for finite element simulations using linear 9407 octrees}, 9408 booktitle = {SC'07: ACM/IEEE Conference on Supercomputing}, 9409 year = {2007}, 9410 url = {http://www.seas.upenn.edu/\~{ }rahulss}, 9411 petsc_uses = {KSP} 9412} 9413 9414@InProceedings{ adams-98a, 9415 author = {Adams, Mark ~F.}, 9416 title = {A Parallel Maximal Independent Set Algorithm}, 9417 booktitle = {Proceedings 5th copper mountain conference on iterative methods}, 9418 year = {1998}, 9419 petsc_uses = {KSP} 9420} 9421 9422@Article{ akcelik2005ddd, 9423 title = {{Dynamic data-driven inversion for terascale simulations: real-time 9424 identification of airborne contaminants}}, 9425 author = {Ak\c{c}elik, V. and Biros, G. and Draganescu, A. and Hill, J. and Ghattas, O. and 9426 van Bloemen Waanders, B.}, 9427 journal = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 9428 year = {2005}, 9429 publisher = {IEEE Computer Society Washington, DC, USA}, 9430 petsc_uses = {KSP} 9431} 9432 9433@InBook{ akcelik-2006, 9434 author = {V. Akcelik and G. Biros and Omar Ghattas and J. Hill and David Keyes and B. van 9435 Bloemen Waanders}, 9436 bookeditor = {M. Heroux and P. Raghaven and H. Simon}, 9437 title = {Frontiers of Parallel Computing}, 9438 chapter = {Parallel algorithms for {PDE}-constrained optimization}, 9439 publisher = {SIAM}, 9440 year = {2006}, 9441 petsc_uses = {KSP} 9442} 9443 9444@Article{ dt, 9445 author = {Matthew F. Dixon and C. J. Kenneth Tan}, 9446 title = {Using Distributed Computers to Deterministically Approximate Higher Dimensional 9447 Convection Diffusion Equations}, 9448 journal = {The Journal of Supercomputing}, 9449 year = {2004}, 9450 pages = {235--253}, 9451 volume = {28}, 9452 url = {http://www.springerlink.com/(nekina45nmdgrib5izizn3ip)/app/home/contribution.asp?referrer=parent&backto=issue,8,8;journal,20,73;linkingpublicationresults,1:100302,1}, 9453 petsc_uses = {KSP} 9454} 9455 9456@PhDThesis{ hwang2004, 9457 author = {Feng-Nan Hwang}, 9458 title = {Some Parallel Linear and Nonlinear {Schwarz} Methods with Applications in 9459 Computational Fluid Dynamics}, 9460 school = {University of Colorado at Boulder}, 9461 year = {2004}, 9462 petsc_uses = {KSP} 9463} 9464 9465@PhDThesis{ baker, 9466 author = {{A. H.} Baker}, 9467 title = {On improving the performance of the linear solver restarted {GMRES}}, 9468 school = {University of Colorado at Boulder}, 9469 year = {2003}, 9470 petsc_uses = {KSP} 9471} 9472 9473@TechReport{ klawonnrheinbach601, 9474 author = {Axel Klawonn and Oliver Rheinbach}, 9475 title = {A Parallel Implementation of Dual-Primal {FETI-DP} Methods for Three Dimensional 9476 Linear Elasticity Using a Transformation of Basis}, 9477 institution = {Universit\"at Duisburg-Essen}, 9478 year = {2005}, 9479 type = {Technical Report}, 9480 number = {SM-E-601}, 9481 petsc_uses = {KSP} 9482} 9483 9484@TechReport{ klawonnrheinbach609, 9485 author = {Axel Klawonn and Oliver Rheinbach}, 9486 title = {Inexact FETI-DP Methods}, 9487 institution = {Universit\"at Duisburg-Essen}, 9488 year = {2005}, 9489 type = {Technical Report}, 9490 number = {SM-E-609}, 9491 petsc_uses = {KSP} 9492} 9493 9494@TechReport{ klawonnrheinbach607, 9495 author = {Axel Klawonn and Oliver Rheinbach}, 9496 title = {Robust FETI-DP Methods for Heterogeneous Three Dimensional Elasticity Problems}, 9497 institution = {Universit\"at Duisburg-Essen}, 9498 year = {2005}, 9499 type = {Technical Report}, 9500 number = {SM-E-607}, 9501 petsc_uses = {KSP} 9502} 9503 9504@Article{ kul-natraj-pbp, 9505 author = {Kshitij Kulshreshtha and Neela Nataraj and Michael Jung}, 9506 title = {Performance of a parallel mixed finite element implementation for fourth order 9507 clamped anisotropic plate bending problems in distributed memory environments}, 9508 journal = {Applied Mathematics and Computation}, 9509 volume = {155}, 9510 year = {2004}, 9511 number = {3}, 9512 pages = {753--777}, 9513 petsc_uses = {KSP} 9514} 9515 9516@Article{ bramkamp2006uej, 9517 author = {F. D. Bramkamp and H. M. B{\"u}cker and A. Rasch}, 9518 title = {Using Exact {J}acobians in an Implicit {N}ewton-{K}rylov Method}, 9519 journal = {Computers \& Fluids}, 9520 volume = {35}, 9521 number = {10}, 9522 pages = {1063--1073}, 9523 doi = {10.1016/j.compfluid.2005.10.003}, 9524 abstract = {In an implicit Newton-Krylov method for inviscid, compressible fluid flow, the 9525 derivation of the analytic flux Jacobian can become quite complicated depending on 9526 the complexity of the numerical flux calculation. Practically, the derivation of 9527 the exact Jacobian by hand is an unrealistic option because of the enormous 9528 man-hour investment needed. In this work, automatic differentiation is used to 9529 evaluate the exact Jacobian of upwind schemes implemented in the flow solver 9530 QUADFLOW. We compare the use of exact Jacobians and Jacobians numerically 9531 approximated by first-order forward differences. For a two-dimensional airfoil 9532 under three different flight conditions (quasi-incompressible flow, compressible 9533 subsonic flow, and transonic flow), we show that the robustness and performance of 9534 the present finite volume scheme is significantly improved by using exact 9535 Jacobians.}, 9536 year = {2006}, 9537 petsc_uses = {KSP} 9538} 9539 9540@Article{ shahbazi1, 9541 author = {Khosro Shahbazi}, 9542 title = {An explicit expression for the penalty parameter of the interior penalty method}, 9543 journal = {Journal of Computational Physics}, 9544 volume = {205}, 9545 year = {2005}, 9546 pages = {401--407}, 9547 petsc_uses = {KSP} 9548} 9549 9550@TechReport{ kk, 9551 title = {A Parallel Lanczos Algorithm for Eigensystem Calculation}, 9552 author = {Hans-Peter Kersken and Uwe Kuster}, 9553 year = {1999}, 9554 institution = {University of Stuttgart}, 9555 url = {http://elib.uni-stuttgart.de/opus/volltexte/1999/310/pdf/310.pdf}, 9556 number = {310}, 9557 petsc_uses = {KSP} 9558} 9559 9560@Article{ miha-mija, 9561 author = {M. D. Mihajlovi and S. Mijalkovi}, 9562 title = {A component decomposition preconditioning for 3D stress analysis problems}, 9563 journal = {Numerical Linear Algebra with Applications}, 9564 volume = {9}, 9565 year = {2002}, 9566 pages = {567--583}, 9567 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/98516459/ABSTRACT}, 9568 petsc_uses = {KSP} 9569} 9570 9571@Article{ bjm, 9572 author = {M Benzi and W Joubert and G Mateescu}, 9573 journal = {Electronic Transactions on Numerical Analysis}, 9574 year = {1999}, 9575 volume = {8}, 9576 pages = {88--114}, 9577 title = {Numerical experiments with parallel orderings for {ILU} preconditioners}, 9578 url = {http://scholar.google.com/url?sa=U&q=http://emis.bibl.cwi.nl/journals/ETNA/vol.8.1999/pp88-114.dir/pp88-114.ps}, 9579 petsc_uses = {KSP} 9580} 9581 9582@PhDThesis{ hyde, 9583 author = {EMK Hyde}, 9584 title = {Fast, High-Order Methods for Scattering by Inhomogeneous Media}, 9585 school = {Caltech}, 9586 year = {2003}, 9587 url = {http://www.acm.caltech.edu/\~{ }bruno/02hyde_thesis_print.pdf}, 9588 petsc_uses = {KSP} 9589} 9590 9591@Article{ km2003, 9592 author = {A. Keese and H. G. Matthies}, 9593 journal = {Proceedings in Applied Mathematics and Mechanics}, 9594 year = {2003}, 9595 volume = {2}, 9596 pages = {485--486}, 9597 title = {Parallel Solution of Stochastic PDEs}, 9598 url = {http://www3.interscience.wiley.com/cgi-bin/abstract/104087421/ABSTRACT}, 9599 petsc_uses = {KSP} 9600} 9601 9602@Article{ whszss, 9603 author = {Joachim Weickert and Josef Heers and Christoph Schnorr and Karel J. Zuiderveld 9604 and Otmar Scherzer and H. Siegfried Stiehl}, 9605 journal = {Real Time Imaging}, 9606 year = {2001}, 9607 volume = {7}, 9608 pages = {31--45}, 9609 title = {Fast parallel algorithms for a broad class of nonlinear variational diffusion 9610 approaches}, 9611 url = {http://www.mia.uni-saarland.de/weickert/Papers/TR_5_99.ps.gz}, 9612 petsc_uses = {KSP} 9613} 9614 9615@TechReport{ baker1, 9616 title = {An Efficient Block Variant of GMRES}, 9617 author = {A. H. Baker and J. M. Dennis and E. R. Jessup}, 9618 year = {2003}, 9619 type = {Technical Report}, 9620 institution = {University of Colorado, Boulder}, 9621 url = {http://www.scd.ucar.edu/css/staff/dennis/papers/block.pdf}, 9622 number = {CU-CS-957-03}, 9623 petsc_uses = {KSP} 9624} 9625 9626@InProceedings{ mc2003, 9627 author = {Leszek Marcinkowski and Xiao-Chuan Cai}, 9628 title = {Parallel Performance of Some Two-Level {ASPIN} Algorithms}, 9629 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9630 Methods}, 9631 pages = {639--646}, 9632 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9633 note = {}, 9634 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9635 year = {2003}, 9636 petsc_uses = {KSP} 9637} 9638 9639@InProceedings{ kt2003, 9640 author = {Deepak V. Kulkarni and Daniel A. Tortorelli}, 9641 title = {A Domain Decomposition Based Two-Level Newton Scheme for Nonlinear Problems}, 9642 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9643 Methods}, 9644 pages = {615--622}, 9645 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9646 note = {}, 9647 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9648 year = {2003}, 9649 petsc_uses = {KSP} 9650} 9651 9652@InProceedings{ krw2003, 9653 author = {Axel Klawonn and Oliver Rheinbach and Olof B. Widlund}, 9654 title = {Some Computational Results for Dual-Primal FETI Methods for Elliptic Problems in 9655 3D}, 9656 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9657 Methods}, 9658 pages = {361--368}, 9659 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9660 note = {}, 9661 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9662 year = {2003}, 9663 petsc_uses = {KSP} 9664} 9665 9666@InProceedings{ hc2003, 9667 author = {Feng-Nan Hwang and Xiao-Chuan Cai}, 9668 title = {Improving Robustness and Parallel Scalability of {Newton's} Method Through 9669 Nonlinear Preconditioning}, 9670 booktitle = {Proceedings of the 15th International Conference on Domain Decomposition 9671 Methods}, 9672 pages = {201--208}, 9673 publisher = {Springer, Lecture Notes in Computational Science and Engineering (LNCSE).}, 9674 note = {}, 9675 url = {http://www.ddm.org/DD15/proceedings-dd15.html}, 9676 year = {2003}, 9677 petsc_uses = {KSP} 9678} 9679 9680@InProceedings{ g2003, 9681 author = {P. Goldfeld}, 9682 title = {Balancing {Neumann-Neumann} for (In)Compressible Linear Elasticity and 9683 (Generalized) {Stokes} and Parallel Implementation}, 9684 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9685 Methods}, 9686 pages = {209--216}, 9687 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9688 publisher = {National Autonomous University of Mexico (UNAM)}, 9689 note = {}, 9690 url = {http://www.ddm.org/DD14}, 9691 year = {2003}, 9692 petsc_uses = {KSP} 9693} 9694 9695@InProceedings{ dhv2003, 9696 author = {Zdenek Dostal and David Horak and Oldrich Vlach}, 9697 title = {Toward scalable {FETI} algorithm for variational inequalities with applications to 9698 composites}, 9699 booktitle = {Proceedings of the 14th International Conference on Domain Decomposition 9700 Methods}, 9701 pages = {395--401}, 9702 editor = {I. Herrera and D. Keyes and O. Widlund and R. Yates}, 9703 publisher = {National Autonomous University of Mexico (UNAM)}, 9704 note = {}, 9705 url = {http://www.ddm.org/DD14}, 9706 year = {2003}, 9707 petsc_uses = {KSP} 9708} 9709 9710@InProceedings{ dhsv2002, 9711 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9712 title = {Scalabilities of {FETI} for variational inequalities and contact shape 9713 optimization}, 9714 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9715 Methods}, 9716 pages = {359--367}, 9717 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9718 publisher = {CIMNE, Barcelona, Spain}, 9719 note = {}, 9720 url = {http://www.ddm.org/DD13}, 9721 year = {2002}, 9722 petsc_uses = {KSP} 9723} 9724 9725@InProceedings{ cky2002, 9726 author = {Xiao-Chuan Cai and David E. Keyes and David P. Young}, 9727 title = {A Nonlinear Additive {S}chwarz Preconditioned Inexact {N}ewton Method for Shocked 9728 Duct Flows}, 9729 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9730 Methods}, 9731 pages = {343--350}, 9732 editor = {N. Debit and M.Garbey and R. Hoppe and J. Periaux and D. Keyes and Y. Kuznetsov}, 9733 publisher = {CIMNE, Barcelona, Spain}, 9734 note = {}, 9735 url = {http://www.ddm.org/DD13}, 9736 year = {2002}, 9737 petsc_uses = {KSP} 9738} 9739 9740@Conference{ li-etal:03, 9741 author = {Li, Z. and Lanteri S. and Saad, Y.}, 9742 title = {Multiplicative-additive preconditioning combination for general sparse linear 9743 systems}, 9744 booktitle = {2003 International Conference on Preconditioning Techniques for Large Sparse 9745 Matrix Problems in Scientific and Industrial Applications}, 9746 address = {Napa, California, USA}, 9747 date = {october 27-29}, 9748 year = {2003}, 9749 petsc_uses = {KSP} 9750} 9751 9752@Article{ bashir2008hessian, 9753 title = {Hessian-based model reduction for large-scale systems with initial-condition 9754 inputs}, 9755 author = {Bashir, O. and Willcox, K. and Ghattas, O. and van Bloemen Waanders, B. and Hill, 9756 J.}, 9757 journal = {International journal for numerical methods in engineering}, 9758 volume = {73}, 9759 number = {6}, 9760 pages = {844--868}, 9761 year = {2008}, 9762 publisher = {Wiley Online Library}, 9763 petsc_uses = {KSP} 9764} 9765 9766@Article{ bashir2007hessian, 9767 title = {Hessian-Based Model Reduction for Large-Scale Data Assimilation Problems}, 9768 author = {Bashir, O. and Ghattas, O. and Hill, J. and van Bloemen Waanders, B. and Willcox, 9769 K.}, 9770 journal = {Computational Science--ICCS 2007}, 9771 pages = {1010--1017}, 9772 year = {2007}, 9773 publisher = {Springer}, 9774 petsc_uses = {KSP} 9775} 9776 9777@Article{ akcelik2011fast, 9778 title = {Fast algorithms for {B}ayesian uncertainty quantification in large-scale linear 9779 inverse problems based on low-rank partial {H}essian approximations}, 9780 author = {Ak\c{c}elik, V. and Flath, H.P. and Ghattas, O. and Hill, J. and van Bloemen 9781 Waanders, B. and Wilcox, L.}, 9782 journal = {SIAM Journal on Scientific Computing}, 9783 volume = {33}, 9784 number = {1}, 9785 year = {2011}, 9786 petsc_uses = {KSP} 9787} 9788 9789@InProceedings{ ff2003, 9790 author = {Abul K. M. Fahimuddin and Heike Fassbender}, 9791 title = {Model Reduction for Large Scale Applications in Microsystem Technology}, 9792 booktitle = {Proceedings of the 2004 SIAM Parallel Processing Conference}, 9793 year = {2003}, 9794 petsc_uses = {KSP} 9795} 9796 9797@InProceedings{ d2b2004, 9798 author = {Masoud Darbandi and Gerry E. Schneider and Seyed Mehi Bostandoost}, 9799 title = {Parallel Computation of a Fully Implicit Finite Volume Method Using Different 9800 Ordering Strategies}, 9801 booktitle = {Proceedings of AIAA Conference, Reno, Nevada}, 9802 year = {2004}, 9803 petsc_uses = {KSP} 9804} 9805 9806@InProceedings{ d2v2005, 9807 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 9808 title = {A Comparative Study of Preconditioned Methods for Solving Fully Coupled Fluid 9809 Flow Equations}, 9810 booktitle = {The 13th Annual Conference on Computational Fluid Dynamics}, 9811 year = {2005}, 9812 petsc_uses = {KSP} 9813} 9814 9815@InProceedings{ dvs2006, 9816 author = {Masoud Darbandi and Soheyl Vakili and Gerry E. Schneider}, 9817 title = {The Employment of Algebraic Multigrid as a Preconditioner to Solve Fully Implicit 9818 Mixed Convection Equations}, 9819 booktitle = { The 44th AIAA Aerospace Sciences Meeting and Exhibit}, 9820 year = {2006}, 9821 petsc_uses = {KSP} 9822} 9823 9824@Article{ dsv2006, 9825 author = {Masoud Darbandi and Gerry E. Schneider and Soheyl Vakili}, 9826 title = {Using Different Preconditioned Krylov Subspace Methods to Solve Coupled Fluid 9827 Flow Equations}, 9828 journal = {Computational Fluid Dynamics}, 9829 year = {2006}, 9830 volume = {15}, 9831 number = {1}, 9832 petsc_uses = {KSP} 9833} 9834 9835@Article{ lahaye03, 9836 author = {Lahaye, D. and Vandewalle, S. and Hameyer, K.}, 9837 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 9838 journal = {J. Comput. Appl. Math.}, 9839 year = {2004}, 9840 pages = {267--275}, 9841 volume = {168}, 9842 petsc_uses = {KSP} 9843} 9844 9845@TechReport{ brmn, 9846 title = {Faster {PDE}-based Simulations Using Robust Composite Linear Solvers}, 9847 author = {S. Bhowmick and P. Raghavan and L. McInnes and B. Norris}, 9848 year = {2002}, 9849 type = {Technical Report}, 9850 institution = {ANL}, 9851 number = {ANL/MCS-P993-0902}, 9852 note = {To appear in Future Generation Computer Systems}, 9853 petsc_uses = {KSP} 9854} 9855 9856@InProceedings{ mnbr, 9857 author = {L. McInnes and B. Norris and S. Bhowmick and P. Raghavan}, 9858 title = {Adaptive Sparse Linear Solvers for Implicit {CFD} Using {Newton-Krylov} 9859 Algorithms}, 9860 booktitle = {Proceedings of the Second MIT Conference on Computational Fluid and Solid 9861 Mechanics}, 9862 year = {2003}, 9863 petsc_uses = {KSP} 9864} 9865 9866@InProceedings{ bmnr, 9867 author = {S. Bhowmick and L. McInnes and B. Norris and P. Raghavan}, 9868 title = {The Role of Multi-Method Linear Solvers in {PDE}-based Simulations}, 9869 booktitle = {Proceedings of the 2003 International Conference on Computational Science and its 9870 Applications, Lecture notes in Computer Science 2677}, 9871 editor = {V. Kumar and M. L. Gavrilova and C. J. K. Tan and P. L'Ecuyer}, 9872 pages = {828--839}, 9873 year = {2003}, 9874 petsc_uses = {KSP} 9875} 9876 9877@Article{ ph03, 9878 author = {M. Pernice and R. D. Hornung}, 9879 title = {Newton-Krylov-FAC Methods for Problems Discretized on Locally Refined Grids}, 9880 journal = {Computing and Visualization in Science}, 9881 year = {2003}, 9882 lab = {LANL}, 9883 petsc_uses = {KSP} 9884} 9885 9886@Article{ adams-02, 9887 author = {Adams, M.~F. and Brezina, M. and Hu, J. J. and Tuminaro, R. S}, 9888 journal = {J. Comp. Phys.}, 9889 number = {2}, 9890 pages = {593-610}, 9891 title = {Parallel multigrid smoothing: polynomial versus {G}auss--{S}eidel}, 9892 volume = {188}, 9893 year = {2003}, 9894 petsc_uses = {KSP} 9895} 9896 9897@InProceedings{ adams2001distributed, 9898 title = {A distributed memory unstructured {G}auss-{S}eidel algorithm for multigrid 9899 smoothers}, 9900 author = {Adams, M.F.}, 9901 booktitle = {Supercomputing, ACM/IEEE 2001 Conference}, 9902 pages = {14--14}, 9903 year = {2001}, 9904 organization = {IEEE}, 9905 petsc_uses = {KSP} 9906} 9907 9908@PhDThesis{ els01, 9909 author = {Ulrich Elsner}, 9910 title = {Static and Dynamic Graph Partitioning. A comparative study of existing 9911 algorithms}, 9912 school = {Technical University Chemnitz}, 9913 year = {2002}, 9914 publisher = {Logos Verlag, Berlin}, 9915 isbn = {3-89722-923-4}, 9916 annote = {Uses PETSc's high quality parallel algorithms to provide a framework to compare 9917 different graph partitioning algorithms}, 9918 petsc_uses = {KSP} 9919} 9920 9921@TechReport{ ckk02, 9922 title = {Pseudo-Transient Continuation and Differential-Algebraic Equations}, 9923 author = {Todd S. Coffey and C. T. Kelley and David E. Keyes}, 9924 year = {2002}, 9925 type = {Technical Report}, 9926 institution = {ODU}, 9927 url = {http://www.math.odu.edu/\~{ }keyes}, 9928 note = {Submitted to the special issue of the SIAM Journal of Scientific Computing 9929 dedicated to papers from the 2002 Copper Mountain Conference on Iterative 9930 Methods}, 9931 petsc_uses = {KSP} 9932} 9933 9934@Article{ gpw2002, 9935 title = {Balancing Neumann-Neumann Preconditioners for Mixed Approximations of 9936 Heterogeneous Problems in Linear Elasticity}, 9937 author = {Paulo Goldfeld and Luca F. Pavarino and Olof B. Widlund}, 9938 year = {2003}, 9939 pages = {283--324}, 9940 volume = {95}, 9941 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR2002-825/TR2002-825.pdf}, 9942 journal = {Numerische Mathematik}, 9943 petsc_uses = {KSP} 9944} 9945 9946@Article{ dh1, 9947 title = {Scalability and FETI based algorithm for large discretized variational 9948 inequalities}, 9949 author = {Z Dostal and D Horak}, 9950 year = {2003}, 9951 pages = {347--357}, 9952 volume = {61}, 9953 url = {http://portal.acm.org/citation.cfm?id=770222.770239}, 9954 journal = {Mathematics and Computers in Simulation}, 9955 petsc_uses = {KSP} 9956} 9957 9958@InProceedings{ dhsv1, 9959 author = {Zdenek Dostal and David Horak and Jan Szweda and Vit Vondrak}, 9960 url = {http://cdcsp.univ-lyon1.fr/\~{ }dd13/DD13proc/Dostal.pdf}, 9961 title = {36 Scalabilities of {FETI} for Variational Inequalities and Contact Shape 9962 Optimization}, 9963 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9964 Methods}, 9965 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 9966 Kuznetsov}, 9967 petsc_uses = {KSP} 9968} 9969 9970@Article{ lahaye02, 9971 author = {Domenico Lahaye and S. Vandewalle and K. Hameyer}, 9972 title = {An Algebraic Multilevel Preconditioner for Field-Circuit Coupled Problems}, 9973 journal = {IEEEMAGN}, 9974 year = {2002}, 9975 volume = {38}, 9976 number = {2}, 9977 pages = {413-416}, 9978 petsc_uses = {KSP} 9979} 9980 9981@Article{ ckm01, 9982 author = {X.-C. Cai and D. E. Keyes and L. Marcinkowski}, 9983 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/10page.ps}, 9984 title = {Nonlinear additive {Schwarz} preconditioners and applications in computational 9985 fluid dynamics}, 9986 journal = {International Journal of Numerical Methods in Fluid Mechanics}, 9987 year = {2002}, 9988 volume = {40}, 9989 pages = {1463--1470}, 9990 petsc_uses = {KSP} 9991} 9992 9993@InProceedings{ cky01, 9994 author = {X.-C. Cai and D. E. Keyes and D. P. Young}, 9995 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/dd13_1d.ps}, 9996 title = {A nonlinear additive {Schwarz} preconditioned inexact {Newton} method for shocked 9997 duct flow}, 9998 booktitle = {Proceedings of the 13th International Conference on Domain Decomposition 9999 Methods}, 10000 editor = { N. Debit and M. Garbey and R. Hoppe and J. Periaus and D. Keyes and Y. 10001 Kuznetsov}, 10002 year = {2002}, 10003 petsc_uses = {KSP} 10004} 10005 10006@Article{ ck02, 10007 author = {X.-C. Cai and D. E. Keyes}, 10008 url = {http://www.cs.colorado.edu/homes/cai/public_html/papers/aspin.ps}, 10009 title = {Nonlinearly preconditioned inexact {Newton} algorithms}, 10010 journal = {SIAM J. Sci. Comput.}, 10011 year = {2002}, 10012 pages = {183--200}, 10013 volume = {24}, 10014 petsc_uses = {KSP} 10015} 10016 10017@Article{ c04, 10018 author = {Feng-Nan Hwang and X.-C. Cai}, 10019 url = {http://amath.colorado.edu/student/hwangf/papers/one-level-aspin.pdf}, 10020 title = {A parallel nonlinear additive {Schwarz} preconditioned inexact {Newton} algorithm 10021 for incompressible {Navier-Stokes} equations}, 10022 journal = {Journal of Computational Physics}, 10023 year = {2005}, 10024 volume = {204}, 10025 pages = {666--691}, 10026 petsc_uses = {KSP} 10027} 10028 10029@Article{ hc06, 10030 author = {Feng-Nan Hwang and X.-C. Cai}, 10031 url = {http://www.cs.colorado.edu/\~{ }cai/papers/aspin2_06.pdf}, 10032 title = {A Class of Parallel Two-Level Nonlinear {Schwarz} Preconditioned Inexact {Newton} 10033 Algorithms}, 10034 journal = {Computer Methods in Applied Mechanics and Engineering}, 10035 year = {2006}, 10036 volume = {196}, 10037 pages = {1603--1611}, 10038 petsc_uses = {KSP} 10039} 10040 10041@InProceedings{ adams-01, 10042 author = {Mark F. Adams}, 10043 title = {A Distributed Memory Unstructured {G}auss-{S}eidel Algorithm for Multigrid 10044 Smoothers}, 10045 booktitle = {ACM/IEEE Proceedings of SC2001: High Performance Networking and Computing}, 10046 address = {Denver, Colorado}, 10047 month = nov, 10048 year = {2001}, 10049 petsc_uses = {KSP} 10050} 10051 10052@Book{ 1dl, 10053 author = {Domenico Lahaye}, 10054 title = {Algebraic Multigrid for Two Dimensional Time-Harmonic Magnetic Field 10055 Computations}, 10056 year = {2001}, 10057 publisher = {Katholieke Universiteit Leuven}, 10058 notes = {Thesis}, 10059 petsc_uses = {KSP} 10060} 10061 10062@Article{ adams-00, 10063 author = {Adams, M.~F.}, 10064 journal = {International Journal for Numerical Methods in Engineering}, 10065 number = {8}, 10066 pages = {1241-1262}, 10067 title = {Parallel Multigrid Solvers for 3{D} Unstructured Finite Element Problems in Large 10068 Deformation Elasticity and Plasticity}, 10069 volume = {48}, 10070 year = {2000}, 10071 petsc_uses = {KSP} 10072} 10073 10074@Article{ adams2002evaluation, 10075 author = {Adams, M.~F.}, 10076 journal = {International Journal for Numerical Methods in Engineering}, 10077 number = {1}, 10078 pages = {519-534}, 10079 title = {Evaluation of Three Unstructured Multigrid Methods on 3{D} Finite Element 10080 Problems in Solid Mechanics}, 10081 volume = {55}, 10082 year = {2002}, 10083 petsc_uses = {KSP} 10084} 10085 10086@Article{ lahaye00, 10087 author = {Domenico Lahaye and De Gersem, H. and Vandewalle, S. and Hameyer, K.}, 10088 title = {Algebraic Multigrid for Complex Symmetric Systems}, 10089 journal = {IEEEMAGN}, 10090 year = {2000}, 10091 volume = {36}, 10092 number = {4}, 10093 pages = {1535--1538}, 10094 petsc_uses = {KSP} 10095} 10096 10097@InProceedings{ adams-99c, 10098 author = {Mark F. Adams and J. Demmel}, 10099 title = {Parallel Multigrid Solver Algorithms and Implementations for 3{D} Unstructured 10100 Finite Element Problems}, 10101 booktitle = {Proceedings of SC99: High Performance Networking and Computing}, 10102 address = {Portland, Oregon}, 10103 month = nov, 10104 year = {1999}, 10105 petsc_uses = {KSP} 10106} 10107 10108@Article{ chan95, 10109 author = {T. Chan and B. Smith and J. Zou}, 10110 title = {Overlapping {S}chwarz Methods on Unstructured Meshes using Non-matching Coarse 10111 Grids}, 10112 journal = {Numer. Math.}, 10113 year = {1995}, 10114 volume = {73}, 10115 pages = {149--167}, 10116 petsc_uses = {KSP} 10117} 10118 10119@TechReport{ adams-csd-98-993, 10120 pages = {11}, 10121 year = {1998}, 10122 type = {Technical Report}, 10123 number = {CSD-98-993}, 10124 institution = {University of California, Berkeley}, 10125 title = {A Parallel Maximal Independent Set Algorithm}, 10126 bibdate = {March 11, 1998}, 10127 author = {Mark F. Adams and James Demmel}, 10128 abstract = {The parallel construction of maximal independent sets is a useful building block 10129 for many algorithms in the computational sciences, including graph coloring and 10130 multigrid coarse grid creation on unstructured meshes. We present an efficient 10131 asynchronous maximal independent set algorithm for use on parallel computers, for 10132 ``well partitioned'' graphs, that arise from finite element (FE) models. For 10133 appropriately partitioned bounded degree graphs, it is shown that the running time 10134 of our algorithm under the P-RAM computational model is of $O(1)$, which is an 10135 improvement over the previous best P-RAM complexity for this class of graphs. We 10136 present numerical experiments on an IBM SP, that confirm our P-RAM complexity 10137 model is indicative of the performance one can expect with practical partitions on 10138 graphs from FE problems.}, 10139 month = mar, 10140 petsc_uses = {KSP} 10141} 10142 10143@Article{ benzigolubliesen2005, 10144 title = {Numerical solution of saddle point problems}, 10145 author = {Michele Benzi and Gene H. Golub and J\"org Liesen}, 10146 volume = {14}, 10147 journal = {Acta Numerica}, 10148 pages = {1-–137}, 10149 doi = {10.1017/S0962492904000212}, 10150 year = {2005} 10151} 10152 10153@Article{ mardal2011preconditioning, 10154 title = {Preconditioning discretizations of systems of partial differential equations}, 10155 author = {Kent-Andre Mardal and Ragnar Winther}, 10156 journal = {Numerical Linear Algebra with Applications}, 10157 volume = {18}, 10158 number = {1}, 10159 pages = {1--40}, 10160 year = {2011} 10161} 10162 10163@TechReport{ k676, 10164 year = {1994}, 10165 type = {Technical Report}, 10166 number = {TR1994-676}, 10167 institution = {New York University}, 10168 title = {An Optimal Preconditioner for a Class of Saddle Point Problems with a Penalty 10169 Term}, 10170 author = {Axel Klawonn}, 10171 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1994-676/TR1994-676.pdf}, 10172 petsc_uses = {KSP} 10173} 10174 10175@Book{ ak1, 10176 author = {Axel Klawonn}, 10177 title = {Preconditioners for Indefinite Problems}, 10178 year = {1995}, 10179 publisher = {Westfalishen Wilhelms-Universitat Munster}, 10180 url = {http://www.cs.nyu.edu/csweb/Research/TechReports/TR1996-716/TR1996-716.pdf}, 10181 notes = {Thesis}, 10182 petsc_uses = {KSP} 10183} 10184 10185@TechReport{ knepleykarpeev05, 10186 pages = {41}, 10187 year = {2005}, 10188 type = {Technical Report}, 10189 number = {ANL/MCS-P1295-1005}, 10190 institution = {Argonne National Laboratory}, 10191 title = {Flexible Representation of Computational Meshes}, 10192 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10193 abstract = {}, 10194 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}, 10195 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1295.pdf}}, 10196 month = oct, 10197 petsc_uses = {DMPlex} 10198} 10199 10200@TechReport{ knepleykarpeev07a, 10201 pages = {14}, 10202 year = {2007}, 10203 type = {Technical Report}, 10204 number = {ANL/MCS-P1455-0907}, 10205 institution = {Argonne National Laboratory}, 10206 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10207 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10208 abstract = {}, 10209 url = {ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}, 10210 note = {\url{ftp://info.mcs.anl.gov/pub/tech_reports/reports/P1455.pdf}}, 10211 month = feb, 10212 petsc_uses = {DMPlex} 10213} 10214 10215@Article{ knepleykarpeev09, 10216 author = {Matthew G. Knepley and Dmitry A. Karpeev}, 10217 title = {Mesh Algorithms for {PDE} with {Sieve} {I}: {Mesh} Distribution}, 10218 journal = {Scientific Programming}, 10219 volume = {17}, 10220 number = {3}, 10221 pages = {215--230}, 10222 year = {2009}, 10223 doi = {10.3233/SPR-2009-0249}, 10224 url = {http://arxiv.org/abs/0908.4427}, 10225 note = {\url{http://arxiv.org/abs/0908.4427}}, 10226 petsc_uses = {DMPlex} 10227} 10228 10229@Article{ biezuner2012computing, 10230 author = {Biezuner, Rodney and Brown, Jed and Ercole, Grey and Martins, Eder}, 10231 affiliation = {Departamento de Matem\'atica—ICEx, Universidade Federal de Minas Gerais, Av. 10232 Ant\^onio Carlos 6627, Caixa Postal 702, 30161-970 Belo Horizonte, MG, Brazil}, 10233 title = {Computing the First Eigenpair of the $p$-{L}aplacian via Inverse Iteration of 10234 Sublinear Supersolutions}, 10235 journal = {Journal of Scientific Computing}, 10236 publisher = {Springer Netherlands}, 10237 issn = {0885-7474}, 10238 keyword = {Mathematics and Statistics}, 10239 pages = {180--201}, 10240 volume = {52}, 10241 issue = {1}, 10242 year = {2012}, 10243 doi = {10.1007/s10915-011-9540-0}, 10244 petsc_uses = {KSP} 10245} 10246 10247% LiteralHTML: 10248% LiteralHTML: <a name="books"><H3><center>Books</center></H3> 10249% LiteralHTML: 10250@Book{ knepley2017, 10251 title = {Computational Science I}, 10252 author = {Matthew G. Knepley}, 10253 url = {https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}, 10254 note = {\url{https://www.cse.buffalo.edu/~knepley/classes/caam519/CSBook.pdf}}, 10255 publisher = {PETSc}, 10256 year = {2017}, 10257 petsc_uses = {KSP} 10258} 10259 10260@Article{ verleyeuser, 10261 title = {{User friendly permeability predicting software for technical textiles}}, 10262 author = {Verleye, B. and Morren, G. and Lomov, S.V. and Sol, H. and Verpoest, I. and 10263 Roose, D.}, 10264 journal = {status: published}, 10265 issn = {1560-6074}, 10266 publisher = {Hong Kong Polytechnic University, Hong Kong Institution of Textile and Apparel}, 10267 petsc_uses = {KSP} 10268} 10269 10270@Book{ pacheco, 10271 author = {Peter Pacheco}, 10272 title = {Parallel Programming with MPI}, 10273 year = {1997}, 10274 publisher = {Morgan-Kaufmann}, 10275 note = {Devotes a couple of sections to PETSc}, 10276 petsc_uses = {KSP} 10277} 10278 10279@Book{ 1sbg, 10280 author = {Barry F. Smith and Petter Bj{\o}rstad and William D. Gropp}, 10281 title = {Domain Decomposition: Parallel Multilevel Methods for Elliptic Partial 10282 Differential Equations}, 10283 year = {1996}, 10284 publisher = {Cambridge University Press}, 10285 url = {http://www.mcs.anl.gov/~bsmith/ddbook.html}, 10286 petsc_uses = {KSP} 10287} 10288 10289@Misc{ petsc-fem:homepage, 10290 title = {{PETSc-FEM}: A General Purpose, Parallel, Multi-physics {FEM} Program}, 10291 author = {M. Storti and N. Nigro and R. Paz and L. Dalcin and E. Lopez and L. Battaglia and 10292 G. Rodriguez and G. Filippini}, 10293 howpublished = {\url{http://www.cimec.org.ar/twiki/bin/view/Cimec/PETScFEM}}, 10294 petsc_uses = {KSP} 10295} 10296 10297@Misc{ petsc4py-web-page, 10298 author = {Lisandro Dalcin}, 10299 title = {{PETSc} for {Python} -- {Python} bindings for {PETSc} libraries}, 10300 howpublished = {\url{http://code.google.com/p/petsc4py/}}, 10301 note = {http://code.google.com/p/petsc4py/}, 10302 petsc_uses = {KSP} 10303} 10304 10305@Article{ libmeshpaper06, 10306 author = {B.~S.~Kirk and J.~W.~Peterson and R.~H.~Stogner and G.~F.~Carey}, 10307 title = {{\texttt{libMesh}: A C++ Library for Parallel Adaptive Mesh Refinement/Coarsening 10308 Simulations}}, 10309 journal = {Engineering with Computers}, 10310 volume = {22}, 10311 number = {3--4}, 10312 pages = {237--254}, 10313 year = {2006}, 10314 doi = {10.1007/s00366-006-0049-3}, 10315 petsc_uses = {KSP} 10316} 10317 10318@Misc{ sisiphus:homepage, 10319 title = {{SISIPHUS}: Scalable Ice-Sheet Solvers and Infrastructure for Petascale, 10320 High-Resolution, Unstructured Simulations}, 10321 author = {T. {Tautges et al.}}, 10322 howpublished = {\url{http://trac.mcs.anl.gov/projects/sisiphus/wiki}}, 10323 petsc_uses = {KSP} 10324} 10325 10326@Misc{ pflotran:homepage, 10327 title = {{PFLOTRAN} project}, 10328 author = {Ben Andre and Gautam Bisht and Nathan Collier and Glenn Hammond and Satish Karra 10329 and Jitendra Kumar and Peter Lichtner and Richard Mills}, 10330 howpublished = {\url{http://pflotran.org/}}, 10331 petsc_uses = {KSP} 10332} 10333 10334@Misc{ pism:homepage, 10335 title = {{PISM}: A Parallel Ice Sheet Model}, 10336 author = {E. {Bueler et al.}}, 10337 howpublished = {\url{http://pism-docs.org}}, 10338 petsc_uses = {KSP} 10339} 10340 10341@Misc{ dohp:homepage, 10342 title = {Dohp: Dual order $hp$-finite elements}, 10343 author = {J. Brown}, 10344 howpublished = {\url{http://dohp.org}}, 10345 petsc_uses = {KSP} 10346} 10347 10348@Article{ mccourtrognlienetal12, 10349 title = {Improving parallel scalability for edge plasma transport simulations with neutral 10350 gas species}, 10351 author = {M. McCourt and T. D. Rognlien and L. C. McInnes and H. Zhang}, 10352 journal = {Computational Science and Discovery}, 10353 year = {2012}, 10354 volume = {5}, 10355 number = {014012}, 10356 doi = {10.1088/1749-4699/5/1/014012}, 10357 note = {Focus on 22nd International Conference on Numerical Simulations of Plasmas (ICNSP 10358 2011)}, 10359 petsc_uses = {KSP} 10360} 10361 10362@Misc{ petclaw-github, 10363 title = {Pet{C}law Software}, 10364 author = {Kyle T. Mandli and David I. Ketcheson and Amal Alghamdi and Aron Ahmadia}, 10365 year = {2011}, 10366 howpublished = {\url{https://github.com/pyclaw/pyclaw}}, 10367 petsc_uses = {KSP} 10368} 10369 10370@Misc{ pyclaw-web-page, 10371 author = {Kyle T. Mandli and David I. Ketcheson and others}, 10372 title = {{PyClaw} software}, 10373 howpublished = {\url{http://clawpack.github.io/doc/pyclaw/}}, 10374 url = {http://clawpack.github.io/doc/pyclaw/}, 10375 year = {2012}, 10376 petsc_uses = {KSP} 10377} 10378 10379@Article{ ketcheson2011highorder, 10380 title = {High-order wave propagation algorithms for general hyperbolic systems}, 10381 author = {Ketcheson, David I. and Parsani, Matteo and LeVeque, Randall J.}, 10382 year = {2011}, 10383 note = {submitted}, 10384 petsc_uses = {KSP} 10385} 10386 10387@Article{ biros2005pln1, 10388 title = {{Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE} constrained 10389 optimization. Part I: The {Krylov-Schur} solver}}, 10390 author = {Biros, G. and Ghattas, O.}, 10391 journal = {SIAM Journal on Scientific Computing}, 10392 volume = {27}, 10393 number = {2}, 10394 pages = {687--713}, 10395 year = {2005}, 10396 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10397 petsc_uses = {KSP} 10398} 10399 10400@Article{ biros2005pln2, 10401 title = {Parallel {Lagrange-Newton-Krylov-Schur} methods for {PDE}-constrained 10402 optimization. Part {II}: The {Lagrange Newton} solver, and its application to 10403 optimal control of steady viscous flows}, 10404 author = {Biros, G. and Ghattas, O.}, 10405 journal = {SIAM Journal on Scientific Computing}, 10406 volume = {27}, 10407 number = {2}, 10408 pages = {714--739}, 10409 year = {2005}, 10410 publisher = {Society for Industrial and Applied Mathematics Philadelphia, PA, USA}, 10411 petsc_uses = {KSP} 10412} 10413 10414@Misc{ issm:homepage, 10415 title = {{I}ce {S}heet {S}ystem {M}odel}, 10416 author = {Eric Larour and Mathieu Morlighem and Helene Seroussi}, 10417 year = {2010}, 10418 note = {\href{http://issm.jpl.nasa.gov}{\url{issm.jpl.nasa.gov}}}, 10419 petsc_uses = {KSP} 10420} 10421 10422@Article{ morlighem2010spatial, 10423 title = {Spatial patterns of basal drag inferred using control methods from a 10424 full-{S}tokes and simpler models for {P}ine {I}sland {G}lacier, {W}est 10425 {A}ntarctica}, 10426 author = {Morlighem, M. and Rignot, E. and Seroussi, H. and Larour, E. and Dhia, H.B. and 10427 Aubry, D.}, 10428 journal = {Geophysical Research Letters}, 10429 volume = {37}, 10430 number = {14}, 10431 pages = {L14502}, 10432 year = {2010}, 10433 publisher = {American Geophysical Union}, 10434 petsc_uses = {KSP} 10435} 10436 10437@Article{ jardin2012plasmas, 10438 title = {Multiple timescale calculations of sawteeth and other global macroscopic dynamics 10439 of tokamak plasmas}, 10440 author = {S. C. Jardin and N. Ferraro and J. Breslau and J. Chen}, 10441 journal = {Computational Science \& Discovery}, 10442 volume = {5}, 10443 number = {1}, 10444 url = {http://stacks.iop.org/1749-4699/5/014002}, 10445 year = {2012}, 10446 petsc_uses = {KSP} 10447} 10448 10449@Article{ cmz2016, 10450 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10451 author = {Jie Chen and Lois Curfman McInnes and Hong Zhang}, 10452 journal = {Journal of Scientific Computing}, 10453 publisher = {Springer}, 10454 pages = {803--825}, 10455 volume = {68}, 10456 issue = {2}, 10457 url = {http://link.springer.com/article/10.1007/s10915-015-0159-4}, 10458 doi = {10.1007/s10915-015-0159-4}, 10459 year = {2016}, 10460 note = {Also preprint ANL/MCS-P3039-0912}, 10461 petsc_uses = {KSP} 10462} 10463 10464@Article{ knepleybrownruppsmith13, 10465 author = {{Knepley}, M.~G. and {Brown}, J. and {Rupp}, K. and {Smith}, B.~F.}, 10466 title = {Achieving High Performance with Unified Residual Evaluation}, 10467 journal = {ArXiv e-prints}, 10468 eprint = {1309.1204}, 10469 archiveprefix = {arXiv}, 10470 primaryclass = {cs.MS}, 10471 keywords = {Computer Science - Mathematical Software, Computer Science - Computational 10472 Engineering, Finance, and Science}, 10473 year = {2013}, 10474 month = sep, 10475 adsurl = {http://adsabs.harvard.edu/abs/2013arXiv1309.1204K}, 10476 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10477 petsc_uses = {KSP} 10478} 10479 10480@Book{ fenicsbook, 10481 title = {Automated Solution of Differential Equations by the Finite Element Method: The 10482 FEniCS Book}, 10483 series = {Lecture Notes in Computational Science and Engineering}, 10484 volume = {84}, 10485 editor = {Anders Logg, Kent-Andre Mardal, Garth Wells}, 10486 publisher = {Springer}, 10487 isbn = {978-3-642-23098-1}, 10488 year = {2012}, 10489 petsc_uses = {KSP} 10490} 10491 10492@Article{ demidovahnertruppgottschling12, 10493 author = {{Demidov}, D. and {Ahnert}, K. and {Rupp}, K. and {Gottschling}, P.}, 10494 title = {{Programming CUDA and OpenCL: A Case Study Using Modern C++ Libraries}}, 10495 journal = {ArXiv e-prints}, 10496 archiveprefix = {arXiv}, 10497 eprint = {1212.6326}, 10498 primaryclass = {cs.MS}, 10499 keywords = {Computer Science - Mathematical Software, Computer Science - Distributed, 10500 Parallel, and Cluster Computing, Physics - Computational Physics}, 10501 year = {2012}, 10502 month = dec, 10503 adsurl = {http://adsabs.harvard.edu/abs/2012arXiv1212.6326D}, 10504 adsnote = {Provided by the SAO/NASA Astrophysics Data System}, 10505 petsc_uses = {KSP} 10506} 10507 10508@InProceedings{ viennacl, 10509 author = {Rupp, K. and Rudolf, F. and Weinbub, J.}, 10510 title = {{ViennaCL - A High Level Linear Algebra Library for GPUs and Multi-Core CPUs}}, 10511 booktitle = {Intl.~Workshop on GPUs and Scientific Applications}, 10512 year = {2010}, 10513 pages = {51-56}, 10514 petsc_uses = {KSP} 10515} 10516 10517@Article{ knepleybrownmcinnessmithruppadams2015, 10518 title = {Exascale Computing without Threads}, 10519 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10520 Karl Rupp and Mark Adams}, 10521 url = {https://figshare.com/articles/Exascale_Computing_without_Threads-Barry_Smith_pdf/5824950}, 10522 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10523 Scientific Software Architecture for Portability and Performance}, 10524 doi = {10.6084/m9.figshare.5824950.v1}, 10525 year = {2015}, 10526 petsc_uses = {KSP} 10527} 10528 10529@Article{ knepleybrownmcinnessmithruppadams2015b, 10530 title = {Overview of the {PETSc} Library}, 10531 author = {Matthew G. Knepley and Jed Brown and Lois Curfman McInnes and Barry Smith and 10532 Karl Rupp and Mark Adams}, 10533 url = {http://www.orau.gov/hpcor2015/whitepapers/Overview_of_the_PETSc_Library-Lois_McInnes.pdf}, 10534 note = {Whitepaper for the DOE High Performance Computing Operational Review (HPCOR) on 10535 Scientific Software Architecture for Portability and Performance}, 10536 year = {2015}, 10537 petsc_uses = {KSP} 10538} 10539 10540@InBook{ balaybrownknepleymcinnessmith2015, 10541 author = {Satish Balay and Jed Brown and Matthew G. Knepley and Lois McInnes and Barry 10542 Smith}, 10543 bookeditor = {J. Carver}, 10544 title = {Software Engineering for Science}, 10545 chapter = {Providing Mixed Language and Legacy Support within a Library}, 10546 publisher = {Taylor \& Francis}, 10547 year = {2015}, 10548 petsc_uses = {KSP} 10549} 10550 10551@Article{ ruppbalaybrownknepleymcinnessmith2015, 10552 title = {On The Evolution Of User Support Topics in Computational Science and Engineering 10553 Software}, 10554 author = {Karl Rupp and Satish Balay and Jed Brown and Matthew G. Knepley and Lois Curfman 10555 McInnes and Barry F. Smith}, 10556 note = {Whitepaper for Computational Science \& Engineering Software Sustainability and 10557 Productivity Challenges}, 10558 journal = {ArXiv e-prints}, 10559 archiveprefix = {arXiv}, 10560 eprint = {1510.01122}, 10561 year = {2015}, 10562 petsc_uses = {KSP} 10563} 10564 10565@InProceedings{ knepley2013accurately, 10566 title = {Accurately Citing Software and Algorithms Used in Publications}, 10567 author = {Knepley, Matthew G. and Brown, Jed and McInnes, Lois Curfman and Smith, Barry 10568 F.}, 10569 year = {2013}, 10570 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10571 (WSSSPE), held at SC13}, 10572 doi = {10.6084/m9.figshare.785731}, 10573 petsc_uses = {KSP} 10574} 10575 10576@InProceedings{ milleretal2013, 10577 title = {Package Management Practice Essential for Interoperability: Lessons Learned and 10578 Strategies Developed for {FASTMath}}, 10579 author = {Mark C. Miller and Lori Diachin and Satish Balay and Lois Curfman McInnes and 10580 Barry Smith}, 10581 year = {2013}, 10582 booktitle = {First Workshop on Sustainable Software for Science: Practice and Experiences 10583 (WSSSPE), held at SC13}, 10584 doi = {10.6084/m9.figshare.789055}, 10585 petsc_uses = {KSP} 10586} 10587 10588@TechReport{ dudsonetal2012, 10589 title = {Improved Nonlinear Solvers in {BOUT++}}, 10590 author = {Ben Dudson and Sean Farley and Lois Curfman McInnes}, 10591 institution = {Argonne National Laboratory}, 10592 number = {ANL/MCS-P3025-0812}, 10593 year = {2012}, 10594 petsc_uses = {KSP} 10595} 10596 10597@Misc{ brown13, 10598 author = {J. Brown}, 10599 title = {Scalable Repository Workflows}, 10600 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10601 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10602 year = {2013}, 10603 petsc_uses = {KSP} 10604} 10605 10606@Misc{ starforest11, 10607 title = {Star forests as a parallel communication model}, 10608 author = {Jed Brown}, 10609 url = {https://jedbrown.org/files/StarForest.pdf}, 10610 year = {2011}, 10611 petsc_uses = {KSP} 10612} 10613 10614@Misc{ brownknepleysmith13, 10615 author = {J. Brown and M. Knepley and B. Smith}, 10616 title = {Run-time Extensibility: Anything Less is Unsustainable}, 10617 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 10618 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 10619 year = {2013}, 10620 petsc_uses = {KSP} 10621} 10622 10623@Article{ jzhaoyliwkliu15, 10624 author = {J. Zhao and Y. Li and W.K. Liu}, 10625 title = {Predicting band structure of 3{D} mechanical metamaterials with complex geometry 10626 via {XFEM}}, 10627 journal = {Computational Mechanics}, 10628 year = {2015}, 10629 url = {http://link.springer.com/article/10.1007/s00466-015-1129-2}, 10630 petsc_uses = {KSP} 10631} 10632 10633@Article{ alisic14, 10634 author = {L. Alisic and J.F. Rudge and R.F. Katz and G. Wells and S. Rhebergen}, 10635 title = {Compaction around a rigid, circular inclusion in partially molten rock}, 10636 journal = {J. Geophys. Res.}, 10637 year = {2014}, 10638 volume = {119}, 10639 number = {7}, 10640 pages = {5903-5920}, 10641 doi = {10.1002/2013JB010906}, 10642 petsc_uses = {KSP} 10643} 10644 10645@Article{ rhebergen14, 10646 author = {S. Rhebergen and G. Wells and R.F. Katz and A. Wathen}, 10647 title = {Analysis of block preconditioners for models of coupled magma mantle dynamics}, 10648 journal = {SIAM J. Sci. Comp.}, 10649 year = {2014}, 10650 volume = {36}, 10651 number = {4}, 10652 pages = {1960-1977}, 10653 doi = {10.1137/130946678}, 10654 petsc_uses = {KSP} 10655} 10656 10657@Article{ allwright14, 10658 author = {J. Allwright and R.F. Katz}, 10659 title = {Pipe Poiseuille flow of viscously anisotropic, partially molten rock}, 10660 journal = {Geophys. J. Int.}, 10661 year = {2014}, 10662 volume = {199}, 10663 number = {3}, 10664 pages = {1608--1624}, 10665 doi = {10.1093/gji/ggu345}, 10666 petsc_uses = {KSP} 10667} 10668 10669@Misc{ gropp10, 10670 author = {William D. Gropp}, 10671 title = {Update on libraries for {B}lue {W}aters}, 10672 address = {Bordeaux, France}, 10673 year = {2010}, 10674 url = {http://jointlab.ncsa.illinois.edu/events/workshop3/pdf/presentations/Gropp-Update-on-Libraries.pdf}, 10675 petsc_uses = {KSP} 10676} 10677 10678@InProceedings{ mayknepley2017, 10679 title = {{DMSwarm}: Particles in {PETSc}}, 10680 author = {Dave A May and Matthew G Knepley}, 10681 booktitle = {EGU General Assembly Conference Abstracts}, 10682 volume = {19}, 10683 pages = {10133}, 10684 year = {2017}, 10685 petsc_uses = {KSP} 10686} 10687 10688@InProceedings{ adamsbrownknepley2013, 10689 author = {Mark F. Adams and Jed Brown and Matthew G. Knepley}, 10690 title = {Low-communication techniques for extreme-scale multilevel solvers}, 10691 booktitle = {Exascale Mathematics Workshop, Aug 21--22, Washington, DC}, 10692 organization = {DOE Office of Advanced Scientific Computing Research}, 10693 year = {2013}, 10694 petsc_uses = {KSP} 10695} 10696 10697@Article{ bhallagriffithknepleyadamsguy2017, 10698 title = {Scalable smoothing strategies for a geometric multigrid method for the immersed 10699 boundary equations}, 10700 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Matthew G. Knepley and Mark F. 10701 Adams and Robert D. Guy}, 10702 journal = {arXiv e-prints}, 10703 eprint = {1612.02208}, 10704 year = {2017}, 10705 note = {\url{http://arxiv.org/abs/1612.02208}}, 10706 petsc_uses = {KSP} 10707} 10708 10709@Article{ zampini2016pcbddc, 10710 title = {{PCBDDC}: a class of robust dual-primal methods in {PETSc}}, 10711 author = {Zampini, Stefano}, 10712 journal = {SIAM Journal on Scientific Computing}, 10713 volume = {38}, 10714 number = {5}, 10715 pages = {S282--S306}, 10716 year = {2016}, 10717 publisher = {SIAM}, 10718 petsc_uses = {KSP} 10719} 10720 10721@Article{ jolivetromanzampini2020, 10722 title = {{KSPHPDDM} and {PCHPDDM}: extending {PETSc} with advanced {Krylov} methods and 10723 robust multilevel overlapping {Schwarz} preconditioners}, 10724 author = {Pierre Jolivet and Jose Roman and Stefano Zampini}, 10725 journal = {Computers and Mathematics with Applications}, 10726 volume = {84}, 10727 pages = {277--295}, 10728 year = {2020} 10729} 10730 10731@Article{ zampinitu2017, 10732 title = {Multilevel {BDDC} deluxe algorithms with adaptive coarse spaces for flow in 10733 porous media}, 10734 author = {Stefano Zampini and Xuemin Tu}, 10735 journal = {SIAM Journal of Scientific Computing}, 10736 volume = {39}, 10737 number = {4}, 10738 pages = {A1389--A1415}, 10739 year = {2017} 10740} 10741 10742@Article{ ohwidlundzampinidohrmann2017, 10743 title = {{BDDC} algorithms with deluxe scaling and adaptive selection of primal 10744 constraints for {Raviart-Thomas} vector fields}, 10745 author = {D.-S. Oh and Olof B. Widlund and Stefano Zampini and Clark Dohrmann}, 10746 journal = {Mathematics of Computation}, 10747 volume = {87}, 10748 number = {310}, 10749 pages = {659--692}, 10750 year = {2017} 10751} 10752 10753@Article{ veigapavarinoscacchiwidlundzampini2016, 10754 title = {Adaptive selection of primal constraints for isogeometric {BDDC} deluxe 10755 preconditioners}, 10756 author = {L. Beirao Da Veiga and Luca F. Pavarino and S. Scacchi and Olof B. Widlund and 10757 Stefano Zampini}, 10758 journal = {SIAM Journal of Scientific Computing}, 10759 volume = {39}, 10760 number = {1}, 10761 pages = {A281--A302}, 10762 year = {2016} 10763} 10764 10765@Article{ pavarinoscacchiwidlundzampini2018, 10766 title = {Isogeometric {BDDC} deluxe preconditioners for linear elasticity for isogeometric 10767 analysis}, 10768 author = {Luca F. Pavarino and S. Scacchi and Olof B. Widlund and Stefano Zampini}, 10769 journal = {Mathematical Models and Methods in Applied Sciences}, 10770 volume = {28}, 10771 number = {7}, 10772 pages = {1337--1370}, 10773 year = {2018} 10774} 10775 10776@Article{ bergervergiatwaisman2017, 10777 title = {An overlapping Domain Decomposition preconditioning method for monolithic 10778 solution of shear bands}, 10779 author = {Luc Berger-Vergiat and Haim Waisman}, 10780 journal = {Computer Methods in Applied Mechanics and Engineering}, 10781 volume = {318}, 10782 pages = {33--60}, 10783 year = {2017}, 10784 petsc_uses = {KSP} 10785} 10786 10787@Article{ abhyankarmaldonadosmithzhang2020, 10788 title = {{PETSc} {DMNetwork}: A Library for Scalable Network PDE-Based Multiphysics 10789 Simulations}, 10790 author = {S. Abhyankar and G. Betrie and D.A. Maldonado and L.C. McInnes and B. Smith and 10791 H. Zhang}, 10792 journal = {ACM Transactions on Mathematical Software}, 10793 volume = {46}, 10794 number = {1}, 10795 year = {2020}, 10796 doi = {10.1145/3344587}, 10797 petsc_uses = {KSP} 10798} 10799 10800@InProceedings{ zhangellpack2018, 10801 author = {Hong Zhang and Richard T. Mills and Karl Rupp and Barry F. Smith}, 10802 title = {Vectorized Parallel Sparse Matrix-Vector Multiplication in {PETSc} Using 10803 {AVX-512}}, 10804 booktitle = {Proceedings of the 47th International Conference on Parallel Processing}, 10805 year = {2018}, 10806 petsc_uses = {KSP} 10807} 10808 10809@Misc{ petsc-user-meetings:website, 10810 title = {{PETSc User Meetings}}, 10811 key = {PETSc User Meetings}, 10812 howpublished = {\url{https://petsc.org/release/community/meetings/meeting}}, 10813 petsc_uses = {KSP} 10814} 10815 10816@Article{ flexible-bicgstab-chen16, 10817 title = {Analysis and Practical Use of Flexible {BiCGStab}}, 10818 author = {J. Chen and L.C. McInnes and H. Zhang}, 10819 journal = {Journal of Scientific Computing}, 10820 volume = {68}, 10821 number = {2}, 10822 month = jul, 10823 year = {2016}, 10824 pages = {803--825}, 10825 doi = {10.1007/s10915-015-0159-4}, 10826 petsc_uses = {KSP} 10827} 10828 10829@Misc{ petsc-extensibility2016, 10830 author = {M. Knepley and D. A. May and J. Brown and B. Smith}, 10831 title = {{Extensibility in PETSc}}, 10832 note = {SIAM News, available via 10833 \url{https://sinews.siam.org/Details-Page/extensibility-in-petsc}}, 10834 year = {2016}, 10835 petsc_uses = {KSP} 10836} 10837 10838@Misc{ error-estimation-whitepaper2017, 10839 author = {E. Constantinescu and O. Marin and T. Munson and B. Smith and H. Zhang}, 10840 title = {End-to-end error estimation and control}, 10841 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 10842 doi = {10.6084/m9.figshare.5339866}, 10843 year = {2017}, 10844 petsc_uses = {KSP} 10845} 10846 10847@Misc{ petsc-user-support15, 10848 title = {On the Evolution of User Support Topics in Computational Science and Engineering 10849 Software}, 10850 author = {K. Rupp and S. Balay and J. Brown and M. Knepley and L. C. McInnes and B. Smith}, 10851 note = {Workshop on CSE Software Sustainability and Productivity (CSESSP) Challenges, Oct 10852 15-16, 2015}, 10853 year = {2015}, 10854 petsc_uses = {KSP} 10855} 10856 10857@InBook{ petsc-mixed-language-support2016, 10858 title = {Numerical Library Support for High-Performance Mixed Language Applications and 10859 Legacy Code}, 10860 author = {S. Balay and J. Brown and M. Knepley and L.C. McInnes and B. Smith}, 10861 booktitle = {Software Engineering for Science}, 10862 editors = {J. Carver et al.}, 10863 publisher = {CRC Press}, 10864 pages = {201--214}, 10865 year = {2016}, 10866 petsc_uses = {KSP} 10867} 10868 10869@InProceedings{ konolige2018parallel, 10870 title = {A Parallel Solver for Graph {L}aplacians}, 10871 author = {Tristan Konolige and Jed Brown}, 10872 booktitle = {Proceedings of the Platform for Advanced Scientific Computing (PASC)}, 10873 doi = {10.1145/3218176.3218227}, 10874 note = {Best Paper Award}, 10875 archiveprefix = {arXiv}, 10876 eprint = {1705.06266}, 10877 year = {2018}, 10878 petsc_uses = {KSP} 10879} 10880 10881@InProceedings{ werner-kimn2019, 10882 title = {Parallel implementation of {AC} optimal power flow and time-constrained optimal 10883 power flow using high-performance computing}, 10884 author = {Alex Werner and Kapil Duwadi and Nicholas Stegmeier and Timothy M. Hansen and 10885 Jung-Han Kimn}, 10886 booktitle = {IEEE 9th Annual Computing and Communication Workshop and Conference (CCWC 2019)}, 10887 note = {Best Paper in Track}, 10888 year = {2019}, 10889 petsc_uses = {KSP} 10890} 10891 10892@MastersThesis{ rinaldo-ceresoli18, 10893 author = {Stefano Guido Rinaldo and Andrea Ceresoli}, 10894 title = {Newton–Krylov–Schwarz Methods for Distributed Power Flow and Related 10895 Applications}, 10896 school = {Politecnico di Milano}, 10897 year = {2018}, 10898 month = apr, 10899 petsc_uses = {KSP} 10900} 10901 10902@Article{ sananschneppmay2016, 10903 title = {Pipelined, Flexible {K}rylov Subspace Methods}, 10904 author = {P. Sanan and S. M. Schnepp and D. A. May}, 10905 journal = {SIAM Journal on Scientific Computing}, 10906 volume = {38}, 10907 number = {5}, 10908 pages = {C441-C470}, 10909 year = {2016}, 10910 doi = {10.1137/15M1049130}, 10911 petsc_uses = {KSP} 10912} 10913 10914@Article{ petscsf2022, 10915 author = {Zhang, Junchao and Brown, Jed and Balay, Satish and Faibussowitsch, Jacob and 10916 Knepley, Matthew and Marin, Oana and Mills, Richard Tran and Munson, Todd and 10917 Smith, Barry F. and Zampini, Stefano}, 10918 journal = {IEEE Transactions on Parallel and Distributed Systems}, 10919 title = {The {PetscSF} Scalable Communication Layer}, 10920 year = {2022}, 10921 volume = {33}, 10922 number = {4}, 10923 pages = {842-853}, 10924 doi = {10.1109/TPDS.2021.3084070} 10925} 10926 10927@Article{ brandt2000, 10928 title = {General highly accurate algebraic coarsening}, 10929 author = {Achi Brandt}, 10930 journal = {Electronic Transactions on Numerical Analysis}, 10931 volume = {10}, 10932 number = {9680}, 10933 pages = {1--20}, 10934 issn = {10689613}, 10935 year = {2000} 10936} 10937 10938@Article{ dalcinpazklercosimo2011, 10939 title = {Parallel distributed computing using Python}, 10940 author = {Lisandro D. Dalcin and Rodrigo R. Paz and Pablo A. Kler and Alejandro Cosimo}, 10941 journal = {Advances in Water Resources}, 10942 volume = {34}, 10943 number = {9}, 10944 pages = {1124 - 1139}, 10945 note = {New Computational Methods and Software Tools}, 10946 issn = {0309-1708}, 10947 doi = {10.1016/j.advwatres.2011.04.013}, 10948 year = {2011} 10949} 10950 10951@Article{ behnelbradshawcitrodalcinseljebotnsmith2011, 10952 title = {Cython: The Best of Both Worlds}, 10953 author = {Behnel,Stefan and Bradshaw,Robert and Citro,Craig and Dalcin,Lisandro and 10954 Seljebotn,Dag Sverre and Smith,Kurt }, 10955 journal = {Computing in Science \& Engineering}, 10956 volume = {13}, 10957 number = {2}, 10958 pages = {31-39}, 10959 doi = {10.1109/MCSE.2010.118}, 10960 year = {2011} 10961} 10962 10963@Article{ dalcinpazstorti2005, 10964 title = {MPI for Python}, 10965 author = {Lisandro Dalcín and Rodrigo Paz and Mario Storti}, 10966 journal = {Journal of Parallel and Distributed Computing}, 10967 volume = {65}, 10968 number = {9}, 10969 pages = {1108 - 1115}, 10970 issn = {0743-7315}, 10971 doi = {10.1016/j.jpdc.2005.03.010}, 10972 year = {2005} 10973} 10974 10975@Article{ dalcincolliervignalcortescalo2016, 10976 title = {PetIGA: A framework for high-performance isogeometric analysis}, 10977 author = {Lisandro Dalcin and Nathan Collier and P. Vignal and A.M.A. Cortes and Victor M. 10978 Calo}, 10979 journal = {Computer Methods in Applied Mechanics and Engineering}, 10980 volume = {308}, 10981 pages = {151 - 181}, 10982 issn = {0045-7825}, 10983 doi = {10.1016/j.cma.2016.05.011}, 10984 year = {2016} 10985} 10986 10987@Article{ collierpardodalcinpaszynskicalo2012, 10988 title = {The cost of continuity: A study of the performance of isogeometric finite 10989 elements using direct solvers}, 10990 author = {Nathan Collier and David Pardo and Lisandro Dalcin and Maciej Paszynski and V.M. 10991 Calo}, 10992 journal = {Computer Methods in Applied Mechanics and Engineering}, 10993 volume = {213-216}, 10994 pages = {353 - 361}, 10995 issn = {0045-7825}, 10996 doi = {10.1016/j.cma.2011.11.002}, 10997 year = {2012} 10998} 10999 11000@Article{ collierdalcinpardocalo2013, 11001 title = {The Cost of Continuity: Performance of Iterative Solvers on Isogeometric Finite 11002 Elements}, 11003 author = {Nathan Collier and Lisandro Dalcin and David Pardo and Victor M. Calo}, 11004 journal = {SIAM Journal on Scientific Computing}, 11005 volume = {35}, 11006 number = {2}, 11007 pages = {A767-A784}, 11008 doi = {10.1137/120881038}, 11009 year = {2013} 11010} 11011 11012@Article{ dunning2017jump, 11013 title = {{JuMP}: a modeling language for mathematical optimization}, 11014 author = {Dunning, Iain and Huchette, Joey and Lubin, Miles}, 11015 journal = {SIAM Review}, 11016 volume = {59}, 11017 number = {2}, 11018 pages = {295--320}, 11019 year = {2017}, 11020 publisher = {SIAM} 11021} 11022 11023@InProceedings{ prudencioschulz2011, 11024 title = {The parallel {C++} statistical library {QUESO}: Quantification of Uncertainty for 11025 Estimation, Simulation and Optimization}, 11026 author = {Ernesto E Prudencio and Karl W Schulz}, 11027 booktitle = {European Conference on Parallel Processing}, 11028 pages = {398--407}, 11029 year = {2011} 11030} 11031 11032@Misc{ rol-website, 11033 key = {ROL}, 11034 title = {{Rapid Optimization Library} Website}, 11035 howpublished = {\url{https://trilinos.org/packages/rol}}, 11036 year = {2018} 11037} 11038 11039@Article{ more1994line, 11040 title = {Line search algorithms with guaranteed sufficient decrease}, 11041 author = {Mor{\'e}, Jorge J and Thuente, David J}, 11042 journal = {ACM Transactions on Mathematical Software}, 11043 volume = {20}, 11044 number = {3}, 11045 pages = {286--307}, 11046 year = {1994}, 11047 publisher = {ACM} 11048} 11049 11050@Article{ griewank2000algorithm, 11051 title = {Algorithm 799: revolve: an implementation of checkpointing for the reverse or 11052 adjoint mode of computational differentiation}, 11053 author = {Griewank, Andreas and Walther, Andrea}, 11054 journal = {ACM Transactions on Mathematical Software}, 11055 volume = {26}, 11056 number = {1}, 11057 pages = {19--45}, 11058 year = {2000}, 11059 publisher = {ACM} 11060} 11061 11062@Article{ metcalf2011seven, 11063 title = {The seven ages of fortran}, 11064 author = {Metcalf, Michael}, 11065 journal = {Journal of Computer Science \& Technology}, 11066 volume = {11}, 11067 year = {2011} 11068} 11069 11070@Article{ giraldo_2013, 11071 title = {Implicit-explicit formulations of a three-dimensional nonhydrostatic unified 11072 model of the atmosphere {(NUMA)}}, 11073 author = {F.X. Giraldo and J.F. Kelly and E.M. Constantinescu}, 11074 journal = {SIAM Journal on Scientific Computing}, 11075 year = {2013}, 11076 number = {5}, 11077 pages = {B1162-B1194}, 11078 volume = {35}, 11079 doi = {10.1137/120876034} 11080} 11081 11082@Article{ constantinescu_tr2016b, 11083 author = {Constantinescu, E.M.}, 11084 title = {Estimating Global Errors in Time Stepping}, 11085 journal = {ArXiv e-prints}, 11086 archiveprefix = {arXiv}, 11087 eprint = {1503.05166}, 11088 primaryclass = {math.NA}, 11089 keywords = {Mathematics - Numerical Analysis, 65L05, 65L06, 65L20, 65L70}, 11090 year = {2016}, 11091 month = mar, 11092 adsurl = {http://adsabs.harvard.edu/abs/2015arXiv150305166C}, 11093 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 11094} 11095 11096@Article{ pareschi_2005, 11097 title = {Implicit-Explicit {R}unge-{K}utta Schemes and Applications to Hyperbolic Systems 11098 with Relaxation}, 11099 author = {L. Pareschi and G. Russo}, 11100 journal = {Journal of Scientific Computing}, 11101 year = {2005}, 11102 number = {1}, 11103 pages = {129--155}, 11104 volume = {25} 11105} 11106 11107@Article{ kennedy_2003, 11108 title = {Additive {R}unge-{K}utta schemes for convection-diffusion-reaction equations}, 11109 author = {C.A. Kennedy and M.H. Carpenter}, 11110 journal = {Appl. Numer. Math.}, 11111 year = {2003}, 11112 number = {1-2}, 11113 pages = {139--181}, 11114 volume = {44}, 11115 doi = {10.1016/S0168-9274(02)00138-1}, 11116 publisher = {Elsevier Science Publishers B. V.} 11117} 11118 11119@Unpublished{ boscarino_tr2011, 11120 title = {Implicit-Explicit {R}unge-{K}utta schemes for hyperbolic systems and kinetic 11121 equations in the diffusion limit}, 11122 author = {Boscarino, S. and Pareschi, L. and Russo, G.}, 11123 note = {Arxiv preprint arXiv:1110.4375}, 11124 year = {2011} 11125} 11126 11127@Article{ ascher_1997, 11128 title = {Implicit-explicit {R}unge-{K}utta methods for time-dependent partial differential 11129 equations}, 11130 author = {U.M. Ascher and S.J. Ruuth and R.J. Spiteri}, 11131 journal = {Applied Numerical Mathematics}, 11132 year = {1997}, 11133 pages = {151--167}, 11134 volume = {25} 11135} 11136 11137@Book{ ascherpetzold1998, 11138 title = {Computer methods for ordinary differential equations and differential-algebraic 11139 equations}, 11140 author = {Uri M Ascher and Linda R Petzold}, 11141 volume = {61}, 11142 publisher = {SIAM}, 11143 year = {1998} 11144} 11145 11146@Article{ colomesbadia2016, 11147 title = {Segregated {Runge}--{Kutta} methods for the incompressible {Navier}--{Stokes} 11148 equations}, 11149 author = {Oriol Colom{\'e}s and Santiago Badia}, 11150 journal = {International Journal for Numerical Methods in Engineering}, 11151 volume = {105}, 11152 number = {5}, 11153 pages = {372--400}, 11154 year = {2016} 11155} 11156 11157@Article{ sandu_1997, 11158 title = {Benchmarking stiff {ODE} solvers for atmospheric chemistry problems {II}: 11159 {R}osenbrock solvers}, 11160 author = {A. Sandu and J.G. Verwer and J.G. Blom and E.J. Spee and G.R. Carmichael and F.A. 11161 Potra}, 11162 journal = {Atmospheric Environment}, 11163 year = {1997}, 11164 number = {20}, 11165 pages = {3459--3472}, 11166 volume = {31}, 11167 abstract = {In the numerical simulation of atmospheric transport-chemistry processes, a major 11168 task is the integration of the stiff systems of ordinary differential equations 11169 describing the chemical transformations. It is therefore of interest to 11170 systematically search for stiff solvers which can be identified as close to 11171 optimal for atmospheric applications. In this paper we continue our investigation 11172 from Sandu et al. (1996, CWI Report NM-R9603 and Report in Comput. Math., No. 85) 11173 and compare eight solvers on a set of seven box-models used in present day models. 11174 The focus is on Rosenbrock solvers. These turn out to be very well suited for our 11175 application when they are provided with highly efficient sparse matrix techniques 11176 to economize on the linear algebra. Two of the Rosenbrock solvers tested are from 11177 the literature, viz. and 4, and two are new and specially developed for air 11178 quality applications, viz. 3 and 3. } 11179} 11180 11181@Article{ rang_2005, 11182 title = {New {R}osenbrock {W}-methods of order 3 for partial differential algebraic 11183 equations of index 1}, 11184 author = {Rang, J. and Angermann, L.}, 11185 journal = {BIT Numerical Mathematics}, 11186 year = {2005}, 11187 number = {4}, 11188 pages = {761--787}, 11189 volume = {45}, 11190 publisher = {Springer} 11191} 11192 11193@Article{ gottliebketchesonshu2009, 11194 author = {Sigal Gottlieb and David I. Ketcheson and Chi Wang Shu}, 11195 title = {{High order strong stability preserving time discretizations}}, 11196 journal = {Journal of Scientific Computing}, 11197 volume = {38}, 11198 number = {3}, 11199 pages = {251--289}, 11200 doi = {10.1007/s10915-008-9239-z}, 11201 year = {2009} 11202} 11203 11204@Article{ ketcheson_2008, 11205 title = {Highly Efficient Strong Stability-Preserving {R}unge--{K}utta Methods with 11206 Low-Storage Implementations}, 11207 author = {D.I. Ketcheson}, 11208 journal = {SIAM Journal on Scientific Computing}, 11209 year = {2008}, 11210 number = {4}, 11211 pages = {2113--2136}, 11212 volume = {30}, 11213 doi = {10.1137/07070485X}, 11214 keywords = {method of lines, strong stability-preserving, monotonicity, low-storage, 11215 RungeKutta methods}, 11216 publisher = {SIAM} 11217} 11218 11219@Article{ jansen_2000, 11220 title = {A generalized-alpha method for integrating the filtered {N}avier--{S}tokes 11221 equations with a stabilized finite element method}, 11222 author = {Jansen, K.E. and Whiting, C.H. and Hulbert, G.M.}, 11223 journal = {Computer Methods in Applied Mechanics and Engineering}, 11224 year = {2000}, 11225 number = {3}, 11226 pages = {305--319}, 11227 volume = {190}, 11228 publisher = {Elsevier} 11229} 11230 11231@Article{ butcher_2007, 11232 title = {Error propagation of general linear methods for ordinary differential equations}, 11233 author = {J.C. Butcher and Z. Jackiewicz and W.M. Wright}, 11234 journal = {Journal of Complexity}, 11235 year = {2007}, 11236 number = {4-6}, 11237 pages = {560--580}, 11238 volume = {23}, 11239 abstract = {We discuss error propagation for general linear methods for ordinary differential 11240 equations up to terms of order p+2, where p is the order of the method. These 11241 results are then applied to the estimation of local discretization errors for 11242 methods of order p and for the adjacent order p+1. The results of numerical 11243 experiments confirm the reliability of these estimates. This research has 11244 applications in the design of robust stepsize and order changing strategies for 11245 algorithms based on general linear methods.}, 11246 doi = {10.1016/j.jco.2007.01.009}, 11247 issn = {0885-064X} 11248} 11249 11250@Article{ constantinescu_a2010a, 11251 title = {Extrapolated implicit-explicit time stepping}, 11252 author = {E.M. Constantinescu and A. Sandu}, 11253 journal = {SIAM Journal on Scientific Computing}, 11254 year = {2010}, 11255 number = {6}, 11256 pages = {4452-4477}, 11257 volume = {31}, 11258 comment = {Preprint \# ANL/MCS-P1612-0409}, 11259 doi = {10.1137/080732833} 11260} 11261 11262@InProceedings{ devito2011liszt, 11263 title = {Liszt: a domain specific language for building portable mesh-based PDE solvers}, 11264 author = {DeVito, Zachary and Joubert, Niels and Palacios, Francisco and Oakley, Stephen 11265 and Medina, Montserrat and Barrientos, Mike and Elsen, Erich and Ham, Frank and 11266 Aiken, Alex and Duraisamy, Karthik and others}, 11267 booktitle = {Proceedings of 2011 International Conference for High Performance Computing, 11268 Networking, Storage and Analysis}, 11269 pages = {9}, 11270 year = {2011}, 11271 organization = {ACM} 11272} 11273 11274@Article{ devito2011designing, 11275 title = {Designing the Language Liszt for Building Portable Mesh-based PDE Solvers}, 11276 author = {DeVito, Zachary and Hanrahan, Pat}, 11277 journal = {Scientific Discovery through Advanced Computing Program (SciDAC)}, 11278 year = {2011} 11279} 11280 11281@Misc{ pgasintro, 11282 author = {Tim Stitt}, 11283 title = {An Introduction to the Partitioned Global Address Space (PGAS) Programming 11284 Model}, 11285 note = {\url{http://cnx.org/content/m20649/latest/}} 11286} 11287 11288@InProceedings{ el2006upc, 11289 title = {UPC: unified parallel C}, 11290 author = {El-Ghazawi, Tarek and Smith, Lauren}, 11291 booktitle = {Proceedings of the 2006 ACM/IEEE conference on Supercomputing}, 11292 pages = {27}, 11293 year = {2006}, 11294 organization = {ACM} 11295} 11296 11297@InProceedings{ numrich1998co, 11298 title = {Co-Array Fortran for parallel programming}, 11299 author = {Numrich, Robert W and Reid, John}, 11300 booktitle = {ACM Sigplan Fortran Forum}, 11301 volume = {17}, 11302 number = {2}, 11303 pages = {1--31}, 11304 year = {1998}, 11305 organization = {ACM} 11306} 11307 11308@Article{ aiken1997titanium, 11309 title = {Titanium: A high-performance Java dialect}, 11310 author = {Aiken, Alex and Colella, Phil and Gay, David and Graham, Susan and Hilfinger, 11311 Paul and Krishnamurthy, Arvind and Liblit, Ben and Miyamoto, Carleton and Pike, 11312 Geoff and Semenzato, Luigi and others}, 11313 year = {1997} 11314} 11315 11316@Article{ charles2005x10, 11317 title = {X10: an object-oriented approach to non-uniform cluster computing}, 11318 author = {Charles, Philippe and Grothoff, Christian and Saraswat, Vijay and Donawa, 11319 Christopher and Kielstra, Allan and Ebcioglu, Kemal and Von Praun, Christoph and 11320 Sarkar, Vivek}, 11321 journal = {Acm Sigplan Notices}, 11322 volume = {40}, 11323 number = {10}, 11324 pages = {519--538}, 11325 year = {2005}, 11326 publisher = {ACM} 11327} 11328 11329@Article{ chamberlain2007parallel, 11330 title = {Parallel programmability and the chapel language}, 11331 author = {Chamberlain, Bradford L and Callahan, David and Zima, Hans P}, 11332 journal = {International Journal of High Performance Computing Applications}, 11333 volume = {21}, 11334 number = {3}, 11335 pages = {291--312}, 11336 year = {2007}, 11337 publisher = {SAGE Publications} 11338} 11339 11340@InProceedings{ charmppoopsla93, 11341 author = {{Kal\'{e}}, L.V. and Krishnan, S.}, 11342 title = {{CHARM++: A Portable Concurrent Object Oriented System Based on C++}}, 11343 editor = {Paepcke, A.}, 11344 fulleditor = {Paepcke, Andreas}, 11345 pages = {91--108}, 11346 month = sep, 11347 year = {1993}, 11348 booktitle = {{Proceedings of OOPSLA'93}}, 11349 publisher = {{ACM Press}} 11350} 11351 11352@InProceedings{ hewitt1973universal, 11353 title = {A universal modular actor formalism for artificial intelligence}, 11354 author = {Hewitt, Carl and Bishop, Peter and Steiger, Richard}, 11355 booktitle = {Proceedings of the 3rd international joint conference on Artificial 11356 intelligence}, 11357 pages = {235--245}, 11358 year = {1973}, 11359 organization = {Morgan Kaufmann Publishers Inc.} 11360} 11361 11362@Book{ yonezawa1990abcl, 11363 title = {ABCL: an object-oriented concurrent system}, 11364 author = {Yonezawa, Akinori}, 11365 year = {1990}, 11366 publisher = {MIT press} 11367} 11368 11369@InProceedings{ dally1988object, 11370 title = {Object-oriented concurrent programming in CST}, 11371 author = {Dally, William J and Chien, Andrew A}, 11372 booktitle = {Proceedings of the third conference on Hypercube concurrent computers and 11373 applications: Architecture, software, computer systems, and general issues-Volume 11374 1}, 11375 pages = {434--439}, 11376 year = {1988}, 11377 organization = {ACM} 11378} 11379 11380@Article{ grimshaw1993easy, 11381 title = {Easy-to-use object-oriented parallel processing with Mentat}, 11382 author = {Grimshaw, Andrew S.}, 11383 journal = {Computer}, 11384 volume = {26}, 11385 number = {5}, 11386 pages = {39--51}, 11387 year = {1993}, 11388 publisher = {IEEE} 11389} 11390 11391@InProceedings{ gannon1991object, 11392 title = {Object oriented parallelism: pC++ ideas and experiments}, 11393 author = {Gannon, Dennis and Lee, JK}, 11394 booktitle = {Proceedings of}, 11395 pages = {13--23}, 11396 year = {1991} 11397} 11398 11399@InProceedings{ lau1992object, 11400 title = {An object-oriented class library for scalable parallel heuristic search}, 11401 author = {Lau, Wing-cheong and Singh, Vineet}, 11402 booktitle = {ECOOP’92 European Conference on Object-Oriented Programming}, 11403 pages = {252--267}, 11404 year = {1992}, 11405 organization = {Springer} 11406} 11407 11408@Book{ chase1989amber, 11409 title = {The Amber system: Parallel programming on a network of multiprocessors}, 11410 author = {Chase, Jeffery and Amador, Franz and Lazowska, Edward and Levy, Henry and 11411 Littlefield, Richard}, 11412 volume = {23}, 11413 number = {5}, 11414 year = {1989}, 11415 publisher = {ACM} 11416} 11417 11418@InProceedings{ kaiser2009parallex, 11419 title = {Parallex an advanced parallel execution model for scaling-impaired applications}, 11420 author = {Kaiser, Hartmut and Brodowicz, Maciej and Sterling, Thomas}, 11421 booktitle = {Parallel Processing Workshops, 2009. ICPPW'09. International Conference on}, 11422 pages = {394--401}, 11423 year = {2009}, 11424 organization = {IEEE} 11425} 11426 11427@TechReport{ ipm, 11428 author = {Barry F. Smith}, 11429 title = {A New Parallel Programming Model for Computer Simulation}, 11430 institution = {Argonne National Laboratory}, 11431 year = {2014}, 11432 number = {ANL/MCS-P5135-0414} 11433} 11434 11435@Article{ groppsnir, 11436 author = {William Gropp and Marc Snir}, 11437 title = {Programming for Exascale Computers}, 11438 journal = {Computing in Science and Engineering}, 11439 volume = {15}, 11440 number = {6}, 11441 issn = {1521-9615}, 11442 year = {2013}, 11443 pages = {27-35}, 11444 doi = {10.1109/MCSE.2013.96}, 11445 publisher = {IEEE Computer Society}, 11446 address = {Los Alamitos, CA} 11447} 11448 11449@Book{ mpi3, 11450 title = {MPI: A Message-Passing Interface Standard, Version 3.0}, 11451 author = {Message Passing Interface Forum}, 11452 year = {2012}, 11453 publisher = {High Performance Computing Center Stuttgart (HLRS)} 11454} 11455 11456@Book{ openmp4, 11457 title = {OpenMP Application Program Interface, Version 4.0}, 11458 year = {2013}, 11459 publisher = {OpenMP Architecture Review Board} 11460} 11461 11462@InProceedings{ hartono2009annotation, 11463 title = {Annotation-based empirical performance tuning using {Orio}}, 11464 author = {Hartono, Albert and Norris, Boyana and Sadayappan, Ponnuswamy}, 11465 booktitle = {Parallel \& Distributed Processing, 2009. IPDPS 2009. IEEE International 11466 Symposium on}, 11467 pages = {1--11}, 11468 year = {2009}, 11469 organization = {IEEE} 11470} 11471 11472@Book{ toselli2005domain, 11473 title = {Domain Decomposition Methods: Algorithms and Theory}, 11474 author = {Toselli, Andrea and Widlund, Olof B}, 11475 volume = {34}, 11476 year = {2005}, 11477 publisher = {Springer} 11478} 11479 11480@InBook{ st2016, 11481 author = {Barry F. Smith and Xumin Tu}, 11482 chapter = {Domain Decomposition}, 11483 title = {Encyclopedia of Applied and Computational Mathematics}, 11484 bookeditor = {B. Engquist}, 11485 publisher = {Springer}, 11486 pages = {375--381}, 11487 year = {2016} 11488} 11489 11490@TechReport{ saws, 11491 author = {Matt Otten and Jed Brown and Barry F. Smith}, 11492 title = {Scientific Application Web Server {(SAWs)} Users Manual}, 11493 institution = {Argonne National Laboratory}, 11494 year = {2013} 11495} 11496 11497@Article{ smith1997domain, 11498 title = {Domain Decomposition Methods for Partial Differential Equations}, 11499 author = {Smith, B.F.}, 11500 journal = {ICASE LARC Interdisciplinary Series in Science and Engineering}, 11501 volume = {4}, 11502 pages = {225--244}, 11503 year = {1997}, 11504 publisher = {Citeseer} 11505} 11506 11507@Article{ spillane2011abstract, 11508 title = {Abstract robust coarse spaces for systems of {PDEs} via generalized eigenproblems 11509 in the overlaps}, 11510 author = {Spillane, N and Dolean, V and Hauret, P and Nataf, F and Pechstein, C and 11511 Scheichl, R}, 11512 journal = {NuMa-Report}, 11513 volume = {7}, 11514 pages = {2007}, 11515 year = {2011} 11516} 11517 11518@InProceedings{ jolivet2013scalabledd, 11519 title = {Scalable domain decomposition preconditioners for heterogeneous elliptic 11520 problems}, 11521 author = {Jolivet, Pierre and Hecht, Fr{\'e}d{\'e}ric and Nataf, Fr{\'e}d{\'e}ric and 11522 Prud'homme, Christophe}, 11523 booktitle = {Proceedings of SC13: International Conference for High Performance Computing, 11524 Networking, Storage and Analysis}, 11525 pages = {80}, 11526 year = {2013}, 11527 organization = {ACM} 11528} 11529 11530@Book{ ks2000, 11531 author = {D. Kinderlehrer and G. Stampacchia}, 11532 publisher = {Society for Industrial Mathematics}, 11533 title = {An Introduction to Variational Inequalities and Their Applications}, 11534 year = {2000} 11535} 11536 11537@Article{ wan2000energy, 11538 title = {An energy-minimizing interpolation for robust multigrid methods}, 11539 author = {Wan, W.L. and Chan, T.F. and Smith, B. F.}, 11540 journal = {SIAM Journal on Scientific Computing}, 11541 volume = {21}, 11542 number = {4}, 11543 pages = {1632--1649}, 11544 year = {2000}, 11545 publisher = {Philadelphia, PA: SIAM, c1993-} 11546} 11547 11548@Article{ chansmith1994, 11549 title = {Domain decomposition and multigrid algorithms for elliptic problems on 11550 unstructured meshes}, 11551 author = {Chan, T.F. and Smith, B.F.}, 11552 journal = {Electronic Transactions on Numerical Analysis}, 11553 volume = {2}, 11554 pages = {171--182}, 11555 year = {1994} 11556} 11557 11558@TechReport{ proto-fsp, 11559 author = {Venkatramani Balaji and Barry Smith and Brian Van Straalen and Priya Vashishta 11560 and Michael Zarnstorff and Michael Zika}, 11561 title = {Report of the {Proto-FSP} {Assessment Panel for the FSP}}, 11562 institution = {Princeton Plasma Physics Laboratory}, 11563 year = {2010}, 11564 url = {http://www.pppl.gov/fsp/documents/Proto-FSPAssessmentReport.pdf} 11565} 11566 11567@Article{ hirvijoki2021, 11568 title = {Structure-preserving marker-particle discretizations of {Coulomb} collisions for 11569 particle-in-cell codes}, 11570 journal = {Plasma Phys. Control. Fusion}, 11571 author = {Eero Hirvijoki}, 11572 note = {in press}, 11573 doi = {10.1088/1361-6587/abe884}, 11574 year = {2021} 11575} 11576 11577@Article{ ipsen2001, 11578 author = {Ilse C. F. Ipsen}, 11579 journal = {SIAM J. Sci. Comput.}, 11580 pages = {1050--1051}, 11581 volume = {23}, 11582 publisher = {SIAM}, 11583 title = {A Note on Preconditioning Nonsymmetric Matrices}, 11584 year = {2001} 11585} 11586 11587% Random papers on solvers for GPUs 11588@InProceedings{ gpus-suck, 11589 author = {Vuduc, R. and Chandramowlishwaran, A. and Choi, J. and Guney M. }, 11590 title = { On the Limits of {GPU} Acceleration}, 11591 booktitle = {HOTPAR: Proceedings of the 2nd USENIX Workshop on Hot Topics in Parallelism}, 11592 year = {2010}, 11593 publisher = {USENIX} 11594} 11595 11596@InProceedings{ 882364, 11597 author = {Bolz, Jeff and Farmer, Ian and Grinspun, Eitan and Schr\"{o}oder, Peter}, 11598 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 11599 booktitle = {SIGGRAPH '03: ACM SIGGRAPH 2003 Papers}, 11600 year = {2003}, 11601 isbn = {1-58113-709-5}, 11602 pages = {917--924}, 11603 location = {San Diego, California}, 11604 doi = {10.1145/1201775.882364}, 11605 publisher = {ACM}, 11606 address = {New York, NY} 11607} 11608 11609@Conference{ feng2008multigrid, 11610 author = {Feng, Z. and Li, P.}, 11611 booktitle = {IEEE/ACM International Conference on Computer-Aided Design, 2008. ICCAD 2008}, 11612 date-added = {2010-08-19 15:57:06 -0500}, 11613 date-modified = {2010-08-19 15:57:06 -0500}, 11614 pages = {647--654}, 11615 title = {Multigrid on {GPU}: Tackling power grid analysis on parallel SIMT platforms}, 11616 year = {2008} 11617} 11618 11619@Conference{ goodnight2003multigrid, 11620 author = {Goodnight, N. and Woolley, C. and Lewin, G. and Luebke, D. and Humphreys, G.}, 11621 booktitle = {Proceedings of the ACM SIGGRAPH/EUROGRAPHICS conference on Graphics hardware}, 11622 date-added = {2010-08-19 15:45:20 -0500}, 11623 date-modified = {2010-08-19 15:45:20 -0500}, 11624 organization = {Eurographics Association}, 11625 pages = {102--111}, 11626 title = {A multigrid solver for boundary value problems using programmable graphics 11627 hardware}, 11628 year = {2003} 11629} 11630 11631@Article{ buatois2007concurrent, 11632 author = {Buatois, L. and Caumon, G. and L{\'e}vy, B.}, 11633 date-added = {2010-08-19 15:45:02 -0500}, 11634 date-modified = {2010-08-19 15:45:02 -0500}, 11635 journal = {High Performance Computing and Communications}, 11636 pages = {358--371}, 11637 publisher = {Citeseer}, 11638 title = {Concurrent number cruncher: {A}n efficient sparse linear solver on the {GPU}}, 11639 year = {2007} 11640} 11641 11642@Article{ joldes2010real, 11643 author = {Joldes, G.R. and Wittek, A. and Miller, K.}, 11644 date-added = {2010-08-19 15:44:41 -0500}, 11645 date-modified = {2010-08-19 15:44:41 -0500}, 11646 journal = {Computer Methods in Applied Mechanics and Engineering}, 11647 publisher = {Elsevier}, 11648 title = {Real-time nonlinear finite element computations on {GPU}-application to 11649 neurosurgical simulation}, 11650 year = {2010} 11651} 11652 11653@Misc{ aharon2005gpu, 11654 author = {Aharon, S.}, 11655 date-added = {2010-08-19 15:44:32 -0500}, 11656 date-modified = {2010-08-19 15:44:32 -0500}, 11657 month = apr, 11658 note = {US Patent App. 11/115,642}, 11659 publisher = {Google Patents}, 11660 title = {{GPU}-based Finite Element}, 11661 year = {2005} 11662} 11663 11664@Article{ cevahir2009fast, 11665 author = {Cevahir, A. and Nukada, A. and Matsuoka, S.}, 11666 date-added = {2010-08-19 15:44:01 -0500}, 11667 date-modified = {2010-08-19 15:44:01 -0500}, 11668 journal = {Computational Science--ICCS 2009}, 11669 pages = {893--903}, 11670 publisher = {Springer}, 11671 title = {Fast conjugate gradients with multiple {GPU}s}, 11672 year = {2009} 11673} 11674 11675@Article{ maier1995symmetric, 11676 author = {Maier, G. and Miccoli, S. and Perego, U. and Novati, G.}, 11677 date-added = {2010-08-19 15:43:57 -0500}, 11678 date-modified = {2010-08-19 15:43:57 -0500}, 11679 journal = {Computational Mechanics}, 11680 number = {1}, 11681 pages = {115--129}, 11682 publisher = {Springer}, 11683 title = {Symmetric {G}alerkin boundary element method in plasticity and gradient 11684 plasticity}, 11685 volume = {17}, 11686 year = {1995} 11687} 11688 11689@Article{ corrigan-running, 11690 author = {Corrigan, A. and Camelli, F. and L{\\"o}hner, R. and Wallin, J.}, 11691 date-added = {2010-08-19 15:43:47 -0500}, 11692 date-modified = {2010-08-19 15:43:47 -0500}, 11693 journal = {International Journal for Numerical Methods in Fluids}, 11694 publisher = {John Wiley \& Sons}, 11695 title = {Running unstructured grid based CFD solvers on modern graphics hardware} 11696} 11697 11698@InProceedings{ volkov08, 11699 author = {Vasily Volkov and James W. Demmel}, 11700 title = {Benchmarking GPUs to tune dense linear algebra}, 11701 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing (SC08)}, 11702 note = {\url{http://mc.stanford.edu/cgi-bin/images/6/65/SC08_Volkov_GPU.pdf}}, 11703 year = {2008} 11704} 11705 11706@TechReport{ cray-mvmult, 11707 author = {Guy~E. Blelloch and Michael~A. Heroux and Marco Zagha}, 11708 title = {Segmented Operations for Sparse Matrix Computation on Vector Multiprocessors}, 11709 institution = {School of Computer Science, Carnegie Mellon University}, 11710 number = {CMU-CS-93-173}, 11711 month = aug, 11712 year = {1993} 11713} 11714 11715@Conference{ bell2009implementing, 11716 author = {Bell, N. and Garland, M.}, 11717 booktitle = {Proceedings of the Conference on High Performance Computing Networking, Storage 11718 and Analysis}, 11719 date-added = {2010-08-19 15:43:42 -0500}, 11720 date-modified = {2010-08-19 15:43:42 -0500}, 11721 organization = {ACM}, 11722 pages = {1--11}, 11723 title = {Implementing sparse matrix-vector multiplication on throughput-oriented 11724 processors}, 11725 year = {2009} 11726} 11727 11728@Article{ bell2008efficient, 11729 author = {Bell, N. and Garland, M.}, 11730 date-added = {2010-08-19 15:43:36 -0500}, 11731 date-modified = {2010-08-19 15:43:36 -0500}, 11732 journal = {{NVIDIA} Corporation, {NVIDIA} Technical Report NVR-2008-004}, 11733 title = {Efficient sparse matrix-vector multiplication on {CUDA}}, 11734 year = {2008} 11735} 11736 11737@Article{ cohen-fast, 11738 author = {Cohen, J. and Molemaker, M.J.}, 11739 date-added = {2010-08-19 15:43:34 -0500}, 11740 date-modified = {2010-08-19 15:43:34 -0500}, 11741 journal = {Parallel Computational Fluid Dynamics: Recent Advances and Future Directions}, 11742 pages = {414}, 11743 publisher = {DEStech Publications}, 11744 title = {A fast double precision CFD code using CUDA} 11745} 11746 11747@Article{ kazhdan2008streaming, 11748 author = {Kazhdan, M. and Hoppe, H.}, 11749 date-added = {2010-08-19 15:43:32 -0500}, 11750 date-modified = {2010-08-19 15:43:32 -0500}, 11751 journal = {ACM Transactions on Graphics (TOG)}, 11752 number = {3}, 11753 pages = {21}, 11754 publisher = {ACM}, 11755 title = {Streaming multigrid for gradient-domain operations on large images}, 11756 volume = {27}, 11757 year = {2008} 11758} 11759 11760@Article{ bonnet1998symmetric, 11761 author = {Bonnet, M. and Maier, G. and Polizzotto, C.}, 11762 date-added = {2010-08-19 15:43:18 -0500}, 11763 date-modified = {2010-08-19 15:43:18 -0500}, 11764 journal = {Appl. Mech. Rev}, 11765 pages = {669--704}, 11766 title = {Symmetric {G}alerkin boundary element method.}, 11767 volume = {51}, 11768 year = {1998} 11769} 11770 11771@Conference{ zamith2007gpu, 11772 author = {Zamith, M. and Clua, E. and Pagliosa, P. and Conci, A. and Montenegro, A. and 11773 Valente, L.}, 11774 booktitle = {Proceedings of the VI Brazilian Symposium on Computer Games and Digital 11775 Entertainment}, 11776 date-added = {2010-08-19 15:43:14 -0500}, 11777 date-modified = {2010-08-19 15:43:14 -0500}, 11778 pages = {37--43}, 11779 title = {The {GPU} used as a math co-processor in real time applications}, 11780 year = {2007} 11781} 11782 11783@Article{ baskaran2009optimizing, 11784 author = {Baskaran, M.M. and Bordawekar, R.}, 11785 date-added = {2010-08-19 15:42:56 -0500}, 11786 date-modified = {2010-08-19 15:42:56 -0500}, 11787 journal = {IBM Research Report RC24704, IBM}, 11788 title = {Optimizing sparse matrix-vector multiplication on {GPU}s}, 11789 year = {2009} 11790} 11791 11792@Misc{ szeliski2006locally, 11793 author = {Szeliski, R.}, 11794 date-added = {2010-08-19 15:42:45 -0500}, 11795 date-modified = {2010-08-19 15:42:45 -0500}, 11796 month = jul, 11797 note = {US Patent App. 11/459,724}, 11798 publisher = {Google Patents}, 11799 title = {Locally adapted hierarchical basis preconditioning}, 11800 year = {2006} 11801} 11802 11803@Article{ jung2006cholesky, 11804 author = {Jung, J.H. and O'Leary, D.P.}, 11805 date-added = {2010-08-19 15:42:34 -0500}, 11806 date-modified = {2010-08-19 15:42:34 -0500}, 11807 journal = {Scholarly Paper, University of Maryland}, 11808 publisher = {Citeseer}, 11809 title = {Cholesky decomposition and linear programming on a {GPU}}, 11810 year = {2006} 11811} 11812 11813@Conference{ filipovic2009gpu, 11814 author = {Filipovic, J. and Peterlik, I. and Fousek, J.}, 11815 booktitle = {SAAHPC: Symposium on Application Accelerators in HPC}, 11816 date-added = {2010-08-19 15:42:33 -0500}, 11817 date-modified = {2010-08-19 15:42:33 -0500}, 11818 title = {{GPU} Acceleration of Equations Assembly in Finite Elements Method-Preliminary 11819 Results}, 11820 year = {2009} 11821} 11822 11823@Article{ taylor2009modelling, 11824 author = {Taylor, ZA and Comas, O. and Cheng, M. and Passenger, J. and Hawkes, DJ and 11825 Atkinson, D. and Ourselin, S.}, 11826 date-added = {2010-08-19 15:42:23 -0500}, 11827 date-modified = {2010-08-19 15:42:23 -0500}, 11828 journal = {Medical Image Analysis}, 11829 number = {2}, 11830 pages = {234--244}, 11831 publisher = {Elsevier}, 11832 title = {On modelling of anisotropic viscoelasticity for soft tissue simulation: Numerical 11833 solution and {GPU} execution}, 11834 volume = {13}, 11835 year = {2009} 11836} 11837 11838@Conference{ owens2007survey, 11839 author = {Owens, J.D. and Luebke, D. and Govindaraju, N. and Harris, M. and Kr{\\"u}ger, J. 11840 and Lefohn, A.E. and Purcell, T.J.}, 11841 booktitle = {Computer Graphics Forum}, 11842 date-added = {2010-08-19 15:42:21 -0500}, 11843 date-modified = {2010-08-19 15:42:21 -0500}, 11844 number = {1}, 11845 organization = {John Wiley \& Sons}, 11846 pages = {80--113}, 11847 title = {A survey of general-purpose computation on graphics hardware}, 11848 volume = {26}, 11849 year = {2007} 11850} 11851 11852@Article{ strzodka2005scientific, 11853 author = {Strzodka, R. and Doggett, M. and Kolb, A.}, 11854 date-added = {2010-08-19 15:42:18 -0500}, 11855 date-modified = {2010-08-19 15:42:18 -0500}, 11856 journal = {Simulation Modelling Practice and Theory}, 11857 number = {8}, 11858 pages = {667--680}, 11859 publisher = {Elsevier}, 11860 title = {Scientific computation for simulations on programmable graphics hardware}, 11861 volume = {13}, 11862 year = {2005} 11863} 11864 11865@Conference{ rumpf2001using, 11866 author = {Rumpf, M. and Strzodka, R.}, 11867 booktitle = {Proc. of IASTED Visualization, Imaging and Image Processing Conference 11868 (VIIP-01)}, 11869 date-added = {2010-08-19 15:42:15 -0500}, 11870 date-modified = {2010-08-19 15:42:15 -0500}, 11871 organization = {Citeseer}, 11872 pages = {193--202}, 11873 title = {Using graphics cards for quantized FEM computations}, 11874 year = {2001} 11875} 11876 11877@Article{ sirtori1992galerkin, 11878 author = {Sirtori, S. and Maier, G. and Novati, G. and Miccoli, S.}, 11879 date-added = {2010-08-19 15:42:14 -0500}, 11880 date-modified = {2010-08-19 15:42:14 -0500}, 11881 journal = {International Journal for Numerical Methods in Engineering}, 11882 number = {2}, 11883 pages = {255--282}, 11884 publisher = {John Wiley \& Sons}, 11885 title = {A {G}alerkin symmetric boundary-element method in elasticity: formulation and 11886 implementation}, 11887 volume = {35}, 11888 year = {1992} 11889} 11890 11891@Article{ tejada2005large, 11892 author = {Tejada, E. and Ertl, T.}, 11893 date-added = {2010-08-19 15:42:09 -0500}, 11894 date-modified = {2010-08-19 15:42:09 -0500}, 11895 journal = {Simulation Modelling Practice and Theory}, 11896 number = {8}, 11897 pages = {703--715}, 11898 publisher = {Elsevier}, 11899 title = {Large steps in {GPU}-based deformable bodies simulation}, 11900 volume = {13}, 11901 year = {2005} 11902} 11903 11904@Article{ goddeke2008using, 11905 author = {Goddeke, D. and Strzodka, R. and Mohd-Yusof, J. and McCormick, P. and Wobker, H. 11906 and Becker, C. and Turek, S.}, 11907 date-added = {2010-08-19 15:42:06 -0500}, 11908 date-modified = {2010-08-19 15:42:06 -0500}, 11909 journal = {International Journal of Computational Science and Engineering}, 11910 number = {1}, 11911 pages = {36--55}, 11912 publisher = {Inderscience}, 11913 title = {Using {GPU}s to improve multigrid solver performance on a cluster}, 11914 volume = {4}, 11915 year = {2008} 11916} 11917 11918@Article{ garland2008parallel, 11919 author = {Garland, M. and Le Grand, S. and Nickolls, J. and Anderson, J. and Hardwick, J. 11920 and Morton, S. and Phillips, E. and Zhang, Y. and Volkov, V.}, 11921 date-added = {2010-08-19 15:41:51 -0500}, 11922 date-modified = {2010-08-19 15:41:51 -0500}, 11923 journal = {IEEE Micro}, 11924 number = {4}, 11925 pages = {13--27}, 11926 title = {Parallel computing experiences with CUDA}, 11927 volume = {28}, 11928 year = {2008} 11929} 11930 11931@Article{ wong1985method, 11932 author = {Wong, SH and Ciric, IR}, 11933 date-added = {2010-08-19 15:41:48 -0500}, 11934 date-modified = {2010-08-19 15:41:48 -0500}, 11935 journal = {COMPEL: The International Journal for Computation and Mathematics in Electrical 11936 and Electronic Engineering}, 11937 publisher = {MCB UP Ltd}, 11938 title = {Method of conformal transformation for the finite-element solution of 11939 axisymmetric exterior-field problems}, 11940 volume = {4}, 11941 year = {1985} 11942} 11943 11944@Article{ turek-feast, 11945 author = {Turek, S. and G{\\"o}ddeke, D. and Becker, C. and Buijssen, S.H.M. and Wobker, 11946 H.}, 11947 date-added = {2010-08-19 15:41:47 -0500}, 11948 date-modified = {2010-08-19 15:41:47 -0500}, 11949 journal = {Concurrency and Computation: Practice and Experience}, 11950 publisher = {John Wiley \& Sons}, 11951 title = {FEAST-realization of hardware-oriented numerics for HPC simulations with finite 11952 elements} 11953} 11954 11955@Article{ abedi2006space, 11956 author = {Abedi, R. and Petracovici, B. and Haber, R.B.}, 11957 date-added = {2010-08-19 15:41:46 -0500}, 11958 date-modified = {2010-08-19 15:41:46 -0500}, 11959 journal = {Computer Methods in Applied Mechanics and Engineering}, 11960 number = {25-28}, 11961 pages = {3247--3273}, 11962 publisher = {Elsevier}, 11963 title = {A space-time discontinuous {G}alerkin method for linearized elastodynamics with 11964 element-wise momentum balance}, 11965 volume = {195}, 11966 year = {2006} 11967} 11968 11969@Conference{ georgii2005interactiveb, 11970 author = {Georgii, J. and Westermann, R.}, 11971 booktitle = {Proceedings of VMV}, 11972 date-added = {2010-08-19 15:41:36 -0500}, 11973 date-modified = {2010-08-19 15:41:36 -0500}, 11974 title = {Interactive simulation and rendering of heterogeneous deformable bodies}, 11975 year = {2005} 11976} 11977 11978@Article{ mosegaard2005gpu, 11979 author = {Mosegaard, J. and others}, 11980 date-added = {2010-08-19 15:41:35 -0500}, 11981 date-modified = {2010-08-19 15:41:35 -0500}, 11982 publisher = {IEEE Computer Society}, 11983 title = {{GPU} accelerated surgical simulators for complex morphology}, 11984 year = {2005} 11985} 11986 11987@Article{ meyer2007particle, 11988 author = {Meyer, M. and Nelson, B. and Kirby, R. and Whitaker, R.}, 11989 date-added = {2010-08-19 15:41:33 -0500}, 11990 date-modified = {2010-08-19 15:41:33 -0500}, 11991 journal = {IEEE Transactions on Visualization and Computer Graphics}, 11992 pages = {1015--1026}, 11993 publisher = {Published by the IEEE Computer Society}, 11994 title = {Particle systems for efficient and accurate high-order finite element 11995 visualization}, 11996 year = {2007} 11997} 11998 11999@Conference{ rumpf2001nonlinear, 12000 author = {Rumpf, M. and Strzodka, R.}, 12001 booktitle = {Data Visualization 2001: proceedings of the Joint Eurographics-IEEE TCVG 12002 Symposium on Visualization in Ascona, Switzerland, May 28-30, 2001}, 12003 date-added = {2010-08-19 15:41:29 -0500}, 12004 date-modified = {2010-08-19 15:41:29 -0500}, 12005 organization = {Springer Verlag Wien}, 12006 pages = {75}, 12007 title = {Nonlinear diffusion in graphics hardware}, 12008 year = {2001} 12009} 12010 12011@Article{ georgii2005interactive, 12012 author = {Georgii, J. and Echtler, F. and Westermann, R.}, 12013 date-added = {2010-08-19 15:41:28 -0500}, 12014 date-modified = {2010-08-19 15:41:28 -0500}, 12015 journal = {Simulation and Visualisation}, 12016 pages = {247--258}, 12017 publisher = {Citeseer}, 12018 title = {Interactive simulation of deformable bodies on {GPU}s}, 12019 volume = {2005}, 12020 year = {2005} 12021} 12022 12023@Article{ harish2007accelerating, 12024 author = {Harish, P. and Narayanan, P.}, 12025 date-added = {2010-08-19 15:41:27 -0500}, 12026 date-modified = {2010-08-19 15:41:27 -0500}, 12027 journal = {High Performance Computing--HiPC 2007}, 12028 pages = {197--208}, 12029 publisher = {Springer}, 12030 title = {Accelerating large graph algorithms on the {GPU} using CUDA}, 12031 year = {2007} 12032} 12033 12034@Article{ keunings1995parallel, 12035 author = {Keunings, R.}, 12036 date-added = {2010-08-19 15:41:19 -0500}, 12037 date-modified = {2010-08-19 15:41:19 -0500}, 12038 journal = {Computers and Chemical Engineering}, 12039 number = {6}, 12040 pages = {647--670}, 12041 publisher = {Oxford; New York: Pergamon Press, 1977-}, 12042 title = {Parallel finite element algorithms applied to computational rheology}, 12043 volume = {19}, 12044 year = {1995} 12045} 12046 12047@Conference{ taylor2007real, 12048 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12049 booktitle = {Proceedings of the 10th international conference on Medical image computing and 12050 computer-assisted intervention-Volume Part I}, 12051 date-added = {2010-08-19 15:41:17 -0500}, 12052 date-modified = {2010-08-19 15:41:17 -0500}, 12053 organization = {Springer-Verlag}, 12054 pages = {701--708}, 12055 title = {Real-time nonlinear finite element analysis for surgical simulation using 12056 graphics processing units}, 12057 year = {2007} 12058} 12059 12060@Article{ liu2000finite, 12061 author = {Liu, R. and Li, DY}, 12062 date-added = {2010-08-19 15:41:16 -0500}, 12063 date-modified = {2010-08-19 15:41:16 -0500}, 12064 journal = {Materials Science and Engineering A}, 12065 number = {1-2}, 12066 pages = {169--175}, 12067 publisher = {Elsevier}, 12068 title = {A finite element model study on wear resistance of pseudoelastic {TiNi} alloy}, 12069 volume = {277}, 12070 year = {2000} 12071} 12072 12073@Conference{ kakadiaris1994active, 12074 author = {Kakadiaris, I.A. and Metaxas, D. and Bajcsy, R.}, 12075 booktitle = {IEEE Computer Society Conference on Computer Vision and Pattern Recognition}, 12076 date-added = {2010-08-19 15:41:15 -0500}, 12077 date-modified = {2010-08-19 15:41:15 -0500}, 12078 organization = {Citeseer}, 12079 pages = {980--980}, 12080 title = {Active part-decomposition, shape, and motion estimation of articulated objects: A 12081 physics-based approach}, 12082 year = {1994} 12083} 12084 12085@Conference{ de2004gpu, 12086 author = {De Pascale, M. and De Pascale, G. and Prattichizzo, D. and Barbagli, F.}, 12087 booktitle = {Proceedings of Eurohaptics}, 12088 date-added = {2010-08-19 15:41:14 -0500}, 12089 date-modified = {2010-08-19 15:41:14 -0500}, 12090 organization = {Citeseer}, 12091 pages = {44--51}, 12092 title = {A {GPU}-friendly method for haptic and graphic rendering of deformable objects}, 12093 volume = {2004}, 12094 year = {2004} 12095} 12096 12097@Book{ taflove1995computational, 12098 author = {Taflove, A. and Hagness, S.C.}, 12099 date-added = {2010-08-19 15:41:14 -0500}, 12100 date-modified = {2010-08-19 15:41:14 -0500}, 12101 publisher = {Artech House Norwood, MA}, 12102 title = {Computational electrodynamics}, 12103 year = {1995} 12104} 12105 12106@Conference{ galoppo2005lu, 12107 author = {Galoppo, N. and Govindaraju, N.K. and Henson, M. and Manocha, D.}, 12108 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 12109 date-added = {2010-08-19 15:41:13 -0500}, 12110 date-modified = {2010-08-19 15:41:13 -0500}, 12111 organization = {IEEE Computer Society}, 12112 pages = {3}, 12113 title = {{LU-GPU}: Efficient algorithms for solving dense linear systems on graphics 12114 hardware}, 12115 year = {2005} 12116} 12117 12118@Conference{ ryoo2008optimization, 12119 author = {Ryoo, S. and Rodrigues, C.I. and Baghsorkhi, S.S. and Stone, S.S. and Kirk, D.B. 12120 and Hwu, W.W.}, 12121 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 12122 parallel programming}, 12123 date-added = {2010-08-19 15:41:12 -0500}, 12124 date-modified = {2010-08-19 15:41:12 -0500}, 12125 organization = {ACM}, 12126 pages = {73--82}, 12127 title = {Optimization principles and application performance evaluation of a multithreaded 12128 {GPU} using CUDA}, 12129 year = {2008} 12130} 12131 12132@Conference{ micikevicius20093d, 12133 author = {Micikevicius, P.}, 12134 booktitle = {Proceedings of 2nd Workshop on General Purpose Processing on Graphics Processing 12135 Units}, 12136 date-added = {2010-08-19 15:41:11 -0500}, 12137 date-modified = {2010-08-19 15:41:11 -0500}, 12138 organization = {ACM}, 12139 pages = {79--84}, 12140 title = {3D finite difference computation on {GPU}s using {CUDA}}, 12141 year = {2009} 12142} 12143 12144@Conference{ zhou2004pixel, 12145 author = {Zhou, Y. and Garland, M. and Haber, R.}, 12146 booktitle = {IEEE Visualization, 2004}, 12147 date-added = {2010-08-19 15:41:03 -0500}, 12148 date-modified = {2010-08-19 15:41:03 -0500}, 12149 pages = {425--432}, 12150 title = {Pixel-exact rendering of spacetime finite element solutions}, 12151 year = {2004} 12152} 12153 12154@Article{ komatitsch2009porting, 12155 author = {Komatitsch, D. and Mich{\'e}a, D. and Erlebacher, G.}, 12156 date-added = {2010-08-19 15:41:01 -0500}, 12157 date-modified = {2010-08-19 15:41:01 -0500}, 12158 journal = {Journal of Parallel and Distributed Computing}, 12159 number = {5}, 12160 pages = {451--460}, 12161 publisher = {Elsevier}, 12162 title = {Porting a high-order finite-element earthquake modeling application to NVIDIA 12163 graphics cards using CUDA}, 12164 volume = {69}, 12165 year = {2009} 12166} 12167 12168@Article{ komatitsch1998spectral, 12169 author = {Komatitsch, D. and Vilotte, J.P.}, 12170 date-added = {2010-08-19 15:40:59 -0500}, 12171 date-modified = {2010-08-19 15:40:59 -0500}, 12172 journal = {Bulletin of the Seismological Society of America}, 12173 number = {2}, 12174 pages = {368--392}, 12175 publisher = {[El Cerrito, Calif., etc., Seismological Society of America, etc.]}, 12176 title = {The spectral element method: {A}n efficient tool to simulate the seismic response 12177 of 2D and 3D geological structures}, 12178 volume = {88}, 12179 year = {1998} 12180} 12181 12182@Article{ wu2005improved, 12183 author = {Wu, W. and Heng, P.A.}, 12184 date-added = {2010-08-19 15:40:59 -0500}, 12185 date-modified = {2010-08-19 15:40:59 -0500}, 12186 journal = {The Visual Computer}, 12187 number = {8}, 12188 pages = {707--716}, 12189 publisher = {Springer}, 12190 title = {An improved scheme of an interactive finite element model for 3D soft-tissue 12191 cutting and deformation}, 12192 volume = {21}, 12193 year = {2005} 12194} 12195 12196@Article{ taylor2008high, 12197 author = {Taylor, Z.A. and Cheng, M. and Ourselin, S.}, 12198 date-added = {2010-08-19 15:40:57 -0500}, 12199 date-modified = {2010-08-19 15:40:57 -0500}, 12200 journal = {IEEE transactions on medical imaging}, 12201 number = {5}, 12202 pages = {650}, 12203 title = {High-speed nonlinear finite element analysis for surgical simulation using 12204 graphics processing units.}, 12205 volume = {27}, 12206 year = {2008} 12207} 12208 12209@Conference{ bolz2003sparse, 12210 author = {Bolz, J. and Farmer, I. and Grinspun, E. and Schr{\\"o}oder, P.}, 12211 booktitle = {ACM SIGGRAPH 2003 Papers}, 12212 date-added = {2010-08-19 15:40:55 -0500}, 12213 date-modified = {2010-08-19 15:40:55 -0500}, 12214 organization = {ACM}, 12215 pages = {924}, 12216 title = {Sparse matrix solvers on the {GPU}: conjugate gradients and multigrid}, 12217 year = {2003} 12218} 12219 12220@Article{ wu2004hybrid, 12221 author = {Wu, W. and Heng, P.A.}, 12222 date-added = {2010-08-19 15:40:54 -0500}, 12223 date-modified = {2010-08-19 15:40:54 -0500}, 12224 journal = {Computer Animation and Virtual Worlds}, 12225 number = {3-4}, 12226 pages = {219--227}, 12227 publisher = {John Wiley \& Sons}, 12228 title = {A hybrid condensed finite element model with {GPU} acceleration for interactive 12229 3D soft tissue cutting}, 12230 volume = {15}, 12231 year = {2004} 12232} 12233 12234% ---------------------------------------------------------------------------------------------------------------- 12235@TechReport{ davis97, 12236 author = {T. Davis}, 12237 title = {The {U}niversity of {F}lorida Sparse Matrix Collection}, 12238 institution = {University of Florida}, 12239 year = {1997} 12240} 12241 12242@Article{ davis2011, 12243 author = {Davis, T. A. and Hu, Y.}, 12244 title = {The {U}niversity of {F}lorida sparse matrix collection}, 12245 journal = {ACM Transactions on Mathematical Software}, 12246 volume = {38}, 12247 issue = {1}, 12248 year = {2011}, 12249 pages = {1--25} 12250} 12251 12252@Article{ davis2004algorithm, 12253 title = {Algorithm 832: {UMFPACK} V4.3---An Unsymmetric-Pattern Multifrontal Method}, 12254 author = {Davis, Timothy A}, 12255 journal = {ACM Transactions on Mathematical Software}, 12256 volume = {30}, 12257 number = {2}, 12258 pages = {196--199}, 12259 year = {2004}, 12260 publisher = {ACM} 12261} 12262 12263@TechReport{ streams, 12264 author = {J. D. McCalpin}, 12265 title = {{STREAM}: Sustainable memory bandwidth in high performance computers}, 12266 institution = {University of Virginia}, 12267 url = {http://www.cs.virginia.edu/stream}, 12268 year = {1995} 12269} 12270 12271@Article{ areusken_1988b, 12272 author = {A. Reusken}, 12273 title = {Convergence of the multigrid full approximation scheme for a class of elliptic 12274 mildly nonlinear boundary value problems}, 12275 journal = {Numer. Math.}, 12276 volume = {52}, 12277 year = {1988}, 12278 pages = {251--277} 12279} 12280 12281@Article{ areusken_1988c, 12282 author = {A. Reusken}, 12283 title = {Convergence of the multigrid full approximation scheme including the {V}--cycle}, 12284 journal = {Numer. Math.}, 12285 volume = {53}, 12286 year = {1988}, 12287 pages = {663--686} 12288} 12289 12290@Unpublished{ mgnet, 12291 title = {Multigrid Net; http://www.mgnet.org/}, 12292 author = {Craig Douglas}, 12293 note = {Contains enormous bibliography on multigrid publications}, 12294 year = {2009} 12295} 12296 12297@Unpublished{ copper, 12298 title = {Fourteenth Copper Mountain Conference on Multigrid Methods}, 12299 author = {}, 12300 note = {Held bi-annually}, 12301 year = {2009} 12302} 12303 12304@Book{ wessling1992, 12305 author = {Pieter Wesseling}, 12306 title = {An Introduction to Multigrid Methods}, 12307 year = {2004}, 12308 publisher = {R. T. Edwards} 12309} 12310 12311@Book{ bhm2000, 12312 author = {William L. Briggs and Van Emden Henson and Steve F. McCormick}, 12313 title = {A Multigrid Tutorial}, 12314 year = {2000}, 12315 publisher = {SIAM} 12316} 12317 12318@Book{ trottenberg2001multigrid, 12319 title = {{Multigrid}}, 12320 author = {Trottenberg, U. and Oosterlee, C.W. and Sch{\"u}ller, A.}, 12321 isbn = {012701070X}, 12322 year = {2001}, 12323 publisher = {Academic Press} 12324} 12325 12326@TechReport{ brandt1984, 12327 author = {Achi Brandt}, 12328 title = {Multigrid Techniques: 1984 Guide with Applications for Fluid Dynamics}, 12329 institution = {Gesellschaft fur Mathematik und Dataenverarbeitung}, 12330 number = {GMD-Studien Nr. 85}, 12331 year = {1984} 12332} 12333 12334@Article{ yavneh1998coarse, 12335 title = {Coarse-Grid Correction for Nonelliptic and Singular Perturbation Problems}, 12336 author = {Yavneh, I.}, 12337 journal = {SIAM Journal on Scientific Computing}, 12338 volume = {19}, 12339 number = {5}, 12340 pages = {1682--1699}, 12341 year = {1998}, 12342 publisher = {Society for Industrial and Applied Mathematics} 12343} 12344 12345@Article{ wan2003phase, 12346 title = {A Phase Error Analysis of Multigrid Methods for Hyperbolic Equations}, 12347 author = {Wan, WL and Chan, T.F.}, 12348 journal = {SIAM Journal on Scientific Computing}, 12349 volume = {25}, 12350 pages = {857}, 12351 year = {2003} 12352} 12353 12354@Article{ imex, 12355 author = {Uri M. Ascher and Steven J. Ruuth and Brian T. R. Wetton}, 12356 title = {Implicit-Explicit Methods for Time-Dependent Partial Differential Equations}, 12357 journal = {SIAM Journel on Numerical Analysis}, 12358 volume = {32}, 12359 number = {3}, 12360 pages = {797--823}, 12361 year = {1995} 12362} 12363 12364@Article{ ow1, 12365 author = {T. Washio and C. W. Oosterlee}, 12366 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes with Application to 12367 Recirculating Flow}, 12368 journal = {SIAM Journal on Scientific Computing}, 12369 volume = {21}, 12370 number = {5}, 12371 pages = {1670--1690}, 12372 year = {2000} 12373} 12374 12375@Article{ vm1, 12376 author = {V. A. Mousseau}, 12377 title = {Implicitly Balanced Solution of the Two-Phase Flow Equations Coupled to Nonlinear 12378 Heat Conduction}, 12379 journal = {Journal Of Computational Physics}, 12380 volume = {200}, 12381 pages = {104--132}, 12382 year = {2004} 12383} 12384 12385@Article{ vm2, 12386 author = {V. A. Mousseau}, 12387 title = {A Fully Implicit Hybrid Solution Method for a Two-Phase Thermal-Hydraulic Model}, 12388 journal = {Journal Of Heat Transfer}, 12389 volume = {127}, 12390 pages = {531--539}, 12391 year = {2005} 12392} 12393 12394@Misc{ salome1, 12395 author = {Laurent Dada and Daniel Caruge}, 12396 title = {The {SALOME} Open Source {CAE} Platform Application to Reactor Physics 12397 Simulation}, 12398 year = {2005}, 12399 url = {http://conferences.esa.int/05c26/Seminar-2005-09-28-SALOME.pdf}, 12400 note = {Presentation at an ESA/ESTEC conference} 12401} 12402 12403@InProceedings{ downar1, 12404 author = {D. A. Barber and W. Wang and R. M. Miller and T. J. Downar and H. G. Joe and V. 12405 A. Mousseau and D. E. Ebert}, 12406 title = {Application of a generalized interface module to the coupling of {PARCS} with 12407 both {RELAP5} and {TRAC-M}}, 12408 booktitle = {Proceedings of 1999 annual meeting of the American Nuclear Society}, 12409 year = {1999} 12410} 12411 12412@Article{ lopez1, 12413 author = {A. P. Lopez and J. B. Sandova}, 12414 title = {A methodology for the coupling of {RAMONA-3B} neutron kinetics and {TRAC-BF1} 12415 thermal-hydraulics}, 12416 journal = {Annals of Nuclear Energy}, 12417 volume = {32(6)}, 12418 pages = {621--634}, 12419 year = {2005} 12420} 12421 12422@InProceedings{ og-1996, 12423 author = {C. R. E. de Oliveira and A. J. H. Goddard}, 12424 title = {{EVENT}: A Multidimensional Finite Element-Spherical Harmonics Radiation 12425 Transport Code}, 12426 booktitle = {Proceedings of the OECD International Seminar on 3D Deterministic Radiation 12427 Transport Codes}, 12428 editor = {}, 12429 publisher = {}, 12430 pages = {}, 12431 note = {Paris, France}, 12432 month = dec, 12433 year = {1996} 12434} 12435 12436@Article{ wo-2000, 12437 author = {P. Warner and C. R. E. de Oliveira}, 12438 title = {Verification and Validation of the 3D Finite Element Transport Theory Code 12439 {EVENT} for Shielding Applications}, 12440 journal = {J. Nucl. Sci. and Tech.}, 12441 volume = {Supplement 1}, 12442 pages = {466--470}, 12443 year = {2000} 12444} 12445 12446@Unpublished{ gnep-web, 12447 author = {{U.S. Department of Energy}}, 12448 title = {Global Nuclear Energy Partnership ({GNEP})}, 12449 note = {\url{ http://www.gnep.energy.gov}}, 12450 year = {2007} 12451} 12452 12453@Book{ lewis-miller-1984, 12454 author = {E. E. Lewis and W. F. Miller, Jr.}, 12455 title = {Computational Methods of Neutron Transport}, 12456 address = {}, 12457 publisher = {Wiley}, 12458 year = {1984} 12459} 12460 12461@Article{ couple1, 12462 author = {J. M. Cook and D. Okrent and D. Satkus and R. B. Lazarus and M. B. Wells}, 12463 title = {{AX-1}, A COMPUTING PROGRAM FOR COUPLED NEUTRONICS-HYDRODYNAMICS CALCULATIONS ON 12464 THE {IBM-704}}, 12465 journal = {Nuclear Sci. and Eng.}, 12466 year = {1959}, 12467 pages = {113--115}, 12468 volume = {2(1)} 12469} 12470 12471@InProceedings{ weber1, 12472 author = {D. P. Weber and S. S. Chen and C. Y. Wang and T. Y. C. Wei and S. Jansson}, 12473 title = {Coupled {CFD/CSM} vibration design methodology for generation {IV} long-life fuel 12474 and component design}, 12475 booktitle = {4th International Conference on Supercomputing in Nuclear Applications}, 12476 year = {2000} 12477} 12478 12479@Misc{ gnep:report, 12480 author = {Phillip Finck and David Keyes and Rick Stevens}, 12481 title = {{Report on the {DOE} Joint {NE/SC} Workshop Simulation and Modeling for Advanced 12482 Nuclear Energy Systems}}, 12483 year = {2006} 12484} 12485 12486@Misc{ subsurface-workshop-ref, 12487 author = {D. {Zachman (Chair)}}, 12488 title = {{Computational Subsurface Sciences Workshop}}, 12489 note = {January 9--12, 2007, Bethesda, MD, see \url{http://subsurface2007.labworks.org/}} 12490} 12491 12492@Misc{ fusion:report, 12493 title = {{Report of the Fusion Energy Sciences Advisory Committee Burning Plasma Strategy 12494 Panel}}, 12495 author = {{Fusion Energy Sciences Advisory Committee}}, 12496 year = {2002}, 12497 note = {see \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/Austinfinal.pdf}} 12498} 12499 12500@Misc{ hecrtf:report, 12501 title = {{Report of the High End Computing Revitalization Task Force (HECRTF)}}, 12502 key = {HECRTF}, 12503 year = {2004}, 12504 howpublished = {see \url{http://www.ostp.gov/nstc/html/HECRTF-FINAL_051004.pdf}} 12505} 12506 12507@Misc{ doesc20years, 12508 title = {{Facilities for the Future of Science: A Twenty-Year Outlook}}, 12509 key = {Office of Science, U.S. Department of Energy}, 12510 year = {2003}, 12511 howpublished = {Office of Science, U.S. Department of Energy, see 12512 \url{http://www.sc.doe.gov/Scientific_User_Facilities/History/20-Year-Outlook-screen.pdf}} 12513} 12514 12515@PhDThesis{ karpeev-thesis, 12516 author = {D. A. Karpeyev}, 12517 title = {Geometric Integrators for Hamiltonian PDEs}, 12518 school = {Old Dominion University}, 12519 year = {2002} 12520} 12521 12522@InCollection{ fjp:ima, 12523 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12524 title = {The Scalability of Mesh Improvement Algorithms}, 12525 booktitle = {Algorithms for Parallel Processing}, 12526 publisher = {Springer-Verlag}, 12527 volume = {105}, 12528 series = {The IMA Volumes in Mathematics and Its Applications}, 12529 editor = {Michael T.\ Heath and Abhiram Ranade and Robert S.\ Schreiber}, 12530 year = {1998}, 12531 pages = {185--212} 12532} 12533 12534@InProceedings{ poet, 12535 author = {Rob Armstrong and Alex Cheung}, 12536 title = {{POET} ({P}arallel {O}bject-Oriented {E}nvironment and {T}oolkit) and Frameworks 12537 for Scientific Distributed Computing}, 12538 booktitle = {Proceedings of {HICSS97}}, 12539 year = {1997} 12540} 12541 12542@Misc{ pseware-web-page, 12543 author = {}, 12544 title = {{PSEware} {Web} page}, 12545 note = {\url{http://www.extreme.indiana.edu/pseware}, Indiana University}, 12546 key = {{PSEware} {Web} page} 12547} 12548 12549@Article{ epperly2011high, 12550 title = {High-performance language interoperability for scientific computing through 12551 {B}abel}, 12552 author = {Epperly, Thomas GW and Kumfert, Gary and Dahlgren, Tamara and Ebner, Dietmar and 12553 Leek, Jim and Prantl, Adrian and Kohn, Scott}, 12554 journal = {International Journal of High Performance Computing Applications}, 12555 pages = {1094342011414036}, 12556 year = {2011}, 12557 publisher = {SAGE Publications} 12558} 12559 12560@Misc{ babel-web-page, 12561 author = {Tom Epperly and Tamara Dahlgren and Gary Kumfert}, 12562 title = {{Babel} {Web} page}, 12563 note = {\url{http://www.llnl.gov/CASC/components/babel.html}} 12564} 12565 12566@Misc{ infospheres-web-page, 12567 author = {K.~M. {Chandy et al.}}, 12568 title = {{Infospheres} {W}eb page}, 12569 note = {\url{http://www.infospheres.caltech.edu}}, 12570 key = {{Infospheres} {Web} page} 12571} 12572 12573@Misc{ hammond, 12574 author = {Glenn Hammond}, 12575 title = {{Sandia National Laboratory}, {C}omputations on {R}eactive {F}low, private 12576 communication} 12577} 12578 12579@Misc{ ornl, 12580 author = {Oak Ridge National Laboratory}, 12581 title = {Private communication via petsc-maint email support} 12582} 12583 12584@Unpublished{ cumulvs-web-page, 12585 author = {}, 12586 title = {{Cumulvs} {W}eb page}, 12587 note = {http://www.epm.ornl.gov/cs/cumulvs.html}, 12588 key = {{Cumulvs} {W}eb page} 12589} 12590 12591@Article{ nonlineargmres, 12592 author = {T. Washio and C. W. Oosterlee}, 12593 title = {Krylov Subspace Acceleration for Nonlinear Multigrid Schemes}, 12594 journal = {ETNA}, 12595 year = {1997}, 12596 pages = {271--290}, 12597 volume = {6} 12598} 12599 12600@Article{ pcice, 12601 author = {Richard C. Martineau and Ray A. Berry}, 12602 title = {The pressure-corrected ICE finite element method for compressible flows on 12603 unstructured meshes}, 12604 journal = {Journal of Computational Physics}, 12605 year = {2004}, 12606 pages = {659--685}, 12607 volume = {198(2)} 12608} 12609 12610@Article{ cumulvs97, 12611 author = {G. A. Geist and J. A. Kohl and P. M. Papadopoulos}, 12612 title = {{CUMULVS}: Providing Fault-Tolerance, Visualization, and Steering of Parallel 12613 Applications}, 12614 journal = {International Journal of Supercomputing Applications}, 12615 year = {1997} 12616} 12617 12618@TechReport{ daly2012interagency, 12619 author = {John Daly and Bill Harrod and Thuc Hoang and Lucy Nowell and Bob Adolf and 12620 Shekhar Borkar and Nathan DeBardeleben and Mootaz Elnozahy and Mike Heroux and 12621 David Rogers and Rob Ross and Vivek Sarkar and Martin Schulz and Marc Snir and 12622 Paul Woodward}, 12623 title = {Inter-Agency Workshop on HPC Resilience at Extreme Scale}, 12624 year = {2012}, 12625 publisher = {US Department of Defense} 12626} 12627 12628@Article{ karpeev1, 12629 author = {A. L. Islas and D. A. Karpeev and C. M. Schober}, 12630 title = {Geometric Integrators for the Nonlinear Schr\"odinger Equation}, 12631 journal = {J. Comp. Phys.}, 12632 year = {2001}, 12633 pages = {116--148}, 12634 volume = {173} 12635} 12636 12637@InProceedings{ scirun97, 12638 author = {S. G. Parker and D. W. Weinstein and C. R. Johnson}, 12639 title = {The {SCIRun} Computational Steering System}, 12640 booktitle = {Modern Software Tools in Scientific Computing}, 12641 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 12642 publisher = {Birkhauser Press}, 12643 year = {1997} 12644} 12645 12646@TechReport{ szyld, 12647 author = {Valeria Simoncini and Daniel B. Szyld}, 12648 title = { Theory of Inexact Krylov Subspace Methods and Applications to Scientific 12649 Computing}, 12650 year = {2002}, 12651 institution = {Department of Mathematics, Temple University}, 12652 number = {02-4-12} 12653} 12654 12655@TechReport{ pdelab, 12656 author = {S. Weerawarana and E. N. Houstis and J. R. Rice and A. C. Catlin and C. Crabill 12657 and C. C. Chui and S. Markus}, 12658 title = {{PDELab}: An Object-Oriented Framework for Building Problem Solving Environments 12659 for {PDE} Based Applications}, 12660 year = {1994}, 12661 institution = {Department of Computer Sciences, Purdue University}, 12662 number = {CSD-TR-94-021} 12663} 12664 12665@Unpublished{ ilu-web-page, 12666 author = {Bill Janssen and Mike Spreitzer and Dan Larner and Chris Jacobi}, 12667 title = {{I}nter-{L}anguage {U}nification Reference Manual}, 12668 note = {ftp://ftp.parc.xerox.com/ilu/ilu.html, Xerox Corporation} 12669} 12670 12671@Unpublished{ doe2k-web-page, 12672 title = {{DOE2000 Initiative} {W}eb page}, 12673 note = {http://www.mcs.anl.gov/DOE2000}, 12674 key = {DOE2000 Initiative} 12675} 12676 12677@Misc{ pvode-web-page, 12678 title = {{PVODE} {W}eb Page}, 12679 note = {\url{http://www.llnl.gov/CASC/PVODE}, Lawrence Livermore National Laboratory}, 12680 author = {A. {Hindmarsh et al.}} 12681} 12682 12683@Book{ szyperski97, 12684 author = {Clemens Szyperski}, 12685 title = {Component Software: Beyond Object-Oriented Programming}, 12686 publisher = {ACM Press}, 12687 address = {New York}, 12688 year = {1997} 12689} 12690 12691@Unpublished{ petsc:coloringuse, 12692 title = {Code for computing sparse {J}acobians}, 12693 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12694 institution = {Argonne National Laboratory} 12695} 12696 12697@Unpublished{ petsc:external, 12698 author = {B. F. {Smith et al.}}, 12699 title = {{External Software Used by PETSc}}, 12700 note = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/external.html}}, 12701 institution = {Argonne National Laboratory} 12702} 12703 12704@Unpublished{ petsc:use-by-external-packages, 12705 author = {B. F. {Smith et al.}}, 12706 title = {{Software Packages that Use or Interface to PETSc}}, 12707 note = {\url{http://www.mcs.anl.gov/petsc/publications/petscapps.html#packages}}, 12708 institution = {Argonne National Laboratory} 12709} 12710 12711@Unpublished{ petsc:prizes, 12712 author = {B. F. {Smith et al.}}, 12713 title = {{Prizes Won Using PETSc}}, 12714 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12715 institution = {Argonne National Laboratory} 12716} 12717 12718@Unpublished{ petsc:csgf, 12719 author = {B. F. {Smith et al.}}, 12720 title = {{DOE Computational Science Graduate Fellowship (CSGF) Users of PETSc}}, 12721 note = {\url{http://www.mcs.anl.gov/petsc/publications/prizes.html}}, 12722 institution = {Argonne National Laboratory} 12723} 12724 12725@Unpublished{ flash-web-page, 12726 title = {{U}niversity of {C}hicago {C}enter on {A}strophysical {T}hermonuclear {F}lashes 12727 {W}eb Page}, 12728 note = {http://www.asci.uchicago.edu}, 12729 author = {R. {Rosner et al.}}, 12730 institution = {University of Chicago} 12731} 12732 12733@Unpublished{ esi-web-page, 12734 title = {{E}quation {S}olver {I}nterface {F}orum {W}eb Page}, 12735 note = {http://z.ca.sandia.gov/esi}, 12736 author = {R. {Clay et al.}} 12737} 12738 12739@Unpublished{ infobus-web-page, 12740 title = {{I}nfo{B}us {W}eb Page}, 12741 note = {http://www.java.sun.com/beans/infobus}, 12742 key = {infobus} 12743} 12744 12745@Unpublished{ xray-web-page, 12746 title = {{S}upercomputer {S}olution of {M}assive {C}rystallographic and {M}icrotomographic 12747 {S}tructural {P}roblems {W}eb Page ({DOE} Grand Challenge Project)}, 12748 note = {http://www.mcs.anl.gov/xray/}, 12749 institution = {Argonne National Laboratory} 12750} 12751 12752@InProceedings{ kohn98, 12753 author = {Andrew Cleary and Scott Kohn and Steven Smith and Brent Smolinski}, 12754 title = {Language Interoperability Mechanisms for High-Performance Scientific 12755 Applications}, 12756 publisher = {SIAM}, 12757 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12758 Scientific and Engineering Computing}, 12759 year = {1999}, 12760 pages = {30-39} 12761} 12762 12763@InProceedings{ kohn01, 12764 author = {Scott Kohn and Gary Kumfert and Jeff Painter and Cal Ribbens}, 12765 title = {Divorcing Language Dependencies from a Scientific Software Library}, 12766 publisher = {SIAM}, 12767 booktitle = {Proceedings of the Tenth SIAM Conference on Parallel Processing}, 12768 year = {2001} 12769} 12770 12771@InProceedings{ freitag_jones_plassmann98, 12772 author = {Lori Freitag and Mark Jones and Paul Plassmann}, 12773 title = {Component Integration for Unstructured Mesh Algorithms and Software}, 12774 publisher = {SIAM}, 12775 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 12776 Scientific and Engineering Computing}, 12777 year = {1999}, 12778 pages = {215-224} 12779} 12780 12781@Book{ templates, 12782 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 12783 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. Van der Vorst }, 12784 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 12785 Methods}, 12786 publisher = {SIAM}, 12787 year = {1994}, 12788 address = {Philadelphia, PA} 12789} 12790 12791@InProceedings{ parasha2, 12792 author = {M. Parashar and J. C. Browne and C. Edwards and K. Klimkowski}, 12793 title = { A Common Data Management Infrastructure for Parallel Adaptive Algorithms for 12794 {PDE} Solutions}, 12795 booktitle = {SC97 Proceedings}, 12796 publisher = {IEEE Computer Society Press}, 12797 year = {1997} 12798} 12799 12800@TechReport{ parasha, 12801 author = {M. Parashar and J. C. Browne}, 12802 title = {{DAGH}: A Data-Management Infrastructure for Parallel Adaptive Mesh Refinement 12803 Techniques}, 12804 institution = {Department of Computer Science, University of Texas at Austin}, 12805 year = {1995} 12806} 12807 12808@Article{ parti, 12809 author = {R. Das and M. Uysal and J. Saltz and Y. S. Hwang}, 12810 title = {Communication Optimizations for Irregular Scientific Computations on Distributed 12811 Memory Architectures}, 12812 journal = {Journal of Parallel and Distributed Computing}, 12813 year = {1994}, 12814 volume = {22}, 12815 pages = {462--478} 12816} 12817 12818@Article{ mparti, 12819 author = {G. Agrawal and A. Sussman and J. Saltz}, 12820 title = {An Integrated Runtime and Compile-time Approach for Parallelizing Structured and 12821 Block Structured Applications}, 12822 journal = {IEEE Trans. on Parallel and Distributed Systems}, 12823 volume = {6}, 12824 number = {7}, 12825 year = {1995} 12826} 12827 12828@Article{ gropp-lusk-doss-skjellum, 12829 author = { William Gropp and Ewing Lusk and Nathan Doss and Anthony Skjellum}, 12830 title = {A high-performance, portable implementation of the {MPI} Message Passing 12831 Interface standard}, 12832 journal = {Parallel Computing}, 12833 year = {1996}, 12834 volume = {22}, 12835 pages = {789--828} 12836} 12837 12838@InProceedings{ lam, 12839 author = {Greg Burns and Raja Daoud and James Vaigl}, 12840 title = {{LAM}: An Open Cluster Environment for {MPI}}, 12841 booktitle = {Proceedings of Supercomputing Symposium '94}, 12842 editor = {John W. Ross}, 12843 publisher = {University of Toronto}, 12844 pages = {379--386}, 12845 year = {1994} 12846} 12847 12848@Article{ cs99, 12849 author = {X.-C. Cai and M. Sarkis}, 12850 title = {A restricted additive {S}chwarz preconditioner for general sparse linear 12851 systems}, 12852 journal = {SIAM J. Scientific Computing}, 12853 year = {1999}, 12854 volume = {21}, 12855 pages = {792-797} 12856} 12857 12858@Article{ cai2003restricted, 12859 title = {Restricted additive {S}chwarz preconditioners with harmonic overlap for symmetric 12860 positive definite linear systems}, 12861 author = {Cai, X.C. and Dryja, M. and Sarkis, M.}, 12862 journal = {SIAM Journal on Numerical Analysis}, 12863 volume = {41}, 12864 issue = {1}, 12865 pages = {1209--1231}, 12866 year = {2003}, 12867 doi = {10.1137/S0036142901389621} 12868} 12869 12870@TechReport{ caisaad, 12871 author = {Xiao-Chuan Cai and Youcef Saad}, 12872 title = {Overlapping domain decomposition algorithms for general sparse matrices}, 12873 institution = {Army High Performance Computing Research Center, University of Minnesota }, 12874 year = {1993}, 12875 number = {Preprint 93-027 }, 12876 note = {SIAM J. Sci. Comp. (submitted)} 12877} 12878 12879@Book{ ruminations, 12880 author = {Andrew Koenig and Barbara Moo}, 12881 title = {Ruminations on C++}, 12882 year = {1996}, 12883 publisher = {Addison-Wesley} 12884} 12885 12886@Book{ mpi-complete, 12887 author = {Marc Snir and Steve Otto and Steven Huss-Lederman and David Walker and Jack 12888 Dongarra}, 12889 title = {{MPI}: The Complete Reference}, 12890 year = {1995}, 12891 publisher = {MIT Press} 12892} 12893 12894@Unpublished{ tcl-tk-web-page, 12895 title = {{Tcl/Tk} {W}orld {W}ide {W}eb page}, 12896 note = {http://www.sunlabs.com/research/tcl/}, 12897 year = {1996}, 12898 month = aug 12899} 12900 12901@Misc{ mpich-web-page, 12902 author = {William Gropp and {et. al.}}, 12903 title = {{MPICH} {W}eb page}, 12904 key = {MPICH}, 12905 url = {http://www.mpich.org}, 12906 howpublished = {\url{http://www.mpich.org}} 12907} 12908 12909@Article{ mpi-final, 12910 author = {MPI Forum}, 12911 title = {{MPI}: A Message-Passing Interface Standard}, 12912 journal = {International J. Supercomputing Applications}, 12913 volume = {8}, 12914 number = {3/4}, 12915 year = {1994}, 12916 key = {MPI Standard - final} 12917} 12918 12919@Unpublished{ npb-web-page, 12920 key = {NAS Parallel Benchmarks}, 12921 title = {{NAS} {P}arallel {B}enchmarks {W}eb page}, 12922 note = {http://www.nas.nasa.\-gov/\-NAS/\-NPB/\-index.html}, 12923 year = {1996}, 12924 month = dec 12925} 12926 12927@Book{ george81, 12928 title = {Computer Solution of Large Sparse Positive Definite Systems}, 12929 author = {Alan George and Joseph W. Liu}, 12930 publisher = {Prentice-Hall}, 12931 year = {1981}, 12932 key = {SparseDirect} 12933} 12934 12935@Book{ p4-book, 12936 title = {Portable Programs for Parallel Processors}, 12937 publisher = {Holt, Rinehart, {and} Winston}, 12938 year = {1987}, 12939 author = {James Boyle and Ralph Butler and Terrence Disz and Barnett Glickfeld and Ewing 12940 Lusk and Ross Overbeek and James Patterson and Rick Stevens}, 12941 key = {P4Book} 12942} 12943 12944@Article{ stones, 12945 author = {H. L. Stone}, 12946 title = {Iterative solution of implicit approximations of multidimensional partial 12947 differential equations}, 12948 journal = {SIAM J. Numerical Analysis}, 12949 pages = {87--113}, 12950 volumne = {5}, 12951 year = {1968} 12952} 12953 12954@Article{ parallelstones, 12955 author = {J. S. Reeve and A. D. Scurr and J. H. Merlin}, 12956 title = {Parallel versions of {S}tones strongly implicit algorithm}, 12957 journal = {Concurrency and Computation: Practice and Experience}, 12958 pages = {1049--1062}, 12959 volumne = {13}, 12960 year = {2001} 12961} 12962 12963@Article{ p4-paper, 12964 author = {Ralph Butler and Ewing Lusk}, 12965 title = {Monitors, Messages, and Clusters: {T}he p4 Parallel Programming System}, 12966 journal = {Journal of Parallel Computing}, 12967 note = {To appear (Also Argonne National Laboratory Mathematics and Computer Science 12968 Division preprint P362-0493)}, 12969 year = {1993} 12970} 12971 12972@TechReport{ picl, 12973 author = {G.~A.~Geist and Michael~T.~Heath and B.~W.~Peyton and Patrick~H.~Worley}, 12974 title = {{PICL}: A portable instrumented communications library}, 12975 institution = {Oak Ridge National Laboratory}, 12976 number = {TM-11130}, 12977 year = {1990}, 12978 key = {PICL} 12979} 12980 12981@TechReport{ upshot, 12982 author = {Virginia Herrarte and Ewing Lusk}, 12983 title = {Studying Parallel Program Behavior with {U}pshot}, 12984 institution = {Argonne National Laboratory}, 12985 number = {ANL-91/15}, 12986 month = aug, 12987 year = {1991}, 12988 key = {Upshot} 12989} 12990 12991@TechReport{ p4-manual, 12992 author = {Ralph Butler and Ewing Lusk}, 12993 title = {User's Guide to the p4 Parallel Programming System}, 12994 institution = {Argonne National Laboratory}, 12995 number = {ANL-92/17}, 12996 month = oct, 12997 year = {1992}, 12998 key = {p4-Manual} 12999} 13000 13001@InProceedings{ oldparti, 13002 author = {Gagan Agrawal and Alan Sussman and Joel Saltz}, 13003 title = {Compiler and Runtime Support for Unstructured and Block Structured Problems}, 13004 booktitle = {Proceedings of Supercomputing '93}, 13005 pages = {578--587}, 13006 year = {1993} 13007} 13008 13009@Article{ parti2, 13010 author = {S. S. Mukherjee and S. D. Sharma and M. DF. Hill and J. R. Larus and A. Rogers 13011 and J. Saltz}, 13012 title = {Efficient Support for Irregular Applications on Distributed Memory Machines}, 13013 journal = {ACM SIGPLAN Notices}, 13014 year = {1995}, 13015 pages = {68-79}, 13016 volume = {30}, 13017 number = {8} 13018} 13019 13020@Article{ parti3, 13021 author = {J. Saltz and R. Mirchandaney and K. Crowley}, 13022 title = {Run-Time Parallelization and Scheduling of Loops}, 13023 journal = {IEEE Trans. Computers}, 13024 year = {1991}, 13025 pages = {604-612}, 13026 volume = {40}, 13027 number = {5} 13028} 13029 13030@InProceedings{ disz-lusk:wamtrace, 13031 author = {Terrence Disz and Ewing Lusk}, 13032 title = {A Graphical Tool for Observing the Behavior of Parallel Logic Programs}, 13033 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13034 year = {1987}, 13035 pages = {46--53} 13036} 13037 13038@InProceedings{ gorlick-kesselman:gauge, 13039 author = {Michael Gorlick and Carl Kesselman}, 13040 title = {Timing {Prolog} programs without Clocks}, 13041 booktitle = {Proceedings of the 1987 Symposium on Logic Programming}, 13042 year = {1996}, 13043 publisher = {Birkhauser} 13044} 13045 13046@TechReport{ aztec, 13047 author = {Scott A. Hutchinson and John N. Shadid and Ray S. Tuminaro}, 13048 title = {Aztec User's Guide Version 1.1}, 13049 institution = {Sandia National Laboratories}, 13050 month = oct, 13051 year = {1995}, 13052 number = {SAND95/1559} 13053} 13054 13055@TechReport{ aztec2, 13056 author = {Ray S. Tuminaro and Micheal Heroux and Scott A. Hutchinson and John N. Shadid}, 13057 title = {Official {Aztec} User's Guide Version 2.1}, 13058 institution = {Sandia National Laboratories}, 13059 year = {1999} 13060} 13061 13062@Book{ taylor-chandy:pcn, 13063 author = {Chandy, M. and Taylor, S.}, 13064 title = {An Introduction to Parallel Programming}, 13065 year = {1991}, 13066 publisher = {Jones and Bartlett} 13067} 13068 13069@Book{ foster-taylor:strand, 13070 title = {Strand: New Concepts in Parallel Programming}, 13071 author = {Ian Foster and Stephen Taylor}, 13072 publisher = {Prentice-Hall}, 13073 adress = { Englewood Cliffs, New Jersey}, 13074 year = {1990} 13075} 13076 13077@Article{ aurora, 13078 author = {E. Lusk and R. Butler and T. Disz and R. Olson and R. Overbeek and R. Stevens and 13079 D.H.D. Warren and A. Calderwood and P. Szeredi and S. Haridi and P. Brand and M. 13080 Carlsson and A. Ciepielewski and B. Hausman}, 13081 title = {The Aurora OR-Parallel Prolog System}, 13082 journal = {New Generation Computing}, 13083 volume = {7}, 13084 number = {3}, 13085 year = {1990}, 13086 pages = {243--271} 13087} 13088 13089@TechReport{ roo, 13090 author = {E. Lusk and W. McCune and J. Slaney}, 13091 title = {Roo---a Parallel Theorem Prover}, 13092 institution = {Argonne National Laboratory}, 13093 number = {MCS--TM--149}, 13094 year = {1991} 13095} 13096 13097@TechReport{ heath-etheridge:vppp, 13098 author = {M. T. Heath and J. A. Etheridge}, 13099 title = {Visualizing the Performance of Parallel Programs}, 13100 institution = {Oak Ridge National Laboratory}, 13101 number = {ORNL TM-11813}, 13102 year = {1991} 13103} 13104 13105@TechReport{ chem:vis, 13106 author = {Ewing L. Lusk}, 13107 title = {Performance Visualization for Parallel Programs}, 13108 institution = {Argonne National Laboratory}, 13109 number = {ANL/MCS--P287--0192}, 13110 year = {1991}, 13111 note = {(to appear in {\em Theoretica Chimica Acta})} 13112} 13113 13114@TechReport{ picltrace, 13115 author = {P.~H.~Worley}, 13116 title = {A new {PICL} trace file format}, 13117 institution = {Oak Ridge National Laboratory}, 13118 number = {ORNL TM-12125}, 13119 month = jun, 13120 year = {1992} 13121} 13122 13123@InProceedings{ hideo, 13124 author = {Gary Olsen and Carl Woese and Ray Hagstrom and Hideo Matsuda and Ross Overbeek}, 13125 title = {Inference of Phylogenetic trees using maximum likelihood}, 13126 booktitle = {Proceedings of the First Intel Delta Applications Workshop}, 13127 year = {1992}, 13128 pages = {247--262} 13129} 13130 13131@InProceedings{ dw90, 13132 author = {M. Dryja and O. Widlund}, 13133 title = {Towards a Unified Theory of Domain Decomposition Algorithms for Elliptic 13134 Problems}, 13135 booktitle = {Third International Symposium on Domain Decomposition Methods}, 13136 editor = {T. F. Chan and R. Glowinski and J. P\'eriaux and O. B. Widlund}, 13137 year = {1990}, 13138 pages = {3-21}, 13139 publisher = {SIAM}, 13140 address = {Philadelphia}, 13141 annote = {Additive {S}chwarz. Surveys recent (1989) results; some comments on 3-d and how 13142 many approaches may be cast in the form of additive {S}chwarz-subspace form. 58 13143 references, good introduction to the theory. No computations}, 13144 key = {DryjaWidlund90 !AS} 13145} 13146 13147@Unpublished{ rosing, 13148 author = {Matt Rosing and Joel Saltz}, 13149 title = {Low Latency Messages on Distributed Memory Multiprocessors}, 13150 key = {LowLatency}, 13151 note = {manuscript, 1992} 13152} 13153 13154@TechReport{ jp:incomplete, 13155 author = {Mark T. Jones and Paul E. Plassmann}, 13156 title = {An Improved Incomplete {C}holesky Factorization}, 13157 institution = {Argonne National Laboratory}, 13158 address = {Argonne, IL}, 13159 type = {Preprint}, 13160 note = {(to appear in {\em ACM Trans. on Mathematical Software, 1995})}, 13161 number = {MCS-P206-0191}, 13162 year = {1991}, 13163 key = {jones} 13164} 13165 13166@InCollection{ jp:ima, 13167 author = {Mark Jones and Paul Plassmann}, 13168 title = {The Efficient Parallel Iterative Solution of Large Sparse Linear Systems}, 13169 booktitle = {Graph Theory and Sparse Matrix Computation}, 13170 publisher = {Springer-Verlag}, 13171 series = {The IMA Volumes in Mathematics and Its Applications}, 13172 editor = {Alan George and John Gilbert and Joseph W.H.~Liu}, 13173 volume = {56}, 13174 year = {1993}, 13175 pages = {229--245} 13176} 13177 13178@Article{ pw98, 13179 author = {M. Pernice and H. F. Walker}, 13180 title = {{NITSOL}: A {Newton} Iterative Solver for Nonlinear Systems}, 13181 journal = {SIAM J. Sci. Stat. Comput.}, 13182 year = {1998}, 13183 volume = {19}, 13184 pages = {302--318} 13185} 13186 13187@TechReport{ ysmp83, 13188 key = {Eisenstat}, 13189 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13190 title = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13191 institution = {Department of Computer Science, Yale University}, 13192 number = {YALE/DCS/RR-265}, 13193 month = apr, 13194 year = {1983} 13195} 13196 13197@InBook{ ysmp84, 13198 author = {S.~C.~Eisenstat and H.~C.~Elman and M.~H.~Schultz and A.~H.~Sherman}, 13199 chaptertitle = {The (New) {Y}ale {S}parse {M}atrix {P}ackage}, 13200 title = {Elliptic Problem Solvers II}, 13201 publisher = {Academic Press}, 13202 pages = {45--52}, 13203 editors = {G. Birkhoff and A. Schoenstadt}, 13204 year = {1984} 13205} 13206 13207@TechReport{ sparsekit, 13208 key = {Saad}, 13209 author = {Youcef Saad}, 13210 title = {{SPARSKIT}, a basic tool kit for sparse matrix computations}, 13211 institution = {Center for Supercomputing Research and Development, University of Illinois at 13212 Urbana-Champaign}, 13213 number = {1029}, 13214 year = {1990} 13215} 13216 13217@TechReport{ pde-user-ref, 13218 author = {Barry F. Smith}, 13219 title = {Extensible {PDE} Solvers Package Users Manual}, 13220 institution = {Argonne National Laboratory}, 13221 month = sep, 13222 year = {1994}, 13223 number = {ANL-93/40}, 13224 key = {Smith94 ! PDE} 13225} 13226 13227@TechReport{ bs-user-ref, 13228 author = {Mark T. Jones and Paul E. Plassmann}, 13229 title = {{BlockSolve95} Users Manual: Scalable Library Software for the Parallel Solution 13230 of Sparse Linear Systems}, 13231 institution = {Argonne National Laboratory}, 13232 month = dec, 13233 year = {1995}, 13234 number = {ANL-95/48} 13235} 13236 13237@TechReport{ snes-user-ref, 13238 author = {William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 13239 title = {Using the {S}calable {N}onlinear {E}quations {S}olvers Package}, 13240 institution = {Argonne National Laboratory}, 13241 month = feb, 13242 year = {1995}, 13243 number = {ANL/MCS-TM-193}, 13244 key = {GroppMcInnesSmith95 ! SNES} 13245} 13246 13247@TechReport{ sles-user-ref, 13248 author = {William D. Gropp and Barry F. Smith}, 13249 title = {{S}implified {L}inear {E}quation {S}olvers Users Manual}, 13250 institution = {Argonne National Laboratory}, 13251 month = mar, 13252 year = {1993}, 13253 number = {ANL-93/8}, 13254 key = {GroppSmith93 ! SLES} 13255} 13256 13257@TechReport{ chameleon-user-ref, 13258 author = {William D. Gropp and Barry F. Smith}, 13259 title = {Chameleon Parallel programming tools Users Manual}, 13260 institution = {Argonne National Laboratory}, 13261 month = mar, 13262 year = {1993}, 13263 number = {ANL-93/23}, 13264 key = {GroppSmith93 ! Chameleon} 13265} 13266 13267@Article{ euclid2, 13268 author = {D. Hysom and A. Pothen}, 13269 title = {A Scalable Parallel Algorithm For Incomplete Factor Preconditioning}, 13270 journal = {SIAM J. Sci. Comput.}, 13271 volume = {22}, 13272 number = {6}, 13273 pages = {2194--2215} 13274} 13275 13276@TechReport{ euclid1, 13277 author = {D. Hysom and A. Pothen}, 13278 title = {Euclid User Manual (A Scalable {ILU} Preconditioning Library for the Parallel 13279 Solution of Sparse Linear Systems)}, 13280 institution = {Old Dominion University}, 13281 year = {2001} 13282} 13283 13284@TechReport{ ksp-user-ref, 13285 author = {William D. Gropp and Barry F. Smith}, 13286 title = {Users Manual for {KSP}: Data-Structure-Neutral Codes Implementing {K}rylov Space 13287 Methods}, 13288 institution = {Argonne National Laboratory}, 13289 month = aug, 13290 year = {1993}, 13291 number = {ANL-93/30}, 13292 key = {GroppSmith93 ! KSP} 13293} 13294 13295@TechReport{ mpi-chameleon, 13296 author = {William D. Gropp and Ewing Lusk}, 13297 title = {A Test Implementation of the {MPI} Draft Message-Passing Standard}, 13298 institution = {Argonne National Laboratory}, 13299 month = dec, 13300 year = {1992}, 13301 number = {ANL-92/47}, 13302 key = {GroppLusk92 ! MPI} 13303} 13304 13305@TechReport{ blockcomm-fortran, 13306 author = {William D. Gropp}, 13307 title = {Block{C}omm for {F}ortran}, 13308 institution = {Argonne National Laboratory}, 13309 month = may, 13310 year = {1993}, 13311 number = {ANL-93/00 (to appear)}, 13312 key = {Gropp93 ! BlockComm} 13313} 13314 13315@TechReport{ autodocument, 13316 author = {William D. Gropp}, 13317 title = {Automatic documentation of {C} programs}, 13318 institution = {Argonne National Laboratory}, 13319 month = may, 13320 year = {1993}, 13321 number = {ANL-93/00}, 13322 key = {Gropp93 ! Autodoc} 13323} 13324 13325@TechReport{ zipcode, 13326 author = {Anthony Skjellum and Steven G. Smith and Charles H Still and Alvin P. Leung and 13327 Manfred Morari}, 13328 title = {The {Z}ipcode message-passing system}, 13329 institution = {Lawrence Livermore National Laboratory}, 13330 month = sep, 13331 year = {1992}, 13332 number = {Unpublished}, 13333 key = {Skjellum92 ! Zipcode} 13334} 13335 13336@Article{ paragraph, 13337 author = {Michael T. Heath and Jennifer Etheridge Finger}, 13338 title = {Visualizing performance of parallel programs}, 13339 journal = {IEEE Software}, 13340 volume = {8}, 13341 number = {5}, 13342 month = sep, 13343 year = {1991}, 13344 pages = {29--39}, 13345 key = {Heath91 ! Paragraph} 13346} 13347 13348@Article{ gropp90, 13349 author = {William Gropp and Edward Smith}, 13350 title = {Computational Fluid Dynamics on Parallel Processors}, 13351 journal = {Computers and Fluids}, 13352 volume = {18}, 13353 year = {1990}, 13354 pages = {289--304}, 13355 key = {Gropp90 ! performance} 13356} 13357 13358@Article{ foster92, 13359 author = {Ian Foster and William Gropp and Rick Stevens}, 13360 title = {The parallel scalability of the spectral transform method}, 13361 journal = {Monthly Weather Review}, 13362 volume = {120}, 13363 year = {1992}, 13364 pages = {835--850}, 13365 key = {Foster92 ! performance} 13366} 13367 13368@InBook{ fgn, 13369 author = {R. Freund and G. H. Golub and N. Nachtigal}, 13370 title = {Iterative Solution of Linear Systems}, 13371 series = {Acta Numerica}, 13372 year = {1992}, 13373 publisher = {Cambridge University Press}, 13374 pages = {57--100} 13375} 13376 13377@TechReport{ nachtigal90, 13378 author = {No{\"e}l M. Nachtigal and Satish C. Reddy and Lloyd N. Trefethen}, 13379 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13380 institution = {Massachusetts Institute of Technology}, 13381 month = mar, 13382 year = {1990}, 13383 number = {90-2}, 13384 key = {Nachtigal | Krylov} 13385} 13386 13387@Article{ nachtigal1992fnm, 13388 title = {How Fast are Nonsymmetric Matrix Iterations?}, 13389 author = {Nachtigal, N.M. and Reddy, S.C. and Trefethen, L.N.}, 13390 journal = {SIAM Journal on Matrix Analysis and Applications}, 13391 volume = {13}, 13392 pages = {778}, 13393 year = {1992}, 13394 publisher = {SIAM} 13395} 13396 13397@TechReport{ embree1999descriptive, 13398 title = {How descriptive are {GMRES} convergence bounds}, 13399 author = {Embree, M.}, 13400 year = {1999}, 13401 number = {08}, 13402 institution = {Oxford University Computing Laboratory} 13403} 13404 13405@Article{ vorst92, 13406 author = {H. van der Vorst}, 13407 title = {Bi-{CGSTAB}: A fast and smoothly converging variant of {Bi-CG} for the solution 13408 of nonsymmetric linear systems}, 13409 journal = {SIAM J. Sci. Stat. Comput.}, 13410 year = {1992}, 13411 volume = {13}, 13412 pages = {631--644} 13413} 13414 13415@Article{ eisenstat81, 13416 author = {S. Eisenstat}, 13417 title = {Efficient Implementation of a Class of {CG} Methods}, 13418 journal = {SIAM J. Sci. Stat. Comput.}, 13419 year = {1981}, 13420 volume = {2}, 13421 pages = {1--4} 13422} 13423 13424@Manual{ ibm-essl, 13425 title = {{E}ngineering and {S}cientific {S}ubroutine {L}ibrary Version 2: Guide and 13426 Reference}, 13427 organization = {IBM}, 13428 year = {1992}, 13429 key = {IBM-ESSL} 13430} 13431 13432@Manual{ ibm-eui, 13433 title = {{IBM} {AIX} Parallel Environment Parallel Programming Subroutine Reference 13434 Release 2.0}, 13435 organization = {IBM}, 13436 month = jun, 13437 year = {1994}, 13438 key = {IBM-EUI} 13439} 13440 13441@Manual{ ibm-euih, 13442 title = {Using {EUIH}: An Experimental {EUI} Implementation}, 13443 organization = {IBM}, 13444 author = {Peter Hochschild}, 13445 year = {1993}, 13446 key = {IBM-EUIH} 13447} 13448 13449@TechReport{ mpi, 13450 title = {Document for a Standard Message-Passing Interface}, 13451 author = {Message Passing Interface Forum}, 13452 institution = {University of Tennessee}, 13453 number = {CS-93-214}, 13454 month = nov, 13455 year = {1993}, 13456 key = {MPI Standard} 13457} 13458 13459@Unpublished{ mpi-final-web, 13460 author = {Message Passing Interface Forum}, 13461 title = {{MPI}: A Message-Passing Interface Standard}, 13462 note = {http://www.mcs.anl.gov/mpi/mpi-report/mpi-report.html}, 13463 year = {1994}, 13464 month = may 13465} 13466 13467@Book{ hockney-jesshope, 13468 author = {R. W. Hockney and C. R. Jesshope}, 13469 title = {Parallel Computers 2}, 13470 publisher = {Adam Hilger}, 13471 year = {1988} 13472} 13473 13474@Book{ cm-fortran, 13475 author = {{Thinking Machines Corporation}}, 13476 title = {Users Manual for CM-Fortran}, 13477 publisher = {Thinking Machines Corporation}, 13478 year = {1993} 13479} 13480 13481@TechReport{ chang93, 13482 title = {Experiments and Bounds on Block Diagonal Preconditioning}, 13483 author = {Mark Yan-Ming Chang and Martin H. Schultz}, 13484 institution = {Yale Department of Computer Science}, 13485 number = {YALEU/DCS/RR-994}, 13486 month = nov, 13487 year = {1993}, 13488 key = {BDD|diag} 13489} 13490 13491@InProceedings{ gropplevine93, 13492 author = {N. Galbreath and W. Gropp and D. Levine}, 13493 title = {Applications-Driven Parallel {I/O}}, 13494 booktitle = {Proceedings of Supercomputing '93}, 13495 year = {1993}, 13496 pages = {462--471} 13497} 13498 13499@Book{ siegle85, 13500 author = {H. J. Siegel}, 13501 title = {Interconnection Networks for Large Scale Parallel Processing}, 13502 publisher = {Lexington Books}, 13503 year = {1985}, 13504 key = {Network Comparison} 13505} 13506 13507@Article{ lawrie75, 13508 author = {D. H. Lawrie}, 13509 title = {Access and alignment of data in an array processor}, 13510 journal = {IEEE Transactions on Computers}, 13511 volume = {C-24}, 13512 number = {12}, 13513 month = dec, 13514 year = {1975}, 13515 pages = {1145--1155}, 13516 key = {Omega Network} 13517} 13518 13519@Book{ knuth1986, 13520 title = {The {\TeX}{Book}}, 13521 author = {Donald Ervin Knuth and Duane Bibby}, 13522 volume = {1993}, 13523 year = {1986}, 13524 publisher = {Addison-Wesley Reading, Massachusetts} 13525} 13526 13527@Book{ lamport86, 13528 author = {Leslie Lamport}, 13529 title = {{LaTeX}: A document preparation system}, 13530 publisher = {Addison-Wesley}, 13531 year = {1986}, 13532 key = {Latex Manual} 13533} 13534 13535@InProceedings{ gropp-lusk:unix-tools, 13536 author = {William Gropp and Ewing Lusk}, 13537 title = {Scalable {U}nix Tools on Parallel Processors}, 13538 booktitle = {Proceedings of the 1994 Scalable High Performanc Computing Conference}, 13539 publisher = {IEEE}, 13540 pages = {56--62} 13541} 13542 13543@InProceedings{ jp:bell_prize, 13544 author = {Mark Jones and Paul Plassmann}, 13545 title = {Solution of Large, Sparse Systems of Linear Equations in Massively Parallel 13546 Applications}, 13547 booktitle = {Proceedings of Supercomputing '92}, 13548 publisher = {IEEE Computer Society Press}, 13549 year = {1992}, 13550 pages = {551--560} 13551} 13552 13553@COMMENT{WEB, CWEB references (for doctext)} 13554@TechReport{ web, 13555 author = {Donald E. Knuth}, 13556 title = {The {\tt WEB} system of structured documentation}, 13557 institution = {Computer Science Department, Stanford University}, 13558 year = {1983}, 13559 number = {980}, 13560 month = sep 13561} 13562 13563@Article{ literatepgm, 13564 author = {Donald E. Knuth}, 13565 title = {Literate Programming}, 13566 journal = {Computer Journal}, 13567 year = {1984}, 13568 volume = {27}, 13569 number = {2}, 13570 pages = {91--111} 13571} 13572 13573@Unpublished{ cweb-code, 13574 author = {Silvio Levy and Donald E. Knuth}, 13575 title = {CWEB}, 13576 note = {CWEB is available at ftp://pip.shsu.edu/tex-archive/web/c\_cpp/cweb} 13577} 13578 13579@Article{ jp:scalable, 13580 author = {Mark Jones and Paul Plassmann}, 13581 title = {Scalable Iterative Solution of Sparse Linear Systems}, 13582 journal = {Parallel Computing}, 13583 volume = {20}, 13584 number = {5}, 13585 month = may, 13586 year = {1994}, 13587 pages = {753--773} 13588} 13589 13590@Article{ jp:pcolor, 13591 author = {Mark T. Jones and Paul E. Plassmann}, 13592 title = {A Parallel Graph Coloring Heuristic}, 13593 journal = {SIAM J. Sci. Comput.}, 13594 volume = {14}, 13595 number = {3}, 13596 pages = {654-669}, 13597 year = {1993} 13598} 13599 13600@TechReport{ block_solve, 13601 author = {Mark T. Jones and Paul E. Plassmann}, 13602 title = {{B}lock{S}olve v1.1: Scalable Library Software for the Parallel Solution of 13603 Sparse Linear Systems}, 13604 institution = {Argonne National Laboratory}, 13605 year = {1992}, 13606 number = {ANL-92/46}, 13607 key = {JonesPlassmann92 ! block_solve} 13608} 13609 13610@InProceedings{ supercond, 13611 author = {Lois Curfman Mc{I}nnes and Mario Palumbo}, 13612 title = {Parallel Solution of the Anisotropic {G}inzburg-{L}andau Model}, 13613 booktitle = {Proceedings of the Toward Teraflop Computing and New Grand Challenge Applications 13614 Conference}, 13615 month = feb, 13616 year = {1994}, 13617 key = {McInnesPalumbo94 ! superconductivity } 13618} 13619 13620@Unpublished{ preosti:93, 13621 author = {Gianfranco Preosti}, 13622 title = { }, 13623 note = {Unpublished information, {P}hysics {D}epartment, {P}urdue {U}niversity}, 13624 year = {1993}, 13625 key = {preosti93 ! GL-tilt3d} 13626} 13627 13628@Unpublished{ more:93, 13629 author = {Jorge J. Mor\'{e}}, 13630 title = { }, 13631 note = {Unpublished information, {M}athematics and {C}omputer {S}cience {D}ivision, 13632 {A}rgonne {N}ational {L}aboratory}, 13633 year = {1993}, 13634 key = {more93 ! MINPACK-2} 13635} 13636 13637@Article{ brownsaad:90, 13638 author = {Peter N. Brown and Youcef Saad}, 13639 title = {Hybrid {K}rylov Methods for Nonlinear Systems of Equations}, 13640 journal = {SIAM J. Sci. Stat. Comput.}, 13641 year = {1990}, 13642 volume = {11}, 13643 pages = {450-481} 13644} 13645 13646@Book{ using-mpi, 13647 author = {William Gropp and Ewing Lusk and Anthony Skjellum}, 13648 title = {Using MPI: Portable Parallel Programming with the Message Passing Interface}, 13649 publisher = {MIT Press}, 13650 year = {1994} 13651} 13652 13653@Book{ using-mpi2, 13654 author = {William Gropp and Ewing Lusk and Rajeev Thakur}, 13655 title = {Using MPI 2: Advanced Features of the Message Passing Interface}, 13656 publisher = {MIT Press}, 13657 year = {1999} 13658} 13659 13660@Article{ hs:52, 13661 author = {Magnus R. Hestenes and Eduard Steifel}, 13662 title = {Methods of Conjugate Gradients for Solving Linear Systems}, 13663 journal = {J. Research of the National Bureau of Standards}, 13664 year = {1952}, 13665 volume = {49}, 13666 pages = {409-436} 13667} 13668 13669@Article{ so:89, 13670 author = {Peter Sonneveld}, 13671 title = {{CGS}, A Fast {L}anczos-type Solver for Nonsymmetric Linear Systems}, 13672 journal = {SIAM J. Sci. Stat. Comput.}, 13673 year = {1989}, 13674 volume = {10}, 13675 pages = {36-52} 13676} 13677 13678@Article{ v:92, 13679 author = {{H. A.} {van der Vorst}}, 13680 title = {{B}i{CGSTAB}: A fast and smoothly converging variant of {B}i{CG} for the solution 13681 of nonsymmetric linear systems}, 13682 journal = {SIAM J. Sci. Stat. Comput.}, 13683 volume = {13}, 13684 year = {1992}, 13685 pages = {631-644} 13686} 13687 13688@Article{ f:93, 13689 author = {Roland W. Freund}, 13690 title = {A Transpose-Free Quasi-Minimal Residual Algorithm for Non-{H}ermitian Linear 13691 Systems}, 13692 journal = {SIAM J. Sci. Stat. Comput.}, 13693 volume = {14}, 13694 year = {1993}, 13695 pages = {470-482} 13696} 13697 13698@Article{ ish:89, 13699 author = {S. Ishizuka}, 13700 title = {An Experimental Study on Extinction and Stablity of Tubular Flames}, 13701 journal = {Combustion and Flame}, 13702 volume = {75}, 13703 year = {1989}, 13704 pages = {367-379} 13705} 13706 13707@Book{ williams89, 13708 title = {Combustion Theory, The Fundamental Theory of Chemically Reacting Flow Systems}, 13709 author = {F.A. Williams}, 13710 publisher = {Addison-Wesley}, 13711 year = {1989}, 13712 pages = {367-379} 13713} 13714 13715@Book{ ra75, 13716 author = {R. Aris}, 13717 title = {The Mathematical Theory of Diffusion and Reaction in Permeable Catalysts}, 13718 publisher = {Oxford}, 13719 year = {1975} 13720} 13721 13722@Book{ bebernes89, 13723 author = {J. Bebernes and D. Eberly}, 13724 title = {Mathematical Problems from Combustion Theory}, 13725 publisher = {Springer-Verlag}, 13726 series = {Applied Mathematical Sciences 83}, 13727 year = {1989} 13728} 13729 13730@InProceedings{ kikuchi89, 13731 author = {F. Kikuchi}, 13732 booktitle = { Computing Methods in Applied Sciences and Engineering}, 13733 editor = {R. Glowinski and J. L. Lions}, 13734 publisher = {Springer-Verlag}, 13735 series = {Lecture Notes in Mathematics}, 13736 title = {Finite element approximations to bifurcation problems of turning point type}, 13737 year = {1977} 13738} 13739 13740@Article{ rg85, 13741 author = {R. Glowinski and H.B. Keller and L. Reinhart}, 13742 title = {Continuation-conjugate Gradient Methods fo the Least Squares Solution of 13743 Nonlinear Boundary Problems}, 13744 journal = {SIAM J. Sci. Stat. Comput.}, 13745 volume = {6}, 13746 year = {1985}, 13747 pages = {793-832} 13748} 13749 13750@InProceedings{ whitfield91, 13751 author = {D. Whitfield and L. Taylor}, 13752 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13753 Schemes}, 13754 booktitle = {Proceedings of the AIAA Tenth Computational Fluid Dynamics Conference}, 13755 misc = {AIAA-91-1539}, 13756 pages = {134-145}, 13757 year = {1991} 13758} 13759 13760@InProceedings{ quinlan1, 13761 author = {M. Lemke and D. Quinlan}, 13762 title = {P++, a {C}++ Virtual Shared Grids Based Programming Environment for 13763 Architecture-Independent Development of Structured Grid Applications}, 13764 booktitle = {CONPAR/VAPP V, Lecture Notes in Computer Science}, 13765 publisher = {Springer Verlag}, 13766 year = {1992} 13767} 13768 13769@InProceedings{ quinlan2, 13770 author = {R. Parsons and D. Quinlan}, 13771 title = {A++/{P}++ Array Classes for Architecture Independent Finite Difference 13772 Computations}, 13773 booktitle = {Proceedings of the Second Annual Object-Oriented Numerics Conference}, 13774 year = {1994} 13775} 13776 13777% ***** Overview of functionality in Diffpack 13778@InBook{ dpoverview, 13779 author = {Bruaset, A. M. and Langtangen, H. P.}, 13780 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13781 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations; 13782 {Diffpack}}, 13783 publisher = {Birkh{\"{a}}user}, 13784 pages = {61--90}, 13785 year = {1997} 13786} 13787 13788% ***** Short overview of Diffpack 13789@InCollection{ dpoverview2, 13790 author = {Bruaset, A. M. and Langtangen, H. P.}, 13791 editor = {A. Sydow}, 13792 booktitle = {Proceedings of the 15th IMACS World Congress on Scientific Computation, Modelling 13793 and Applied Mathematics}, 13794 title = {Diffpack: A Software Environment for Rapid Prototyping of {PDE} Solvers}, 13795 pages = {553--558}, 13796 volume = {4}, 13797 year = {1997} 13798} 13799 13800% ***** Comprehensive documentation of Diffpack and 13801% associated numerical methods: 13802@Book{ dpbook, 13803 author = {H. P. Langtangen}, 13804 title = {Numerical Solution of Partial Differential Equations; Models, Algorithms and 13805 Software. Part I}, 13806 series = {Lecture Notes in Computational Science and Engineering}, 13807 publisher = {Springer-Verlag}, 13808 year = {1998} 13809} 13810 13811% ***** Design issues of the linear solvers in Diffpack, serves also as a 13812% collection of examples on O-O in numerical computing 13813@Article{ ambhpl97a, 13814 author = {A. M. Bruaset and H. P. Langtangen }, 13815 title = {Object-Oriented Design of Preconditioned Iterative Methods in {Diffpack}}, 13816 journal = {Transactions on Mathematical Software}, 13817 volume = {23 }, 13818 pages = {50--80}, 13819 year = {1997} 13820} 13821 13822@Misc{ dpurl, 13823 author = {{Diffpack Web page}}, 13824 howpublished = {\url{http://www.diffpack.com}} 13825} 13826 13827% ***** General intro to object-oriented numerics for "FORTRAN programmers" 13828@InCollection{ oonintro, 13829 author = {Arge, E. and Bruaset, A. M. and H. P. Langtangen}, 13830 editor = {D{\ae}hlen, M. and Tveito, A.}, 13831 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13832 title = {Object-Oriented Numerics}, 13833 publisher = {Birkh{\"{a}}user}, 13834 year = {1997} 13835} 13836 13837% ***** Efficiency comparison: BLAS 1, Diffpack, C, 13838% and finite element applications (F77 vs Diffpack) 13839@InCollection{ dpefficiency, 13840 author = {Arge, E. and Bruaset, A. M. and Calvin, P. B. and Kanney, J. F. and Langtangen, 13841 H. P. and Miller, C. T.}, 13842 editor = {D{\ae}hlen, M. and Tveito, A.}, 13843 booktitle = {Mathematical Models and Software Tools in Industrial Mathematics}, 13844 title = {On the Efficiency of {C++} in Scientific Computing}, 13845 publisher = {Birkh{\"{a}}user}, 13846 pages = {91--118}, 13847 year = {1997} 13848} 13849 13850% ***** Parallel concept in Diffpack: 13851@InCollection{ dpparallel, 13852 author = {A.~M.~Bruaset and X. Cai and H. P. Langtangen and A. Tveito}, 13853 editor = {Y. Ishikawa and R. R. Oldehoeft and J. V. W. Reynders and M. Tholburn}, 13854 booktitle = {Scientific Computing in Object-Oriented Parallel Environments}, 13855 title = {Numerical Solution of {PDE}s on Parallel Computers Utilizing Sequential 13856 Simulators}, 13857 publisher = {Springer--Verlag}, 13858 series = {Lecture Notes in Computer Science}, 13859 pages = {161--168}, 13860 year = {1997} 13861} 13862 13863% ***** DD and ML methods in Diffpack: 13864@InCollection{ dpddml, 13865 author = {A.~M.~Bruaset and H. P. Langtangen and G. W. Zumbusch}, 13866 editor = {P. Bj{\o}rstad and M. Espedal and D. Keyes}, 13867 booktitle = {Proceedings of the 9th Conference on Domain Decomposition}, 13868 title = {Domain decomposition and multilevel methods in Diffpack}, 13869 year = {1997} 13870} 13871 13872@InProceedings{ bsca98, 13873 author = {David L. Bruhwiler and Svetlana G. Shasharina and John R. Cary and David 13874 Alexander}, 13875 title = {Design and Implementation of an Object Oriented C++ Library for Nonlinear 13876 Optimization}, 13877 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 13878 Scientific and Engineering Computing}, 13879 editor = {Mike Henderson et al.}, 13880 pages = {165-173}, 13881 year = {1998} 13882} 13883 13884@Book{ scalapack-user-guide, 13885 author = {L. S. Blackford and J. Choi and A. Cleary and E. D'Azevedo and J. Demmel and I. 13886 Dhillon and J. Dongarra and S. Hammarling and G. Henry and A. Petitet and K. 13887 Stanley and D. Walker and R. C. Whaley}, 13888 title = {Sca{LAPACK} Users' Guide}, 13889 publisher = {SIAM}, 13890 address = {Philadelphia, PA}, 13891 year = {1997} 13892} 13893 13894@InProceedings{ keyes99, 13895 author = {D. E. Keyes}, 13896 title = {How Scalable is Domain Decomposition in Practice?}, 13897 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 13898 Methods}, 13899 editor = {C.-H. Lai et al.}, 13900 publisher = {Domain Decomposition Press, Bergen}, 13901 note = {To appear}, 13902 year = {1999} 13903} 13904 13905@Article{ fun3d, 13906 author = {W. K. Anderson and D. L. Bonhaus}, 13907 title = {An implicit upwind algorithm for computing turbulent flows on unstructured 13908 grids}, 13909 journal = {Computers and Fluids}, 13910 year = {1994}, 13911 volume = {23}, 13912 pages = {1--21} 13913} 13914 13915% ------------------------------------------------------------------------- 13916% ------------------------------------------------------------------------- 13917@Article{ torczon, 13918 author = {Dennis, Jr., J. E. and V.~Torczon}, 13919 title = {Direct Search Methods on Parallel Machines}, 13920 journal = {SIAM J. Optimization}, 13921 volume = {1}, 13922 pages = {448--474}, 13923 year = {1991}, 13924 key = {Torczon !PDS} 13925} 13926 13927@InProceedings{ wt91, 13928 author = {D. L. Whitfield and L. K. Taylor}, 13929 title = {Discretized {N}ewton-Relaxation Solution of High Resolution Flux-Difference Split 13930 Schemes}, 13931 booktitle = {Proceedings of the AIAA Tenth Annual Computational Fluid Dynamics Conference}, 13932 misc = {AIAA-91-1539}, 13933 pages = {134-145}, 13934 year = {1991} 13935} 13936 13937@Article{ ew96, 13938 author = {S. C. Eisenstat and H. F. Walker}, 13939 title = {Choosing the forcing terms in an inexact {N}ewton method}, 13940 journal = {SIAM J. Scientific Computing}, 13941 volume = {17}, 13942 year = {1996}, 13943 pages = {16--32} 13944} 13945 13946@Book{ thi93, 13947 author = {{Thinking Machines Corporation}}, 13948 title = {Users Manual for CM-Fortran}, 13949 publisher = {Thinking Machines Corporation}, 13950 year = {1993} 13951} 13952 13953@Book{ mortonmayers94, 13954 author = {K. W. Morton and D. F. Mayers}, 13955 title = {Numerical Solution of Partial Differential Equations}, 13956 publisher = {Press Syndicate of the University of Cambridge}, 13957 year = {1994} 13958} 13959 13960@Book{ heath97, 13961 author = {Michael T. Heath}, 13962 title = {Scientific Computing: An Introductory Survey}, 13963 publisher = {McGraw Hill}, 13964 year = {1997} 13965} 13966 13967@Article{ captools96, 13968 author = {C. S. Ierotheou and S. P Johnson and M. Cross and P. F. Leggett}, 13969 title = {Computer Aided Parallelization Tools ({CAPTools}) - Conceptual Overview and 13970 Performance on the Parallelization of Structured Mesh Codes}, 13971 journal = {Parallel Computing}, 13972 volume = {22}, 13973 pages = {197-226}, 13974 year = {1996} 13975} 13976 13977@Unpublished{ nastran-web-page, 13978 author = {{MSC Software Corporation}}, 13979 title = {{NASTRAN} {W}eb page}, 13980 note = {See {\tt http://www.mechsolutions.com\-/products\-/nastran/}} 13981} 13982 13983@Book{ hpf, 13984 author = {C. H. Koelbel and D. B. Loveman and R. S. Schreiber and G. L. Steele and M. E. 13985 Zosel}, 13986 title = {The High Performance Fotran Handbook}, 13987 publisher = {MIT Press}, 13988 year = {1994} 13989} 13990 13991@InProceedings{ keyes98, 13992 author = {D. E. Keyes}, 13993 title = {Trends in Algorithms for Nonuniform Applications on Hierarchical Distributed 13994 Architectures}, 13995 booktitle = {Proceedings of the Workshop on Computational Aerosciences for the 21st Century}, 13996 editors = {M. D. Salas and W. K. Anderson}, 13997 ppublisher = {Elsevier}, 13998 year = {1998} 13999} 14000 14001@InProceedings{ pooma-atlas, 14002 author = {S. Atlas and S. Banerjee and J. C. Cummings and P. J. Hinker and M. Srikant and 14003 J. V. W. Reynders and M. Tholburn}, 14004 title = {{POOMA}: A High-Performance Distributed Simulation Environment for Scientific 14005 Applications}, 14006 year = {1995}, 14007 month = dec, 14008 booktitle = {Supercomputing '95 Proceedings} 14009} 14010 14011% --------------------------------------------------------------------------------- 14012% New bib entries for CRPC paper 14013@Misc{ mgnet-web-page, 14014 author = {Craig C. Douglas}, 14015 title = {{MGNet Web page}}, 14016 note = {See {\tt http://\-www.mgnet.org}} 14017} 14018 14019@Misc{ dagh-web-page, 14020 author = {M. Parashar and J. C. Browne}, 14021 title = {{DAGH Web page}}, 14022 note = {\url{http://www.caip.rutgers.edu/~parashar/DAGH}} 14023} 14024 14025@Misc{ parasol-web-page, 14026 key = {PARASOL}, 14027 title = {{PARASOL Web page}}, 14028 note = {See {\tt http://\-www.genias.de/\-projects/\-parasol}} 14029} 14030 14031@Misc{ pooma-web-page, 14032 author = {{POOMA Web page}}, 14033 note = {See {\tt http://\-www.acl.lanl.gov/pooma}} 14034} 14035 14036@Misc{ mudpack-web-page, 14037 author = {John C. Adams}, 14038 title = {{MUDPACK Web page}}, 14039 note = {See {\tt http://\-www.scd.ucar.edu/\-css/\-software/\-mudpack}} 14040} 14041 14042@Misc{ pellpack-web-page, 14043 author = {Elias Houstis and John Rice and Apostolos Hadjidimos}, 14044 title = {{Parallel ELLPACK Web page}}, 14045 note = {See {\tt http://\-www.cs.purdue.edu/\-research/\-cse/\-pellpack/}} 14046} 14047 14048@InProceedings{ pellpack95, 14049 author = {E. N. Houstis and S. B. Kim and S. Markus and P. Wu and N. E. Houstis and A.C. 14050 Catlin and S. Weerawarana and T.S. Papatheodorou}, 14051 title = {Parallel {ELLPACK} Elliptic {PDE} Solvers}, 14052 booktitle = {Proceedings of INTEL Supercomputer User's Group Conference}, 14053 address = {Albuquerque, NM}, 14054 year = {1995} 14055} 14056 14057@Misc{ nhse-web-page, 14058 author = {{National High-Performance Software Exchange Web page}}, 14059 note = {See {\tt http://\-www.nhse.org}} 14060} 14061 14062@Misc{ doug-web-page, 14063 author = {Mark J. Hagger and Linda Stals}, 14064 title = {{DOUG Web Page}}, 14065 note = {See {\tt http://\-www.maths.bath.ac.uk/\~{ }parsoft/\-doug/}} 14066} 14067 14068@TechReport{ doug97, 14069 author = {Mark J. Hagger}, 14070 title = {Automatic Domain Decomposition on Unstructured Grids {(DOUG)}}, 14071 institution = {Mathematical Sciences, University of Bath}, 14072 year = {1997}, 14073 number = {9706}, 14074 note = {Advances in Computational Mathematics (to appear)} 14075} 14076 14077@Misc{ ug-web-page, 14078 author = {{UG Web Page}}, 14079 note = {See {\tt http://\-cox.iwr.uni-heidelberg.de/\~{ }ug/}} 14080} 14081 14082@Article{ ug97, 14083 author = {P. Bastian and K. Birken and K. Johannsen and S. Lang and N. Neuss and H. 14084 Rentz-Reichert and C. Wieners}, 14085 title = {{UG} -- A Flexible Software Toolbox for Solving Partial Differential Equations}, 14086 journal = {Computing and Visualization in Science}, 14087 year = {1997}, 14088 volume = {}, 14089 pages = {} 14090} 14091 14092@Misc{ vecfem-web-page, 14093 author = {Lutz Grosz}, 14094 title = {{VECFEM Web Page}}, 14095 note = {See {\tt http://\-wwwmaths.anu.edu.au/\-\~{ }vecfem/}} 14096} 14097 14098@Misc{ atlas-web-page, 14099 author = {R. Clint {Whaley et al.}}, 14100 title = {{ATLAS Web Page}}, 14101 howpublished = {\url{http://math-atlas.sourceforge.net}} 14102} 14103 14104@Misc{ fenics-web-page, 14105 author = {Todd Dupont and Johan Hoffman and Johan Jansson and Claes Johnson and Robert C. 14106 Kirby and Matthew Knepley and Mats Larson and Anders Logg and Ridgway Scott}, 14107 title = {{FEniCS Web Page}}, 14108 note = {\url{http://www.fenicsproject.org}}, 14109 year = {2005} 14110} 14111 14112@Misc{ matlab-web-page, 14113 author = {{The} {MathWorks}}, 14114 title = {{Matlab} {Web} page}, 14115 url = {http://www.mathworks.com} 14116} 14117 14118@Misc{ phipac-web-page, 14119 author = {J. A. Bilmes and K. Asanovic and R. Vudoc and S. Iyer and J. Demmel and C. Chin 14120 and D. Lam}, 14121 title = {{PHiPAC Web Page}}, 14122 note = {See {\tt http://\-www.icsi.berkeley.edu/\-\~{ }bilmes/\-phipac/}} 14123} 14124 14125@InProceedings{ kelp, 14126 author = {Stephan J. Fink and Scott B. Baden and Scott R. Kohn}, 14127 title = {Flexible Communication Mechanisms for Dynamic Structured Applications}, 14128 booktitle = {Irregular '96}, 14129 year = {1996} 14130} 14131 14132@Unpublished{ kelp-web-page, 14133 author = {Scott Baden}, 14134 title = {{KeLP} {W}eb page}, 14135 note = {See {\tt http://\-www-cse.ucsd.edu/\-groups/\-hpcl/\-scg/\-kelp/}} 14136} 14137 14138@InProceedings{ hk99, 14139 author = {R. Hornung and S. Kohn}, 14140 title = {The Use of Object-Oriented Design Patterns in the {SAMRAI} Structured {AMR} 14141 Framework}, 14142 booktitle = {Proceedings of the SIAM Workshop on Object-Oriented Methods for Inter-Operable 14143 Scientific and Engineering Computing}, 14144 pages = {235-244}, 14145 year = {1999}, 14146 note = {See \url{http://www.llnl.gov/CASC/samrai}} 14147} 14148 14149@Unpublished{ samrai-web-page, 14150 title = {{SAMRAI} {W}eb Page}, 14151 author = {Scott Kohn and Xabier Garaiza and Rich Hornung and Steve Smith}, 14152 note = {See {\tt http://www.llnl.gov/\-CASC/SAMRAI}} 14153} 14154 14155@Misc{ overture-web-page, 14156 author = {William Henshaw and Kyle Chand}, 14157 title = {{Overture} {W}eb page}, 14158 howpublished = {\url{http://www.llnl.gov/CASC/Overture}} 14159} 14160 14161@InProceedings{ overture99, 14162 author = {D.L. Brown and W.D. Henshaw and D.J. Quinlan}, 14163 title = {Overture: An Object-Oriented Framework for Solving Partial Differential Equations 14164 on Overlapping Grids}, 14165 publisher = {SIAM}, 14166 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14167 Scientific and Engineering Computing}, 14168 year = {1999}, 14169 pages = {215-224}, 14170 note = {See \url{http://www.llnl.gov/CASC/Overture}} 14171} 14172 14173@InProceedings{ diffpack, 14174 author = {A.M. Bruaset and H.P. Langtangen}, 14175 title = {A Comprehensive Set of Tools for Solving Partial Differential Equations: 14176 {D}iffpack}, 14177 booktitle = {Numerical Methods and Software Tools in Industrial Mathematics}, 14178 year = {1997}, 14179 pages = {61--90}, 14180 publisher = {Birkhauser Press} 14181} 14182 14183@Article{ dongarra:1984:ila, 14184 author = {J. J. Dongarra and F. G. Gustavson and A. Karp}, 14185 title = {Implementing Linear Algebra Algorithms for Dense Matrices on a Vector Pipeline 14186 Machine}, 14187 journal = {SIAM Review}, 14188 volume = {26}, 14189 number = {1}, 14190 pages = {91--112}, 14191 month = jan, 14192 year = {1984}, 14193 coden = {SIREAD}, 14194 issn = {0036-1445 (print), 1095-7200 (electronic)}, 14195 mrclass = {65F10 (65F30)}, 14196 mrnumber = {85c:65032}, 14197 bibdate = {Mon Jan 20 1997}, 14198 abstract = {The authors examine common implementations of linear algebra algorithms, such as 14199 matrix-vector multiplication, matrix-matrix multiplication and the solution of 14200 linear equations. The different versions are examined for efficiency on a computer 14201 architecture which uses vector processing and has pipelined instruction execution. 14202 By using the advanced architectural features of such machines, one can usually 14203 achieve maximum performance, and tremendous improvements in terms of execution 14204 speed can be seen over conventional computers.}, 14205 classification= {723; 921}, 14206 journalabr = {SIAM Rev}, 14207 keywords = {computer programming --- Algorithms; dense matrices; linear algebra algorithms; 14208 mathematical programming; vector pipeline machine} 14209} 14210 14211@Book{ qv99, 14212 author = {Alfio Quarteroni and Alberto Valli}, 14213 title = {Domain Decomposition Methods for Partial Differential Equations}, 14214 publisher = {Oxford Science Publications}, 14215 address = {Oxford}, 14216 year = {1999} 14217} 14218 14219@Book{ ksv97, 14220 editor = {David E. Keyes and Ahmed Sameh and V. Venkatakrishnan}, 14221 title = {Parallel Numerical Algorithms}, 14222 publisher = {Kluwer Academic Publishers}, 14223 address = {the Netherlands}, 14224 year = {1997} 14225} 14226 14227@Book{ hackbusch94, 14228 author = {Wolfgang Hackbusch}, 14229 title = {Iterative Solution of Large Sparse Systems of Equations}, 14230 publisher = {Springer-Verlag}, 14231 address = {New York}, 14232 year = {1994} 14233} 14234 14235@Article{ hackbusch1980fast, 14236 title = {Fast solution of elliptic control problems}, 14237 author = {Hackbusch, W.}, 14238 journal = {Journal of Optimization Theory and Applications}, 14239 volume = {31}, 14240 number = {4}, 14241 pages = {565--581}, 14242 year = {1980}, 14243 publisher = {Springer} 14244} 14245 14246@Book{ hackbusch1985multi, 14247 title = {{Multi-grid methods and applications}}, 14248 author = {Hackbusch, W.}, 14249 isbn = {3540127615}, 14250 issn = {0179-3632}, 14251 year = {1985}, 14252 publisher = {Springer Verlag} 14253} 14254 14255@Book{ axelsson94, 14256 author = {Owe Axelsson}, 14257 title = {Iterative Solution Methods}, 14258 publisher = {Cambridge University Press}, 14259 address = {Cambridge}, 14260 year = {1994} 14261} 14262 14263@Book{ saad96, 14264 author = {Yousef Saad}, 14265 title = {Iterative Methods for Sparse Linear Systems}, 14266 publisher = {PWS Publishing Company}, 14267 address = {Boston}, 14268 year = {1996} 14269} 14270 14271@Book{ saad2003, 14272 title = {Iterative Methods for Sparse Linear Systems}, 14273 author = {Saad, Yousef}, 14274 doi = {10.1016/S1570-579X(01)80025-2}, 14275 edition = {2nd}, 14276 publisher = {SIAM}, 14277 year = {2003} 14278} 14279 14280@Book{ vandervorst03, 14281 author = {Henk A. {van der Vorst}}, 14282 title = {Iterative Krylov Methods for Large Linear Systems}, 14283 publisher = {Cambridge Monographs on Applied ahd Computational Mathematics}, 14284 year = {2003} 14285} 14286 14287@Book{ koniges00, 14288 editor = {Alice E. Koniges}, 14289 title = {Industrial Strength Parallel Computing}, 14290 publisher = {Morgan Kaufmann Publishers}, 14291 address = {San Francisco}, 14292 year = {2000} 14293} 14294 14295@Misc{ fftw-web-page, 14296 key = {Fftw}, 14297 title = {{FFTW} {Web} page}, 14298 note = {\texttt{http://www.fftw.org/}}, 14299 annote = {fast FFT. Parallel versions with MPI and Cilk} 14300} 14301 14302@InProceedings{ frigojohnson93, 14303 author = {Matteo Frigo and Steven G. Johnson}, 14304 title = {The Design and Implementation of {FFTW3}}, 14305 booktitle = {Proceedings of the IEEE}, 14306 volume = {93}, 14307 number = {2}, 14308 pages = {216--231}, 14309 year = {2005} 14310} 14311 14312@Book{ kelley95, 14313 author = {C. T. Kelley}, 14314 title = {Iterative Methods for Linear and Nonlinear Equations}, 14315 year = {1995}, 14316 publisher = {SIAM}, 14317 address = {Philadelphia} 14318} 14319 14320@Unpublished{ spai-web-page, 14321 title = {{SPAI} {W}eb {P}age}, 14322 note = {http://www.sam.math.ethz.ch/\~{ }grote/spai/}, 14323 author = {Steven Bernard and Marcus Grote}, 14324 institution = {NASA Ames Research Center and ETH Zurich} 14325} 14326 14327@Article{ gh97, 14328 author = {M. J. Grote and T. Huckle}, 14329 title = {Parallel Preconditioning with Sparse Approximate Inverses}, 14330 year = {1997}, 14331 journal = {SIAM J. of Scient. Comput.}, 14332 volume = {18}, 14333 pages = {838-853} 14334} 14335 14336@Article{ zhang96, 14337 author = {Wen Zhang}, 14338 title = {Using {MOL} to Solve a high order nonlinear {PDE} with a moving boundary in the 14339 simulation of a sintering process}, 14340 year = {1996}, 14341 journal = {Appl. Numer. Math.}, 14342 volume = {20}, 14343 pages = {235-244} 14344} 14345 14346@Article{ zhang98, 14347 author = {Wen Zhang and Ian Gladwell}, 14348 title = {The sintering of two particles by surface and grain boundary diffusion - a 14349 three-dimensional numerical study}, 14350 journal = {Comp. Mater. Sci.}, 14351 year = {1998}, 14352 volume = {12} 14353} 14354 14355@InProceedings{ mollerschwartzbach01, 14356 author = {Anders M\o{}ller and Michael I. Schwartzbach}, 14357 title = {The Pointer Assertion Logic Engine}, 14358 booktitle = {ACM Proceedings of PLDI'01}, 14359 year = {2001} 14360} 14361 14362@InProceedings{ klarlandschwartzbach97, 14363 author = {Nils Klarland and Michael I. Schwartzbach}, 14364 title = {A Domain-Specific Languages for Regular Sets of Strings and Trees}, 14365 booktitle = {Proceedings of the Conference on Domain-Specific Languages}, 14366 publisher = {USENIX}, 14367 month = oct, 14368 year = {1997}, 14369 address = {Santa Barbara, CA} 14370} 14371 14372@InProceedings{ conselmarlet98, 14373 author = {C. Consel and R. Marlet}, 14374 title = {Architecturing software using a methodology for language development}, 14375 booktitle = {Proceedings of the 10th International Symposium on Programming Languages, 14376 Implementations, Logics and Programs}, 14377 year = {1998}, 14378 pages = {170-174}, 14379 month = sep, 14380 address = {Pisa, Italy} 14381} 14382 14383@Misc{ sundials:homepage, 14384 author = {C. {Woodward et al.}}, 14385 title = {{SUNDIALS {W}eb page}}, 14386 howpublished = {\url{https://computation.llnl.gov/casc/sundials/main.html}} 14387} 14388 14389@article{gardner2022sundials, 14390 title = {Enabling new flexibility in the {SUNDIALS} suite of nonlinear and differential/algebraic equation solvers}, 14391 author = {Gardner, David J and Reynolds, Daniel R and Woodward, Carol S and Balos, Cody J}, 14392 journal = {ACM Transactions on Mathematical Software (TOMS)}, 14393 publisher = {ACM}, 14394 year = {2022}, 14395 doi = {10.1145/3539801} 14396} 14397 14398@Misc{ sundials-user-ref, 14399 title = {{SUNDIALS}: Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14400 note = {See \url{http://www.llnl.gov/CASC/sundials}}, 14401 author = {Allan Hindmarsh and Peter Brown and Keith Grant and Steven Lee and Radu Serban 14402 and Dan Shumaker and Carol Woodward}, 14403 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14404 number = {UCRL-JP-200037}, 14405 year = {2003} 14406} 14407 14408@Article{ sundials05, 14409 author = {A. Hindmarsh and P. Brown and K. Grant and S. Lee and R. Serban and D. Shumaker 14410 and C. Woodward}, 14411 title = {{SUNDIALS:} Suite of Nonlinear and Differential/Algebraic Equation Solvers}, 14412 journal = {ACM Transactions on Mathematical Software}, 14413 volume = {31}, 14414 number = {3}, 14415 pages = {363--396}, 14416 year = {2005} 14417} 14418 14419@InProceedings{ serban2005cvodes, 14420 title = {{CVODES}, the sensitivity-enabled {ODE} solver in {SUNDIALS}}, 14421 author = {Serban, Radu and Hindmarsh, Alan C}, 14422 booktitle = {Proceedings of the 5th International Conference on Multibody Systems, Nonlinear 14423 Dynamics and Control, Long Beach, CA}, 14424 year = {2005} 14425} 14426 14427@Article{ pvode99, 14428 author = {G. Byrne and A. Hindmarsh}, 14429 title = {{PVODE}, An {ODE} Solver for Parallel Computers}, 14430 journal = {Int. J. High Perf. Comput. Apps.}, 14431 volume = {13}, 14432 number = {4}, 14433 year = {1999}, 14434 pages = {354 -- 365} 14435} 14436 14437@Article{ cvode95, 14438 author = {S. Cohen and A. Hindmarsh}, 14439 title = {{CVODE}, A Stiff/Nonstiff {ODE} Solver in {C}}, 14440 journal = {Computers in Physics}, 14441 volume = {10}, 14442 number = {2}, 14443 year = {1996}, 14444 pages = {138 -- 143} 14445} 14446 14447@TechReport{ ifpack, 14448 title = {Robust Algebraic Preconditioners using {IFPACK} 3.0}, 14449 author = {Marzio Sala and Michael Heroux}, 14450 institution = {Sandia National Laboratories}, 14451 number = {SAND2005-0662}, 14452 year = {2005} 14453} 14454 14455@TechReport{ kinsol-user-ref, 14456 title = {User Documentation for {KINSOL}, A Nonlinear Solver for Sequential and Parallel 14457 Computers}, 14458 author = {Allan Taylor and Alan Hindmarsh}, 14459 institution = {Center for Applied Scientific Computing, Lawrence Livermore National Laboratory}, 14460 number = {UCRL-ID-131185}, 14461 year = {1998} 14462} 14463 14464@Article{ fiardmanteuffelmccormick98, 14465 author = {J.-M. Fiard and T. Manteuffel and S. McCormick}, 14466 title = {First-order system least squares {(FOSLS)} for convection-diffusion problems: 14467 numerical results}, 14468 journal = {SIAM J. Sci. Comp.}, 14469 year = {1998}, 14470 volume = {19}, 14471 pages = {1958--1979} 14472} 14473 14474@InProceedings{ vuduc02, 14475 author = {Richard Vuduc and James W. Demmel and Katherine A. Yelick and Shoaib Kamil and 14476 Rajesh Nishtala and Benjamin Lee}, 14477 title = {Performance Optimizations and Bounds for Sparse Matrix-Vector Multiply}, 14478 booktitle = {Proceedings of Supercomputing}, 14479 year = {2002}, 14480 month = nov, 14481 address = {Baltimore} 14482} 14483 14484@Article{ beckerbraackrannacher1999, 14485 title = {Numerical simulation of laminar flames at low Mach number by adaptive finite 14486 elements}, 14487 author = {Roland Becker and Malte Braack and Rolf Rannacher}, 14488 journal = {Combustion Theory and Modelling}, 14489 volume = {3}, 14490 pages = {503--534}, 14491 year = {1999} 14492} 14493 14494@Article{ beckerrannacher01, 14495 author = {R. Becker and R. Rannacher}, 14496 title = {An optimal control approach to a posteriori error estimation in finite element 14497 methods}, 14498 journal = {Acta Numerica}, 14499 year = {2001}, 14500 volume = {10}, 14501 pages = {1--102} 14502} 14503 14504@Article{ babuskamiller84a, 14505 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14506 title = {The post-processing approach in the finite element method, {I}: Calculations of 14507 displacements, stresses, and other higher derivatives of the displacements}, 14508 journal = {Int. J. Numer. Meth. Eng.}, 14509 year = {1984}, 14510 volume = {20}, 14511 pages = {1085--1109} 14512} 14513 14514@Article{ babuskamiller84b, 14515 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14516 title = {The post-processing approach in the finite element method, {II}: The calculation 14517 of stress intensity factors}, 14518 journal = {Int. J. Numer. Meth. Eng.}, 14519 year = {1984}, 14520 volume = {20}, 14521 pages = {1111--1129} 14522} 14523 14524@Article{ babuskamiller84c, 14525 author = {I. Babu$\check{s}$ka and A.D. Miller}, 14526 title = {The post-processing approach in the finite element method, {III}: A posteriori 14527 error estimation and adaptive mesh refinement}, 14528 journal = {Int. J. Numer. Meth. Eng.}, 14529 year = {1984}, 14530 volume = {20}, 14531 pages = {2311--2324} 14532} 14533 14534@Unpublished{ jtb-web-page, 14535 title = {{The Java Tree Builder}}, 14536 note = {See \url{http://www.cs.purdue.edu/jtb}}, 14537 author = {Jens Palsberg}, 14538 institution = {Purdue University} 14539} 14540 14541@Unpublished{ palsberg98, 14542 title = {Why Visitors?}, 14543 note = {See \url{http://www.cs.purdue.edu/jtb/whyvisitors}}, 14544 author = {Jens Palsberg}, 14545 institution = {Purdue University}, 14546 year = {1998} 14547} 14548 14549@Unpublished{ ply-web-page, 14550 title = {{PLY (Python Lex-Yacc)}}, 14551 note = {\url{http://systems.cs.chicago.edu/ply}}, 14552 author = {David Beazley}, 14553 institution = {University of Chicago} 14554} 14555 14556@Misc{ adic-web-page, 14557 title = {{ADIC Web page}}, 14558 note = {\url{http://www.mcs.anl.gov/autodiff}}, 14559 author = {Paul Hovland and Uwe Naumann and Boyana Norris}, 14560 institution = {Argonne National Laboratory} 14561} 14562 14563@Article{ naumann02, 14564 author = {Uwe Naumann}, 14565 title = {Optimal accumulation of {J}acobian matrices by elimination methods on the dual 14566 computational graph}, 14567 journal = {Mathematical Programming (to appear)}, 14568 note = {Preprint ANL/MCS-P944-0402, Argonne National Laboratory, April 2002}, 14569 year = {2003} 14570} 14571 14572@Article{ kaper1, 14573 author = {H. G. Kaper and T. J. Kaper}, 14574 title = {Asymptotic Analysis of Two Reduction Methods for Systems of Chemical Reactions}, 14575 journal = {Physica D}, 14576 year = {2002}, 14577 pages = {66--93}, 14578 volume = {165} 14579} 14580 14581@Misc{ veltisto-web-page, 14582 author = {George Biros}, 14583 title = {{Veltisto Web page}}, 14584 note = {\url{http://www.cs.nyu.edu/~biros/veltisto}} 14585} 14586 14587@Article{ karypiskumar98, 14588 author = {George Karypis and Vipin Kumar}, 14589 title = {A Parallel Algorithm for Multilevel Graph Partitioning and Sparse Matrix 14590 Ordering}, 14591 journal = {Journal of Parallel and Distributed Computing}, 14592 volume = {48}, 14593 pages = {71--85}, 14594 year = {1998} 14595} 14596 14597@TechReport{ karypiskumar97, 14598 author = {Karypis, George and Kumar, V.}, 14599 institution = {Department of Computer Science, University of Minnesota}, 14600 keywords = {graph partitioning; ParMetis}, 14601 note = {http://www.cs.umn.edu/~metis}, 14602 number = {97-060}, 14603 title = {{ParMETIS}: Parallel graph partitioning and sparse matrix ordering library}, 14604 year = {1997} 14605} 14606 14607@Misc{ parmetis-web-page, 14608 author = {George {Karypis et al.}}, 14609 title = {{ParMETIS Web page}}, 14610 note = {\url{http://www.cs.umn.edu/~karypis/metis/parmetis}}, 14611 year = {2005} 14612} 14613 14614@Misc{ sparskit-web-page, 14615 author = {Yousef {Saad et al.}}, 14616 title = {{SPARSKIT Web page}}, 14617 note = {\url{http://www.cs.umn.edu/~saad/software/SPARSKIT/sparskit.html}} 14618} 14619 14620@Misc{ dscpack-web-page, 14621 author = {Padma Raghavan}, 14622 title = {{DSCPACK Web page}}, 14623 note = {\url{http://www.cse.psu.edu/~raghavan/Dscpack}} 14624} 14625 14626@Misc{ gaussian-web-page, 14627 author = {}, 14628 title = {{Gaussian Web page}}, 14629 note = {\url{http://gaussian.com}}, 14630 key = {{Gaussian} {Web} page} 14631} 14632 14633@Book{ lapack-user-guide, 14634 author = {E. Anderson and Z. Bai and C. Bischof and S. Blackford and J. Demmel and J. 14635 Dongarra and J. Du Cris and A. Greenbaum and S. Hammarling and A. McKenney and D. 14636 Sorensen}, 14637 title = {LAPACK Users' Guide, Third Edition}, 14638 publisher = {SIAM}, 14639 year = {1999} 14640} 14641 14642@Manual{ nwchem4.1, 14643 author = {High Performance Computational Chemistry Group}, 14644 title = {{NWChem}, A Computational Chemistry Package for Parallel Computers, Version 4.1}, 14645 year = {2002}, 14646 organization = {Pacific Northwest National Laboratory}, 14647 address = {Richland, Washington 99325-0999 USA}, 14648 note = {See \url{http://www.emsl.pnl.gov/pub/docs/nwchem/}} 14649} 14650 14651@TechReport{ tchem, 14652 title = {{TC}hem: {A} Software Toolkit for the Analysis of Complex Kinetic Models}, 14653 author = {Cosmin Safta and Habib Najm and Omar Knio}, 14654 institution = {Sandia National Laboratories}, 14655 number = {SAND2011-3282}, 14656 year = {2011} 14657} 14658 14659@Misc{ scidac-web-page, 14660 author = {}, 14661 title = {{{SciDAC Initiative Web page}}}, 14662 note = {\url{http://www.osti.gov/scidac}}, 14663 key = {{SciDAC Initiative Web page}} 14664} 14665 14666@Misc{ cmrs:homepage, 14667 author = {Amitava {Bhattacharjee (PI)}}, 14668 title = {{Center for Magnetic Reconnection Studies}}, 14669 howpublished = {\url{http://www.physics.uiowa.edu/cmrs}} 14670} 14671 14672@Misc{ tops:homepage, 14673 author = {David {Keyes (PI)}}, 14674 title = {{Towards Optimal Petascale Simulations (TOPS) Center}}, 14675 howpublished = {\url{http://scalablesolvers.org}} 14676} 14677 14678@Misc{ tstt:homepage, 14679 author = {David Brown and Jim Glimm and Lori Freitag}, 14680 title = {{Terascale Simulation Tools and Technology (TSTT) Center}}, 14681 howpublished = {\url{http://www.tstt-scidac.org}}, 14682 year = {2005} 14683} 14684 14685@Misc{ petsc:applications, 14686 author = {B. F. {Smith et al.}}, 14687 title = {{Scientific Applications Using {PETSc}}}, 14688 howpublished = {\url{http://www.mcs.anl.gov/petsc/publications}} 14689} 14690 14691@Misc{ petsc:users, 14692 author = {B. F. {Smith et al.}}, 14693 title = {{PETSc User Statistics}}, 14694 howpublished = {\url{http://www.mcs.anl.gov/petsc/miscellaneous/usage.html}} 14695} 14696 14697@Misc{ cemm:homepage, 14698 author = {Steve {Jardin (PI)}}, 14699 title = {{Center for Extended MHD Modeling}}, 14700 howpublished = {\url{http://w3.pppl.gov/CEMM}} 14701} 14702 14703@Misc{ m3d:homepage, 14704 author = {Steve {Jardin et al.}}, 14705 title = {{M3D Web page}}, 14706 howpublished = {\url{http://w3.pppl.gov/m3d}} 14707} 14708 14709@Misc{ nimrod:homepage, 14710 author = {Carl R. {Sovinec et al.}}, 14711 title = {{NIMROD Web page}}, 14712 howpublished = {http://nimrodteam.org} 14713} 14714 14715@Misc{ grace-web-page, 14716 author = {Manish {Parashar et al.}}, 14717 title = {{GrACE Web Page}}, 14718 howpublished = {\url{http://www.caip.rutgers.edu/~parashar/TASSL/Projects/GrACE}} 14719} 14720 14721@Misc{ accel1, 14722 title = {Advanced Computing for 21st Century Accelerator Science and Technology Web page}, 14723 howpublished = {\url{http://scidac.nersc.gov/accelerator/}}, 14724 author = {K. Ko and R. Ryne (PIs)} 14725} 14726 14727@Unpublished{ katzspiegelman03, 14728 author = {Richard F. Katz and Marc Spiegelman}, 14729 title = {A semi-{L}agrangian {C}rank-{N}icholson algorithm for the numerical solution of 14730 advection-diffusion problems}, 14731 note = {Columbia University, in preparation} 14732} 14733 14734@Misc{ acts:homepage, 14735 author = {}, 14736 title = {{Advanced CompuTational Software (ACTS) Web page}}, 14737 howpublished = {\url{http://acts.nersc.gov}}, 14738 key = {{Advanced CompuTational Software (ACTS) Web page}} 14739} 14740 14741@Article{ superlu99, 14742 author = {James W. Demmel and Stanley C. Eisenstat and John R. Gilbert and Xiaoye S. Li and 14743 Joseph W. H. Liu}, 14744 title = {A supernodal approach to sparse partial pivoting}, 14745 journal = {SIAM J. Matrix Analysis and Applications}, 14746 year = {1999}, 14747 volume = {20}, 14748 number = {3}, 14749 pages = {720-755} 14750} 14751 14752@Misc{ superlu:homepage, 14753 author = {J. Demmel and J. Gilbert and X. Li}, 14754 title = {{SuperLU Web page}}, 14755 howpublished = {http://crd.lbl.gov/\~xiaoye/SuperLU} 14756} 14757 14758@InProceedings{ ccf98, 14759 author = {E. Chow and A. Cleary and R. Falgout}, 14760 title = {Design of the hypre Preconditioner Library}, 14761 booktitle = {Proceedings of the SIAM Workshop on Object Oriented Methods for Inter-operable 14762 Scientific and Engineering Computing}, 14763 publisher = {SIAM}, 14764 year = {1999} 14765} 14766 14767@TechReport{ hypre-users-manual, 14768 author = {R. Falgout}, 14769 title = {{hypre} Users Manual}, 14770 number = {Revision 2.28}, 14771 institution = {Lawrence Livermore National Laboratory}, 14772 year = {2023}, 14773 url = {https://hypre.readthedocs.io/} 14774} 14775 14776@Misc{ hypre:homepage, 14777 author = {R. Falgout}, 14778 title = {{hypre Web page}}, 14779 howpublished = {\url{https://www.llnl.gov/casc/hypre}} 14780} 14781 14782@InProceedings{ trilinos:gpu, 14783 author = {C.G. Baker and M.A. Heroux. and H.C. Edwards and A.B. Williams}, 14784 title = {A Light-weight API for Portable Multicore Programming}, 14785 booktitle = {18th Euromicro International Conference on Parallel, Distributed and 14786 Network-Based Processing (PDP)}, 14787 pages = {601--606}, 14788 publisher = {IEEE}, 14789 year = {2010} 14790} 14791 14792@InProceedings{ heroux2004design, 14793 title = {The design of {T}rilinos}, 14794 author = {Heroux, Michael A and Sala, Marzio}, 14795 booktitle = {International Workshop on Applied Parallel Computing}, 14796 pages = {620--628}, 14797 year = {2004}, 14798 organization = {Springer} 14799} 14800 14801@Misc{ trilinos:homepage, 14802 author = {M. {Heroux et al.}}, 14803 title = {{Trilinos Web page}}, 14804 howpublished = {{\tt http://trilinos.sandia.gov/}} 14805} 14806 14807@Article{ trilinos:overview, 14808 author = {Michael A. Heroux and Roscoe A. Bartlett and Vicki E. Howle and Robert J. 14809 Hoekstra and Jonathan J. Hu and Tamara G. Kolda and Richard B. Lehoucq and Kevin 14810 R. Long and Roger P. Pawlowski and Eric T. Phipps and Andrew G. Salinger and Heidi 14811 K. Thornquist and Ray S. Tuminaro and James M. Willenbring and Alan Williams and 14812 Kendall S. Stanley}, 14813 title = {An overview of the {T}rilinos project}, 14814 journal = {ACM Transactions on Mathematical Software}, 14815 volume = {31}, 14816 number = {3}, 14817 year = {2005}, 14818 issn = {0098-3500}, 14819 pages = {397--423}, 14820 publisher = {ACM Press}, 14821 doi = {10.1145/1089014.1089021} 14822} 14823 14824@Misc{ rythmos:homepage, 14825 author = {T. Coffey and R. Bartlett}, 14826 title = {Rythmos: Transient Integration of Differential Equations}, 14827 howpublished = {\url{http://trilinos.sandia.gov/packages/rythmos}} 14828} 14829 14830@Misc{ triangle:homepage, 14831 author = {J. {Shewchuk}}, 14832 title = {{Triangle: A Two-Dimensional Quality Mesh Generator and Delaunay Triangulator}}, 14833 howpublished = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}}, 14834 year = {2005} 14835} 14836 14837@Misc{ tetgen:homepage, 14838 author = {Hang {Si}}, 14839 title = {{TetGen: A Quality Tetrahedral Mesh Generator and Three-Dimensional Delaunay 14840 Triangulator}}, 14841 howpublished = {\url{http://tetgen.berlios.de}}, 14842 year = {2005} 14843} 14844 14845@Misc{ eigen:homepage, 14846 author = {Benoit Jacob and Ga\"el Guennebaud}, 14847 title = {{Eigen} {W}eb page}, 14848 key = {Jacob}, 14849 url = {http://eigen.tuxfamily.org/}, 14850 howpublished = {\url{http://eigen.tuxfamily.org/}}, 14851 year = {2015} 14852} 14853 14854@Misc{ dune:homepage, 14855 author = {Peter Bastian and Markus Blatt and Andreas Dedner and Christian Engwer and Jorrit 14856 Fahlke and Christoph Gersbacher and Carsten Gr\"aser and Christoph Gr\"uninger 14857 Robert Kl\"ofkorn and Steffen M\"uthing and Martin Nolte and Mario Ohlberger and 14858 Oliver Sander}, 14859 title = {{DUNE} {W}eb page}, 14860 key = {Bastian}, 14861 url = {http://www.dune-project.org/}, 14862 howpublished = {\url{http://www.dune-project.org/}}, 14863 year = {2015} 14864} 14865 14866@Misc{ thrust, 14867 author = {N. Bell and J. Hoberock}, 14868 title = {The {T}hrust Library}, 14869 howpublished = {{\tt http://code.google.com/p/thrust/}}, 14870 year = {2010} 14871} 14872 14873@Misc{ cusp, 14874 author = {N. Bell and M. Garland}, 14875 title = {The {C}usp Library}, 14876 howpublished = {{\tt http://code.google.com/p/cusp-library/}}, 14877 year = {2010} 14878} 14879 14880@Misc{ cig:homepage, 14881 author = {M. {Gurnis et al.}}, 14882 title = {{Computational Infrastructure for Geodynamics}}, 14883 howpublished = {\url{http://www.geodynamics.org}} 14884} 14885 14886@Article{ maltsevselkov00, 14887 author = {R. Overbeek and N. Larsen and G. Pusch and M. D'Souza and E. Selkov Jr. and N. 14888 Kyrpides and M. Fonstein and N. Maltsev and E. Selkov}, 14889 title = {{WIT}: {I}ntegrated system for high-throughput genome sequence analysis and 14890 metabolic reconstruction}, 14891 journal = {Nucleic Acids Res.}, 14892 year = {2000}, 14893 month = jan, 14894 pages = {123-125}, 14895 volume = {28}, 14896 number = {1} 14897} 14898 14899@Article{ more:coloring, 14900 author = {Thomas F. Coleman and Jorge J. Mor\'{e}}, 14901 title = {Estimation of sparse {J}acobian matrices and graph coloring problems}, 14902 journal = {SIAM Journal on Numerical Analysis}, 14903 year = {1983}, 14904 month = feb, 14905 pages = {187--209}, 14906 volume = {20}, 14907 number = {1} 14908} 14909 14910@Article{ selkovmaltsev97, 14911 author = {E. Selkov and N. Maltsev and G.J. Olsen and R. Overbeek and W. B. Whitman}, 14912 title = {A reconstruction of the metabolism of Methanococcus jannaschii from sequence 14913 data}, 14914 journal = {Gene}, 14915 year = {1997}, 14916 pages = {GC11-GC26}, 14917 volume = {197}, 14918 number = {1-2} 14919} 14920 14921@Unpublished{ rocketcenter, 14922 title = {Center for Simulation of Advanced Rockets}, 14923 note = {http://www.csar.uiuc.edu}, 14924 institution = {University of Illinois at Urbana-Champaign} 14925} 14926 14927@Article{ kirby03, 14928 title = {A posteriori error estimates for the mixed hybrid finite element method}, 14929 author = {Robert C Kirby}, 14930 journal = {Computational Geosciences}, 14931 volume = {7}, 14932 pages = {197--214}, 14933 note = {\url{http://www.ices.utexas.edu/~clint/nsf/apostmfem.ps}}, 14934 year = {2003} 14935} 14936 14937@Article{ kirby2003b, 14938 title = {On the convergence of high resolution methods with multiple time scales for 14939 hyperbolic conservation laws}, 14940 author = {Robert C Kirby}, 14941 journal = {Mathematics of computation}, 14942 volume = {72}, 14943 number = {243}, 14944 pages = {1239--1250}, 14945 year = {2003} 14946} 14947 14948@Article{ dawsonkirby2001, 14949 title = {High resolution schemes for conservation laws with locally varying time steps}, 14950 author = {Clint Dawson and Robert C Kirby}, 14951 journal = {SIAM Journal on Scientific Computing}, 14952 volume = {22}, 14953 number = {6}, 14954 pages = {2256--2281}, 14955 year = {2001}, 14956 publisher = {SIAM} 14957} 14958 14959@Article{ dawsonkirby1999, 14960 title = {Solution of parabolic equations by backward Euler-mixed finite element methods on 14961 a dynamically changing mesh}, 14962 author = {Clint Dawson and Robert C Kirby}, 14963 journal = {SIAM Journal on Numerical Analysis}, 14964 volume = {37}, 14965 number = {2}, 14966 pages = {423--442}, 14967 year = {1999}, 14968 publisher = {SIAM} 14969} 14970 14971@Article{ barthlarson00, 14972 author = {T. J. Barth and M. G. Larson}, 14973 title = {{\em A posteriori} Error Estimation for Discontiuous {G}alerkin Approximations of 14974 Hyperbolic Systems}, 14975 journal = {LNCS}, 14976 year = {2000}, 14977 volume = {11}, 14978 publisher = {Spinger-Verlag} 14979} 14980 14981@Article{ xu1, 14982 author = {J. Xu}, 14983 title = {Iterative Methods by Space Decomposition and Subspace Correction}, 14984 journal = {SIAM Review}, 14985 volume = {34}, 14986 pages = {581--613}, 14987 year = {1992} 14988} 14989 14990@Article{ brandt77, 14991 author = {Achi Brandt}, 14992 title = {Multi-Level Adaptive Solutions to Boundary-Value Problems}, 14993 journal = {Mathematics of Computation}, 14994 month = apr, 14995 year = {1977}, 14996 pages = {333--390}, 14997 volume = {31}, 14998 number = {138}, 14999 doi = {10.2307/2006422} 15000} 15001 15002@Article{ brandt1979multigrid, 15003 title = {{Multigrid solutions to elliptic flow problems}}, 15004 author = {Brandt, A. and Dinar, N.}, 15005 journal = {Numerical Methods for Partial Differential Equations}, 15006 pages = {53--147}, 15007 year = {1979} 15008} 15009 15010@InCollection{ brandt1979singular, 15011 title = {Multi-Level Adaptive Techniques(MLAT) for singular-perturbation problems}, 15012 author = {Achi Brandt}, 15013 booktitle = {Numerical Analysis of Singular Perturbation Problems}, 15014 editor = {Hemker, Pieter W. and Miller, John J.H.}, 15015 pages = {53--142}, 15016 year = {1979}, 15017 publisher = {Academic Press} 15018} 15019 15020@Article{ amge1, 15021 author = {M. Brezina and A. J. Cleary and R. D. Falgout and V. E. Henson and J. E. Jones 15022 and T. A. Manteuffel and S. F. McCormick and J. W. Ruge}, 15023 title = {Algebraic Multigrid Based on Element Interpolation (AMGe)}, 15024 journal = {SIAM J. Scientific Computing}, 15025 volume = {22}, 15026 pages = {1570--1592}, 15027 year = {2000} 15028} 15029 15030@Book{ bramble1, 15031 author = {J. H. Bramble}, 15032 title = {Multigrid Methods}, 15033 publisher = {Longman Scientific and Technical}, 15034 address = {Essex, England}, 15035 year = {1993} 15036} 15037 15038@Book{ arpack98, 15039 author = {R. B. Lehoucq and D. C. Sorensen and C. Yang}, 15040 title = {ARPACK, Users' Guide}, 15041 publisher = {SIAM}, 15042 year = {1998} 15043} 15044 15045@Article{ bbder96, 15046 author = {R. Barrett and M. Berry and J. Dongarra and V. Eijkhout and C. Romine}, 15047 title = {Algorithmic bombardment for the iterative solution of linear systems: A 15048 polyIterative approach}, 15049 journal = {J. of Computational and Applied Mathematics}, 15050 year = {1996}, 15051 volume = {74}, 15052 pages = {91--110} 15053} 15054 15055@Article{ egks94, 15056 author = {A. Ern and V. Giovangigli and D. E. Keyes and M. D. Smooke}, 15057 title = {Towards polyalgorithmic linear system solvers for nonlinear elliptic problems,}, 15058 journal = {SIAM J. Scientific Computing}, 15059 year = {1994}, 15060 volume = {15}, 15061 number = {3}, 15062 pages = {681--703} 15063} 15064 15065@Article{ dftb02, 15066 author = {P. Zapol and M. Sternberg and L.A. Curtiss and Th. Frauenheim and D.M. Gruen}, 15067 title = {Tight-binding molecular-dynamics simulation of impurities in ultrananocrystalline 15068 diamond grain boundaries,}, 15069 journal = {Phys. Rev}, 15070 year = {2002}, 15071 volume = {B65}, 15072 pages = {045403} 15073} 15074 15075@InBook{ lsa, 15076 author = {R. Bramley and D. Gannon and T. Stuckey and J. Villacis and J. Balasubramanian 15077 and E. Akman and F. Berg and S. Diwan and M. Govindaraju}, 15078 title = {The linear system analyzer}, 15079 series = {enabling technologies for computational science}, 15080 year = {2002}, 15081 publisher = {Kluwer}, 15082 location = {Dordrecht} 15083} 15084 15085@Article{ kk97, 15086 author = {Carl T. Kelley and David E. Keyes}, 15087 title = {Convergence analysis of pseudo-transient continuation}, 15088 journal = {SIAM J. Numerical Analysis}, 15089 year = {1998}, 15090 volume = {35}, 15091 pages = {508--523} 15092} 15093 15094@Article{ swtm01, 15095 author = {R. Shepard and A. F. Wagner and J. L. Tilson and M. Minkoff}, 15096 journal = {Journal of Computational Physics}, 15097 year = {2001}, 15098 volume = {172}, 15099 number = {2}, 15100 pages = {472--514}, 15101 title = {The Subspace Projected Approximate Matrix {(SPAM)} Modification of the {D}avidson 15102 Method} 15103} 15104 15105@TechReport{ zhou03, 15106 author = {Y. Zhou}, 15107 title = {Eigenvalue Computation from the Optimization Perspective: On {Jacobi-Davidson, 15108 IIGD, RQI and Newton} Updates}, 15109 institution = {Argonne National Laboratory}, 15110 number = {ANL/MCS-P1074-0803}, 15111 note = {Submitted to Numerical Linear Algebra with Applications}, 15112 year = {2003} 15113} 15114 15115@Unpublished{ mtwm03, 15116 author = {G. G. Maisuradze and D. L. Thompson and A. F. Wagner and M. Minkoff}, 15117 title = {Interpolating moving least squares methods for fitting potential energy surfaces: 15118 Detailed analysis of one-dimensional applications}, 15119 note = {to appear in the Journal of Chemical Physics}, 15120 year = {2003} 15121} 15122 15123@Article{ singhjosephheslaglowinskipan00, 15124 author = {P. Singh and D. D. Joseph and T. Hesla and R. Glowinski and T.-W. Pan}, 15125 title = {A distributed {L}agrange multiplier/fictitious domain model for viscoelastic 15126 particulate flows}, 15127 journal = {J. Non-Newtonian Fluid Mech.}, 15128 volume = {91}, 15129 pages = {165--188}, 15130 year = {2000} 15131} 15132 15133@Book{ joseph02, 15134 author = {Daniel D. Joseph}, 15135 title = {Interrogations of Direct Numerical Simulations of Sloid-Liquid Flows}, 15136 publisher = {Springer-Verlag}, 15137 month = mar, 15138 year = {2002}, 15139 note = {\url{http://www.efluids.com/efluids/books/joseph.htm}} 15140} 15141 15142@Misc{ triangle-web-page, 15143 author = {Jonathan R. Shewchuk}, 15144 title = {{Triangle Web} page}, 15145 note = {\url{http://www-2.cs.cmu.edu/~quake/triangle.html}} 15146} 15147 15148@InCollection{ shewchuk96, 15149 author = {Jonathan R. Shewchuk}, 15150 title = {Triangle: {E}ngineering a {2D} Quality Mesh Generator and {D}elaunay 15151 Triangulator}, 15152 booktitle = {Applied Computational Geometry: Towards Geometric Engineering}, 15153 editor = {Ming C. Lin and Dinesh Manocha}, 15154 series = {Lecture Notes in Computer Science}, 15155 volume = {1148}, 15156 publisher = {Springer-Verlag}, 15157 pages = {203--222}, 15158 month = may, 15159 year = {1996}, 15160 note = {From the First ACM Workshop on Applied Computational Geometry} 15161} 15162 15163@Article{ leaf1, 15164 author = {Transient Dynamics of Pinning of Domain Walls}, 15165 title = {G. K. Leaf and S. Obukhov and S. Scheidl and V. M. Vinokur}, 15166 journal = {J. Magnetism and Magnetic Materials}, 15167 volume = {241}, 15168 pages = {118--123}, 15169 year = {2002} 15170} 15171 15172@Article{ leaf2, 15173 author = {D. O. Gunter and H. G. Kaper and G. K. Leaf}, 15174 title = {Implicit Integration of the Time-Dependent {Ginzburg-Landau} Equations of 15175 Superconductivity}, 15176 journal = {SIAM J. Sci. Comp.}, 15177 volume = {23}, 15178 pages = {1944--1959}, 15179 year = {2002} 15180} 15181 15182@Article{ leaf3, 15183 author = { J. S. Jiang and H. G. Kaper and G. K. Leaf}, 15184 title = {Hysteresis in Layered Spring Magnets}, 15185 journal = { Discreet and Continuous Dynamical Systems, Series B}, 15186 volume = {1}, 15187 pages = {219--232}, 15188 year = {2001} 15189} 15190 15191@Article{ leaf4, 15192 author = {J. S. Jiang and S. D. Bader and H. G. Kaper and G. K. Leaf}, 15193 title = {Rotational Hysteresis of Exchange-Spring Magnets}, 15194 journal = {J. Phys. D Appl. Phys.}, 15195 volume = {35}, 15196 pages = {2339--2343}, 15197 year = {2002} 15198} 15199 15200@Article{ leaf5, 15201 author = {M. Grimsditch and G. K. Leaf and H. G. Kaper and D. A. Karpeev and R. E. Camley}, 15202 title = {Normal Modes of Spin Excitation in Magnetic Nanoparticles}, 15203 journal = {Submitted to Phys. Rev. B.}, 15204 note = {Submitted}, 15205 year = {2003} 15206} 15207 15208@Article{ graysumpternoidbarnes01, 15209 author = {S. K. Gray and B. G. Sumpter and D. W. Noid and M. d. Barnes}, 15210 title = {Quantum Mechanical Model of Localized Electrons on the Surface of Polymer 15211 Nanospheres}, 15212 journal = {Chem. Phys. Lett.}, 15213 volume = {333}, 15214 pages = {308--313}, 15215 year = {2001} 15216} 15217 15218@InProceedings{ petsc-efficient, 15219 author = {Satish Balay and William~D. Gropp and Lois Curfman McInnes and Barry~F. Smith}, 15220 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 15221 Libraries}, 15222 booktitle = {Modern Software Tools in Scientific Computing}, 15223 editor = {E. Arge and A.~M. Bruaset and H.~P. Langtangen}, 15224 publisher = {Birkh{\"{a}}user Press}, 15225 pages = {163--202}, 15226 year = {1997} 15227} 15228 15229@Article{ mumps01, 15230 author = {Patrick R. Amestoy and Ian S. Duff and Jean-Yves L'Excellent and Jacko Koster}, 15231 title = {A fully asynchronous multifrontal solver using distributed dynamic scheduling}, 15232 journal = {SIAM Journal on Matrix Analysis and Applications}, 15233 volume = {23}, 15234 number = {1}, 15235 pages = {15--41}, 15236 year = {2001} 15237} 15238 15239@Article{ mumps19, 15240 title = {{Performance and Scalability of the Block Low-Rank Multifrontal Factorization on 15241 Multicore Architectures}}, 15242 author = {P.R. Amestoy and A. Buttari and J.-Y. L'Excellent and T. Mary}, 15243 journal = {ACM Transactions on Mathematical Software}, 15244 volume = {45}, 15245 issue = {1}, 15246 pages = {2:1--2:26}, 15247 year = {2019} 15248} 15249 15250@Article{ zoltan06, 15251 author = {Karen D. Devine and Erik G. Boman and Robert T. Heaphy and \"Umit V. 15252 \c{C}ataly\"urek and Robert H. Bisseling}, 15253 title = {Parallel Hypergraph Partitioning for Irregular Problems}, 15254 journal = {SIAM Parallel Processing for Scientific Computing}, 15255 month = feb, 15256 year = {2006} 15257} 15258 15259@Article{ lidemmel03, 15260 author = {Xiaoye S. Li and James W. Demmel}, 15261 title = {{SuperLU\_DIST}: a scalable distributed-memory sparse direct solver for 15262 unsymmetric linear systems}, 15263 journal = {ACM Transactions on Mathematical Software}, 15264 year = {2003}, 15265 month = jun, 15266 volume = {29}, 15267 number = {2}, 15268 pages = {110--140} 15269} 15270 15271@TechReport{ superlu, 15272 author = {James W. Demmel and John R. Gilbert and Xiaoye S. Li}, 15273 title = {{SuperLU} Users' Guide}, 15274 number = {LBNL-44289}, 15275 institution = {Lawrence Berkeley National Laboratory}, 15276 year = {2003}, 15277 url = {http://crd.lbl.gov/\~xiaoye/SuperLU/} 15278} 15279 15280@TechReport{ trilinos-overview03, 15281 title = {{An Overview of {T}rilinos}}, 15282 author = {Michael Heroux and Roscoe Bartlett and Vicki Howle Robert Hoekstra and Jonathan 15283 Hu and Tamara Kolda and Richard Lehoucq and Kevin Long and Roger Pawlowski and 15284 Eric Phipps and Andrew Salinger and Heidi Thornquist and Ray Tuminaro and James 15285 Willenbring and Alan Williams}, 15286 institution = {Sandia National Laboratories}, 15287 number = {SAND2003-2927}, 15288 year = {2003} 15289} 15290 15291@TechReport{ trilinos-users-guide, 15292 title = {{Trilinos} Users Guide}, 15293 author = {Michael A. Heroux and James M. Willenbring}, 15294 institution = {Sandia National Laboratories}, 15295 number = {SAND2003-2952}, 15296 url = {http://trilinos.sandia.gov/}, 15297 year = {2003} 15298} 15299 15300@Article{ pilut01, 15301 author = {David Hysom and Alex Pothen}, 15302 title = {A scalable parallel algorithm for incomplete factor preconditioning}, 15303 journal = {SIAM Journal on Scientific Computing}, 15304 volume = {22}, 15305 pages = {2194--2215}, 15306 year = {2001} 15307} 15308 15309@TechReport{ boomeramg00, 15310 author = {V.~E. Henson and U.~M. Yang}, 15311 title = {{BoomerAMG}: A parallel algebraic multigrid solver and preconditioner}, 15312 institution = {Lawrence Livermore National Laboratory}, 15313 number = {UCRL-JC-133948}, 15314 year = {2000} 15315} 15316 15317@InCollection{ baker2012scaling, 15318 title = {Scaling algebraic multigrid solvers: {O}n the road to exascale}, 15319 author = {Baker, Allison H. and Falgout, Robert D. and Gamblin, Todd and Kolev, Tzanio V. 15320 and Schulz, Martin and Yang, Ulrike Meier}, 15321 booktitle = {Competence in High Performance Computing 2010}, 15322 pages = {215--226}, 15323 year = {2012}, 15324 publisher = {Springer} 15325} 15326 15327@Article{ knollkeyes:04, 15328 author = {D. A. Knoll and D. E. Keyes}, 15329 year = {2004}, 15330 title = {Jacobian-free {Newton-Krylov} Methods: A Survey of Approaches and Applications}, 15331 journal = {J. Comp. Phys.}, 15332 volume = {193}, 15333 pages = {357-397} 15334} 15335 15336@Article{ chacon02, 15337 author = {Luis Chacon and Dana A. Knoll and John M. Finn}, 15338 title = {An implicit nonlinear reduced resistive {MHD} solver}, 15339 journal = {J. Comput. Phys}, 15340 volume = {188}, 15341 year = {2002}, 15342 pages = {15--36} 15343} 15344 15345@Article{ mousseau03, 15346 author = {V. A. Mousseau and D. A. Knoll}, 15347 title = {New Physics-based Preconditioning of Implicit Methods for Non-Equilibrium 15348 Radiation Diffusion}, 15349 journal = {J. Comput. Physics}, 15350 year = {2003} 15351} 15352 15353@Article{ mousseau00, 15354 author = {V. A. Mousseau and D. A. Knoll and W. J. Rider}, 15355 title = {Physics-based Preconditioning and the {Newton-Krylov} Method for Non-Equilibrium 15356 Radiation Diffusion}, 15357 journal = {J. Comput. Physics}, 15358 year = {2000}, 15359 pages = {743--765}, 15360 volume = {160} 15361} 15362 15363@Unpublished{ facets:homepage, 15364 author = {John {Cary (PI)}}, 15365 title = {{Framework Application for Core-Edge Transport Simulations (FACETS)}}, 15366 note = {Proto-FSP project, see \url{http://www.facetsproject.org}} 15367} 15368 15369@Unpublished{ cpes:homepage, 15370 author = {{C.S.} {Chang (PI)}}, 15371 title = {{Center for Plasma Edge Simulation (CPES)}}, 15372 note = {Proto-FSP project, see \url{http://www.cims.nyu.edu/cpes}} 15373} 15374 15375@Misc{ epsi:homepage, 15376 author = {{C.S.} {Chang (PI)}}, 15377 title = {{Center for Edge Physics Simulation (EPSI)}}, 15378 note = {\url{http://epsi.pppl.gov}} 15379} 15380 15381@Unpublished{ groundwater-scidac2:web, 15382 author = {Peter {Lichtner (PI)}}, 15383 title = {Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15384 Advanced Computing}, 15385 howpublished = {http://www.scidac.gov/groundwater/gwflow.html} 15386} 15387 15388@Misc{ pflotran:web, 15389 author = {Peter {Lichtner (PI)}}, 15390 title = {{Modeling Multiscale-Multiphase-Multicomponent Subsurface Reactive Flows Using 15391 Advanced Computing}}, 15392 note = {\url{http://ees.lanl.gov/pflotran/}} 15393} 15394 15395@Misc{ accel-scidac2-solicitation, 15396 author = {{DOE Office of Science}}, 15397 title = {{Program Announcement LAB 07-09, SciDAC: Accelerator Science and Simulation}}, 15398 year = {2006}, 15399 note = {\url{http://www.science.doe.gov/grants/LAB07_09.html}} 15400} 15401 15402@Article{ nieter04, 15403 author = {C. Nieter and J. R. Cary}, 15404 title = {{VORPAL}: A Versatile Plasma Simulation Code}, 15405 journal = {J. Comp. Phys.}, 15406 year = {2004}, 15407 volume = {196}, 15408 pages = {448} 15409} 15410 15411@Article{ synergia06, 15412 author = {J. Amundson and P. Spentzouris and J. Qiang and R. Ryne}, 15413 title = {Synergia: An accelerator modeling tool with {3-D} space charge}, 15414 journal = {J. Comp. Phys.}, 15415 year = {2006}, 15416 volume = {211}, 15417 pages = {229-248} 15418} 15419 15420@Unpublished{ stoltz07, 15421 author = {P. H. Stoltz}, 15422 title = {Maps of {RF} cavities generated from electromagnetic simulations}, 15423 year = {2007}, 15424 note = {to appear in Proceedings of the 2007 Particle Accelerator Conference (PAC07), 15425 Albuquerque, NM, 2007} 15426} 15427 15428@Misc{ iter:homepage, 15429 key = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15430 year = {2007}, 15431 title = {{International Thermonuclear Experimental Reactor (ITER) homepage}}, 15432 howpublished = {\url{http://www.iter.org}} 15433} 15434 15435@Misc{ epp2010, 15436 author = {{Committee on Elementary Particle Physics in the 21st Century, National Research 15437 Council}}, 15438 title = {Revealing the Hidden Nature of Space and Time: Charting the Course for Elementary 15439 Particle Physics}, 15440 year = {2006}, 15441 howpublished = {The National Academies Press, ISBN: 0309101948} 15442} 15443 15444@Misc{ post-fsp-report, 15445 author = {D.~E.~Post and D.~B.~Batchelor and R.~B.~Bramley and J.~R.~Cary and R.~H.~Cohen 15446 and P.~Colella and S.~C.~Jardin}, 15447 title = {{Report of Fusion Simulation Project Steering Committee}}, 15448 month = aug, 15449 year = {2004}, 15450 note = {Available via \url{http://w3.pppl.gov/usjapanim/FSPReport.pdf}} 15451} 15452 15453@Misc{ fsp:workshop2011, 15454 key = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15455 title = {{Fusion Simulation Project (FSP) Planning Workshop}}, 15456 month = feb, 15457 year = {2011}, 15458 note = {\url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 15459} 15460 15461@Book{ hazeltine-meiss-book, 15462 author = {R.~D.~Hazeltine and J.~D.~Meiss}, 15463 title = {Plasma Confinement}, 15464 year = {1991}, 15465 publisher = {Addison-Wesley, Redwood City, CA} 15466} 15467 15468@Article{ falgout05a, 15469 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15470 title = {Conceptual Interfaces in hypre}, 15471 journal = {Future Generation Computer Systems}, 15472 note = {Special issue on PDE software}, 15473 volume = {22}, 15474 year = {2005}, 15475 pages = {239--251} 15476} 15477 15478@Article{ falgout05b, 15479 author = {R. D. Falgout and J. E. Jones and U. M. Yang}, 15480 title = {Pursuing Scalability for hypre's Conceptual Interfaces}, 15481 journal = {ACM Trans. Math. Softw.}, 15482 volume = {31}, 15483 year = {2005}, 15484 pages = {326--350} 15485} 15486 15487@Unpublished{ compass:homepage, 15488 author = {Panagiotis {Spentzouris (PI)}}, 15489 title = {Community Petascale Project for Accelerator Science and Simulation (ComPASS)}, 15490 note = {SciDAC2 project, see \url{https://compass.fnal.gov/}} 15491} 15492 15493@Unpublished{ cmsnf:homepage, 15494 author = {{Todd Allen, Director}}, 15495 title = {{Center for Materials Science of Nuclear Fuel}}, 15496 note = {Energy Frontier Research Center, see 15497 \url{https://inlportal.inl.gov/portal/server.pt/community/center_for_materials_science_of_nuclear_fuel}} 15498} 15499 15500@Unpublished{ dvi-materials:project, 15501 author = {{L.~C.} {McInnes (PI)}}, 15502 title = {Large-Scale Differential Variational Inequalities for Heterogeneous Materials}, 15503 note = {{SciDAC}-e project}, 15504 year = {2011} 15505} 15506 15507@Misc{ scidac:homepage, 15508 author = {{DOE Office of Science}}, 15509 title = {{Scientific Discovery through Advanced Computing}}, 15510 year = {2007}, 15511 howpublished = {\url{http://www.scidac.gov}} 15512} 15513 15514@Misc{ corba, 15515 author = {{Object Management Group}}, 15516 year = {2007}, 15517 title = {{Common Object Request Broker Architecture (CORBA)}}, 15518 howpublished = {\url{http://www.corba.org}} 15519} 15520 15521@Article{ uedge, 15522 author = {T.~D. Rognlien and D.~D. Ryutov and N. Mattor and G.~D. Porter}, 15523 title = {Two-Dimensional Electric Fields and Drifts near the Magnetic Separatrix in 15524 Divertor Tokamak}, 15525 journal = {J. Plasma Physics}, 15526 year = {1999}, 15527 volume = {6}, 15528 pages = {1851}, 15529 note = {also see user manual at http://www.mfescience.org, then UEDGE link} 15530} 15531 15532@Article{ bout, 15533 author = {X.~Q. Xu and R.~H. Cohen and T.~D. Rognlien and J.~R. Myra}, 15534 title = {Low-to-High Confinement Transition Simulations in Divertor Geometry}, 15535 journal = {J. Plasma Physics}, 15536 year = {2000}, 15537 volume = {7}, 15538 pages = {1951}, 15539 note = {} 15540} 15541 15542@Article{ bout++, 15543 author = {B. Dudson and M. Umansky and X.~Q. Xu and P. B. Snyder and H. R. Wilson}, 15544 title = {{BOUT++}: A Framework for Parallel Plasma Fluid Simulations}, 15545 journal = {Computer Physics Communications}, 15546 year = {2009}, 15547 volume = {180}, 15548 issue = {9}, 15549 pages = {1467 -- 1480}, 15550 note = {} 15551} 15552 15553@Article{ tempest, 15554 author = {Z. Xiong and X.Q. Xu and B.I. Cohen and R. Cohen and M.R. Dorr and J.A. Hittinger 15555 and G. Kerbel and W.M. Nevins and T. Rognlien}, 15556 title = {Simulation of Plasma Transport in a Toroidal Annulus with TEMPEST}, 15557 journal = {Bull. Am. Phys. Soc. }, 15558 year = {2005}, 15559 volume = {50}, 15560 number = {86}, 15561 pages = {CP1}, 15562 note = {} 15563} 15564 15565@Article{ ccahpc, 15566 author = {David E. Bernholdt and Benjamin A. Allan and Robert Armstrong and Felipe Bertrand 15567 and Kenneth Chiu and Tamara L. Dahlgren and Kostadin Damevski and Wael R. Elwasif 15568 and Thomas G. W. Epperly and Madhusudhan Govindaraju and Daniel S. Katz and James 15569 A. Kohl and Manoj Krishnan and Gary Kumfert and J. Walter Larson and Sophia 15570 Lefantzi and Michael J. Lewis and Allen D. Malony and Lois C. McInnes and Jarek 15571 Nieplocha and Boyana Norris and Steven G. Parker and Jaideep Ray and Sameer Shende 15572 and Theresa L. Windus and Shujia Zhou}, 15573 title = {A Component Architecture for High-Performance Scientific Computing}, 15574 journal = {Intl. J. High-Perf. Computing Appl.}, 15575 volume = {20}, 15576 pages = {163--202}, 15577 year = {2006}, 15578 note = {ACTS Collection special issue} 15579} 15580 15581@Misc{ cca-forum:homepage, 15582 author = {{Common Component Architecture Forum}}, 15583 note = {\url{http://www.cca-forum.org}}, 15584 year = {2010} 15585} 15586 15587@Misc{ petsc:driven-cavity-example, 15588 title = {{PETSc Driven Cavity Example Code}}, 15589 author = {B. F. {Smith et al.}}, 15590 howpublished = {\url{https://petsc.org/release/src/snes/tutorials/ex19.c.html}} 15591} 15592 15593@Misc{ petsc-dm:webpage, 15594 author = {B. F. {Smith et al.}}, 15595 title = {{PETSc DM Webpage}}, 15596 howpublished = {\url{https://petsc.org/release/manualpages/DM/}}, 15597 year = {2018} 15598} 15599 15600@Misc{ unic-ref, 15601 author = {Giuseppe Palmiotti}, 15602 title = {{UNIC} Neutronics Software}, 15603 note = {Nuclear Engineering Division, Argonne National Laboratory} 15604} 15605 15606% ----------------------------------------------------------------------- 15607% Model coupling refs 15608@Book{ greve-blatter, 15609 author = {Ralf Greve and Heinz Blatter}, 15610 title = {Dynamics of Ice Sheets and Glaciers}, 15611 series = {Advances in Geophysical and Environmental Mechanics and Mathematics}, 15612 publisher = {Springer}, 15613 year = {2009} 15614} 15615 15616@Misc{ doe-isicles, 15617 key = {ISICLES}, 15618 title = {Ice {S}heet {I}nitiative for {CL}-imate {E}xtreme{S}}, 15619 howpublished = {\url{http://www.csm.ornl.gov/ISICLES/index.html}} 15620} 15621 15622@Article{ safta2011tchem, 15623 title = {TChem-a software toolkit for the analysis of complex kinetic models}, 15624 author = {Safta, Cosmin and Najm, Habib N and Knio, Omar}, 15625 journal = {Sandia Report, SAND2011-3282}, 15626 year = {2011} 15627} 15628 15629@Misc{ chemkin-website, 15630 key = {chemkin}, 15631 title = {ANSYS Chemkin-Pro Website}, 15632 howpublished = {\url{http://www.ansys.com/products/fluids/ansys-chemkin-pro}}, 15633 year = {2017} 15634} 15635 15636@Misc{ mct-website, 15637 key = {MCT}, 15638 title = {{M}odel {C}oupling {T}oolkit ({MCT}) {W}eb {S}ite}, 15639 howpublished = {\url{http://www.mcs.anl.gov/mct}} 15640} 15641 15642@Article{ larson:05, 15643 author = {Jay Larson and Robert Jacob and Everest Ong}, 15644 title = {{The Model Coupling Toolkit}: A New {Fortran90} Toolkit for Building 15645 Multi-Physics Parallel Coupled Models}, 15646 journal = {Int. J. High Perf. Comp. App.}, 15647 year = {2005}, 15648 pages = {277--292} 15649} 15650 15651@Article{ dennis2012computational, 15652 title = {Computational performance of ultra-high-resolution capability in the Community 15653 Earth System Model}, 15654 author = {Dennis, John M and Vertenstein, Mariana and Worley, Patrick H and Mirin, Arthur A 15655 and Craig, Anthony P and Jacob, Robert and Mickelson, Sheri}, 15656 journal = {International Journal of High Performance Computing Applications}, 15657 volume = {26}, 15658 number = {1}, 15659 pages = {5--16}, 15660 year = {2012}, 15661 publisher = {SAGE Publications} 15662} 15663 15664@InProceedings{ bettge01, 15665 author = {T. Bettge and A. Craig and R. James and V. Wayland and G. Strand}, 15666 year = {2001}, 15667 title = {The {DOE} Parallel Climate Model {(PCM)}: The Computational Highway and 15668 Backroads}, 15669 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15670 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15671 pages = {148 -- 156}, 15672 series = {Lecture Notes in Computer Science}, 15673 volume = {2073}, 15674 publisher = {Springer-Verlag} 15675} 15676 15677@InProceedings{ jacob01, 15678 author = {R. Jacob and C. Schafer and I. Foster and M. Tobis and J. Anderson}, 15679 year = {2001}, 15680 title = {Computational Design and Performance of the {Gast} Ocean Atmosphere Model}, 15681 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15682 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15683 series = {Lecture Notes in Computer Science}, 15684 volume = {2073}, 15685 publisher = {Springer-Verlag} 15686} 15687 15688@Article{ chen2008new, 15689 title = {New generation of multi-scale {NWP} system {(GRAPES)}: General scientific 15690 design}, 15691 author = {Chen, DeHui and Xue, JiShan and Yang, XueSheng and Zhang, HongLiang and Shen, 15692 XueShun and Hu, JiangLin and Wang, Yu and Ji, LiRen and Chen, JiaBin}, 15693 journal = {Chinese Science Bulletin}, 15694 volume = {53}, 15695 number = {22}, 15696 pages = {3433--3445}, 15697 year = {2008}, 15698 publisher = {Springer} 15699} 15700 15701@InProceedings{ baum01, 15702 author = {J. Baum and H. Luo and E. Mestreau and D. Sharov and R. Loehner and D. Pelessone 15703 and C. Charman}, 15704 year = {2001}, 15705 title = {Recent Developments of a Coupled {CFD/CSD} Methodology}, 15706 booktitle = {Proc. International Conference on Computational Science (ICCS) 2001}, 15707 editors = {V. N. Alexandrow and J. J. Dongarra and C. J. K. Tan}, 15708 series = {Lecture Notes in Computer Science}, 15709 volume = {2073}, 15710 publisher = {Springer-Verlag} 15711} 15712 15713@InProceedings{ lefantzi03, 15714 author = {S. Lefantzi and J. Ray}, 15715 year = {2003}, 15716 title = {A Component-based Scientific Toolkit for Reacting Flows}, 15717 booktitle = {Proc. Second MIT Conference on Computational Fluid and Solid Mechanics}, 15718 volume = {2}, 15719 publisher = {Elsevier} 15720} 15721 15722@Article{ boville98, 15723 author = {B. A. Boville and P. R. Gent}, 15724 title = {The {NCAR} Climate System Model, Version One}, 15725 journal = {Journal of Climate}, 15726 volume = {11}, 15727 year = {1998}, 15728 pages = {1115--1130} 15729} 15730 15731@Misc{ paraschivoiu99, 15732 author = {M. Paraschivoiu and X.-C. Cai and M. Sarkis and D. P. Young and D. Keyes}, 15733 title = {Multi-domain multi-model formulation for compressible flows: Conservative 15734 interface coupling and parallel implicit solvers for {3D} unstructured meshes}, 15735 note = {AIAA Paper 99-0784}, 15736 year = {1999} 15737} 15738 15739@Article{ peszynska, 15740 author = {M. Peszynska and M. F. Wheeler and I. Yotov}, 15741 title = {Mortar upscaling for multiphysics flow in porous media}, 15742 journal = {Computational Geosciences} 15743} 15744 15745@TechReport{ wheeler00, 15746 author = {M. F. Wheeler and J. Wheeler and M. Peszynska}, 15747 title = {A distributed computing portal for coupling multi-physics and multiple domains in 15748 porous media}, 15749 institution = {University of Texas at Austin}, 15750 number = {TICAM 00-03}, 15751 year = {2000} 15752} 15753 15754@TechReport{ peszynska00, 15755 author = {M. Peszynska and Q. Lu and M. F. Wheeler}, 15756 title = {Multiphysics Coupling of Codes}, 15757 institution = {University of Texas at Austin}, 15758 number = {TICAM 00-02}, 15759 year = {2000} 15760} 15761 15762@Article{ joshaghanijoodatnakshatrala2019, 15763 title = {A stabilized mixed discontinuous Galerkin formulation for double 15764 porosity/permeability model}, 15765 author = {MS Joshaghani and SHS Joodat and KB Nakshatrala}, 15766 journal = {Computer Methods in Applied Mechanics and Engineering}, 15767 volume = {352}, 15768 pages = {508--560}, 15769 year = {2019} 15770} 15771 15772@InProceedings{ cai99, 15773 author = {X.-C. Cai and M. Paraschivoiu and M. Sarkis}, 15774 title = {An explicit multi-model compressible flow formulation based on the full potential 15775 equation and the {Euler} equations on {3D} unstructured meshes}, 15776 booktitle = {Proceedings of the 11th International Conference on Domain Decomposition 15777 Methods}, 15778 editor = {C-H. Lai and P. Bjorstad and M. Cross and O. Widlund}, 15779 year = {1999} 15780} 15781 15782@Article{ he05, 15783 author = {Yun He and Chris H. Q. Ding}, 15784 title = {Coupling Multi-Component Models with {MPH} on Distributed Memory Computer 15785 Architectures}, 15786 year = {2005}, 15787 volume = {19}, 15788 pages = {329--240}, 15789 number = {3}, 15790 journal = {Int. Journal of High Performance Computing Applications} 15791} 15792 15793@InProceedings{ uiuc-rocket-center02, 15794 author = {W. A. Dick and M. T. Heath}, 15795 title = {Whole System Simulation of Solid Propellant Rockets}, 15796 booktitle = {Proceedings of the AIAA Joint Propulsion Conference, AIAA2002-4345}, 15797 month = jul, 15798 year = {2002} 15799} 15800 15801@InProceedings{ toth04, 15802 author = {G. Toth and O. Volberg and A. J. Ridley and T. I Gombosi and D. DeZeeuw and K. W. 15803 Hansen and D. R. Chesney and Q. F. Stout and K. G. Powell and K. Kane and R. 15804 Oehmke}, 15805 title = {A Physics-Based Software Framework for Sun-Earth Connection Modeling}, 15806 editor = {A. T. Y. Lui and Y. Kamide and G. Consolini}, 15807 booktitle = {Multiscale Coupling of Sun-Earth Processes, Proceedings of the Conference on the 15808 Sun-Earth Connection}, 15809 year = {2004}, 15810 publisher = {Elsevier}, 15811 pages = {383--397} 15812} 15813 15814@Misc{ csdrm:web, 15815 author = {M. Aivazis and B. Goddard and D. Meiron and M. Ortiz and J. Pool and J. 15816 Shepherd}, 15817 title = {{Center for Simulation of Dynamic Response of Materials}}, 15818 note = {California Institute of Technology, see \url{http://csdrm.caltech.edu}} 15819} 15820 15821@Misc{ csar:web, 15822 author = {M. {Heath (Director)}}, 15823 title = {{Center for Simulation of Advanced Rockets}}, 15824 note = {University of Illinois at Urbana-Champaign, see \url{http://www.csar.uiuc.edu}} 15825} 15826 15827@Misc{ csafe:web, 15828 author = {D. {Pershing (Director)}}, 15829 title = {{Center for Simulation of Accidental Fires and Explosions}}, 15830 note = {University of Utah, see \url{http://www.csafe.utah.edu}} 15831} 15832 15833@Misc{ cits:web, 15834 author = {P. {Moin (Director)}}, 15835 title = {{Center for Integrated Turbulence Simulations}}, 15836 note = {Stanford University, see \url{http://www.stanford.edu/group/cits}} 15837} 15838 15839@Misc{ flash:web, 15840 author = {D. {Lamb (Director)}}, 15841 title = {{Center for Integrated Turbulence Simulations}}, 15842 note = {University of Chicago, see \url{http://flash.uchicago.edu}} 15843} 15844 15845@TechReport{ utah-csafe03, 15846 author = {J. Guilkey and T. Harman and A. Xia and B. Kashiwa and P. McMurtry}, 15847 title = {An Eulerian-Lagrangian Approach for Large Deformation Fluid Structure Interaction 15848 Problems, Part 1: Algorithm Development}, 15849 institution = {University of Utah, Center for the Simulation of Accidental Fires and 15850 Explosions}, 15851 year = {2003} 15852} 15853 15854@InBook{ shepherd07, 15855 author = {M. Shepherd and E. Seol and B. FrantzDale}, 15856 title = {Toward a Multi-Model Hierarchy to Support Multiscale Simulations}, 15857 year = {2007}, 15858 booktitle = {CRC Handbook of Dynamic System Modeling}, 15859 publisher = {Wiley}, 15860 pages = {1--41}, 15861 note = {also available as SCOREC Report 2007-2, Rensselaer Polytechnic Institute} 15862} 15863 15864@InProceedings{ cactus02, 15865 author = {Tom Goodale and Gabrielle Allen and Gerd Lanfermann and Joan Masso and Thomas 15866 Radke and Edward Seidel and John Shalf}, 15867 title = {The {Cactus} Framework and Toolkit: Design and Applications}, 15868 booktitle = {VECPAR'2002, 5th International Conference, Lecture Notes in Computer Science}, 15869 year = {2002}, 15870 url = {http://www.cactuscode.org/Papers/VecPar_2002.pdf} 15871} 15872 15873@Misc{ cactus:homepage, 15874 author = {G. {Allen et al.}}, 15875 title = {{Cactus Web page}}, 15876 howpublished = {\url{http://cactuscode.org}} 15877} 15878 15879@Misc{ open-grid-forum:web, 15880 key = {{Open Grid Forum}}, 15881 title = {{Open Grid Forum}}, 15882 note = {See \url{http://www.ogf.org}} 15883} 15884 15885@Misc{ nox:web, 15886 author = {Tamara Kolda and Roger {Pawlowski et al.}}, 15887 title = {Nonlinear Object-Oriented Solutions {(NOX)}}, 15888 note = {See \url{http://software.sandia.gov/nox}} 15889} 15890 15891@Misc{ chombo:web, 15892 author = {P. {Colella (PI)}}, 15893 title = {{Chombo}}, 15894 note = {See \url{http://seesar.lbl.gov/anag/chombo}} 15895} 15896 15897@Article{ lanzkron96, 15898 author = {P. J. Lanzkron and D. J. Rose and J. T. Wilkes}, 15899 title = {An Analysis of Approximate Nonlinear Elimination}, 15900 journal = {SIAM J. Sci. Comput.}, 15901 volume = {17}, 15902 year = {1996}, 15903 pages = {538--559} 15904} 15905 15906@Article{ jiang95, 15907 author = {J. Jiang and P. Forsyth}, 15908 title = {Robust Linear and Nonlinear Strategies for Solution of the Transonic {Euler} 15909 Equations}, 15910 journal = {Computers and Fluids}, 15911 volume = {24}, 15912 pages = {753--770}, 15913 year = {1995} 15914} 15915 15916@Article{ young90, 15917 author = {D. Young and R. Melbin and M. Bieterman and F. Johnson and S. Samant}, 15918 title = {Global Convergence of Inexact {Newton} Methods for Transonic Flow}, 15919 journal = {Int. J. Numer. Methods Fluids}, 15920 volume = {11}, 15921 pages = {1075--1095}, 15922 year = {1990} 15923} 15924 15925@Article{ fishwick04, 15926 author = {Paul A. Fishwick}, 15927 title = {Toward an Integrated Multimodeling Interface: A Human-Computer Interface Approach 15928 to Interrelating Model Structures}, 15929 journal = {SCS Trans. on Simulation}, 15930 note = {Special Issue in Grand Challenges in Computer Simulation}, 15931 year = {2004} 15932} 15933 15934@Article{ fishwick03, 15935 author = {Paul Fishwick and Jinho Lee and Minho Park and Jyunju Shim}, 15936 title = {{RUBE}: A Customized {2D} and {3D} Modeling Framework for Simulation}, 15937 booktitle = {Proceedings of the 2003 Winter Simulation Conference}, 15938 editor = {S. Chick and P. J. Sanchez and D. Ferrin and D. J. Morrice}, 15939 year = {2003} 15940} 15941 15942@InProceedings{ kirner00, 15943 author = {T. G. Kirner and V. F. Martins}, 15944 title = {Development of an Information Visualization Tool Using Virtual Reality}, 15945 booktitle = {Proceedings of the 2000 ACM Symposium on Applied Computing}, 15946 year = {2000}, 15947 pages = {604--606} 15948} 15949 15950@InProceedings{ orso03, 15951 author = {A. Orso and J. Jones and M. J. Harrold}, 15952 title = {Visualization of Program-Execution Data for Deployed Software}, 15953 booktitle = {Proceedings of the 2003 ACM Symposium on Software Visualization}, 15954 year = {2003}, 15955 pages = {67--76} 15956} 15957 15958@Book{ tiller01, 15959 author = {M. Tiller}, 15960 title = {Introduction to Physical System Modeling with Modelica}, 15961 series = {Kluwer International Series inEngineering and Computer Science}, 15962 volume = {615}, 15963 publisher = {Kluwer}, 15964 year = {2001} 15965} 15966 15967@Article{ buck94, 15968 author = {J. Buck and S. Ha and E. Lee and D. Messerschmitt}, 15969 title = {Ptolemy: A Framework for Simulating and Prototyping Heterogeneous Systems}, 15970 journal = {Int. Journal of Computer Simulation}, 15971 volume = {4}, 15972 pages = {155--182}, 15973 year = {1994} 15974} 15975 15976@Article{ mu95, 15977 author = {M. Mu and J.R. Rice}, 15978 title = {Modeling with collaborating {PDE} solvers - Theory and practice}, 15979 journal = {Comp. Syst. Engr.}, 15980 volume = {6}, 15981 year = {1995}, 15982 pages = {87--95} 15983} 15984 15985@TechReport{ drashansky96, 15986 title = {Multidisciplinary Problem Solving using Agents in a Cluster Environment}, 15987 author = {R. Drashansky and A. Joshi and J. R. Rice}, 15988 institution = {Emory Universtity, Department of Mathematics and Computer Science}, 15989 year = {1996} 15990} 15991 15992@Article{ michopoulos05, 15993 title = {Survey on Modeling and Simulation of Multiphysics Systems}, 15994 author = {John G. Michopoulos and Charbel Farhat and Jacob Fish}, 15995 journal = {Journal of Computing and Information Science in Engineering}, 15996 volume = {5}, 15997 issue = {3}, 15998 pages = {198--213}, 15999 year = {2005} 16000} 16001 16002@Article{ dubey09, 16003 title = {Extensibe Component-Based Architecture for {FLASH}, a Massively Parallel 16004 Multiphysics Simulation Code}, 16005 author = {A. Dubey and K. Antypass and M. Ganapathy and L. Reid and D. Sheeler and A. 16006 Siegel and K. Weide}, 16007 journal = {Parallel Computing}, 16008 volume = {35}, 16009 issue = {10 -- 11}, 16010 pages = {512 -- 522}, 16011 year = {2009} 16012} 16013 16014@Book{ bottloring95, 16015 author = {Raoul Bott and Loring W. Tu}, 16016 title = {Differential Forms in Algebraic Topology}, 16017 publisher = {Springer}, 16018 year = {1995} 16019} 16020 16021@Book{ kobayashinomizu96, 16022 author = {Shoshichi Kobayashi and Katsumi Nomizu}, 16023 title = {Foundations of Differential Geometry}, 16024 publisher = {Wiley-Interscience}, 16025 year = {1996} 16026} 16027 16028@Article{ hornungkohn02, 16029 author = {Richard D. Hornung and Scott R. Kohn}, 16030 title = {Managing Application Complexity in the SAMRAI Object-Oriented Framework}, 16031 journal = {Concurrency and Computation: Practice and Experience}, 16032 volume = {14}, 16033 pages = {347--368}, 16034 year = {2002} 16035} 16036 16037@InProceedings{ concepts06, 16038 author = {Douglas Gregor and Jaakko J{\"a}rvi and Jeremy Siek and Bjarne Stroustrup and 16039 Gabriel Dos Reis and Andrew Lumsdaine}, 16040 title = {Concepts: Linguistic Support for Generic Programming in C++}, 16041 booktitle = {Proceedings of OOPSLA 2006}, 16042 year = {2006}, 16043 pages = {???--???} 16044} 16045 16046@Book{ hatcher02, 16047 author = {Hatcher, Allen}, 16048 title = {Algebraic Topology}, 16049 publisher = {Cambridge University Press}, 16050 year = {2002} 16051} 16052 16053@Book{ gammahelmjohnsonvlissides95, 16054 abstract = {{Design Patterns is a modern classic in the literature of object-oriented 16055 development, offering timeless and elegant solutions to common problems in 16056 software design. It describes patterns for managing object creation, composing 16057 objects into larger structures, and coordinating control flow between objects. The 16058 book provides numerous examples where using composition rather than inheritance 16059 can improve the reusability and flexibility of code. Note, though, that it's not a 16060 tutorial but a catalog that you can use to find an object-oriented design pattern 16061 that's appropriate for the needs of your particular application--a selection for 16062 virtuoso programmers who appreciate (or require) consistent, well-engineered 16063 object-oriented designs.} {Now on CD, this internationally acclaimed bestseller is 16064 more valuable than ever! 16065 16066 Use the contents of the CD to create your own design documents and reusable 16067 components. The CD contains: 23 patterns you can cut and paste into your own 16068 design documents; sample code demonstrating pattern implementation; complete 16069 Design Patterns content in standard HTML format, with numerous hyperlinked 16070 cross-references; accessed through a standard web browser; Java-based dynamic 16071 search mechanism, enhancing online search capabilities; graphical user environment, 16072 allowing ease of navigation. 16073 16074 First published in 1995, this landmark work on object-oriented software design 16075 presents a catalog of simple and succinct solutions to common design problems. 16076 Created by four experienced designers, the 23 patterns contained herein have 16077 become an essential resource for anyone developing reusable object-oriented 16078 software. In response to reader demand, the complete text and pattern catalog are 16079 now available on CD-ROM. This electronic version of Design Patterns enables 16080 programmers to install the book directly onto a computer or network for use as an 16081 online reference for creating reusable object-oriented software. 16082 16083 The authors first describe what patterns are and how they can help you in the 16084 design process. They then systematically name, explain, evaluate, and catalog 16085 recurring designs in object-oriented systems. All patterns are compiled from 16086 real-world examples and include code that demonstrates how they may be implemented 16087 in object-oriented programming languages such as C++ and Smalltalk. Readers who 16088 already own the book will want the CD to take advantage of its dynamic search 16089 mechanism and ready-to-install patterns.}}, 16090 author = {Gamma, Erich and Helm, Richard and Johnson, Ralph and Vlissides, John}, 16091 citeulike-article-id={115158}, 16092 howpublished = {Hardcover}, 16093 isbn = {0201633612}, 16094 keywords = {1995 algorithms architecture book books computer computing design design-pattern 16095 design-patterns design_patterns designpatterns development diplom entwurfsmuster 16096 four gang gof java mathgamespatterns no-tag object object-orientation 16097 object-oriented of oo-patterns oop oriented pattern patterns programming se 16098 software software-development software-engineering software_design 16099 softwareengineering standard}, 16100 month = jan, 16101 publisher = {{Addison-Wesley Professional}}, 16102 title = {Design Patterns}, 16103 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0201633612}, 16104 year = {1995} 16105} 16106 16107@InProceedings{ chaco95, 16108 author = {Bruce Hendrickson and Robert Leland}, 16109 title = {A multilevel algorithm for partitioning graphs}, 16110 booktitle = {Supercomputing '95: Proceedings of the 1995 ACM/IEEE Conference on Supercomputing 16111 (CDROM)}, 16112 year = {1995}, 16113 isbn = {0-89791-816-9}, 16114 pages = {28}, 16115 location = {San Diego, California, United States}, 16116 doi = {10.1145/224170.224228}, 16117 publisher = {ACM Press}, 16118 address = {New York} 16119} 16120 16121@Book{ aleksandrov98, 16122 author = {Aleksandrov, Pavel S.}, 16123 title = {Combinatorial Topology}, 16124 publisher = {Dover}, 16125 volume = {3}, 16126 year = {1998} 16127} 16128 16129@Book{ steenrod99, 16130 abstract = {{ Fibre bundles, now an integral part of differential geometry, are also of great 16131 importance in modern physics--such as in gauge theory. This book, a succinct 16132 introduction to the subject by renown mathematician Norman Steenrod, was the first 16133 to present the subject systematically. 16134 16135 It begins with a general introduction to bundles, including such topics as 16136 differentiable manifolds and covering spaces. The author then provides brief 16137 surveys of advanced topics, such as homotopy theory and cohomology theory, before 16138 using them to study further properties of fibre bundles. The result is a classic 16139 and timeless work of great utility that will appeal to serious mathematicians and 16140 theoretical physicists alike. }}, 16141 author = {Steenrod, Norman}, 16142 citeulike-article-id={712999}, 16143 howpublished = {Paperback}, 16144 isbn = {0691005486}, 16145 keywords = {fibre_bundles topology}, 16146 month = apr, 16147 publisher = {{Princeton University Press}}, 16148 title = {The Topology of Fibre Bundles. (PMS-14)}, 16149 url = {http://www.amazon.ca/exec/obidos/redirect?tag=citeulike04-20{\&}path=ASIN/0691005486}, 16150 year = {1999} 16151} 16152 16153@Book{ bredon97, 16154 author = {Bredon, Glen E.}, 16155 title = {Sheaf Theory}, 16156 publisher = {Springer}, 16157 pages = {524}, 16158 series = {Graduate Texts in Mathematics}, 16159 year = {1997} 16160} 16161 16162@TechReport{ tautgesmeyers04, 16163 title = {{MOAB}: A Mesh-Oriented Database}, 16164 author = {Timothy J. Tautges and Ray Meyers and Karl Merkley and Clint Stimpson and Corey 16165 Ernst}, 16166 institution = {Sandia National Laboratories}, 16167 number = {SAND2004-1592}, 16168 month = apr, 16169 year = {2004} 16170} 16171 16172@Article{ tautges04, 16173 author = {Timothy J. Tautges}, 16174 title = {{MOAB}-{SD}: Integrated Structured and Unstructured Mesh Representation}, 16175 journal = {Engineering With Computers}, 16176 volume = {20}, 16177 pages = {286--293}, 16178 year = {2004} 16179} 16180 16181@InProceedings{ meyers02, 16182 author = {Ray Meyers et. al}, 16183 title = {{SNL} Implementation of the {TSTT} Mesh Interface}, 16184 booktitle = {8th International conference on numerical grid generation in computational field 16185 simulations}, 16186 month = jun, 16187 year = {2002} 16188} 16189 16190@InProceedings{ seolshepard05, 16191 author = {E. S. Seol and Mark S. Shephard}, 16192 title = {A Flexible Distributed Mesh Data Structure to Support Parallel Adaptive 16193 Analysis}, 16194 booktitle = {Proceedings of the 8th US National Congress on Computational Mechanics}, 16195 year = {2005} 16196} 16197 16198@Article{ beallwalshshephard04, 16199 author = {Mark W. Beall and Joe Walsh and Mark S. Shephard}, 16200 title = {A comparison of techniques for geometry access related to mesh generation}, 16201 journal = {Engineering With Computers}, 16202 volume = {20}, 16203 number = {3}, 16204 pages = {210--221}, 16205 year = {2004} 16206} 16207 16208@Article{ careyandersoncarneskirk04, 16209 author = {Graham F. Carey and Michael L. Anderson and Brian R. Carnes and Benjamin S. 16210 Kirk}, 16211 title = {Some aspects of adaptive grid technology related to boundary and interior 16212 layers}, 16213 journal = {Journal of Computational Applied Mathematics}, 16214 volume = {166}, 16215 number = {1}, 16216 pages = {55--86}, 16217 year = {2004} 16218} 16219 16220@PhDThesis{ gralthesis, 16221 author = {Guntram Berti}, 16222 title = {Generic Software Components for Scientific Computing}, 16223 school = {TU Cottbus}, 16224 year = {2000}, 16225 note = {\url{http://www.math.tu-cottbus.de/~berti/diss}} 16226} 16227 16228@Article{ whitehead1949, 16229 title = {Combinatorial homotopy. I}, 16230 author = {John HC Whitehead}, 16231 journal = {Bulletin of the American Mathematical Society}, 16232 volume = {55}, 16233 number = {3. P1}, 16234 pages = {213--245}, 16235 year = {1949}, 16236 publisher = {American Mathematical Society} 16237} 16238 16239@Article{ beylkincoifmanrokhlin91, 16240 author = {Gregory Beylkin and Ronald Coifman and Vladimir Rokhlin}, 16241 title = {Fast Wavelet Transforms and Numerical Algorithms {I}}, 16242 journal = {Communications on Pure and Applied Mathematics}, 16243 volume = {44}, 16244 pages = {141--183}, 16245 year = {1991} 16246} 16247 16248@Book{ wesseling92, 16249 author = {Pieter Wesseling}, 16250 title = {An Introduction to Multigrid Methods}, 16251 publisher = {John Wiley and Sons}, 16252 year = {1992} 16253} 16254 16255@Book{ grakakos04, 16256 author = {Loukas Grakakos}, 16257 title = {Classical and Modern Fourier Analysis}, 16258 publisher = {Pearson Education}, 16259 address = {New Jersey}, 16260 year = {2004} 16261} 16262 16263@Misc{ hlib-web-page, 16264 key = {HLib}, 16265 title = {{HLib} {Web} page}, 16266 note = {{\texttt{http://www.hlib.org/}}}, 16267 annote = {Hierarchical matrices for fast integral transform} 16268} 16269 16270@Article{ hackbusch99, 16271 author = {Wolfgang Hackbusch}, 16272 title = {A sparse matrix arithmetic based on {$\mathcal H$}-matrices. Part {I}: 16273 Introduction to {$\mathcal H$}-matrices}, 16274 journal = {Computing}, 16275 volume = {62}, 16276 pages = {89--108}, 16277 year = {1999} 16278} 16279 16280@TechReport{ kay1999green, 16281 title = {A {G}reen's function preconditioner for the steady-state {N}avier-{S}tokes 16282 equations}, 16283 author = {Kay, D. and Loghin, D.}, 16284 year = {1999}, 16285 institution = {Oxford University Computing Laboratory}, 16286 number = {99/06} 16287} 16288 16289@Article{ bebendorf2003existence, 16290 title = {Existence of {$\mathcal H$}-matrix approximants to the inverse {FE}-matrix of 16291 elliptic operators with {$L^\infty$}-coefficients}, 16292 author = {Bebendorf, M. and Hackbusch, W.}, 16293 journal = {Numerische Mathematik}, 16294 volume = {95}, 16295 number = {1}, 16296 pages = {1--28}, 16297 year = {2003}, 16298 publisher = {Springer} 16299} 16300 16301@Article{ hackbusch2005direct, 16302 title = {Direct {S}chur complement method by domain decomposition based on {$\mathcal 16303 H$}-matrix approximation}, 16304 author = {Hackbusch, W. and Khoromskij, B.N. and Kriemann, R.}, 16305 journal = {Computing and Visualization in Science}, 16306 volume = {8}, 16307 number = {3}, 16308 pages = {179--188}, 16309 year = {2005}, 16310 publisher = {Springer} 16311} 16312 16313@TechReport{ duphof2003, 16314 author = {T. Dupont and J. Hoffman and C. Johnson and R. C. Kirby and M. G. Larson and A. 16315 Logg and L. R. Scott}, 16316 title = {The {FE}ni{CS} project}, 16317 institution = {Chalmers Finite Element Center Preprint Series}, 16318 number = {2003--21}, 16319 year = {2003} 16320} 16321 16322@Article{ flame01, 16323 author = {John A. Gunnels and Fred G. Gustavson and Greg M. Henry and Robert A. van de 16324 Geijn}, 16325 title = {{FLAME}: Formal Linear Algebra Methods Environment}, 16326 journal = {Transactions on Mathematical Software}, 16327 volume = {27}, 16328 number = {4}, 16329 year = {2001}, 16330 pages = {422--455} 16331} 16332 16333@Article{ puschel05, 16334 author = {Markus P{\"u}schel and Jos{\'e} M. F. Moura and Jeremy Johnson and David Padua 16335 and Manuela Veloso and Bryan W. Singer and Jianxin Xiong and Franz Franchetti and 16336 Aca Ga\v{c}i\'{c} and Yevgen Voronenko and Kang Chen and Robert W. Johnson and 16337 Nick Rizzolo}, 16338 title = {{SPIRAL}: Code Generation for {DSP} Transforms}, 16339 journal = {Proceedings of the IEEE}, 16340 volume = {93}, 16341 number = {2}, 16342 year = {2005}, 16343 note = {special issue on "Program Generation, Optimization, and Adaptation"} 16344} 16345 16346@Article{ kirbylogg06, 16347 author = {Robert C. Kirby and Anders Logg}, 16348 title = {A compiler for variational forms}, 16349 journal = {ACM Transactions on Mathematical Software}, 16350 volume = {32}, 16351 number = {3}, 16352 year = {2006}, 16353 issn = {0098-3500}, 16354 pages = {417--444}, 16355 doi = {10.1145/1163641.1163644}, 16356 publisher = {ACM Press}, 16357 address = {New York, NY} 16358} 16359 16360@Article{ kirbylogg07, 16361 author = {Robert C. Kirby and Anders Logg}, 16362 title = {Efficient compilation of a class of variational forms}, 16363 journal = {ACM Transactions on Mathematical Software}, 16364 volume = {33}, 16365 number = {3}, 16366 year = {2007}, 16367 issn = {0098-3500}, 16368 pages = {17}, 16369 doi = {10.1145/1268769.1268771}, 16370 publisher = {ACM Press}, 16371 address = {New York, NY} 16372} 16373 16374@Article{ bankdupont81, 16375 author = {Randolph Bank and Todd Dupont}, 16376 title = {An optimal order process for solving finite element equations}, 16377 journal = {Mathematics of Computation}, 16378 volume = {36}, 16379 pages = {35--51}, 16380 year = {1981} 16381} 16382 16383@TechReport{ adams00, 16384 author = {Mark F. Adams}, 16385 title = {Evaluation of three unstructured multigrid methods on 3D finite element problems 16386 in solid mechanics}, 16387 institution = {UC Berkeley}, 16388 number = {CSD-00-1103}, 16389 year = {2000}, 16390 url = {citeseer.ist.psu.edu/article/adams00evaluation.html} 16391} 16392 16393@Article{ bergengradlhuelsemannruede06, 16394 author = {Benjamin Bergen and Tobias Gradl and Frank H\"ulsemann and Ulrich R\"ude}, 16395 title = {A Massively Parallel Multigrid Method for Finite Elements}, 16396 journal = {Computing in Science \& Engineering}, 16397 volume = {8}, 16398 number = {6}, 16399 pages = {56--62}, 16400 year = {2006} 16401} 16402 16403@MastersThesis{ brunethesis08, 16404 author = {Peter R. Brune}, 16405 title = {Enabling Unstructured Multigrid Under the Sieve Framework}, 16406 school = {University of Chicago}, 16407 address = {Chicago, IL}, 16408 year = {2008}, 16409 month = feb 16410} 16411 16412@Article{ arnoldwinther02, 16413 author = {Douglas N. Arnold and Ragnar Winther}, 16414 title = {Mixed finite elements for elasticity}, 16415 journal = {Numerische Mathematik}, 16416 volume = {92}, 16417 number = {3}, 16418 month = sep, 16419 year = {2002}, 16420 pages = {401--419}, 16421 doi = {10.1007/s002110100348} 16422} 16423 16424@Article{ arnoldfalkwinther06, 16425 author = {Douglas N. Arnold and Richard S. Falk and Ragnar Winther}, 16426 title = {Finite element exterior calculus, homological techniques, and applications}, 16427 journal = {Acta Numerica}, 16428 year = {2006}, 16429 volume = {15}, 16430 pages = {1--155}, 16431 publisher = {Cambridge University Press}, 16432 doi = {10.1017/S0962492906210018} 16433} 16434 16435@Article{ kirby04, 16436 author = {Robert C. Kirby}, 16437 title = {Algorithm 839: {FIAT}, a new paradigm for computing finite element basis 16438 functions}, 16439 journal = {ACM Transactions on Mathematical Software}, 16440 volume = {30}, 16441 number = {4}, 16442 year = {2004}, 16443 issn = {0098-3500}, 16444 pages = {502--516}, 16445 doi = {10.1145/1039813.1039820}, 16446 publisher = {ACM Press}, 16447 address = {New York, NY} 16448} 16449 16450@Article{ kirby06, 16451 author = {Robert C. Kirby}, 16452 title = {Optimizing {FIAT} with level 3 {BLAS}}, 16453 journal = {ACM Transactions on Mathematical Software}, 16454 volume = {32}, 16455 number = {2}, 16456 year = {2006}, 16457 issn = {0098-3500}, 16458 pages = {223--235}, 16459 doi = {10.1145/1141885.1141889}, 16460 publisher = {ACM Press}, 16461 address = {New York, NY} 16462} 16463 16464@Misc{ bluecrystal08, 16465 author = {{B}lue {C}rystal Cluster}, 16466 title = {Advanced {C}omputing {R}esearch {C}entre{,} {University of Bristol}}, 16467 year = {2008}, 16468 note = {\url{http://www.acrc.bris.ac.uk/acrc/hpc.htm}} 16469} 16470 16471@Article{ beylkin95, 16472 author = {Gregory Beylkin}, 16473 title = {On the Fast Fourier Transform of Functions With Singularities}, 16474 journal = {Applied and Computational Harmonic Analysis}, 16475 volume = {2}, 16476 pages = {363--381}, 16477 year = {1995} 16478} 16479 16480@InProceedings{ riehl08, 16481 author = {Jonathan Riehl}, 16482 title = {Implementing the MyFEM Embedded Domain-specific Language}, 16483 booktitle = {Proceedings of the Second International Workshop on Domain-specific Program 16484 Development (DSPD'08)}, 16485 address = {Nashville, TN}, 16486 year = {2008} 16487} 16488 16489@Article{ appel85, 16490 author = {Andrew W. Appel}, 16491 date-added = {2008-02-27 12:23:39 +0000}, 16492 date-modified = {2008-02-27 12:24:02 +0000}, 16493 doi = {10.1137/0906008}, 16494 journal = {SIAM Journal on Scientific and Statistical Computing}, 16495 keywords = {treecodes}, 16496 number = {1}, 16497 pages = {85-103}, 16498 publisher = {SIAM}, 16499 title = {An Efficient Program for Many-Body Simulation}, 16500 volume = {6}, 16501 year = {1985} 16502} 16503 16504@Article{ ewald21, 16505 author = {{Ewald}, P.~P.}, 16506 title = {{Die Berechnung optischer und elektrostatischer Gitterpotentiale}}, 16507 journal = {Annalen der Physik}, 16508 year = {1921}, 16509 volume = {369}, 16510 pages = {253-287}, 16511 doi = {10.1002/andp.19213690304}, 16512 adsurl = {http://adsabs.harvard.edu/abs/1921AnP...369..253E}, 16513 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 16514} 16515 16516@Article{ greengardrokhlin87, 16517 author = {L. Greengard and V. Rokhlin}, 16518 date-added = {2008-02-15 18:43:55 +0000}, 16519 date-modified = {2008-02-26 20:09:11 +0000}, 16520 doi = {10.1016/0021-9991(87)90140-9}, 16521 journal = {J. Comput.\ Phys.}, 16522 keywords = {FMM}, 16523 number = {2}, 16524 pages = {325--348}, 16525 title = {A Fast Algorithm for Particle Simulations}, 16526 url = {citeseer.ist.psu.edu/greengard87fast.html}, 16527 volume = {73}, 16528 year = {1987}, 16529 bdsk-url-1 = {citeseer.ist.psu.edu/greengard87fast.html} 16530} 16531 16532@Article{ greengardrokhlin97, 16533 author = {L. Greengard and V. Rokhlin}, 16534 title = {A New Version of the Fast Multipole Method for the Laplace Equation in Three 16535 Dimensions}, 16536 journal = {Acta Numerica}, 16537 volume = {6}, 16538 year = {1997}, 16539 pages = {229--269} 16540} 16541 16542@Article{ luchenghuangmccammon06, 16543 author = {Benzhuo Lu and Xiaolin Cheng and Jingfang Huang and J. Andrew McCammon}, 16544 title = {Order {N} algorithm for computation of electrostatic interactions in biomolecular 16545 systems}, 16546 journal = {PNAS}, 16547 doi = {10.1073/pnas.0605166103}, 16548 volume = {102}, 16549 number = {51}, 16550 year = {2006}, 16551 pages = {19314--19319} 16552} 16553 16554@Article{ schussnadlereisenberg01, 16555 author = {Zev Schuss and Boaz Nadler and Robert S. Eisenberg}, 16556 title = {Derivation of {P}oisson and {N}ernst-{P}lanck equations in a bath and channel 16557 from a molecular model}, 16558 journal = {Physical Review E}, 16559 volume = {64}, 16560 number = {3}, 16561 year = {2001} 16562} 16563 16564@Book{ hairerlubichwanner02, 16565 author = {E. Hairer and Ch. Lubich and G. Wanner}, 16566 title = {Geometric Numerical Integration}, 16567 publisher = {Springer-Verlag}, 16568 address = {Berlin Heidelberg}, 16569 year = {2002} 16570} 16571 16572@Article{ holstbakerwang00, 16573 author = {M. Holst and N. Baker and F. Wang}, 16574 title = {The adaptive multilevel finite element solution of the {P}oisson-{B}oltzmann 16575 equation on massively parallel computers}, 16576 journal = {Journal of Computational Chemistry}, 16577 volume = {21}, 16578 year = {2000} 16579} 16580 16581@Book{ hockneyeastwood81, 16582 author = {R. Hockney and J. Eastwood}, 16583 title = {Computer simulation using particles}, 16584 publisher = {McGraw-Hill}, 16585 address = {New York}, 16586 year = {1981} 16587} 16588 16589@Article{ lutydavistironigunsteren94, 16590 author = {Brock A. Luty and Malcolm E. Davis and Ilario G. Tironi and Wilfred F. Van 16591 Gunsteren}, 16592 title = {A Comparison of {P}article-{P}article, {P}article-{M}esh and {E}wald Methods for 16593 Calculating Electrostatic Interactions in Periodic Molecular Systems}, 16594 journal = {Molecular Simulation}, 16595 volume = {14}, 16596 number = {1}, 16597 year = {1994}, 16598 pages = {11--20} 16599} 16600 16601@Book{ briggshensonmccormick00, 16602 author = {Briggs,, William L. and Henson,, Van Emden and McCormick,, Steve F.}, 16603 title = {A Multigrid Tutorial (2nd ed.)}, 16604 year = {2000}, 16605 isbn = {0-89871-462-1}, 16606 publisher = {Society for Industrial and Applied Mathematics}, 16607 address = {Philadelphia, PA} 16608} 16609 16610@Article{ chartier2003spectral, 16611 title = {Spectral AMGe ($\rho$ AMGe)}, 16612 author = {Chartier, Tim and Falgout, RD and Henson, VE and Jones, J and Manteuffel, T and 16613 McCormick, S and Ruge, J and Vassilevski, PS}, 16614 journal = {SIAM Journal on Scientific Computing}, 16615 volume = {25}, 16616 number = {1}, 16617 pages = {1--26}, 16618 year = {2003}, 16619 publisher = {SIAM} 16620} 16621 16622@Article{ galvis2010domain, 16623 title = {Domain decomposition preconditioners for multiscale flows in high-contrast 16624 media}, 16625 author = {Galvis, Juan and Efendiev, Yalchin}, 16626 journal = {Multiscale Modeling \& Simulation}, 16627 volume = {8}, 16628 number = {4}, 16629 pages = {1461--1483}, 16630 year = {2010}, 16631 publisher = {SIAM} 16632} 16633 16634@Book{ brennerscott02, 16635 author = {Susanne~C. Brenner and L.~Ridgway Scott}, 16636 title = {The mathematical theory of finite element methods}, 16637 year = {2002}, 16638 isbn = {0-38795-451-1}, 16639 publisher = {Springer}, 16640 pages = {361} 16641} 16642 16643@Book{ trefethenbau97, 16644 author = {Lloyd N. Trefethen and David {Bau, III}}, 16645 title = {Numerical Linear Algebra}, 16646 publisher = {Society for Industrial and Applied Mathematics}, 16647 address = {Philadelphia, PA}, 16648 pages = {xii + 361}, 16649 year = {1997}, 16650 isbn = {0-89871-361-7}, 16651 isbn-13 = {978-0-89871-361-9}, 16652 lccn = {QA184 .T74 1997}, 16653 mrclass = {65-01 (65-02 65Fxx)}, 16654 mrnumber = {MR1444820 (98k:65002)}, 16655 mrreviewer = {Moody T. Chu}, 16656 bibdate = {Wed Jan 07 15:23:19 1998}, 16657 bibsource = {ftp://ftp.math.utah.edu/pub/bibnet/authors/t/trefethen-lloyd-n.bib} 16658} 16659 16660@Article{ liptonreagan2014, 16661 title = {Quantum Algorithms via Linear Algebra: A Primer}, 16662 author = {Richard J Lipton and Kenneth W Regan}, 16663 pages = {206}, 16664 isbn = {978-0-26202-839-4}, 16665 year = {2014} 16666} 16667 16668@InProceedings{ rhea08, 16669 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Georg Stadler and Eh 16670 Tan and T.~Tu and Lucas~C. Wilcox and Shijie Zhong}, 16671 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 16672 booktitle = {Proceedings of IEEE/ACM SC '08}, 16673 year = {2008} 16674} 16675 16676@Misc{ bursteddewilcox09, 16677 author = {Carsten Burstedde and Lucas~C. Wilcox}, 16678 title = {The p4est library: A parallel scalable forest of adaptive octrees}, 16679 note = {in preparation} 16680} 16681 16682@Article{ skeeltezcanhardy02, 16683 author = {R. D. Skeel and I. Tezcan and D. J. Hardy}, 16684 title = {Multiple Grid Methods for Classical Molecular Dynamics}, 16685 journal = {J. Comp. Chem.}, 16686 volume = {23}, 16687 pages = {673--684}, 16688 year = {2002} 16689} 16690 16691@Article{ verschelde99, 16692 author = {Jan Verschelde}, 16693 title = {Algorithm 795: PHCpack: a general-purpose solver for polynomial systems by 16694 homotopy continuation}, 16695 journal = {ACM Trans. Math. Softw.}, 16696 volume = {25}, 16697 number = {2}, 16698 issn = {0098-3500}, 16699 pages = {251--276}, 16700 doi = {10.1145/317275.317286}, 16701 publisher = {ACM}, 16702 address = {New York, NY}, 16703 year = {1999} 16704} 16705 16706@InProceedings{ sommeseverscheldewampler08, 16707 author = {Andrew J. Sommese and Jan Verschelde and Charles W. Wampler}, 16708 title = {Solving Polynomial Systems Equation by Equation}, 16709 booktitle = {IMA Volume 146: Algorithms in Algebraic Geometry}, 16710 editor = {Alicia Dickenstein and Frank-Olaf Schreyer and Andrew J. Sommese}, 16711 pages = {133--152}, 16712 publisher = {Springer-Verlag}, 16713 year = {2008} 16714} 16715 16716@Article{ phanthientanner77, 16717 author = {N. Phan-Thien and R.~I. Tanner}, 16718 title = {A new constitutive equation derived from network theory}, 16719 journal = {J. Non-Newt. Fluid Mech.}, 16720 volume = {2}, 16721 pages = {353}, 16722 year = {1977} 16723} 16724 16725@Manual{ sage, 16726 key = {SAGE}, 16727 author = {W.\thinspace{}A. Stein and others}, 16728 organization = {The Sage~Development Team}, 16729 title = {{S}age {M}athematics {S}oftware ({V}ersion 3.3)}, 16730 note = {{\tt http://www.sagemath.org}}, 16731 year = {2009} 16732} 16733 16734@Misc{ bateshauensteinsommesewampler06, 16735 author = {Daniel J. Bates and Jonathan D. Hauenstein and Andrew J. Sommese and Charles W. 16736 Wampler}, 16737 title = {{B}ertini: {S}oftware for {N}umerical {A}lgebraic {G}eometry}, 16738 howpublished = {Available at http://www.nd.edu/$\sim$sommese/bertini} 16739} 16740 16741@Article{ archer09, 16742 author = {A. J. Archer}, 16743 collaboration = {}, 16744 title = {Dynamical density functional theory for molecular and colloidal fluids: A 16745 microscopic approach to fluid mechanics}, 16746 publisher = {AIP}, 16747 year = {2009}, 16748 journal = {The Journal of Chemical Physics}, 16749 volume = {130}, 16750 number = {1}, 16751 eid = {014509}, 16752 numpages = {8}, 16753 pages = {014509}, 16754 keywords = {colloids; continuum mechanics; density functional theory; free energy; glass 16755 transition; statistical distributions; stochastic processes}, 16756 doi = {10.1063/1.3054633} 16757} 16758 16759@Article{ giesekus1966, 16760 author = {Hanswalter Giesekus}, 16761 title = {Die Elastizit\"at von Fl\"ussigkeiten}, 16762 journal = {Rheologica Acta}, 16763 publisher = {Springer Berlin / Heidelberg}, 16764 volume = {5}, 16765 number = {1}, 16766 month = mar, 16767 year = {1966}, 16768 doi = {10.1007/BF01973575}, 16769 pages = {29-35} 16770} 16771 16772@Article{ baaijens98, 16773 author = {F.P. Baaijens}, 16774 title = {Mixed finite element methods for viscoelastic flow analysis: a review}, 16775 journal = {Journal of Non-Newtonian Fluid Mechanics}, 16776 volume = {79}, 16777 year = {1998}, 16778 pages = {361--385} 16779} 16780 16781@Book{ joseph90, 16782 author = {D.~D. Joseph}, 16783 title = {Fluid Dynamics of Viscoelastic Liquids}, 16784 publisher = {Springer}, 16785 address = {New York, NY}, 16786 year = {1990} 16787} 16788 16789@Article{ oldroyd50, 16790 author = {J.~G. Oldroyd}, 16791 title = {On the Formulation of Rheological Equations of State}, 16792 journal = {Proceedings of the Royal Society of London. Series A, Mathematical and Physical 16793 Sciences}, 16794 volume = {200}, 16795 year = {1950}, 16796 pages = {523--541} 16797} 16798 16799@InProceedings{ bynasungroppthakur04, 16800 author = {S. Byna and X.-H. Sun and W. Gropp and R. Thakur}, 16801 title = {Predicting Memory-Access Cost Based on Data-Access Patterns}, 16802 booktitle = {Proceedings of IEEE International Conference on Cluster Computing, San Diego}, 16803 year = {2004} 16804} 16805 16806@Book{ pozrikidis07, 16807 author = {C. Pozrikidis}, 16808 title = {Fluid Dynamics: Theory, Computation, and Numerical Simulation}, 16809 publisher = {Kluwer (Springer)}, 16810 pages = {675}, 16811 year = {2001}, 16812 isbn = {0792373510} 16813} 16814 16815@Misc{ kritzkeyesfsp07, 16816 author = {A. Kritz and D. Keyes}, 16817 title = {{Fusion Simulation Project Workshop Report}}, 16818 month = jul, 16819 year = {2007}, 16820 note = {Available via 16821 \url{http://www.sc.doe.gov/ofes/More_HTML/FESAC/FESAC07/FSP_report_070702d.pdf}} 16822} 16823 16824@Misc{ dahlburg02, 16825 author = {J. {Dahlburg (Chair)}}, 16826 title = {{Final Report of the FESAC ISOFS SubCommittee}}, 16827 year = {2002}, 16828 note = {Available via 16829 \url{http://www.ofes.fusion.doe.gov/More_HTML/FESAC/FESAC11-02/Dahlburg.pdf}} 16830} 16831 16832@Misc{ brown08, 16833 author = {D. {Brown (Chair)}}, 16834 title = {{Applied Mathematics at the U.S. Department of Energy: Past, Present, and a View 16835 to the Future}}, 16836 year = {2008}, 16837 howpublished = {Office of Science, U.S. Department of Energy}, 16838 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/Brown_report_may_08.pdf} 16839} 16840 16841@Misc{ crosscutting10, 16842 author = {D. Brown and P. {Messina (Chairs)}}, 16843 title = {{Scientific Grand Challenges: Crosscutting Technologies for Computing at the 16844 Exascale}}, 16845 year = {2010}, 16846 howpublished = {Office of Science, U.S. Department of Energy}, 16847 url = {http://extremecomputing.labworks.org/SumReps/Crosscutting-SumRep-PNNL_20168.pdf} 16848} 16849 16850@Misc{ extreme-scale-solvers-workshop12, 16851 author = {J. Ang and K. Evans and A. Geist and M. Heroux and P. Hovland and O. Marques and 16852 L.C. McInnes and E. Ng and S. Wild}, 16853 title = {Report on the Workshop on Extreme-Scale Solvers: Transitions to Future 16854 Architectures}, 16855 howpublished = {Office of Advanced Scientific Computing Research, U.S. Department of Energy}, 16856 note = {{Washington, DC}, March 8-9, 2012}, 16857 url = {http://science.energy.gov/~/media/ascr/pdf/program-documents/docs/reportExtremeScaleSolvers2012.pdf}, 16858 year = {2012} 16859} 16860 16861@Misc{ monizrosner09, 16862 author = {{E. Moniz and R. Rosner}}, 16863 title = {{Workshop on Science Based Nuclear Energy Systems Enabled by Advanced Modeling 16864 and Simulation at the Extreme Scale}}, 16865 month = may, 16866 year = {2009}, 16867 note = {See 16868 \url{http://extremecomputing.labworks.org/crosscut/references/nuclearenergy10exascael.pdf}} 16869} 16870 16871@Misc{ blanford08, 16872 author = {{R. Blandord (Chair)}}, 16873 title = {{Workshop on Challenges for Understanding the Quantum Universe and the Role of 16874 Computing at the Extreme Scale}}, 16875 month = dec, 16876 year = {2008}, 16877 note = {See 16878 \url{http://extremecomputing.labworks.org/crosscut/references/HEPreport10exascale.pdf}} 16879} 16880 16881@Misc{ exascale07, 16882 author = {H. Simon and T. Zacharia and R. Stevens}, 16883 title = {{Modeling and Simulation at the Exascale for Energy and the Environment}}, 16884 year = {2007}, 16885 note = {See \url{http://www.sc.doe.gov/ascr/ProgramDocuments/Docs/TownHall.pdf}} 16886} 16887 16888@Misc{ ascrbreakthroughs08, 16889 author = {{Panel on Recent Significant Advancements in Computational Science}}, 16890 title = {Breakthroughs}, 16891 year = {2008}, 16892 note = {See 16893 \url{http://www.er.doe.gov/ASCR/ProgramDocuments/Docs/Breakthroughs_2008.pdf}} 16894} 16895 16896@Misc{ petsc-rd100-2009, 16897 author = {{R\&D Magazine}}, 16898 title = {{PETSc} {R}\&{D} 100 Award}, 16899 year = {2009}, 16900 note = {See 16901 \url{http://www.rdmag.com/Awards/RD-100-Awards/2009/07/PETSc-Release-3-0-Expands-Capabilities}} 16902} 16903 16904@Article{ compass-scidac08, 16905 author = {P. Spentzouris and J. Cary and L. C. McInnes and W. Mori and C. Ng and E. Ng and 16906 R. Ryne}, 16907 title = {Community Petascale Project for Accelerator Science and Simulation: Advancing 16908 Computational Science for Future Accelerators and Accelerator Technologies}, 16909 journal = {J. Phys.: Conf. Ser.}, 16910 volume = {125}, 16911 year = {2008}, 16912 pages = {012001}, 16913 url = {http://iopscience.iop.org/1742-6596/125/1/012001} 16914} 16915 16916@Article{ compass-amundson-scidac08, 16917 title = {Multiscale, Multiphysics Beam Dynamics Framework Design and Applications}, 16918 author = {J. Amundson and D. Dechow and L. McInnes and B. Norris and P. Spentzouris and P. 16919 Stoltz}, 16920 journal = {J. Phys.: Conf. Ser.}, 16921 volume = {125}, 16922 year = {2008} 16923} 16924 16925@InProceedings{ muszala09, 16926 title = {Two-tiered Component Design and Performance Analysis of {Synergia2} Accelerator 16927 Simulations}, 16928 author = {S. Muszala and J. Amundson and L. C. McInnes and B. Norris}, 16929 booktitle = {Proceedings of the 2009 Workshop on Component-Based High Performance Computing 16930 {(CBHPC 2009)}}, 16931 year = {2009} 16932} 16933 16934@Article{ gaston09, 16935 title = {{MOOSE}: A Parallel Computational Framework for Coupled Systems of Nonlinear 16936 Equations}, 16937 author = {Derek Gaston and Chris Newman and Glen Hansen and Damien Lebrun-Grandie}, 16938 journal = {Nuclear Engineering and Design}, 16939 volume = {239}, 16940 number = {10}, 16941 year = {2009}, 16942 pages = {1768 -- 1778} 16943} 16944 16945@Article{ gaston09b, 16946 title = {Parallel Multiphysics Algorithms and Software for Computational Nuclear 16947 Engineering}, 16948 author = {D. Gaston and G. Hansen and S. Kadioglu and D. Knoll and C. Newman and H. Park 16949 and C. Permann and W. Taitano}, 16950 journal = {J. Phys.: Conf. Ser.}, 16951 volume = {180}, 16952 year = {2009}, 16953 pages = {012012} 16954} 16955 16956@Article{ newman09, 16957 title = {Three Dimensional Coupled Simulation of Thermomechanics, Heat, and Oxygen 16958 Diffusion in {UO$_2$} Nuclear Fuel Rods}, 16959 author = {Chris Newman and Glen Hansen and Derek Gaston}, 16960 journal = {Journal of Nuclear Materials}, 16961 volume = {392}, 16962 issue = {1}, 16963 year = {2009}, 16964 pages = {6 -- 15} 16965} 16966 16967@Misc{ www:fenics, 16968 author = {{FE}ni{CS}}, 16969 title = {{FE}ni{CS} Project}, 16970 howpublished = {\url{http://www.fenics.org/}}, 16971 year = {2018} 16972} 16973 16974@InProceedings{ zwart08, 16975 title = {A Multiphysics and Multiscale Software Environment for Modeling Astrophysical 16976 Systems}, 16977 author = {S. Zwart and S. McMillan and B. Nuallain and D. Heggie and J. Lombarsi and P. Hut 16978 and S. Banerjee and H. Belkus and T. Fragos and J. Fregeau and M. Fuji and E. 16979 Gaburov and E. Glebbeek and D. Groen and S. Harfst and R. Izzard and J. Juric and 16980 S. Justham and P. Teuben and J. van Bever and O. Yaron and M. Zemp}, 16981 booktitle = {Proceedings of ICCS 2008}, 16982 year = {2008} 16983} 16984 16985@Article{ klocknerwarburtonbridgehesthaven09, 16986 author = {Kl\"{o}ckner, A. and Warburton, T. and Bridge, J. and Hesthaven, J. S.}, 16987 title = {Nodal discontinuous {G}alerkin methods on graphics processors}, 16988 journal = {J. Comput. Phys.}, 16989 volume = {228}, 16990 number = {21}, 16991 year = {2009}, 16992 issn = {0021-9991}, 16993 pages = {7863--7882}, 16994 doi = {10.1016/j.jcp.2009.06.041}, 16995 publisher = {Academic Press Professional}, 16996 address = {San Diego, CA} 16997} 16998 16999@PhDThesis{ rankin99, 17000 author = {Rankin, W. T.}, 17001 keywords = {FMM, parallel FMM}, 17002 school = {Department of Electrical and Computer Engineering, Duke University}, 17003 title = {Efficient parallel implementations of multipole-based {$N$}-body algorithms}, 17004 year = {1999} 17005} 17006 17007@InProceedings{ warrensalmon93, 17008 abstract = {We report on an efficient adaptive N-body method which we have recently designed 17009 and implemented. The algorithm computes the forces on an arbitrary distribution of 17010 bodies in a time which scales as N log N with the particle number. The accuracy of 17011 the force calculations is analytically bounded, and can be adjusted via a user 17012 defined parameter between a few percent relative accuracy, down to machine 17013 arithmetic accuracy. Instead of using pointers to indicate the topology of the 17014 tree, we identify...}, 17015 address = {New York}, 17016 author = {Warren, Michael S. and Salmon, John K.}, 17017 booktitle = {Proceedings of the 1993 ACM/IEEE Conference on Supercomputing}, 17018 citeulike-article-id={580952}, 17019 keywords = {oct-tree}, 17020 pages = {12--21}, 17021 publisher = {ACM}, 17022 title = {A parallel hashed Oct-Tree {N}-body algorithm}, 17023 year = {1993}, 17024 doi = {10.1145/169627.169640}, 17025 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.50.100} 17026} 17027 17028@Unpublished{ cruzwccm10, 17029 author = {Felipe A. Cruz}, 17030 title = {Heterogeneous extension of the PetFMM a Fast Multipole Library}, 17031 note = {Presentation at WCCM 2010, Sydney Australia}, 17032 year = {2010} 17033} 17034 17035@Article{ mcguffee06, 17036 author = {S.~R. {McGuffee} and A.~H. Elcock}, 17037 title = {Atomistically detailed simulations of concentrated protein solutions: the effects 17038 of salt, {pH}, point mutations, and protein concentration in simulations of 17039 1000-molecule systems}, 17040 journal = {Journal of the American Chemical Society}, 17041 volume = {128}, 17042 pages = {12098--12110}, 17043 year = {2006} 17044} 17045 17046@Article{ nilsencaihoylandlangtangen10, 17047 author = {{Nilsen}, J.~K. and {Cai}, X. and {Hoyland}, B. and {Petter Langtangen}, H.}, 17048 title = {{Simplifying Parallelization of Scientific Codes by a Function-Centric Approach 17049 in Python}}, 17050 journal = {ArXiv e-prints}, 17051 archiveprefix = {arXiv}, 17052 eprint = {1002.0705}, 17053 primaryclass = {cs.DC}, 17054 keywords = {Computer Science - Distributed, Parallel, and Cluster Computing, Computer Science 17055 - Programming Languages}, 17056 year = {2010}, 17057 month = feb, 17058 adsurl = {http://adsabs.harvard.edu/abs/2010arXiv1002.0705N}, 17059 adsnote = {Provided by the SAO/NASA Astrophysics Data System} 17060} 17061 17062@Misc{ mcinnes:siam09:minisymposium, 17063 title = {Implicit Nonlinear Solvers in Multimodel Simulations}, 17064 author = {L. C. McInnes and C. {Woodward (co-organizers)}}, 17065 note = {invited minisymposium session at the SIAM Annual Meeting, July 9-10, 2009, 17066 Denver, CO, speakers were: C. Woodward (LLNL), E. Myra (Univ. of Michigan), J. 17067 White (Stanford Univ.), A. Barker (Univ. of Colorado, Boulder), L. Wilcox (Univ. 17068 of Texas at Austin), R. Mills (ORNL), B. F. Smith (ANL), J. Shadid (SNL), D. Knoll 17069 (INL), G. Hansen (INL), J. Cary (Tech-X Corp.), T. Wildey (Univ. of Texas at 17070 Austin).} 17071} 17072 17073@Misc{ mcinnes:fsp-summary:feb2011, 17074 author = {Lois Curfman McInnes and Luis Chacon and John Shadid}, 17075 title = {Solvers and Time Integration Breakout Summary}, 17076 note = {FSP Planning Workshop, General Atomics, Feb 8-11, 2011, see 17077 \url{https://ice.txcorp.com/trac/2011_FspDefinitionWorkshop}} 17078} 17079 17080@Misc{ dvi-materials:siamcse11, 17081 title = {Progress in Large-Scale Differential Variational Inequalities for Heterogeneous 17082 Materials}, 17083 author = {M. Anitescu and A. El-Azab and J. Lee and L. C. McInnes and T. Munson and B. F. 17084 Smith and L. Wang}, 17085 note = {minisymposium presentation at the 2011 SIAM Conference on Computational Science 17086 and Engineering, March 3, 2011} 17087} 17088 17089@Misc{ jamroz:cemm10, 17090 title = {{JFNK} within the semi-implicit scheme in {NIMROD}}, 17091 author = {B. Jamroz and S. Kruger and T. Austin}, 17092 note = {presentation, CEMM Meeting, Chicago, IL, Nov 7, 2010} 17093} 17094 17095@Misc{ kruger:feb4-2011, 17096 title = {personal communication}, 17097 author = {S. Kruger}, 17098 note = {February, 2011} 17099} 17100 17101@Article{ elman1996, 17102 author = {H.C. Elman}, 17103 title = {Preconditioning for the steady-state {Navier-Stokes} equations for low 17104 viscosity}, 17105 journal = {SIAM J. Sci. Comput.}, 17106 volume = {20}, 17107 year = {1996}, 17108 pages = {1299--1316} 17109} 17110 17111@Article{ kayloghinwathen2002, 17112 author = {D. Kay and D. Loghin and A. Wathen}, 17113 title = {A preconditioning for the steady-state {Navier-Stokes} equations}, 17114 journal = {SIAM J. Sci. Comput.}, 17115 volume = {24}, 17116 year = {2002}, 17117 pages = {237--256} 17118} 17119 17120@Article{ elmanhowleshadidshuttleworthtuminaro2006, 17121 author = {H.C. Elman and V.E. Howle and J. Shadid and R. Shuttleworth and R. Tuminaro}, 17122 title = {Block preconditioners based on approximate commutators}, 17123 journal = {SIAM J. Sci. Comput.}, 17124 volume = {27}, 17125 number = {5}, 17126 year = {2006}, 17127 pages = {1651--1668} 17128} 17129 17130@Article{ braesssarazin1997, 17131 author = {Dietrich Braess and Regina Sarazin}, 17132 title = {An efficient smoother for the {Stokes} problem}, 17133 journal = {Applied Numerical Mathematics}, 17134 volume = {23}, 17135 number = {1}, 17136 year = {1997}, 17137 pages = {3--19}, 17138 doi = {10.1016/S0168-9274(96)00059-1} 17139} 17140 17141@Article{ wright2001large, 17142 title = {Large-Scale Computation of Pseudospectra Using {ARPACK} and \texttt{eigs}}, 17143 author = {Wright, T.G. and Trefethen, L.N.}, 17144 journal = {SIAM Journal on Scientific Computing}, 17145 volume = {23}, 17146 pages = {591}, 17147 year = {2001} 17148} 17149 17150@Misc{ wright2002eigtool, 17151 title = {Eig{T}ool}, 17152 author = {Wright, T.G. and Trefethen, LN}, 17153 howpublished = {Software available at \url{http://www.comlab.ox.ac.uk/pseudospectra/eigtool}}, 17154 year = {2002} 17155} 17156 17157@Misc{ visit-web-site, 17158 key = {{VisIt}}, 17159 title = {{VisIt web site}}, 17160 howpublished = {\url{http://wci.llnl.gov/codes/visit/}}, 17161 url = {http://wci.llnl.gov/codes/visit/}, 17162 year = {2011} 17163} 17164 17165@Book{ trefethen1996, 17166 title = {Finite difference and spectral methods for ordinary and partial differential 17167 equations}, 17168 author = {Lloyd Nicholas Trefethen}, 17169 year = {1996}, 17170 publisher = {Cornell University-Department of Computer Science and Center for Applied 17171 Mathematics} 17172} 17173 17174@Book{ trefethen2005spectra, 17175 title = {Spectra and pseudospectra: the behavior of nonnormal matrices and operators}, 17176 author = {Trefethen, L.N. and Embree, M.}, 17177 year = {2005}, 17178 publisher = {Princeton University Press} 17179} 17180 17181@Article{ gomez2010isogeometric, 17182 title = {Isogeometric analysis of the isothermal {N}avier-{S}tokes-{K}orteweg equations}, 17183 author = {Gomez, H. and Hughes, T.J.R. and Nogueira, X. and Calo, V.M.}, 17184 journal = {Computer Methods in Applied Mechanics and Engineering}, 17185 volume = {199}, 17186 number = {25-28}, 17187 pages = {1828--1840}, 17188 issn = {0045-7825}, 17189 year = {2010}, 17190 publisher = {Elsevier} 17191} 17192 17193@Article{ gomez2008isogeometric, 17194 title = {Isogeometric analysis of the {C}ahn-{H}illiard phase-field model}, 17195 author = {G{\'o}mez, H. and Calo, V.M. and Bazilevs, Y. and Hughes, T.J.R.}, 17196 journal = {Computer Methods in Applied Mechanics and Engineering}, 17197 volume = {197}, 17198 number = {49-50}, 17199 pages = {4333--4352}, 17200 year = {2008}, 17201 publisher = {Elsevier} 17202} 17203 17204@Misc{ fastmath:project, 17205 author = {Lori {Diachin (PI)}}, 17206 title = {{SciDAC Frameworks, Algorithms, and Scalable Technologies for Mathematics 17207 (FASTMath) Institute}}, 17208 howpublished = {\url{https://fastmath-scidac.llnl.gov}} 17209} 17210 17211@Misc{ exascale-software:proposal, 17212 author = {Peter {Beckman (PI)}}, 17213 title = {{Exascale Software Center}}, 17214 note = {proposal to DOE} 17215} 17216 17217@Misc{ imex:project, 17218 author = {Barry {Smith (PI)}}, 17219 title = {{Scalable Implicit-Explicit (IMEX) Algorithms and Software for Time-Dependent 17220 Multimodel PDEs}}, 17221 note = {DOE ASCR applied math project} 17222} 17223 17224@Misc{ intel-mic:website, 17225 author = {Intel}, 17226 title = {{Many Integrated Core Architecture}}, 17227 note = {\url{http://www.intel.com/technology/architecture-silicon/mic}} 17228} 17229 17230@Article{ dudson:2009, 17231 author = {B.D. Dudson and M.V. Umansky and X.Q. Xu and P.B. Snyder and H.R. Wilson}, 17232 title = {{{BOUT++:}} a framework for parallel plasma fluid simulations}, 17233 journal = {Computer Physics Communications}, 17234 volume = {180}, 17235 pages = {1467}, 17236 year = {2009} 17237} 17238 17239@Article{ umansky:2009, 17240 author = {M.V. Umansky and X.Q. Xu and B. Dudson and L.L. LoDestro and J.R. Myra}, 17241 title = {{Status and verification of edge plasma turbulence code BOUT}}, 17242 journal = {Computer Physics Communications}, 17243 year = {2009}, 17244 volume = {180}, 17245 pages = {887-903} 17246} 17247 17248@Article{ xu:1998, 17249 author = {X.Q. Xu and R.H. Cohen}, 17250 title = {{Scrape-Off Layer Turbulence Theory and Simulations}}, 17251 journal = {Computer Physics Communications}, 17252 year = {1998}, 17253 volume = {36}, 17254 number = {1-2}, 17255 pages = {158} 17256} 17257 17258@Article{ tron:1999, 17259 title = {Newton's Method for Large Bound-constrained Optimization Problems}, 17260 author = {Chih-Jen Lin and Jorge Mor\'{e}}, 17261 journal = {SIAM Journal on Optimization}, 17262 volume = {9}, 17263 number = {4}, 17264 pages = {1100-1127}, 17265 year = {1999} 17266} 17267 17268@Article{ stubenamg, 17269 author = {K. St\"{u}ben}, 17270 title = {A review of algebraic multigrid}, 17271 journal = {J. Comput. Appl. Math.}, 17272 volume = {128}, 17273 number = {1-2}, 17274 year = {2001}, 17275 issn = {0377-0427}, 17276 pages = {281--309}, 17277 doi = {10.1016/S0377-0427(00)00516-1}, 17278 publisher = {Elsevier Science Publishers B. V.}, 17279 address = {Amsterdam, The Netherlands, The Netherlands} 17280} 17281 17282@Article{ feuchtermg, 17283 author = {D. Feuchter and I. Heppner and S. Sauter and G. Wittum}, 17284 title = {Bridging the gap between geometric and algebraic multigrid methods}, 17285 journal = {Computing and visualization in science}, 17286 publisher = {Springer}, 17287 volume = {6}, 17288 number = {1}, 17289 year = {2003}, 17290 pages = {1--13} 17291} 17292 17293@Article{ chowmgsmoothness, 17294 abstract = {For non-M-matrices, this paper proposes an unstructured multigrid method that 17295 only attempts to interpolate in the directions of geometrical smoothness. These 17296 directions are determined by analyzing samples of algebraically smooth error, e. 17297 Neighboring grid points i and j are called smoothly coupled if e i and e j are 17298 consistently nearby in value. In addition, these dierences may be used to dene 17299 interpolation weights. These new ideas may be incorporated into the algebraic 17300 multigrid method. Test results show that the new method can have much lower grid 17301 and operator complexities compared to AMG, leading to lower solve timings. 1 }, 17302 author = {Chow, Edmond}, 17303 citeulike-article-id={7675372}, 17304 citeulike-linkout-0={http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17305 journal = {American Journal of Mathematics}, 17306 keywords = {fem, multigrid}, 17307 pages = {197--215}, 17308 posted-at = {2010-08-17 23:29:51}, 17309 priority = {2}, 17310 title = {An Unstructured Multigrid Method Based on Geometric Smoothness}, 17311 url = {http://citeseerx.ist.psu.edu/viewdoc/summary?doi=10.1.1.22.4305}, 17312 volume = {65}, 17313 year = {2001} 17314} 17315 17316@Article{ jonesamge, 17317 abstract = {{This paper contains the main ideas for an AMGe (algebraic multigrid for finite 17318 elements) method based on element agglomeration. In the method, coarse grid 17319 elements are formed by agglomerating fine grid elements. Compatible interpolation 17320 operators are constructed which yield coarse grid basis functions with a minimal 17321 energy property. Heuristics based on interpolation quality measures are used to 17322 guide the agglomeration procedure. The performance of the resulting method is 17323 demonstrated in two-level numerical experiments.}}, 17324 author = {Jones, Jim E. and Vassilevski, Panayot S.}, 17325 citeulike-article-id={8598569}, 17326 citeulike-linkout-0={http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17327 citeulike-linkout-1={http://link.aip.org/link/?SCE/23/109}, 17328 journal = {SIAM Journal on Scientific Computing}, 17329 keywords = {amg, fem, multigrid}, 17330 number = {1}, 17331 pages = {109--133}, 17332 posted-at = {2011-01-13 18:05:55}, 17333 priority = {2}, 17334 publisher = {SIAM}, 17335 title = {{AMGE Based on Element Agglomeration}}, 17336 url = {http://scitation.aip.org/getabs/servlet/GetabsServlet?prog=normal&id=SJOCE3000023000001000109000001&idtype=cvips&gifs=yes}, 17337 volume = {23}, 17338 year = {2001} 17339} 17340 17341@Article{ saad1993, 17342 author = {Saad, Youcef}, 17343 doi = {10.1137/0914028}, 17344 issn = {10648275}, 17345 journal = {SIAM Journal on Scientific Computing}, 17346 keywords = {65f10,ams,especially since the popularization,gate gradient,general purpose 17347 iterative methods,gmres,krylov subspace methods,mos,non-hermitian systems,of 17348 precondition-,preconditioned conju-,subject classi cations,variable 17349 preconditioners}, 17350 number = {2}, 17351 pages = {461--469}, 17352 title = {{A flexible inner-outer preconditioned GMRES algorithm}}, 17353 volume = {14}, 17354 year = {1993} 17355} 17356 17357@Misc{ path:homepage, 17358 author = {S. Dirkse and M. Ferris and T. Munson}, 17359 title = {{{PATH} {W}eb page}}, 17360 howpublished = {\url{http://pages.cs.wisc.edu/~ferris/path.html}} 17361} 17362 17363@Article{ ketcheson2008, 17364 author = {David I Ketcheson}, 17365 title = {Highly Efficient Strong Stability Preserving {Runge-Kutta} Methods with 17366 Low-Storage Implementations}, 17367 volume = {30}, 17368 journal = {SIAM Journal on Scientific Computing}, 17369 year = {2008}, 17370 pages = {2113--2136} 17371} 17372 17373@Article{ elman2009boundary, 17374 title = {{Boundary conditions in approximate commutator preconditioners for the 17375 Navier-Stokes equations}}, 17376 author = {Elman, H.C. and Tuminaro, R.}, 17377 journal = {Electronic Transactions on Numerical Analysis}, 17378 volume = {35}, 17379 pages = {257--280}, 17380 year = {2009} 17381} 17382 17383@Article{ elman2008tcp, 17384 title = {{A taxonomy and comparison of parallel block multi-level preconditioners for the 17385 incompressible Navier-Stokes equations}}, 17386 author = {Elman, H.C. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, 17387 R.}, 17388 journal = {Journal of Computational Physics}, 17389 volume = {227}, 17390 number = {1}, 17391 pages = {1790--1808}, 17392 year = {2008}, 17393 publisher = {Academic Press}, 17394 url = {http://chess.cs.umd.edu/~elman/papers/tax.pdf} 17395} 17396 17397@Article{ arioli2013, 17398 title = {Generalized {G}olub--{K}ahan bidiagonalization and stopping criteria}, 17399 author = {Arioli, Mario}, 17400 journal = {SIAM Journal on Matrix Analysis and Applications}, 17401 volume = {34}, 17402 number = {2}, 17403 pages = {571--592}, 17404 year = {2013}, 17405 publisher = {SIAM} 17406} 17407 17408@Book{ wesseling2009, 17409 title = {Principles of computational fluid dynamics}, 17410 author = {Wesseling, Pieter}, 17411 volume = {29}, 17412 year = {2009}, 17413 publisher = {Springer Science \& Business Media} 17414} 17415 17416@Article{ silvester2001efficient, 17417 title = {{Efficient preconditioning of the linearized Navier-Stokes equations for 17418 incompressible flow}}, 17419 author = {Silvester, D. and Elman, H. and Kay, D. and Wathen, A.}, 17420 journal = {Journal of Computational and Applied Mathematics}, 17421 volume = {128}, 17422 number = {1-2}, 17423 pages = {261--279}, 17424 issn = {0377-0427}, 17425 year = {2001}, 17426 publisher = {Elsevier} 17427} 17428 17429@Article{ elman1999bfbt, 17430 title = {{Preconditioning for the steady-state Navier-Stokes equations with low 17431 viscosity}}, 17432 author = {Elman, H.C.}, 17433 journal = {SIAM Journal on Scientific Computing}, 17434 volume = {20}, 17435 number = {4}, 17436 pages = {1299--1316}, 17437 issn = {1064-8275}, 17438 year = {1999}, 17439 publisher = {Citeseer} 17440} 17441 17442@Article{ elman2006bpb, 17443 title = {{Block preconditioners based on approximate commutators}}, 17444 author = {Elman, H. and Howle, V.E. and Shadid, J. and Shuttleworth, R. and Tuminaro, R.}, 17445 journal = {SIAM Journal on Scientific Computing}, 17446 volume = {27}, 17447 number = {5}, 17448 pages = {1651--1668}, 17449 year = {2006}, 17450 publisher = {Philadelphia, PA: SIAM, c1993-} 17451} 17452 17453@Article{ olshanskii2006analysis, 17454 title = {{Analysis of a Stokes interface problem}}, 17455 author = {Olshanskii, M.A. and Reusken, A.}, 17456 journal = {Numerische Mathematik}, 17457 volume = {103}, 17458 number = {1}, 17459 pages = {129--149}, 17460 issn = {0029-599X}, 17461 year = {2006}, 17462 publisher = {Springer} 17463} 17464 17465@Article{ patankar1972cph, 17466 title = {{A calculation procedure for heat, mass and momentum transfer in 17467 three-dimensional parabolic flows}}, 17468 author = {Patankar, S.V. and Spalding, D.B.}, 17469 journal = {Int. J. Heat Mass Transfer}, 17470 volume = {15}, 17471 pages = {1787--1806}, 17472 year = {1972} 17473} 17474 17475@Article{ rannacher1992simple, 17476 title = {{Simple nonconforming quadrilateral Stokes element}}, 17477 author = {Rannacher, R. and Turek, S.}, 17478 journal = {Numerical Methods for Partial Differential Equations}, 17479 volume = {8}, 17480 number = {2}, 17481 pages = {97--111}, 17482 issn = {1098-2426}, 17483 year = {1992}, 17484 publisher = {Wiley Online Library} 17485} 17486 17487@Article{ rannacher2000finite, 17488 title = {Finite Element Methods for the Incompressible {N}avier-{S}tokes Equations}, 17489 author = {Rannacher, R.}, 17490 journal = {Fundamental Directions in Mathematical Fluid Mechanics}, 17491 pages = {191}, 17492 isbn = {3764364149}, 17493 year = {2000}, 17494 publisher = {Birkhauser} 17495} 17496 17497@Article{ vanka1986block, 17498 title = {{Block-implicit multigrid solution of Navier-Stokes equations in primitive 17499 variables}}, 17500 author = {Vanka, S.P.}, 17501 journal = {Journal of Computational Physics}, 17502 volume = {65}, 17503 number = {1}, 17504 pages = {138--158}, 17505 issn = {0021-9991}, 17506 year = {1986}, 17507 publisher = {Elsevier} 17508} 17509 17510@Article{ eisenstat1983variational, 17511 title = {Variational iterative methods for nonsymmetric systems of linear equations}, 17512 author = {Eisenstat, S.C. and Elman, H.C. and Schultz, M.H.}, 17513 journal = {SIAM Journal on Numerical Analysis}, 17514 volume = {20}, 17515 number = {2}, 17516 pages = {345--357}, 17517 year = {1983}, 17518 publisher = {JSTOR} 17519} 17520 17521@InProceedings{ burstedde2008scalable, 17522 title = {Scalable adaptive mantle convection simulation on petascale supercomputers}, 17523 author = {Burstedde, C. and Ghattas, O. and Gurnis, M. and Stadler, G. and Tan, E. and Tu, 17524 T. and Wilcox, L.C. and Zhong, S.}, 17525 booktitle = {Proceedings of the 2008 ACM/IEEE conference on Supercomputing}, 17526 pages = {62}, 17527 year = {2008}, 17528 organization = {IEEE Press} 17529} 17530 17531@Article{ burstedde2009parallel, 17532 title = {Parallel scalable adjoint-based adaptive solution of variable-viscosity {Stokes} 17533 flow problems}, 17534 author = {Burstedde, C. and Ghattas, O. and Stadler, G. and Tu, T. and Wilcox, L.C.}, 17535 journal = {Computer Methods in Applied Mechanics and Engineering}, 17536 volume = {198}, 17537 number = {21-26}, 17538 pages = {1691--1700}, 17539 year = {2009}, 17540 publisher = {Elsevier} 17541} 17542 17543@Article{ stadler2010dynamics, 17544 title = {The dynamics of plate tectonics and mantle flow: From local to global scales}, 17545 author = {Stadler, G. and Gurnis, M. and Burstedde, C. and Wilcox, L.C. and Alisic, L. and 17546 Ghattas, O.}, 17547 journal = {Science}, 17548 volume = {329}, 17549 number = {5995}, 17550 pages = {1033}, 17551 year = {2010}, 17552 publisher = {American Association for the Advancement of Science} 17553} 17554 17555@Article{ tackley2008modelling, 17556 title = {Modelling compressible mantle convection with large viscosity contrasts in a 17557 three-dimensional spherical shell using the yin-yang grid}, 17558 author = {Tackley, P.J.}, 17559 journal = {Physics of the Earth and Planetary Interiors}, 17560 volume = {171}, 17561 number = {1-4}, 17562 pages = {7--18}, 17563 year = {2008}, 17564 publisher = {Elsevier} 17565} 17566 17567@Article{ moresizhonggurnis96, 17568 author = {Louis N. Moresi and Shijie Zhong and Michael Gurnis}, 17569 title = {The accuracy of finite element solutions of {S}tokes' flow with strongly varying 17570 viscosity}, 17571 journal = {Physics of the Earth and Planetary Interiors}, 17572 volume = {97}, 17573 pages = {83-–94}, 17574 year = {1996} 17575} 17576 17577@Article{ moresisolomatov95, 17578 author = {Louis N. Moresi and V. S. Solomatov}, 17579 title = {Numerical investigation of {2D} convection with extremely large viscosity 17580 variations}, 17581 journal = {Physics of Fluids}, 17582 volume = {7}, 17583 number = {9}, 17584 pages = {2154-–2162}, 17585 year = {1995} 17586} 17587 17588@Article{ chenmolnar83, 17589 author = {W.-P. Chen and P. Molnar}, 17590 title = {Focal depths of intra-continental and intraplate earthquakes and their 17591 implications for the thermal and mechanical properties of the lithosphere}, 17592 journal = {Journal of Geophysical Research}, 17593 volume = {88}, 17594 pages = {4183–-4214}, 17595 year = {1983} 17596} 17597 17598@Article{ jackson02, 17599 author = {J. Jackson}, 17600 title = {Strength of the continental lithosphere: time to abandon the jelly sandwich?}, 17601 journal = {GSA Today}, 17602 volume = {12}, 17603 pages = {4–-10}, 17604 year = {2002} 17605} 17606 17607@Article{ burovwatts06, 17608 author = {E.B. Burov and A.B. Watts}, 17609 title = {The long-term strength of continental lithosphere: jelly sandwich or creme 17610 brulee?}, 17611 journal = {GSA Today}, 17612 volume = {16}, 17613 pages = {4–-10}, 17614 year = {2006} 17615} 17616 17617@InProceedings{ yang:brent:2002, 17618 title = {The Improved {BiCGStab} Method for Large and Sparse Unsymmetric Linear Systems on 17619 Parallel Distributed Memory Architectures}, 17620 author = {Laurence T. Yang and Richard Brent}, 17621 booktitle = {Proceedings of the Fifth International Conference on Algorithms and Architectures 17622 for Parallel Processing}, 17623 year = {2002}, 17624 publisher = {IEEE} 17625} 17626 17627@Article{ demmel2008communication, 17628 title = {Communication-optimal parallel and sequential {QR} and {LU} factorizations}, 17629 author = {Demmel, J. and Grigori, L. and Hoemmen, M. and Langou, J.}, 17630 journal = {Arxiv preprint arXiv:0808.2664}, 17631 year = {2008} 17632} 17633 17634@Article{ demmel09, 17635 author = {J. Demmel and M. Hoemmen and M. Mohiyuddin and K Yelick}, 17636 title = {Communication-optimal Iterative Methods}, 17637 journal = {Journal of Physics: Conf. Series}, 17638 volume = {180}, 17639 year = {2009} 17640} 17641 17642@TechReport{ parms04, 17643 author = {Yousef Saad and Masha Sosonkina}, 17644 title = {{pARMS}: A package for the parallel iterative solution of general large sparse 17645 linear systems user's guide}, 17646 number = {UMSI2004-8}, 17647 institution = {Minnesota Supercomputer Institute, University of Minnesota}, 17648 year = {2004} 17649} 17650 17651@Article{ picard1890, 17652 author = {Emile Picard}, 17653 title = {M\'emoire sur la th\'eorie des \'equations aux d\'eriv\'ees partielles et la 17654 m\'ethode des approximations successives}, 17655 journal = {Journal De Math\'ematiques Pures et Appliqu\'ees}, 17656 volume = {4}, 17657 number = {6}, 17658 pages = {145--210}, 17659 year = {1890}, 17660 url = {http://math-doc.ujf-grenoble.fr/JMPA/PDF/JMPA_1890_4_6_A3_0.pdf} 17661} 17662 17663@Book{ rall1969, 17664 author = {Louis B. Rall}, 17665 title = {Computational solution of nonlinear operator equations}, 17666 publisher = {Krieger Pub Co.}, 17667 pages = {225}, 17668 year = {1969} 17669} 17670 17671@Article{ fletcherreeves1964, 17672 author = {R. Fletcher and C. M. Reeves}, 17673 title = {Function Minimization by Conjugate Gradients}, 17674 journal = {Computer Journal}, 17675 volume = {7}, 17676 pages = {149–-154}, 17677 year = {1964} 17678} 17679 17680@InBook{ mcinnesallanetal06, 17681 author = {Lois Curfman McInnes and Benjamin Allan and Robert Armstrong and Steven Benson 17682 and David Bernholdt and Tamara Dahlgren and Lori Diachin and Manojkumar Krishnan 17683 and James Kohl and Jay Larson and Sophia Lefantzi and Jarek Nieplocha and Boyana 17684 Norris and Steven Parker and Jaideep Ray and Shujia Zhou}, 17685 editor = {A.~M.~Bruaset and A.~Tveito}, 17686 title = {Numerical Solution of Partial Differential Equations on Parallel Computers}, 17687 chapter = {Parallel {PDE}-Based Simulations Using the {Common Component Architecture}}, 17688 publisher = {Springer}, 17689 year = {2006}, 17690 number = {51}, 17691 series = {Lecture Notes in Computational Science and Engineering}, 17692 pages = {327--381}, 17693 doi = {10.1016/S0167-8191(02)00191-6} 17694} 17695 17696@Article{ cyrshadidtuminaro12, 17697 title = {Stabilization and scalable block preconditioning for the {Navier–Stokes} 17698 equations}, 17699 journal = {Journal of Computational Physics}, 17700 volume = {231}, 17701 number = {2}, 17702 pages = {345 - 363}, 17703 year = {2012}, 17704 issn = {0021-9991}, 17705 doi = {10.1016/j.jcp.2011.09.001}, 17706 author = {Eric C. Cyr and John N. Shadid and Raymond S. Tuminaro} 17707} 17708 17709@Article{ keyesmcinneswoodwardetal13, 17710 title = {Multiphysics Simulations: Challenges and Opportunities}, 17711 author = {David E. Keyes and Lois Curfman McInnes and Carol Woodward and William Gropp and 17712 Eric Myra and Michael Pernice and John Bell and Jed Brown and Alain Clo and 17713 Jeffrey Connors and Emil Constantinescu and Don Estep and Kate Evans and Charbel 17714 Farhat and Ammar Hakim and Glenn Hammond and Glen Hansen and Judith Hill and Tobin 17715 Isaac and Xiangmin Jiao and Kirk Jordan and Dinesh Kaushik and Efthimios Kaxiras 17716 and Alice Koniges and Kihwan Lee and Aaron Lott and Qiming Lu and John Magerlein 17717 and Reed Maxwell and Michael McCourt and Miriam Mehl and Roger Pawlowski and 17718 Amanda Peters Randles and Daniel Reynolds and B\'{e}atrice Rivi\`{e}re and Ulrich 17719 R\"{u}de and Tim Scheibe and John Shadid and Brendan Sheehan and Mark Shephard and 17720 Andrew Siegel and Barry Smith and Xianzhu Tang and Cian Wilson and Barbara Wohlmuth}, 17721 journal = {International Journal of High Performance Computing Applications}, 17722 month = feb, 17723 year = {2013}, 17724 volume = {27}, 17725 number = {1}, 17726 pages = {4--83}, 17727 doi = {10.1177/1094342012468181}, 17728 note = {Special issue}, 17729 abstract = {We consider multiphysics applications from algorithmic and architectural 17730 perspectives, where ``algorithmic'' includes both mathematical analysis and 17731 computational complexity and ``architectural'' includes both software and hardware 17732 environments. Many diverse multiphysics applications can be reduced, en route to 17733 their computational simulation, to a common algebraic coupling paradigm. 17734 Mathematical analysis of multiphysics coupling in this form is not always 17735 practical for realistic applications, but model problems representative of 17736 applications discussed herein can provide insight. A variety of software 17737 frameworks for multiphysics applications have been constructed and refined within 17738 disciplinary communities and executed on leading-edge computer systems. We examine 17739 several of these, expose some commonalities among them, and attempt to extrapolate 17740 best practices to future systems. From our study, we summarize challenges and 17741 forecast opportunities.} 17742} 17743 17744@Misc{ rosner10, 17745 author = {Robert {Rosner (Chair)}}, 17746 title = {{The Opportunities and Challenges of Exascale Computing}}, 17747 year = {2010}, 17748 howpublished = {Office of Science, U.S. Department of Energy}, 17749 url = {http://science.energy.gov/~/media/ascr/ascac/pdf/reports/Exascale_subcommittee_report.pdf} 17750} 17751 17752@Misc{ kogge2008exascale, 17753 title = {ExaScale Computing Study: {T}echnology Challenges in achieving exascale systems}, 17754 author = {Peter Kogge and Keren Bergman and Shekhar Borkar and Dan Campbell and Willian 17755 Carlson and William Dally and Monty Denneau and Paul Franzon and William Harrod 17756 and Kerry Hill and Jon Hiller and Sherman Karp and Stephen Keckler and Dean Klein 17757 and Robert Lucas and Mark Richards and Al Scarpelly and Steven Scott and Allan 17758 Snavely and Themas Sterling and R. Stanley Williams and Katherine Yelick}, 17759 howpublished = {DARPA}, 17760 year = {2008}, 17761 url = {http://www.cse.nd.edu/Reports/2008/TR-2008-13.pdf} 17762} 17763 17764@Misc{ doegrandchallengeworkshops, 17765 key = {Office of Science, U.S. Department of Energy}, 17766 title = {{Scientific Grand Challenges Workshop Series}}, 17767 howpublished = {Office of Science, U.S. Department of Energy, see 17768 \url{http://extremecomputing.labworks.org/workshops.stm}} 17769} 17770 17771@Misc{ lawrence2011, 17772 key = {Lawrence}, 17773 title = {{Ernest Orlando Lawrence Award Winners}}, 17774 howpublished = {U.S. Department of Energy, {\footnotesize 17775 \url{http://energy.gov/articles/secretary-chu-announces-2011-ernest-orlando-lawrence-award-winners}}}, 17776 year = {2011} 17777} 17778 17779@Article{ murphy2000npi, 17780 title = {{A note on preconditioning for indefinite linear systems}}, 17781 author = {Murphy, M.F. and Golub, G.H. and Wathen, A.J.}, 17782 journal = {SIAM Journal on Scientific Computing}, 17783 volume = {21}, 17784 number = {6}, 17785 pages = {1969--1972}, 17786 year = {2000}, 17787 publisher = {Philadelphia, PA: SIAM, c1993-} 17788} 17789 17790@Article{ elman2011bouyancy, 17791 title = {Fast iterative solvers for buoyancy driven flow problems}, 17792 journal = {Journal of Computational Physics}, 17793 volume = {230}, 17794 number = {10}, 17795 pages = {3900 - 3914}, 17796 year = {2011}, 17797 note = {}, 17798 issn = {0021-9991}, 17799 doi = {10.1016/j.jcp.2011.02.014}, 17800 author = {Howard Elman and Milan Mihajlovic and David Silvester}, 17801 keywords = {Navier-Stokes, Boussinesq, Finite element approximation, Time stepping, 17802 Adaptivity, Preconditioning, Algebraic multigrid} 17803} 17804 17805@Article{ dongarrabeckman11, 17806 author = {J. Dongarra and P. Beckman and et al.}, 17807 title = {The {I}nternational {E}xascale {S}oftware {P}roject {R}oadmap}, 17808 journal = {Int. J. High Perf. Comput. Applics.}, 17809 volume = {25}, 17810 year = {2011}, 17811 pages = {3--60} 17812} 17813 17814@Article{ mandel1999energy, 17815 title = {Energy optimization of algebraic multigrid bases}, 17816 author = {Mandel, J. and Brezina, M. and Van{\v{e}}k, P.}, 17817 journal = {Computing}, 17818 volume = {62}, 17819 number = {3}, 17820 pages = {205--228}, 17821 year = {1999}, 17822 publisher = {Springer} 17823} 17824 17825@Article{ vanek1996algebraic, 17826 title = {Algebraic multigrid by smoothed aggregation for second and fourth order elliptic 17827 problems}, 17828 author = {Van{\v{e}}k, P. and Mandel, J. and Brezina, M.}, 17829 journal = {Computing}, 17830 volume = {56}, 17831 number = {3}, 17832 pages = {179--196}, 17833 year = {1996}, 17834 publisher = {Springer} 17835} 17836 17837@Article{ vanek2001convergence, 17838 title = {Convergence of algebraic multigrid based on smoothed aggregation}, 17839 author = {Van{\v{e}}ek, P. and Brezina, M. and Mandel, J.}, 17840 journal = {Numerische Mathematik}, 17841 volume = {88}, 17842 number = {3}, 17843 pages = {559--579}, 17844 year = {2001}, 17845 publisher = {Springer} 17846} 17847 17848@Article{ brannick2007algebraic, 17849 title = {Algebraic multigrid methods based on compatible relaxation and energy 17850 minimization}, 17851 author = {Brannick, J. and Zikatanov, L.}, 17852 journal = {Domain decomposition methods in science and engineering XVI}, 17853 pages = {15--26}, 17854 year = {2007}, 17855 publisher = {Springer} 17856} 17857 17858@Article{ brannickfalgout2010, 17859 title = {{Compatible Relaxation and Coarsening in Algebraic Multigrid}}, 17860 author = {James J. Brannick and Robert D. Falgout}, 17861 journal = {SIAM Journal on Scientific Computing}, 17862 volume = {32}, 17863 number = {3}, 17864 pages = {1393--1416}, 17865 url = {http://epubs.siam.org/doi/10.1137/090772216}, 17866 doi = {10.1137/090772216}, 17867 issn = {1064-8275}, 17868 year = {2010} 17869} 17870 17871@Article{ xu2004energy, 17872 title = {On an energy minimizing basis for algebraic multigrid methods}, 17873 author = {Xu, J. and Zikatanov, L.}, 17874 journal = {Computing and Visualization in Science}, 17875 volume = {7}, 17876 number = {3}, 17877 pages = {121--127}, 17878 year = {2004}, 17879 publisher = {Springer} 17880} 17881 17882@Article{ dblp:journals/toms/bakerhlt09, 17883 author = {C. G. Baker and Ulrich Hetmaniuk and Richard B. Lehoucq and Heidi Thornquist}, 17884 title = {Anasazi software for the numerical solution of large-scale eigenvalue problems}, 17885 journal = {ACM Trans. Math. Softw.}, 17886 volume = {36}, 17887 number = {3}, 17888 year = {2009}, 17889 doi = {10.1145/1527286.1527287}, 17890 bibsource = {DBLP, http://dblp.uni-trier.de} 17891} 17892 17893@Article{ dblp:journals/siamsc/yanggbllhn05, 17894 author = {Chao Yang and Weiguo Gao and Zhaojun Bai and Xiaoye S. Li and Lie-Quan Lee and 17895 Parry Husbands and Esmond G. Ng}, 17896 title = {An Algebraic Substructuring Method for Large-Scale Eigenvalue Calculation}, 17897 journal = {SIAM J. Scientific Computing}, 17898 volume = {27}, 17899 number = {3}, 17900 year = {2005}, 17901 pages = {873-892}, 17902 doi = {10.1137/040613767}, 17903 bibsource = {DBLP, http://dblp.uni-trier.de} 17904} 17905 17906@TechReport{ ml-guide, 17907 author = {M.W. Gee and C.M. Siefert and J.J. Hu and R.S. Tuminaro and M.G. Sala}, 17908 title = {{ML} 5.0 Smoothed Aggregation User's Guide}, 17909 institution = {Sandia National Laboratories}, 17910 year = {2006}, 17911 number = {SAND2006-2649} 17912} 17913 17914@Article{ brannick06, 17915 title = {An energy-based AMG coarsening strategy}, 17916 volume = {13}, 17917 doi = {10.1002/nla.480}, 17918 number = {2-3}, 17919 journal = {Numerical Linear Algebra with Applications}, 17920 author = {Brannick, J and Brezina, M and MacLachlan, S and Manteuffel, T and McCormick, S 17921 and Ruge, J}, 17922 year = {2006}, 17923 pages = {133--148} 17924} 17925 17926@Article{ olson10, 17927 author = {Olson, Luke N. and Schroder, Jacob and Tuminaro, Raymond S.}, 17928 title = {A new perspective on strength measures in algebraic multigrid}, 17929 journal = {Numerical Linear Algebra with Applications}, 17930 volume = {17}, 17931 number = {4}, 17932 pages = {713--733}, 17933 year = {2010}, 17934 publisher = {John Wiley \& Sons, Ltd.}, 17935 issn = {1099-1506}, 17936 doi = {10.1002/nla.669} 17937} 17938 17939@Article{ olson11, 17940 author = {Olson, Luke N. and Schroder, Jacob B. and Tuminaro, Raymond S.}, 17941 title = {A General Interpolation Strategy for Algebraic Multigrid Using Energy 17942 Minimization}, 17943 journal = {SIAM J. Sci. Comput.}, 17944 issue_date = {April 2011}, 17945 volume = {33}, 17946 issue = {2}, 17947 month = apr, 17948 year = {2011}, 17949 issn = {1064-8275}, 17950 pages = {966--991}, 17951 numpages = {26}, 17952 doi = {10.1137/100803031}, 17953 acmid = {2078825}, 17954 publisher = {Society for Industrial and Applied Mathematics}, 17955 address = {Philadelphia, PA}, 17956 keywords = {algebraic multigrid, interpolation, non-Hermitian, nonsymmetric, smoothed 17957 aggregation} 17958} 17959 17960@Article{ dorit2011, 17961 author = {Dorit Ron and Ilya Safro and Achi Brandt}, 17962 title = {Relaxation-Based Coarsening and Multiscale Graph Organization}, 17963 journal = {Multiscale Modeling {\&} Simulation}, 17964 volume = {9}, 17965 number = {1}, 17966 year = {2011}, 17967 pages = {407-423}, 17968 doi = {10.1137/100791142} 17969} 17970 17971@Article{ chen2011algebraic, 17972 title = {Algebraic distance on graphs}, 17973 author = {Chen, Jie and Safro, Ilya}, 17974 journal = {SIAM Journal on Scientific Computing}, 17975 volume = {33}, 17976 number = {6}, 17977 pages = {3468--3490}, 17978 year = {2011}, 17979 publisher = {SIAM} 17980} 17981 17982@InProceedings{ adams04, 17983 author = {Adams, M.~F. and Bayraktar, H.~H. and Keaveny, T.~M. and Papadopoulos, P.}, 17984 booktitle = {ACM/IEEE Proceedings of SC2004: High Performance Networking and Computing}, 17985 title = {Ultrascalable implicit finite element analyses in solid mechanics with over a 17986 half a billion degrees of freedom}, 17987 note = {Gordon Bell Award}, 17988 year = {2004} 17989} 17990 17991@Article{ adams03a, 17992 author = {Adams, M.~F.}, 17993 journal = {Numerical Linear Algebra with Applications}, 17994 number = {2-3}, 17995 pages = {141-153}, 17996 title = {Algebraic multigrid methods for constrained linear systems with applications to 17997 contact problems in solid mechanics}, 17998 volume = {11}, 17999 year = {2004} 18000} 18001 18002@Article{ adams-10a, 18003 author = {M. ~F. Adams and Ravi Samtaney and Achi Brandt}, 18004 doi = {10.1016/j.jcp.2010.04.024}, 18005 issn = {0021-9991}, 18006 journal = {Journal of Computational Physics}, 18007 keywords = {Implicit magnetohydrodynamics}, 18008 number = {18}, 18009 pages = {6208 - 6219}, 18010 title = {Toward textbook multigrid efficiency for fully implicit resistive 18011 magnetohydrodynamics}, 18012 volume = {229}, 18013 year = {2010} 18014} 18015 18016@InProceedings{ adams98, 18017 address = {Copper Mountain, CO}, 18018 author = {Adams, M.~F.}, 18019 booktitle = {Proceedings 5th Copper Mountain Conference on Iterative Methods}, 18020 title = {A Parallel Maximal Independent Set Algorithm}, 18021 year = {1998} 18022} 18023 18024@InProceedings{ madaypatera89, 18025 author = {Y. Maday and A. T. Patera}, 18026 title = {Spectral element methods for the {Navier-Stokes} equations}, 18027 editor = {A. K. Noor and J. T. Oden}, 18028 booktitle = {State-of-the-Art Surveys in Computational Mechanics}, 18029 pages = {71-–143}, 18030 publisher = {ASME}, 18031 address = {New York, NY}, 18032 year = {1989} 18033} 18034 18035@Article{ mishra2012mlmcfvm, 18036 title = {Multi-level {M}onte {C}arlo finite volume methods for nonlinear systems of 18037 conservation laws in multi-dimensions}, 18038 journal = {Journal of Computational Physics}, 18039 volume = {231}, 18040 number = {8}, 18041 pages = {3365--3388}, 18042 year = {2012}, 18043 issn = {0021-9991}, 18044 doi = {10.1016/j.jcp.2012.01.011}, 18045 author = {S. Mishra and Ch. Schwab and J. {\v S}ukys}, 18046 keywords = {Conservation laws, Euler, MHD, Uncertainty quantification, Multi-level Monte 18047 Carlo, Parallelization} 18048} 18049 18050@Article{ barth2011mlmcfe, 18051 author = {Barth, Andrea and Schwab, Christoph and Zollinger, Nathaniel}, 18052 affiliation = {ETH Zentrum, Seminar für Angewandte Mathematik, Rämistrasse 101, 8092 Zurich, 18053 Switzerland}, 18054 title = {Multi-Level {M}onte {C}arlo Finite Element method for elliptic {PDE}s with 18055 stochastic coefficients}, 18056 journal = {Numerische Mathematik}, 18057 publisher = {Springer Berlin / Heidelberg}, 18058 issn = {0029-599X}, 18059 keyword = {Mathematics and Statistics}, 18060 pages = {123-161}, 18061 volume = {119}, 18062 issue = {1}, 18063 doi = {10.1007/s00211-011-0377-0}, 18064 year = {2011} 18065} 18066 18067@Article{ nguyen2011hybridizable, 18068 title = {Hybridizable discontinuous {G}alerkin methods}, 18069 author = {Nguyen, N.C. and Peraire, J. and Cockburn, B.}, 18070 journal = {Spectral and High Order Methods for Partial Differential Equations}, 18071 pages = {63--84}, 18072 year = {2011}, 18073 publisher = {Springer} 18074} 18075 18076@Misc{ snyder-scidac3:proposal, 18077 author = {Philip {Snyder (PI)}}, 18078 title = {{Plasma Edge Advanced Computation (PEAC) Center}}, 18079 note = {proposal to DOE SciDAC3}, 18080 month = oct, 18081 year = {2011} 18082} 18083 18084@Misc{ wirth-scidac3:proposal, 18085 author = {Brian {Wirth (PI)}}, 18086 title = {{Plasma Surface Interactions: Bridging from the Surface to the Micron Frontier 18087 through Leadership Class Computing}}, 18088 note = {proposal to DOE SciDAC3}, 18089 month = oct, 18090 year = {2011} 18091} 18092 18093@Misc{ cary-scidac3:proposal, 18094 author = {John {Cary (PI)}}, 18095 title = {{Integrated Multiscale Modeling for Plasma Analysis and Control of Tokamak 18096 Stability (IMMPACTS)}}, 18097 note = {proposal to DOE SciDAC3}, 18098 month = oct, 18099 year = {2011} 18100} 18101 18102@Misc{ vashista-scidac3:proposal, 18103 author = {Priya {Vashista (PI)}}, 18104 title = {{Design of Damage-Tolerance Material Interfaces for Extreme 18105 Stress-Temperature-Corrosion Environments: Algorithms and Methods for 18106 Multi-Petaflops Simulations}}, 18107 note = {proposal to DOE SciDAC3}, 18108 month = mar, 18109 year = {2012} 18110} 18111 18112@Article{ elemental2012, 18113 author = {Jack Poulson and Bryan Marker and Jeff R. Hammond and Nichols A. Romero and 18114 Robert {v}an~{d}e~{G}eijn}, 18115 title = {Elemental: A New Framework for Distributed Memory Dense Matrix Computations}, 18116 journal = {{ACM} Transactions on Mathematical Software}, 18117 volume = {39}, 18118 number = {2}, 18119 year = {2013} 18120} 18121 18122@Misc{ elemental-web-page, 18123 author = {Jack Poulson}, 18124 title = {Elemental: Distributed memory dense linear algebra}, 18125 howpublished = {\url{http://libelemental.org}}, 18126 url = {http://libelemental.org/}, 18127 year = {2015} 18128} 18129 18130@Book{ scalesreport, 18131 title = {A Science-based Case for Large-scale Simulation}, 18132 editor = {D. E. Keyes}, 18133 publisher = {U.S. Department of Energy}, 18134 year = {2004}, 18135 url = {http://www.pnl.gov/scales} 18136} 18137 18138@InProceedings{ cilk95, 18139 address = {Santa Barbara, California}, 18140 author = {Robert D. Blumofe and Christopher F. Joerg and Bradley C. Kuszmaul and Charles E. 18141 Leiserson and Keith H. Randall and Yuli Zhou}, 18142 booktitle = {Proceedings of the Fifth ACM SIGPLAN Symposium on Principles and Practice of 18143 Parallel Programming (PPoPP)}, 18144 day = {19--21}, 18145 month = jul, 18146 pages = {207--216}, 18147 title = {{Cilk}: An Efficient Multithreaded Runtime System}, 18148 year = {1995} 18149} 18150 18151@Misc{ valgrind-web-page, 18152 author = {Julian Seward}, 18153 title = {Valgrind}, 18154 url = {http://valgrind.org/}, 18155 howpublished = {\url{http://valgrind.org/}}, 18156 year = {2012} 18157} 18158 18159@Article{ blas79, 18160 author = {C.~L. Lawson and R.~J. Hanson and D. Kincaid and F.~T. Krogh}, 18161 title = {Basic linear algebra subprograms for Fortran usage}, 18162 journal = {ACM Transactions on Mathematical Software}, 18163 volume = {5}, 18164 pages = {308--323}, 18165 year = {1979} 18166} 18167 18168@TechReport{ lapack90, 18169 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. 18170 Du~Croz and A. Greenbaum and S. Hammarling and A. McKenney and D. Sorensen}, 18171 title = {{LAPACK}: A portable linear algebra library for high-performance computers}, 18172 institution = {Computer Science Dept., University of Tennessee}, 18173 number = {CS-90-105}, 18174 month = may, 18175 year = {1990} 18176} 18177 18178@TechReport{ nvidiafermi, 18179 author = {NVIDIA}, 18180 title = {{NVIDIA}'s Next Generation {CUDA} Compute Architecture: {F}ermi}, 18181 institution = {NVIDIA}, 18182 year = {2009} 18183} 18184 18185@Misc{ intelmic, 18186 author = {Many Core Group, Cambridge University}, 18187 title = {Intel Many Integrated Core Architecture}, 18188 howpublished = {\url{http://www.many-core.group.cam.ac.uk/ukgpucc2/talks/Elgar.pdf}}, 18189 month = dec, 18190 year = {2010} 18191} 18192 18193@Article{ abusufahkucklawrie81, 18194 author = {W. Abu-Sufah and D.~J. Kuck and D.~H. Lawrie}, 18195 title = {On the Performance Enhancement of Paging Systems Through Program Analysis and 18196 Transformations}, 18197 journal = {IEEE Trans. Comput.}, 18198 volume = {30}, 18199 number = {5}, 18200 pages = {341--356}, 18201 year = {1981} 18202} 18203 18204@InProceedings{ guobikshandifraguelagarzaranpadua08, 18205 author = {Guo, Jia and Bikshandi, Ganesh and Fraguela, Basilio B. and Garzaran, Maria J. 18206 and Padua, David}, 18207 title = {Programming with tiles}, 18208 booktitle = {Proceedings of the 13th ACM SIGPLAN Symposium on Principles and practice of 18209 parallel programming}, 18210 series = {PPoPP '08}, 18211 year = {2008}, 18212 isbn = {978-1-59593-795-7}, 18213 location = {Salt Lake City, UT}, 18214 pages = {111--122}, 18215 numpages = {12}, 18216 doi = {10.1145/1345206.1345225}, 18217 acmid = {1345225}, 18218 publisher = {ACM}, 18219 address = {New York, NY} 18220} 18221 18222@Article{ strout04, 18223 journal = {International Journal of High Performance Computing Applications}, 18224 year = {2004}, 18225 title = {Sparse Tiling for Stationary Iterative Methods}, 18226 month = feb, 18227 publisher = {Sage Publications}, 18228 pages = {95-114}, 18229 volume = {18}, 18230 number = {1}, 18231 author = {Michelle Mills Strout and Larry Carter and Jeanne Ferrante and Barbara Kreaseck} 18232} 18233 18234@Misc{ openclstandard, 18235 author = {Khronos Group}, 18236 title = {{OpenCL} 1.2 Specification}, 18237 howpublished = {\url{http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}}, 18238 url = {http://www.khronos.org/registry/cl/specs/opencl-1.2.pdf}, 18239 year = {2011} 18240} 18241 18242@Misc{ stlguide, 18243 author = {SGI}, 18244 title = {Standard Template Library Programmer's Guide}, 18245 howpublished = {\url{http://www.sgi.com/tech/stl/}}, 18246 url = {http://www.sgi.com/tech/stl/}, 18247 year = {2011} 18248} 18249 18250@Book{ stepanov09, 18251 author = {Alexander Stepanov and Paul McJones}, 18252 title = {Elements of Programming}, 18253 publisher = {Addison-Wesley}, 18254 isbn = {978-0-321-63537-2}, 18255 year = {2009} 18256} 18257 18258@Article{ bangerthhartmannkanschat2007, 18259 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18260 title = {{deal.II} -- a General Purpose Object Oriented Finite Element Library}, 18261 journal = {ACM Trans. Math. Softw.}, 18262 year = {2007}, 18263 volume = {33}, 18264 number = {4}, 18265 pages = {24/1--24/27} 18266} 18267 18268@Misc{ dealii-web-page, 18269 author = {W. Bangerth and R. Hartmann and G. Kanschat}, 18270 title = {{deal.II}}, 18271 howpublished = {\url{http://www.dealii.org/}}, 18272 url = {http://www.dealii.org/}, 18273 year = {2012} 18274} 18275 18276@InBook{ siek2012, 18277 title = {The C++0x ``Concepts'' Effort}, 18278 author = {Jeremy G. Siek}, 18279 editor = {Jeremy Gibbons}, 18280 booktitle = {Generic and Indexed Programming: International Spring School, SSGIP 2010, Oxford, 18281 UK, March 22-26, 2010, Revised Lectures}, 18282 pages = {175--216}, 18283 isbn = {978-3-642-32202-0}, 18284 doi = {10.1007/978-3-642-32202-0_4}, 18285 url = {http://arxiv.org/abs/1201.0027}, 18286 note = {\url{http://arxiv.org/abs/1201.0027}}, 18287 publisher = {Springer Berlin Heidelberg}, 18288 year = {2012} 18289} 18290 18291@Misc{ sharpclaw, 18292 note = {\url{http://numerics.kaust.edu.sa/sharpclaw}}, 18293 author = {Ketcheson, D. I. and Parsani, M.}, 18294 keywords = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18295 PDEs,sharpclaw,software}, 18296 mendeley-tags = {clawpack,finite volumes,godunov type methods,high order methods,hyperbolic 18297 PDEs,sharpclaw,software}, 18298 title = {{SharpClaw software}}, 18299 year = {2011} 18300} 18301 18302@Book{ leveque2002, 18303 title = {Finite volume methods for hyperbolic problems}, 18304 author = {Randall J LeVeque}, 18305 volume = {31}, 18306 year = {2002} 18307} 18308 18309@Misc{ clawpack45, 18310 note = {\url{http://www.clawpack.org}}, 18311 author = {LeVeque, R. J. and Berger, M. J.}, 18312 keywords = {clawpack,finite volumes,hyperbolic PDEs,software}, 18313 mendeley-tags = {clawpack,finite volumes,hyperbolic PDEs,software}, 18314 title = {{Clawpack Software version 4.5}}, 18315 url = {www.clawpack.org}, 18316 year = {2011} 18317} 18318 18319@Article{ nilsen2010, 18320 archiveprefix = {arXiv}, 18321 arxivid = {arXiv:1002.0705v1}, 18322 author = {Nilsen, J.K. and Cai, X. and H{\o}yland, Bj{\o} rn and Langtangen, H. P.}, 18323 eprint = {arXiv:1002.0705v1}, 18324 file = {:Users/ketch/Documents/Mendeley Desktop/Nilsen et al/2010 - Simplifying the 18325 parallelization of scientific codes by a function-centric approach in 18326 Python.pdf:pdf}, 18327 journal = {Computational Science \& Discovery}, 18328 keywords = {parallel,programming,python,software}, 18329 mendeley-tags = {parallel,programming,python,software}, 18330 pages = {015003}, 18331 publisher = {IOP Publishing}, 18332 title = {{Simplifying the parallelization of scientific codes by a function-centric 18333 approach in Python}}, 18334 url = {http://iopscience.iop.org/1749-4699/3/1/015003}, 18335 volume = {3}, 18336 year = {2010} 18337} 18338 18339@Book{ langtangen09, 18340 author = {Hans Petter Langtangen}, 18341 title = {Python Scripting for Computational Science}, 18342 publisher = {Springer}, 18343 series = {Texts in Computational Science and Engineering}, 18344 pages = {784}, 18345 isbn = {3540739157}, 18346 year = {2009} 18347} 18348 18349@Book{ numpyguide, 18350 author = {Travis E. Oliphant}, 18351 title = {Guide to {N}umpy}, 18352 publisher = {Trelgol}, 18353 year = {2008} 18354} 18355 18356@Misc{ pycuda, 18357 author = {Andreas Kl\"ockner}, 18358 title = {{PyCUDA}}, 18359 howpublished = {\url{http://mathema.tician.de/software/pycuda}}, 18360 year = {2011} 18361} 18362 18363@Misc{ pyopencl, 18364 author = {Andreas Kl\"ockner}, 18365 title = {{PyOpenCL}}, 18366 howpublished = {\url{http://mathema.tician.de/software/pyopencl}}, 18367 year = {2011} 18368} 18369 18370@Article{ klockner2012, 18371 author = {Andreas Kl\"{o}ckner and Nicolas Pinto and Yunsup Lee and Bryan Catanzaro and 18372 Paul Ivanov and Ahmed Fasih}, 18373 title = {{PyCUDA} and {PyOpenCL}: A scripting-based approach to {GPU} run-time code 18374 generation}, 18375 journal = {Parallel Computing}, 18376 volume = {38}, 18377 number = {3}, 18378 pages = {157--174}, 18379 year = {2012}, 18380 issn = {0167-8191}, 18381 doi = {10.1016/j.parco.2011.09.001} 18382} 18383 18384%%%%%% Matt Stuff %%%%%% 18385@Article{ morrabozdagknepleyrassvesselinov, 18386 title = {A Tectonic Shift in Analytics and Computing Is Coming}, 18387 author = {Gabriele Morra and Ebru Bozdag and Matthew G. Knepley and Ludovic R\"ass and 18388 Velimir Vesselinov}, 18389 journal = {Eos}, 18390 volume = {102}, 18391 doi = {10.1029/2021EO159258}, 18392 month = {Jun}, 18393 year = {2021} 18394} 18395 18396@Misc{ knepley:icerm-workshop:2012, 18397 author = {David Keyes and Matthew Knepley and Katherine Yelick}, 18398 title = {Synchronization-reducing and Communication-reducing Algorithms and Programming 18399 Models for Large-scale Simulations}, 18400 note = {Workshop sponsored by the Institute for Computational and Experimental Research 18401 in Mathematics (ICERM), Jan. 9-13, 2012, Providence, RI, 18402 \url{http://icerm.brown.edu/tw12-1-exascale}}, 18403 year = {2012} 18404} 18405 18406@TechReport{ kirbyknepleyscott04, 18407 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18408 title = {Optimal Evaluation of Finite Element Matrices}, 18409 type = {Technical Report}, 18410 number = {TR-2004-04}, 18411 institution = {University of Chicago}, 18412 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}, 18413 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2004-04}}, 18414 pages = {14}, 18415 month = may, 18416 year = {2004} 18417} 18418 18419@TechReport{ kirbyknepleyscott10, 18420 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18421 title = {Languages and Compilers for Variational Forms}, 18422 type = {Technical Report}, 18423 number = {TR-2010-09}, 18424 institution = {University of Chicago}, 18425 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}, 18426 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-09}}, 18427 month = oct, 18428 year = {2010} 18429} 18430 18431@TechReport{ kirbyknepleyscott10b, 18432 author = {Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott}, 18433 title = {Evaluation of the Action of Finite Element Operators}, 18434 type = {Technical Report}, 18435 number = {TR-2010-08}, 18436 institution = {University of Chicago}, 18437 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}, 18438 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2010-08}}, 18439 month = oct, 18440 year = {2010} 18441} 18442 18443@TechReport{ bruneknepleyscott11, 18444 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18445 title = {Exponential grids in high-dimensional space}, 18446 type = {Technical Report}, 18447 number = {TR-2011-07}, 18448 institution = {University of Chicago}, 18449 url = {http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}, 18450 note = {\url{http://www.cs.uchicago.edu/research/publications/techreports/TR-2011-07}}, 18451 month = dec, 18452 year = {2011} 18453} 18454 18455@TechReport{ zheng11, 18456 author = {Liang Zheng and Taras Gerya and Matthew G. Knepley and David A. Yuen and Huai 18457 Zhang and Yaolin Shi}, 18458 title = {Implementation of a multigrid solver on {GPU} for {Stokes} equations with 18459 strongly variable viscosity based on {Matlab} and {CUDA}}, 18460 type = {Research Report}, 18461 number = {UMSI 2011/33}, 18462 institution = {University of Minnesota Supercomputing Institute}, 18463 url = {http://static.msi.umn.edu/rreports/2011/33.pdf}, 18464 note = {\url{http://static.msi.umn.edu/rreports/2011/33.pdf}}, 18465 month = mar, 18466 year = {2011} 18467} 18468 18469@InProceedings{ zheng2010, 18470 author = {Liang Zheng and Taras Gerya and David A. Yuen and Matthew G. Knepley and Huai 18471 Zhang and Yaolin Shi}, 18472 title = {{GPU} Implementation of {Stokes} Equation with Strongly Variable Coefficients}, 18473 booktitle = {Eos Transactions of the AGU}, 18474 organization = {American Geophysical Union}, 18475 note = {Fall Meeting Supplemental, Abstract IN41A-1350}, 18476 year = {2010} 18477} 18478 18479@InCollection{ terrelkirbyknepleyscott12, 18480 author = {Andy R. Terrel and Robert C. Kirby and Matthew G. Knepley and L. Ridgway Scott 18481 and Garth N. Wells}, 18482 title = {Finite elements for incompressible fluids}, 18483 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18484 booktitle = {Automated solutions of differential equations by the finite element method}, 18485 series = {Lecture Notes in Computational Science and Engineering}, 18486 volume = {84}, 18487 pages = {163--169}, 18488 publisher = {Springer-Verlag}, 18489 year = {2012} 18490} 18491 18492@InCollection{ mardalhaga12, 18493 author = {Kent-Andre Mardal and Joachim Berdal Haga}, 18494 title = {Block preconditioning of systems of PDEs}, 18495 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18496 booktitle = {Automated solutions of differential equations by the finite element method}, 18497 series = {Lecture Notes in Computational Science and Engineering}, 18498 volume = {84}, 18499 pages = {643--655}, 18500 publisher = {Springer-Verlag}, 18501 year = {2012} 18502} 18503 18504@InCollection{ kirbyknepleyloggscottterrel12, 18505 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott and 18506 Andy R. Terrel}, 18507 title = {Discrete optimization of finite element matrix evaluation}, 18508 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18509 booktitle = {Automated solutions of differential equations by the finite element method}, 18510 series = {Lecture Notes in Computational Science and Engineering}, 18511 volume = {84}, 18512 pages = {385--397}, 18513 publisher = {Springer-Verlag}, 18514 year = {2012} 18515} 18516 18517@InCollection{ kirby12, 18518 author = {Robert C. Kirby}, 18519 title = {{FIAT}: Numerical Construction of Finite Element Basis Functions}, 18520 editors = {A. Logg and K.A. Mardal and G. N. Wells}, 18521 booktitle = {Automated solutions of differential equations by the finite element method}, 18522 series = {Lecture Notes in Computational Science and Engineering}, 18523 volume = {84}, 18524 publisher = {Springer-Verlag}, 18525 year = {2012} 18526} 18527 18528@Article{ brownconveryhotesknepleypetropolous1993, 18529 author = {Robert W. Brown and Mary Convery and Scott Hotes and Matthew G. Knepley and 18530 Labros Petropolous}, 18531 title = {Closed strings with low harmonics and kinks}, 18532 journal = {Physical Review D}, 18533 volume = {48}, 18534 number = {6}, 18535 year = {1993} 18536} 18537 18538@Article{ minimax1996, 18539 title = {MiniMax: What has been learned thus far}, 18540 author = {Mary E. Convery and W.~L. Davis and Ken W. Del Signore and Tom L. Jenkins and 18541 Erik Kangas and Matthew G. Knepley and Ken L. Kowalski and Cyrus C. Taylor and 18542 C.~H. Wang and S.~H. Oh and W.~D. Walker and P.~L. Colestock and B. Hanna and M. 18543 Martens and J. Streets and R.~C. Ball and H.~R. Gustafson and L.~W. Jones and 18544 M.~J. Longo and J.~D. Bjorken and N. Morgan and C.~A. Pruneau}, 18545 journal = {Nuovo Cimento}, 18546 volume = {19}, 18547 number = {1}, 18548 pages = {1045--1049}, 18549 year = {1996} 18550} 18551 18552@Article{ minimax1997, 18553 author = {Minimax Collaboration}, 18554 title = {Analysis of Charged Particle/Photon Correlations in Hadronic Multiparticle 18555 Production}, 18556 journal = {Physical Review D}, 18557 volume = {55}, 18558 number = {9}, 18559 year = {1997} 18560} 18561 18562@Article{ minimax2000, 18563 author = {Minimax Collaboration}, 18564 title = {Search for disoriented chiral condensate at the {Fermilab} {Tevatron}}, 18565 journal = {Physical Review D}, 18566 volume = {61}, 18567 number = {3}, 18568 year = {2000} 18569} 18570 18571@Article{ kirbyknepleyloggscott05, 18572 author = {Robert C. Kirby and Matthew G. Knepley and Anders Logg and L. Ridgway Scott}, 18573 title = {Optimizing the evaluation of finite element matrices}, 18574 journal = {SIAM Journal on Scientific Computing}, 18575 volume = {27}, 18576 number = {3}, 18577 pages = {741--758}, 18578 year = {2005} 18579} 18580 18581@Article{ bardhanknepleyanitescu2008, 18582 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Mihai Anitescu}, 18583 title = {Bounding the Electrostatic Free Energies Associated with Linear Continuum Models 18584 of Molecular Solvation}, 18585 journal = {Journal of Chemical Physics}, 18586 volume = {130}, 18587 number = {10}, 18588 pages = {104108}, 18589 note = {Selected for the March 15, 2009 issue of Virtual Journal of Biological Physics 18590 Research}, 18591 doi = {10.1063/1.3081148}, 18592 year = {2008} 18593} 18594 18595%Poster at Biophysical Society Fall Meeting 18596@Article{ bardhanknepley2017, 18597 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18598 title = {Accurate Atom-by-Atom Predictions of Solvation Electrostatics Using a 18599 Hydration-Shell {Poisson}-{Boltzmann} Model}, 18600 journal = {Biophysical Journal}, 18601 volume = {110}, 18602 number = {3}, 18603 note = {Fall Meeting Supplemental, Abstract DI14A-08}, 18604 doi = {10.1016/j.bpj.2015.11.1766}, 18605 year = {2017} 18606} 18607 18608@Article{ tabrizirahimigoossensknepleybardhan2018, 18609 title = {Solvation Thermodynamics of Neutral and Charged Solutes Using the Solvation-Layer 18610 Interface Condition (SLIC) Continuum Dielectric Model}, 18611 author = {Amirhossein Molavi Tabrizi and Ali Mehdizadeh Rahimi and Spencer Goossens and 18612 Matthew G. Knepley and Jaydeep P. Bardhan}, 18613 journal = {International Journal of Quantum Chemistry}, 18614 note = {Accepted}, 18615 year = {2018} 18616} 18617 18618@Article{ knepley2010, 18619 author = {Stodden, V. and Knepley, M. G. and Wiggins, C. and LeVeque, R. J. and Donoho, D. 18620 and Fomel, S. and Friedlander, M. P. and Gerstein, M. and Mitchell, I. and 18621 Ouellette, L. L. and Bramble, N. W. and Brown, P. O. and Carey, V. and DeNardis, 18622 L. and Gentleman, R. and {Gezelter, J}, D. and Goodman, A. and Moore, J. E. and 18623 Pasquale, F. A. and Rolnick, J. and Seringhaus, M. and Subramanian, R.}, 18624 title = {{Reproducible Research: addressing the need for data and code sharing in 18625 computational science}}, 18626 journal = {Computing in Science and Engineering}, 18627 volume = {12}, 18628 number = {5}, 18629 pages = {8--13}, 18630 url = {http://www.bepress.com/cgi/viewcontent.cgi?article=1034\&amp;context=sagmb}, 18631 year = {2010} 18632} 18633 18634@Article{ ketchesonahmadiaknepley2011, 18635 title = {Conference Review: High Performance Computing and Hybrid Programming Concepts for 18636 Hyperbolic PDE Codes}, 18637 author = {David I. Ketcheson and Aron Ahmadia and Matthew G. Knepley}, 18638 journal = {SIAM News}, 18639 volume = {44}, 18640 number = {7}, 18641 month = sep, 18642 note = {\url{http://www.siam.org/pdf/news/1912.pdf}}, 18643 year = {2011} 18644} 18645 18646@Article{ yokotabardhanknepleybarbahamada2011, 18647 author = {Rio Yokota and Jaydeep P. Bardhan and Matthew G. Knepley and L.A. Barba and 18648 Tsuyoshi Hamada}, 18649 title = {Biomolecular electrostatics using a fast multipole {BEM} on up to 512 {GPU}s and 18650 a billion unknowns}, 18651 journal = {Computer Physics Communications}, 18652 volume = {182}, 18653 number = {6}, 18654 pages = {1272--1283}, 18655 year = {2011}, 18656 issn = {0010-4655}, 18657 doi = {10.1016/j.cpc.2011.02.013}, 18658 url = {http://arxiv.org/abs/1007.4591} 18659} 18660 18661@Article{ bardhanknepley2011, 18662 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18663 title = {Mathematical Analysis of the {BIBEE} Approximation for Molecular Solvation: Exact 18664 Results for Spherical Inclusions}, 18665 journal = {Journal of Chemical Physics}, 18666 volume = {135}, 18667 number = {12}, 18668 pages = {124107--124117}, 18669 url = {http://arxiv.org/abs/1109.0651}, 18670 note = {\url{http://arxiv.org/abs/1109.0651}}, 18671 year = {2011} 18672} 18673 18674@Article{ bruneknepleyscott2013, 18675 author = {Peter R. Brune and Matthew G. Knepley and L. Ridgway Scott}, 18676 title = {Unstructured Geometric Multigrid in Two and Three Dimensions on Complex and 18677 Graded Meshes}, 18678 journal = {SIAM Journal on Scientific Computing}, 18679 url = {http://arxiv.org/abs/1104.0261}, 18680 note = {\url{http://arxiv.org/abs/1104.0261}}, 18681 volume = {35}, 18682 number = {1}, 18683 pages = {A173--A191}, 18684 year = {2013} 18685} 18686 18687@Article{ bardhanknepley2012a, 18688 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18689 title = {Computational science and re-discovery: open-source implementations of 18690 ellipsoidal harmonics for problems in potential theory}, 18691 journal = {Computational Science \& Discovery}, 18692 volume = {5}, 18693 pages = {014006}, 18694 note = {\url{http://arxiv.org/abs/1204.0267}}, 18695 doi = {10.1088/1749-4699/5/1/014006}, 18696 year = {2012} 18697} 18698 18699@Article{ kreienkampetal2013, 18700 author = {Amy Kreienkamp and Lucy Y. Liu and Mona S. Minkara and Matthew G. Knepley and 18701 Jaydeep P. Bardhan and Mala L. Radhakrishnan}, 18702 title = {Analysis of fast boundary-integral approximations for modeling electrostatic 18703 contributions of molecular binding}, 18704 journal = {Molecular Based Mathematical Biology}, 18705 volume = {1}, 18706 pages = {124--150}, 18707 doi = {10.2478/mlbmb-2013-0007}, 18708 issn = {2299-3266}, 18709 month = jun, 18710 note = {\url{http://www.degruyter.com/view/j/mlbmb.2012.1.issue/mlbmb-2013-0007/mlbmb-2013-0007.xml}}, 18711 year = {2013} 18712} 18713 18714@Article{ bardhanknepleybrune2015, 18715 author = {Jaydeep P. Bardhan and Matthew G. Knepley and Peter R. Brune}, 18716 title = {Analytical Nonlocal Electrostatics Using Eigenfunction Expansions of 18717 Boundary-Integral Operators}, 18718 journal = {Molecular Based Mathematical Biology}, 18719 volume = {3}, 18720 number = {1}, 18721 pages = {1--22}, 18722 doi = {10.1515/mlbmb-2015-0001}, 18723 year = {2015} 18724} 18725 18726@Article{ bardhanknepley14, 18727 author = {Jaydeep P. Bardhan and Matthew G. Knepley}, 18728 title = {Modeling Charge-Sign Asymmetric Solvation Free Energies With Nonlinear Boundary 18729 Conditions}, 18730 journal = {Journal of Chemical Physics}, 18731 volume = {141}, 18732 number = {13}, 18733 pages = {131103}, 18734 doi = {10.1063/1.4897324}, 18735 year = {2014} 18736} 18737 18738@InProceedings{ bardhantejaniwieckowskiramaswamyknepley2015, 18739 title = {A Nonlinear Boundary Condition for Continuum Models of Biomolecular 18740 Electrostatics}, 18741 author = {Jaydeep P. Bardhan and D. A. Tejani and N. S. Wieckowski and A. Ramaswamy and 18742 Matthew G. Knepley}, 18743 booktitle = {Proceedings of PIERS}, 18744 pages = {1215--1221}, 18745 month = jul, 18746 url = {http://piers.org/piersproceedings/piers2015PragueProc.php?start=250}, 18747 year = {2015} 18748} 18749 18750@Article{ tabriziknepleybardhan2016, 18751 title = {Generalising the mean spherical approximation as a multiscale, nonlinear boundary 18752 condition at the solute-solvent interface}, 18753 author = {Amirhossein Molavi Tabrizi and Matthew G. Knepley and Jaydeep P. Bardhan}, 18754 journal = {Molecular Physics}, 18755 volume = {114}, 18756 number = {16-17}, 18757 pages = {2558--2567}, 18758 doi = {10.1080/00268976.2016.1198503}, 18759 year = {2016} 18760} 18761 18762% http://tex.stackexchange.com/questions/155532/biblatex-and-pubmed-pubmed-central-ids 18763@Article{ tabrizigoossensrahimiknepleybardhan2017, 18764 title = {Predicting Solvation Free Energies and Thermodynamics in Polar Solvents and 18765 Mixtures Using a Solvation-Layer Interface Condition}, 18766 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Ali Mehdizadeh Rahimi and 18767 Matthew G. Knepley and Jaydeep P. Bardhan}, 18768 journal = {Journal of Chemical Physics}, 18769 volume = {146}, 18770 number = {9}, 18771 pages = {094103}, 18772 url = {http://scitation.aip.org/content/aip/journal/jcp/146/9/10.1063/1.4977037}, 18773 eprint = {https://arxiv.org/abs/1611.02150}, 18774 doi = {10.1063/1.4977037}, 18775 note = {PMCID: PMC5336475}, 18776 year = {2017} 18777} 18778 18779@Article{ tabrizigoossenscooperknepleybardhan2017, 18780 title = {Extending the Solvation-Layer Interface Condition {(SLIC)} Continum Electrostatic 18781 Model to Linearized {Poisson}-{Boltzmann} Solvent}, 18782 author = {Amirhossein Molavi Tabrizi and Spencer Goossens and Christopher D. Cooper and 18783 Matthew G. Knepley and Jaydeep P. Bardhan}, 18784 number = {6}, 18785 pages = {2897--2914}, 18786 journal = {Journal of Chemical Theory and Computation}, 18787 year = {2017} 18788} 18789 18790@InProceedings{ mcclanahan2011, 18791 author = {McClanahan, C and Czechowski, Kent and Battaglino, Casey and Iyer, K and Yeung, P 18792 K and Vuduc, Richard}, 18793 booktitle = {Proc. ACM/IEEE Conf. Supercomputing (SC)}, 18794 title = {{Prospects for scalable 3D FFTs on heterogeneous exascale systems}}, 18795 url = {http://mcclanahoochie.com/blog/wp-content/uploads/2011/01/fft-sc11.pdf}, 18796 year = {2011} 18797} 18798 18799@Article{ ghyselsashbymeerbergenvanroose2013, 18800 author = {Ghysels, P. and Ashby, T.J. and Meerbergen, K. and Vanroose, W.}, 18801 title = {Hiding global communication latency in the {GMRES} algorithm on massively 18802 parallel machines}, 18803 journal = {SIAM Journal on Scientific Computing}, 18804 volume = {35}, 18805 number = {1}, 18806 pages = {C48--C71}, 18807 year = {2013} 18808} 18809 18810@Article{ ghyselsvanroose2014, 18811 author = {P. Ghysels and W. Vanroose}, 18812 title = {Hiding Global Synchronization Latency in the Preconditioned Conjugate Gradient 18813 Algorithm}, 18814 journal = {Parallel Computing}, 18815 volume = {40}, 18816 number = {7}, 18817 pages = {224--238}, 18818 note = {7th Workshop on Parallel Matrix Algorithms and Applications}, 18819 doi = {10.1016/j.parco.2013.06.001}, 18820 year = {2014} 18821} 18822 18823@InProceedings{ strzodkagoddeke06, 18824 author = {R. Strzodka and D. G\"oddeke}, 18825 title = {Pipelined Mixed Precision Algorithms on {FPGA}s for Fast and Accurate PDE Solvers 18826 from Low Precision Components}, 18827 booktitle = {Proceedings of the 14th Annual IEEE Symposium on Field-Programmable Custom 18828 Computing Machines}, 18829 note = {FCCM ’06}, 18830 pages = {259--270}, 18831 year = {2006}, 18832 organization = {IEEE Computer Society} 18833} 18834 18835@InCollection{ jacquesnicolasvollaire12, 18836 author = {T. Jacques and L. Nicolas and C. Vollaire}, 18837 title = {Electromagnetic Scattering with the Boundary Integral Method on {MIMD} Systems}, 18838 editors = {P. Sloot, M. Bubak, A. Hoekstra, and B. Hertzberger}, 18839 booktitle = {High-Performance Computing and Networking}, 18840 series = {Lecture Notes in Computer Science}, 18841 volume = {1593}, 18842 pages = {1025--1031}, 18843 publisher = {Springer}, 18844 year = {1999} 18845} 18846 18847@InProceedings{ hoeflerlumsdainerehm07, 18848 author = {T. Hoefler and A. Lumsdaine and W. Rehm}, 18849 title = {{Implementation and Performance Analysis of Non-Blocking Collective Operations 18850 for MPI}}, 18851 booktitle = {Proceedings of the 2007 International Conference on High Performance Computing, 18852 Networking, Storage and Analysis, SC07}, 18853 location = {Reno, NV}, 18854 publisher = {IEEE Computer Society/ACM}, 18855 source = {http://www.unixer.de/~htor/publications/}, 18856 month = nov, 18857 year = {2007} 18858} 18859 18860@InProceedings{ hoeflersiebretlumsdaine10, 18861 author = {T. Hoefler and C. Siebert and A. Lumsdaine}, 18862 title = {{Scalable Communication Protocols for Dynamic Sparse Data Exchange}}, 18863 booktitle = {Proceedings of the 2010 ACM SIGPLAN Symposium on Principles and Practice of 18864 Parallel Programming (PPoPP'10)}, 18865 month = jan, 18866 location = {Bangalore, India}, 18867 publisher = {ACM}, 18868 isbn = {978-1-60558-708-0}, 18869 source = {http://www.unixer.de/~htor/publications/}, 18870 pages = {159--168}, 18871 year = {2010} 18872} 18873 18874@Article{ ruppweinbubjungelgrasser15, 18875 title = {Pipelined iterative solvers with kernel fusion for graphics processing units}, 18876 author = {Rupp, Karl and Weinbub, Josef and J{\"u}ngel, Ansgar and Grasser, Tibor}, 18877 journal = {ACM Transactions on Mathematical Software (TOMS)}, 18878 volume = {43}, 18879 number = {2}, 18880 pages = {11}, 18881 year = {2016}, 18882 publisher = {ACM} 18883} 18884 18885@Article{ bai_hu_reichel_1994, 18886 title = {A {Newton} basis {GMRES} implementation}, 18887 volume = {14}, 18888 url = {}, 18889 number = {}, 18890 journal = {IMA Journal of Numerical Analysis}, 18891 author = {Z. Bai and D. Hu and L. Reichel}, 18892 year = {1994}, 18893 pages = {563--581} 18894} 18895 18896@Article{ chronopoulos_gear_1989, 18897 title = {{S-step} iterative methods for symmetric linear systems}, 18898 volume = {25}, 18899 url = {}, 18900 number = {}, 18901 journal = {Journal of Computational and Applied Mathematics}, 18902 author = {A. T. Chronopoulos and C. W. Gear}, 18903 year = {1989}, 18904 pages = {153--168} 18905} 18906 18907@Article{ chronopoulos_1996, 18908 title = {Parallel Iterative {S-step} Methods for Unsymmetric Linear Systems}, 18909 author = {A. T. Chronopoulos and C. D. Swanson}, 18910 journal = {Parallel Computing}, 18911 volume = {22}, 18912 number = {5}, 18913 year = {1996}, 18914 pages = {623--641} 18915} 18916 18917@Article{ chronopoulos_2010, 18918 author = {A. T. Chronopoulos and A. Kucherov}, 18919 title = {Block {S-step} {Krylov} Iterative Methods}, 18920 journal = {Numerical Linear Algebra with Applications}, 18921 volume = {17}, 18922 number = {1}, 18923 pages = {3--15}, 18924 year = {2010} 18925} 18926 18927@Article{ sturler_vorst_1995, 18928 title = {Reducing the effect of global communication in {GMRES(m)} and {CG} on parallel 18929 distributed memory computers}, 18930 volume = {18}, 18931 url = {}, 18932 number = {}, 18933 journal = {Applied Numerical Mathematics}, 18934 author = {E. De Sturler and H. A. van der Vorst}, 18935 year = {1995}, 18936 pages = {441--459} 18937} 18938 18939@Article{ joubert_carey_1992, 18940 title = {Parallelizable restarted iterative methods for nonsymmetric linear systems. part 18941 I: Theory}, 18942 volume = {44}, 18943 url = {}, 18944 number = {}, 18945 journal = {International journal of computer mathematics}, 18946 author = {W. D. Joubert and G. F. Carey}, 18947 year = {1992}, 18948 pages = {243--267} 18949} 18950 18951@Article{ elman_saadsaylor_1986, 18952 title = {A hybrid {Chebyshev} {Krylov}-subspace algorithm for solving nonsymmetric systems 18953 of linear equations}, 18954 volume = {7}, 18955 url = {}, 18956 number = {3}, 18957 journal = {SIAM Journal on Scientific and Statistical Computing}, 18958 author = {Howard Elman and Y. Saad and P. E. Saylor}, 18959 year = {1986}, 18960 pages = {840--855} 18961} 18962 18963@Article{ golub95innerand, 18964 author = {Eldar Giladi and Gene H. Golub and Joseph B. Keller}, 18965 title = {Inner and outer iterations for the {Chebyshev} algorithm}, 18966 journal = {SIAM J. Numer. Anal}, 18967 year = {1995}, 18968 volume = {35}, 18969 pages = {300--319} 18970} 18971 18972@Article{ golub_varga_1961, 18973 title = {{Chebyshev} semi-iterative methods, successive overrelaxation iterative methods, 18974 and second-order {Richardson} iterative methods, parts {I} and {II}}, 18975 volume = {3}, 18976 url = {}, 18977 number = {}, 18978 journal = {Numer. Math.}, 18979 author = {Gene Golub and R.S. Varga}, 18980 year = {1961}, 18981 pages = {147--168} 18982} 18983 18984@Article{ el_maliki_guenette_fortin_2011, 18985 title = {An efficient hierarchical preconditioner for quadratic discretizations of finite 18986 element problems}, 18987 volume = {18}, 18988 doi = {10.1002/nla.757}, 18989 number = {5}, 18990 journal = {Numerical Linear Algebra with Applications}, 18991 author = {A. {El maliki} and R. Guenette and M. Fortin}, 18992 year = {2011}, 18993 pages = {789-803} 18994} 18995 18996@Article{ adavani2008multigrid, 18997 title = {Multigrid Algorithms for Inverse Problems with Linear Parabolic {PDE} 18998 Constraints}, 18999 author = {Adavani, S.S. and Biros, G.}, 19000 journal = {SIAM Journal on Scientific Computing}, 19001 volume = {31}, 19002 number = {1}, 19003 pages = {369--397}, 19004 year = {2008}, 19005 publisher = {Society for Industrial and Applied Mathematics} 19006} 19007 19008@Article{ horton1995space, 19009 title = {A space-time multigrid method for parabolic {PDE}s}, 19010 author = {Horton, G. and Vandewalle, S.}, 19011 journal = {SIAM Journal on Scientific Computing}, 19012 volume = {16}, 19013 number = {4}, 19014 pages = {848--864}, 19015 year = {1995} 19016} 19017 19018@Article{ lewis2005model, 19019 title = {Model problems for the multigrid optimization of systems governed by differential 19020 equations}, 19021 author = {Lewis, R.M. and Nash, S.G.}, 19022 journal = {SIAM Journal on Scientific Computing}, 19023 volume = {26}, 19024 number = {6}, 19025 pages = {1811--1837}, 19026 year = {2005}, 19027 publisher = {Philadelphia, PA: SIAM, c1993-} 19028} 19029 19030@Article{ nash2000mgopt, 19031 title = {A multigrid approach to discretized optimization problems}, 19032 author = {Nash, S.G.}, 19033 journal = {Optimization Methods and Software}, 19034 volume = {14}, 19035 number = {1-2}, 19036 pages = {99--116}, 19037 year = {2000}, 19038 publisher = {Taylor \& Francis} 19039} 19040 19041@Article{ borzi2009multigrid, 19042 title = {Multigrid Methods for {PDE} Optimization}, 19043 author = {Borz{\`i}, A. and Schulz, V.}, 19044 journal = {SIAM Review}, 19045 volume = {51}, 19046 pages = {361}, 19047 year = {2009} 19048} 19049 19050@Article{ borzi2005multigrid, 19051 title = {A multigrid scheme for elliptic constrained optimal control problems}, 19052 author = {Borz{\`i}, A. and Kunisch, K.}, 19053 journal = {Computational Optimization and Applications}, 19054 volume = {31}, 19055 number = {3}, 19056 pages = {309--333}, 19057 year = {2005}, 19058 publisher = {Springer} 19059} 19060 19061@Article{ borzi2003multigrid, 19062 title = {Multigrid methods for parabolic distributed optimal control problems}, 19063 author = {Borz{\`i}, A.}, 19064 journal = {Journal of Computational and Applied Mathematics}, 19065 volume = {157}, 19066 number = {2}, 19067 pages = {365--382}, 19068 year = {2003}, 19069 publisher = {Elsevier} 19070} 19071 19072@Article{ ito2002receding, 19073 title = {Receding horizon optimal control for infinite dimensional systems}, 19074 author = {Ito, K. and Kunisch, K.}, 19075 journal = {ESAIM: Control, Optimisation and Calculus of Variations}, 19076 volume = {8}, 19077 number = {1}, 19078 pages = {741--760}, 19079 year = {2002}, 19080 publisher = {Cambridge University Press} 19081} 19082 19083@Article{ schulz1998solving, 19084 title = {Solving discretized optimization problems by partially reduced {SQP} methods}, 19085 author = {Schulz, V.H.}, 19086 journal = {Computing and Visualization in Science}, 19087 volume = {1}, 19088 number = {2}, 19089 pages = {83--96}, 19090 year = {1998}, 19091 publisher = {Springer} 19092} 19093 19094@Article{ hazra2005aerodynamic, 19095 title = {Aerodynamic shape optimization using simultaneous pseudo-timestepping}, 19096 author = {Hazra, S.B. and Schulz, V. and Brezillon, J. and Gauger, N.R.}, 19097 journal = {Journal of Computational Physics}, 19098 volume = {204}, 19099 number = {1}, 19100 pages = {46--64}, 19101 year = {2005}, 19102 publisher = {Elsevier} 19103} 19104 19105@Article{ mandel1985multilevel, 19106 title = {On multilevel iterative methods for integral equations of the second kind and 19107 related problems}, 19108 author = {Mandel, J.}, 19109 journal = {Numerische Mathematik}, 19110 volume = {46}, 19111 number = {1}, 19112 pages = {147--157}, 19113 year = {1985}, 19114 publisher = {Springer} 19115} 19116 19117@Article{ king1992multilevel, 19118 title = {Multilevel algorithms for ill-posed problems}, 19119 author = {King, J.T.}, 19120 journal = {Numerische Mathematik}, 19121 volume = {61}, 19122 number = {1}, 19123 pages = {311--334}, 19124 year = {1992}, 19125 publisher = {Springer} 19126} 19127 19128@Article{ kaltenbacher2001regularizing, 19129 title = {On the regularizing properties of a full multigrid method for ill-posed 19130 problems}, 19131 author = {Kaltenbacher, B.}, 19132 journal = {Inverse Problems}, 19133 volume = {17}, 19134 pages = {767}, 19135 year = {2001}, 19136 publisher = {IOP Publishing} 19137} 19138 19139@Article{ kaltenbacher2002multi, 19140 title = {A multi-grid method with a priori and a posteriori level choice for the 19141 regularization of nonlinear ill-posed problems}, 19142 author = {Kaltenbacher, B. and Schicho, J.}, 19143 journal = {Numerische Mathematik}, 19144 volume = {93}, 19145 number = {1}, 19146 pages = {77--107}, 19147 year = {2002}, 19148 publisher = {Springer} 19149} 19150 19151@Article{ burger2006regularizing, 19152 title = {Regularizing {N}ewton-{K}aczmarz Methods for Nonlinear Ill-Posed Problems}, 19153 author = {Burger, M. and Kaltenbacher, B.}, 19154 journal = {SIAM Journal on Numerical Analysis}, 19155 volume = {44}, 19156 pages = {153}, 19157 year = {2006} 19158} 19159 19160@Article{ draganescu2008optimal, 19161 title = {Optimal order multilevel preconditioners for regularized ill-posed problems}, 19162 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Todd F. Dupont}, 19163 journal = {Mathematics of Computation}, 19164 volume = {77}, 19165 number = {264}, 19166 pages = {2001--2038}, 19167 year = {2008} 19168} 19169 19170@Article{ bastian1998additive, 19171 title = {Additive and multiplicative multi-grid---a comparison}, 19172 author = {Bastian, P. and Wittum, G. and Hackbusch, W.}, 19173 journal = {Computing}, 19174 volume = {60}, 19175 number = {4}, 19176 pages = {345--364}, 19177 year = {1998}, 19178 publisher = {Springer} 19179} 19180 19181@Article{ fournier2001multiplicative, 19182 title = {Multiplicative and additive parallel multigrid algorithms for the acceleration of 19183 compressible flow computations on unstructured meshes}, 19184 author = {Fournier, L. and Lanteri, S.}, 19185 journal = {Applied Numerical Mathematics}, 19186 volume = {36}, 19187 number = {4}, 19188 pages = {401--426}, 19189 year = {2001}, 19190 publisher = {Elsevier} 19191} 19192 19193@Article{ chow2006survey, 19194 title = {A survey of parallelization techniques for multigrid solvers}, 19195 author = {Chow, E. and Falgout, R.D. and Hu, J.J. and Tuminaro, R.S. and Yang, U.M.}, 19196 journal = {Parallel Processing for Scientific Computing, MA Heroux, P. Raghavan, and HD 19197 Simon, eds}, 19198 volume = {20}, 19199 pages = {179--201}, 19200 year = {2006} 19201} 19202 19203@InBook{ brandt2001multiscale, 19204 title = {Multiscale scientific computation: {R}eview 2001}, 19205 author = {Brandt, A.}, 19206 booktitle = {Multiscale and Multiresolution Methods: Theory and Applications}, 19207 editors = {Barth, T.J. and Chan, T.F. and Haimes, R.}, 19208 series = {Lecture Notes in Computational Science and Engineering}, 19209 year = {2001}, 19210 volume = {20}, 19211 pages = {3--96}, 19212 publisher = {Springer Verlag} 19213} 19214 19215@InCollection{ brandt2003multigrid, 19216 title = {Multigrid solvers and multilevel optimization strategies}, 19217 author = {Brandt, A. and Ron, D.}, 19218 booktitle = {Multilevel Optimization and VLSICAD}, 19219 editors = {J. Cong and J.R. Shinnerl}, 19220 pages = {1--69}, 19221 publisher = {Kluwer Academic Publishers}, 19222 year = {2003} 19223} 19224 19225@InBook{ brandt2009principles, 19226 title = {Principles of systematic upscaling}, 19227 author = {Brandt, A.}, 19228 booktitle = {Bridging the Scales in Science and Engineering}, 19229 editors = {J. Fish}, 19230 publisher = {Oxford University Press}, 19231 pages = {193--215}, 19232 year = {2009} 19233} 19234 19235@Article{ livne2004coarsening, 19236 title = {Coarsening by compatible relaxation}, 19237 author = {Livne, O.E.}, 19238 journal = {Numerical Linear Algebra with Applications}, 19239 volume = {11}, 19240 number = {2-3}, 19241 pages = {205--227}, 19242 year = {2004}, 19243 publisher = {Wiley Online Library} 19244} 19245 19246@InProceedings{ brandt1986stochastic, 19247 title = {Multi-Level Approaches to Discrete-State and Stochastic Problems}, 19248 author = {Brandt, A. and Ron, D. and Amit, D.J.}, 19249 booktitle = {Multigrid methods II: proceedings of the 2nd European Conference on Multigrid 19250 Methods, held at Cologne, October 1-4, 1985}, 19251 volume = {1228}, 19252 pages = {65--98}, 19253 year = {1986}, 19254 organization = {Springer} 19255} 19256 19257@Article{ halko2011finding, 19258 author = {Nathan Halko and Per-Gunnar Martinsson and Joel A. Tropp}, 19259 title = {Finding Structure with Randomness: Probabilistic Algorithms for Constructing 19260 Approximate Matrix Decompositions}, 19261 journal = {SIAM Review}, 19262 volume = {53}, 19263 number = {2}, 19264 year = {2011}, 19265 pages = {217-288}, 19266 doi = {10.1137/090771806} 19267} 19268 19269@InProceedings{ mhdy09, 19270 author = {Mohiyuddin, M. and Hoemmen, M. and Demmel, J. and Yelick, K.}, 19271 booktitle = {Proceedings of SC09}, 19272 organization = {ACM}, 19273 title = {Minimizing communication in sparse matrix solvers}, 19274 doi = {10.1145/1654059.1654096}, 19275 year = {2009} 19276} 19277 19278@InProceedings{ vanrosendale83, 19279 title = {Minimizing inner product data dependencies in conjugate gradient iteration}, 19280 booktitle = {Proceedings of the IEEE International Conference on Parallel Processing}, 19281 author = {J. van Rosendale}, 19282 year = {1983}, 19283 publisher = {IEEE Computer Society} 19284} 19285 19286@PhDThesis{ vuduc95, 19287 title = {Quantitative performance modeling of scientific computations and creating 19288 locality in numerical algorithms}, 19289 author = {R. Vuduc}, 19290 journal = {Massachusetts Institute of Technology}, 19291 school = {Massachusetts Institute of Technology}, 19292 year = {1995} 19293} 19294 19295@Article{ simoncini2003flexible, 19296 title = {Flexible inner-outer {Krylov} subspace methods}, 19297 author = {Simoncini, V. and Szyld, D.B.}, 19298 journal = {SIAM Journal on Numerical Analysis}, 19299 pages = {2219--2239}, 19300 year = {2003}, 19301 publisher = {JSTOR} 19302} 19303 19304@Article{ parks2006recycling, 19305 title = {Recycling {K}rylov Subspaces for Sequences of Linear Systems}, 19306 author = {Parks, M.L. and de Sturler, E. and Mackey, G. and Johnson, D.D. and Maiti, S.}, 19307 journal = {SIAM Journal on Scientific Computing}, 19308 volume = {28}, 19309 number = {5}, 19310 pages = {1651--1674}, 19311 year = {2006}, 19312 publisher = {Society for Industrial and Applied Mathematics} 19313} 19314 19315@Article{ freund2003model, 19316 title = {Model reduction methods based on Krylov subspaces}, 19317 author = {Freund, R.W.}, 19318 journal = {Acta Numerica}, 19319 volume = {12}, 19320 number = {1}, 19321 pages = {267--319}, 19322 year = {2003}, 19323 publisher = {Cambridge Univ Press} 19324} 19325 19326@InBook{ gutknecht2006block, 19327 title = {Block {K}rylov space methods for linear systems with multiple right-hand sides: 19328 an introduction}, 19329 booktitle = {Modern Mathematical Models, Methods and Algorithms for Real World Systems}, 19330 author = {Gutknecht, M.H.}, 19331 editors = {Siddiqi A.H. and Duff I.S. and Christensen O.}, 19332 publisher = {Anamaya Publishers}, 19333 location = {New Delhi}, 19334 pages = {420-447}, 19335 year = {2006} 19336} 19337 19338@Article{ moulton1998black, 19339 title = {The black box multigrid numerical homogenization algorithm}, 19340 author = {Moulton, J.D. and Dendy, J.E. and Hyman, J.M. and others}, 19341 journal = {Journal of Computational Physics}, 19342 volume = {142}, 19343 number = {1}, 19344 pages = {80--108}, 19345 year = {1998}, 19346 publisher = {Elsevier} 19347} 19348 19349@Article{ neuss2001homogenization, 19350 title = {Homogenization and multigrid}, 19351 author = {Neuss, N. and J{\"a}ger, W. and Wittum, G.}, 19352 journal = {Computing}, 19353 volume = {66}, 19354 number = {1}, 19355 pages = {1--26}, 19356 year = {2001}, 19357 publisher = {Springer} 19358} 19359 19360@Article{ bai2002krylov, 19361 title = {Krylov subspace techniques for reduced-order modeling of large-scale dynamical 19362 systems}, 19363 author = {Bai, Z.}, 19364 journal = {Applied Numerical Mathematics}, 19365 volume = {43}, 19366 number = {1}, 19367 pages = {9--44}, 19368 year = {2002}, 19369 publisher = {Elsevier} 19370} 19371 19372@InProceedings{ dong2003piecewise, 19373 title = {Piecewise polynomial nonlinear model reduction}, 19374 author = {Dong, N. and Roychowdhury, J.}, 19375 booktitle = {Design Automation Conference, 2003. Proceedings}, 19376 pages = {484--489}, 19377 year = {2003}, 19378 organization = {IEEE} 19379} 19380 19381@Article{ bond2009stable, 19382 title = {Stable reduced models for nonlinear descriptor systems through piecewise-linear 19383 approximation and projection}, 19384 author = {Bond, B.N. and Daniel, L.}, 19385 journal = {IEEE Transactions on Computer-Aided Design of Integrated Circuits and Systems}, 19386 volume = {28}, 19387 number = {10}, 19388 pages = {1467--1480}, 19389 year = {2009}, 19390 publisher = {IEEE} 19391} 19392 19393@Article{ xin2000front, 19394 title = {Front Propagation in Heterogeneous Media}, 19395 author = {Xin, J.}, 19396 journal = {SIAM Review}, 19397 volume = {42}, 19398 number = {2}, 19399 pages = {161--230}, 19400 year = {2000}, 19401 publisher = {Society for Industrial and Applied Mathematics} 19402} 19403 19404@Article{ owhadi2011localized, 19405 title = {Localized Bases for Finite-Dimensional Homogenization Approximations with 19406 Nonseparated Scales and High Contrast}, 19407 author = {Owhadi, H. and Zhang, L.}, 19408 journal = {Multiscale Modeling and Simulation}, 19409 volume = {9}, 19410 pages = {1373}, 19411 year = {2011} 19412} 19413 19414@Article{ berlyand2010flux, 19415 title = {Flux norm approach to finite dimensional homogenization approximations with 19416 non-separated scales and high contrast}, 19417 author = {Berlyand, L. and Owhadi, H.}, 19418 journal = {Archive for rational mechanics and analysis}, 19419 volume = {198}, 19420 number = {2}, 19421 pages = {677--721}, 19422 year = {2010}, 19423 publisher = {Springer} 19424} 19425 19426@Article{ babuska2011optimal, 19427 title = {Optimal Local Approximation Spaces for Generalized Finite Element Methods with 19428 Application to Multiscale Problems}, 19429 author = {Babuska, I. and Lipton, R.}, 19430 journal = {Multiscale Modeling \& Simulation}, 19431 volume = {9}, 19432 pages = {373}, 19433 year = {2011} 19434} 19435 19436@Article{ boettinger2002phase, 19437 title = {Phase-Field Simulation of Solidification}, 19438 author = {Boettinger, W.J. and Warren, J.A. and Beckermann, C. and Karma, A.}, 19439 journal = {Annual review of materials research}, 19440 volume = {32}, 19441 number = {1}, 19442 pages = {163--194}, 19443 year = {2002}, 19444 publisher = {Annual Reviews} 19445} 19446 19447@Article{ karma1998quantitative, 19448 title = {Quantitative phase-field modeling of dendritic growth in two and three 19449 dimensions}, 19450 author = {Karma, A. and Rappel, W.J.}, 19451 journal = {Physical Review E}, 19452 volume = {57}, 19453 number = {4}, 19454 pages = {4323}, 19455 year = {1998}, 19456 publisher = {APS} 19457} 19458 19459@Article{ chen2002phase, 19460 title = {Phase-field models for microstructure evolution}, 19461 author = {Chen, L.Q.}, 19462 journal = {Annual review of materials research}, 19463 volume = {32}, 19464 number = {1}, 19465 pages = {113--140}, 19466 year = {2002}, 19467 publisher = {Annual Reviews} 19468} 19469 19470@Article{ galbally2010reductionuq, 19471 title = {Non-linear model reduction for uncertainty quantification in large-scale inverse 19472 problems}, 19473 author = {Galbally, D. and Fidkowski, K. and Willcox, K. and Ghattas, O.}, 19474 journal = {International journal for numerical methods in engineering}, 19475 volume = {81}, 19476 number = {12}, 19477 pages = {1581--1608}, 19478 year = {2010}, 19479 publisher = {Wiley Online Library} 19480} 19481 19482@Article{ griebel1995abstract, 19483 title = {On the abstract theory of additive and multiplicative {Schwarz} algorithms}, 19484 author = {Griebel, M. and Oswald, P.}, 19485 journal = {Numerische Mathematik}, 19486 volume = {70}, 19487 number = {2}, 19488 pages = {163--180}, 19489 year = {1995}, 19490 publisher = {Springer} 19491} 19492 19493@InProceedings{ voutchkov2006multiobjective, 19494 title = {Multiobjective optimization using surrogates}, 19495 author = {Voutchkov, I. and Keane, A.J.}, 19496 booktitle = {Adaptive Computing in Design and Manufacture}, 19497 pages = {167--175}, 19498 year = {2006}, 19499 publisher = {The MC Escher Company} 19500} 19501 19502@Article{ leary2001constraint, 19503 title = {A constraint mapping approach to the structural optimization of an expensive 19504 model using surrogates}, 19505 author = {Leary, S.J. and Bhaskar, A. and Keane, A.J.}, 19506 journal = {Optimization and Engineering}, 19507 volume = {2}, 19508 number = {4}, 19509 pages = {385--398}, 19510 year = {2001}, 19511 publisher = {Springer} 19512} 19513 19514@InProceedings{ legresley2000airfoil, 19515 title = {Airfoil design optimization using reduced order models based on proper orthogonal 19516 decomposition}, 19517 author = {LeGresley, P.A. and Alonso, J.J.}, 19518 booktitle = {Fluids 2000 Conference and Exhibit, Denver, CO}, 19519 year = {2000} 19520} 19521 19522@Book{ myers2009response, 19523 title = {Response surface methodology: process and product optimization using designed 19524 experiments}, 19525 author = {Myers, R.H. and Montgomery, D.C. and Anderson-Cook, C.M.}, 19526 volume = {705}, 19527 year = {2009}, 19528 publisher = {John Wiley \& Sons} 19529} 19530 19531@Article{ carlberg2012gnat, 19532 title = {The {GNAT} method for nonlinear model reduction: effective implementation and 19533 application to computational fluid dynamics and turbulent flows}, 19534 author = {Kevin Carlberg and Charbel Farhat and Julien Cortial and David Amsallem}, 19535 journal = {arXiv}, 19536 volume = {1207.1349}, 19537 year = {2012} 19538} 19539 19540@Article{ biros2008multilevel, 19541 title = {A multilevel algorithm for inverse problems with elliptic {PDE} constraints}, 19542 author = {Biros, G. and Dogan, G.}, 19543 journal = {Inverse Problems}, 19544 volume = {24}, 19545 pages = {034010}, 19546 year = {2008}, 19547 publisher = {IOP Publishing} 19548} 19549 19550@Article{ rees2010optimal, 19551 title = {Optimal Solvers for {PDE}-Constrained Optimization}, 19552 author = {Rees, T. and Dollar, H.S. and Wathen, A.J.}, 19553 journal = {SIAM Journal on Scientific Computing}, 19554 volume = {32}, 19555 pages = {271}, 19556 year = {2010} 19557} 19558 19559@Article{ rees2010block, 19560 title = {Block-triangular preconditioners for {PDE}-constrained optimization}, 19561 author = {Rees, T. and Stoll, M.}, 19562 journal = {Numerical Linear Algebra with Applications}, 19563 volume = {17}, 19564 number = {6}, 19565 pages = {977--996}, 19566 year = {2010}, 19567 publisher = {Wiley Online Library} 19568} 19569 19570@Article{ rees2011preconditioning, 19571 title = {Preconditioning Iterative Methods for the Optimal Control of the {S}tokes 19572 Equations}, 19573 author = {Rees, T. and Wathen, A.J.}, 19574 journal = {SIAM Journal on Scientific Computing}, 19575 volume = {33}, 19576 number = {5}, 19577 pages = {2903--2926}, 19578 year = {2011}, 19579 publisher = {Society for Industrial and Applied Mathematics} 19580} 19581 19582@Article{ vogel2007fbicg, 19583 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19584 author = {Vogel,J.A.}, 19585 journal = {Applied Mathematics and Computation}, 19586 volume = {188}, 19587 number = {1}, 19588 pages = {226–-233}, 19589 year = {2007}, 19590 publisher = {Elsevier} 19591} 19592 19593@Unpublished{ leehammond2010, 19594 author = {B. Lee and G.E. Hammond}, 19595 title = {Parallel Performance of Preconditioned {Krylov} Solvers for the {Richards} 19596 Equation}, 19597 key = {multigrid}, 19598 note = {manuscript, 2010} 19599} 19600 19601@Article{ vandeneshop2004inexact, 19602 title = {Inexact {Krylov} Subspace Methods for Linear Systems}, 19603 author = {Jasper {van den} Eshof and Gerard L. G. Sleijpen}, 19604 journal = {SIAM Journal on Matrix Analysis and Applications}, 19605 volume = {26}, 19606 number = {1}, 19607 pages = {125--153}, 19608 year = {2004} 19609} 19610 19611@Article{ fbicg.fbcgs, 19612 title = {Flexible {BiCG} and flexible {Bi-CGSTAB} for nonsymmetric linear systems}, 19613 author = {Judith A. Vogel}, 19614 journal = {Applied Mathematics and Computation}, 19615 volume = {188}, 19616 number = {1}, 19617 pages = {226--233}, 19618 year = {2007} 19619} 19620 19621@Article{ simoncini2003inexact, 19622 title = {Theory of Inexact {Krylov} Subspace Methods and Applications to Scientific 19623 Computing}, 19624 author = {Valeria Simoncini and Daniel B. Szyld}, 19625 journal = {SIAM Journal on Scientific Computing}, 19626 volume = {25}, 19627 number = {2}, 19628 pages = {454--477}, 19629 year = {2003} 19630} 19631 19632@Article{ fqmr, 19633 title = {{FQMR}: A Flexible {Quasi-Minimal Residual} Method with Inexact Preconditioning}, 19634 author = {Daniel B. Szyld and Judith A. Vogel}, 19635 journal = {SIAM Journal on Scientific Computing}, 19636 volume = {23}, 19637 number = {2}, 19638 pages = {363--380}, 19639 year = {2001} 19640} 19641 19642@Article{ ipcg, 19643 title = {Inexact Preconditioned {Conjugate Gradient} Method with Inner-Outer Iteration}, 19644 author = {Gene H. Golub and Qiang Ye}, 19645 journal = {SIAM Journal on Scientific Computing}, 19646 volume = {21}, 19647 number = {4}, 19648 pages = {1305--1320}, 19649 year = {1999} 19650} 19651 19652@Article{ idr.sonneveld, 19653 title = {{IDR}(s): A Family of Simple and Fast Algorithms for Solving Large Nonsymmetric 19654 Systems of Linear Equations}, 19655 author = {Peter Sonneveld and Martin B. van Gijzen}, 19656 journal = {SIAM Journal on Scientific Computing}, 19657 volume = {31}, 19658 number = {2}, 19659 pages = {1035--1062}, 19660 year = {2008} 19661} 19662 19663@Article{ flexiblecg, 19664 title = {Flexible Conjugate Gradients}, 19665 author = {Yvan Notay}, 19666 journal = {SIAM Journal on Scientific Computing}, 19667 volume = {22}, 19668 number = {4}, 19669 pages = {1444--1460}, 19670 year = {2000} 19671} 19672 19673@Article{ generalizedcg, 19674 title = {A Black Box Generalized {Conjugate Gradient} Solver with Inner Iterations and 19675 Variable-Step Preconditioning}, 19676 author = {O. Axelsson and P. S. Vassilevski}, 19677 journal = {SIAM Journal on Matrix Analysis and Applications}, 19678 volume = {12}, 19679 number = {4}, 19680 pages = {625--644}, 19681 year = {1991} 19682} 19683 19684@Article{ bicg, 19685 title = {{Conjugate Gradient} methods for indefinite systems}, 19686 author = {R. Fletcher}, 19687 journal = {Lecture Notes in Mathematics}, 19688 volume = {506}, 19689 pages = {73--89}, 19690 year = {1976} 19691} 19692 19693@Article{ idr.bcgs, 19694 title = {{Bi-CGSTAB} as an induced dimension reduction method}, 19695 author = {Gerard L.G. Sleijpen and Peter Sonneveld and Martin B. van Gijzen}, 19696 journal = {Applied Numerical Mathematics}, 19697 volume = {60}, 19698 pages = {1100--1114}, 19699 year = {2010} 19700} 19701 19702@Article{ idr.bcgsl, 19703 title = {Exploiting {BiCGstab($\ell$)} strategies to induce dimension reduction}, 19704 author = {Gerard L.G. Sleijpen and Martin B. van Gijzen}, 19705 journal = {SIAM J. Sci. Comput.}, 19706 volume = {32}, 19707 number = {5}, 19708 pages = {2687--2709}, 19709 year = {2010} 19710} 19711 19712@Article{ idr.min.sync, 19713 title = {Minimizing synchronization in {IDR(s)}}, 19714 author = {T.P. Collignon and M.B. van Gijzen}, 19715 journal = {Numerical Linear Algebra with Applications}, 19716 volume = {18}, 19717 number = {5}, 19718 pages = {805--825}, 19719 year = {2011} 19720} 19721 19722@TechReport{ flexible.idr, 19723 title = {Flexible and Multi-Shift Induced Dimension Reduction Algorithms for solving Large 19724 Sparse Linear Systems}, 19725 author = {Martin B. van Gijzen and Gerard L.G. Sleijpen and Jens-Peter M. Zemke}, 19726 institution = {Delft University of Technology}, 19727 number = {11-06}, 19728 year = {2011} 19729} 19730 19731@Article{ vangenuchten1980, 19732 title = {A Closed-form Equation for Predicting the Hydraulic Conductivity of Unsaturated 19733 Soils}, 19734 author = {M. Th. van Genuchten}, 19735 journal = {Soil Science Society of America Journal}, 19736 volume = {44}, 19737 pages = {892--898}, 19738 year = {1980} 19739} 19740 19741@Article{ gmresr94, 19742 title = {{GMRESR}: a family of nested {GMRES} methods}, 19743 author = {H. A. Van der Vorst and C. Vuik}, 19744 journal = {Numerical Linear Algebra with Applications}, 19745 volume = {1}, 19746 number = {4}, 19747 pages = {369--386}, 19748 year = {1994} 19749} 19750 19751@Article{ knepley10, 19752 author = {Matthew G. Knepley}, 19753 title = {Removing the Barrier to Scalability in Parallel FMM}, 19754 journal = {CoRR}, 19755 volume = {abs/1008.2410}, 19756 note = {\url{http://arxiv.org/abs/1008.2410}}, 19757 year = {2010} 19758} 19759 19760@Article{ teng1998, 19761 author = {Shang-Hua Teng}, 19762 title = {Provably Good Partitioning and Load Balancing Algorithms for Parallel Adaptive 19763 N-Body Simulation}, 19764 journal = {SIAM J. Sci. Comput.}, 19765 volume = {19}, 19766 number = {2}, 19767 month = mar, 19768 pages = {635--656}, 19769 year = {1998}, 19770 issn = {1064-8275}, 19771 numpages = {22}, 19772 doi = {10.1137/S1064827595288942}, 19773 acmid = {289842}, 19774 issue_date = {March 1998}, 19775 publisher = {Society for Industrial and Applied Mathematics}, 19776 address = {Philadelphia, PA}, 19777 keywords = {N-body simulation, adaptive computing, hierarchical methods, load balancing, 19778 parallel processing, partitioning, scientific computing, the fast multipole 19779 method, tree-codes} 19780} 19781 19782@InProceedings{ skinnerkramer05, 19783 author = {David Skinner and William Kramer}, 19784 title = {Understanding the causes of performance variability in HPC workloads}, 19785 booktitle = {Workload Characterization Symposium, 2005. Proceedings of the IEEE 19786 International}, 19787 organization = {IEEE}, 19788 pages = {137--149}, 19789 year = {2005} 19790} 19791 19792@Article{ notay_2000, 19793 author = {Yvan Notay}, 19794 title = {Flexible {Conjugate Gradients}}, 19795 journal = {SIAM Journal on Scientific Computing}, 19796 volume = {22}, 19797 number = {4}, 19798 year = {2000}, 19799 pages = {1444--1460} 19800} 19801 19802@Article{ bereux1996, 19803 title = {Zero-relaxation limit versus operator splitting for two-phase fluid flow 19804 computations}, 19805 author = {Fran{\c{c}}ois B{\'e}reux}, 19806 journal = {Computer Methods in Applied Mechanics and Engineering}, 19807 volume = {133}, 19808 number = {1-2}, 19809 pages = {93--124}, 19810 year = {1996} 19811} 19812 19813@Article{ pawlowski2006globalization, 19814 title = {Globalization techniques for {N}ewton-{K}rylov methods and applications to the 19815 fully coupled solution of the {N}avier-{S}tokes equations}, 19816 author = {Pawlowski, Roger P and Shadid, John N and Simonis, Joseph P and Walker, Homer F}, 19817 journal = {SIAM Review}, 19818 volume = {48}, 19819 number = {4}, 19820 pages = {700--721}, 19821 year = {2006}, 19822 publisher = {SIAM} 19823} 19824 19825@Article{ roppshadid2009, 19826 title = {Stability of operator splitting methods for systems with indefinite operators: 19827 Advection--diffusion--reaction systems}, 19828 author = {David L Ropp and John N Shadid}, 19829 journal = {Journal of Computational Physics}, 19830 volume = {228}, 19831 number = {9}, 19832 pages = {3508--3516}, 19833 year = {2009} 19834} 19835 19836@Article{ brown1985experiments, 19837 title = {Experiments with quasi-{N}ewton methods in solving stiff {ODE} systems}, 19838 author = {Brown, P.N. and Hindmarsh, A.C. and Walker, H.F.}, 19839 journal = {SIAM Journal on Scientific and Statistical Computing}, 19840 volume = {6}, 19841 number = {2}, 19842 pages = {297--313}, 19843 year = {1985}, 19844 publisher = {SIAM} 19845} 19846 19847@Article{ bicgsl_1993, 19848 author = {GERARD L.G. SLEIJPEN and DIEDERIK R. FOKKEMA}, 19849 title = {{BiCGSTAB(l)} for Linear Equations involving Unsymmetric Matrices with Complex 19850 Spectrum}, 19851 journal = {Electronic Transactions on Numerical Analysis}, 19852 volume = {1}, 19853 year = {1993}, 19854 pages = {11--32} 19855} 19856 19857@Book{ brandt2011revised, 19858 title = {Multigrid Techniques: 1984 Guide with Applications to Fluid Dynamics, Revised 19859 Edition}, 19860 author = {Achi Brandt and Oren Livne}, 19861 year = {2011}, 19862 publisher = {SIAM} 19863} 19864 19865@Article{ axelsson1990algebraic, 19866 title = {Algebraic multilevel preconditioning methods, {II}}, 19867 author = {Axelsson, O. and Vassilevski, P.S.}, 19868 journal = {SIAM Journal on Numerical Analysis}, 19869 volume = {27}, 19870 number = {6}, 19871 pages = {1569--1590}, 19872 year = {1990}, 19873 publisher = {SIAM} 19874} 19875 19876@Article{ zulehner2002analysis, 19877 title = {Analysis of iterative methods for saddle point problems: a unified approach}, 19878 author = {Zulehner, W.}, 19879 journal = {Mathematics of computation}, 19880 volume = {71}, 19881 number = {238}, 19882 pages = {479--506}, 19883 year = {2002} 19884} 19885 19886@Article{ pralet2010, 19887 author = {L. Giraud and A. Haidar and S. Pralet}, 19888 title = {Using multiple levels of parallelism to enhance the performance of domain 19889 decomposition solvers}, 19890 journal = {Parallel Computing}, 19891 volume = {36}, 19892 number = {5-6}, 19893 pages = {285--296}, 19894 year = {2010} 19895} 19896 19897@Book{ brennerscottfem, 19898 title = {The Mathematical Theory of Finite Element Methods}, 19899 author = {Susanne C. Brenner and L. Ridgway Scott}, 19900 edition = {3rd Edition}, 19901 series = {Texts in Applied Mathematics}, 19902 year = {2008}, 19903 publisher = {Springer-Verlag} 19904} 19905 19906@Book{ ortega1987iterative, 19907 title = {Iterative solution of nonlinear equations in several variables}, 19908 author = {Ortega, James M and Rheinboldt, Werner C}, 19909 volume = {30}, 19910 publisher = {Society for Industrial and Applied Mathematics}, 19911 year = {1987} 19912} 19913 19914@InBook{ rheinboldtch6, 19915 author = {Werner C. Rheinboldt}, 19916 title = {6. Combinations of Processes}, 19917 booktitle = {Methods for Solving Systems of Nonlinear Equations}, 19918 chapter = {6}, 19919 pages = {59--74}, 19920 doi = {10.1137/1.9781611970012.ch6}, 19921 year = {1998} 19922} 19923 19924@Article{ allgowerbohmerpotrarheinboldt86, 19925 author = {E. Allgower and K. B\"ohmer and F. Potra and W.~C. Rheinboldt}, 19926 title = {A Mesh-Independence Principle for Operator Equations and Their Discretizations}, 19927 journal = {SIAM Journal on Numerical Analysis}, 19928 volume = {23}, 19929 number = {1}, 19930 pages = {160-169}, 19931 year = {1986}, 19932 doi = {10.1137/0723011} 19933} 19934 19935@Article{ rheinboldt76, 19936 author = {Werner C. Rheinboldt}, 19937 title = {On measures of ill-conditioning for nonlinear equations}, 19938 journal = {Mathematics of Computation}, 19939 volume = {30}, 19940 number = {133}, 19941 pages = {104--111}, 19942 year = {1976} 19943} 19944 19945@Article{ little61, 19946 author = {John D. C. Little}, 19947 title = {A Proof for the Queuing Formula: {$L = \lambda W$}}, 19948 journal = {Operations Research}, 19949 volume = {9}, 19950 number = {3}, 19951 pages = {383--387}, 19952 note = {\url{http://www.jstor.org/stable/167570}}, 19953 year = {1961} 19954} 19955 19956@Misc{ top500, 19957 author = {{TOP500 Supercomputer Sites}}, 19958 url = {http://www.top500.org}, 19959 year = {2013} 19960} 19961 19962@Misc{ hassediagram, 19963 author = {Wikipedia}, 19964 title = {Hasse Diagram}, 19965 url = {http://en.wikipedia.org/wiki/Hasse_diagram}, 19966 note = {\url{http://en.wikipedia.org/wiki/Hasse_diagram}}, 19967 year = {2015} 19968} 19969 19970@Misc{ groupoid, 19971 author = {Wikipedia}, 19972 title = {Groupoid}, 19973 url = {https://en.wikipedia.org/wiki/Groupoid}, 19974 note = {\url{http://en.wikipedia.org/wiki/Groupoid}}, 19975 year = {2015} 19976} 19977 19978@Misc{ cwcomplex, 19979 author = {Wikipedia}, 19980 title = {{CW} complex}, 19981 url = {http://en.wikipedia.org/wiki/CW_complex}, 19982 note = {\url{http://en.wikipedia.org/wiki/CW_complex}}, 19983 year = {2015} 19984} 19985 19986@Misc{ linearalgebra, 19987 author = {Wikipedia}, 19988 title = {Linear Algebra}, 19989 url = {https://en.wikipedia.org/wiki/Linear_algebra}, 19990 note = {\url{https://en.wikipedia.org/wiki/Linear_algebra}}, 19991 year = {2015} 19992} 19993 19994@Misc{ amdahlslaw, 19995 author = {Wikipedia}, 19996 title = {Amdahl's Law}, 19997 url = {https://en.wikipedia.org/wiki/Amdahl's_law}, 19998 note = {\url{https://en.wikipedia.org/wiki/Amdahl's_law}}, 19999 year = {2015} 20000} 20001 20002@Misc{ gustafsonslaw, 20003 author = {Wikipedia}, 20004 title = {Gustafson's Law}, 20005 url = {https://en.wikipedia.org/wiki/Gustafson's_law}, 20006 note = {\url{https://en.wikipedia.org/wiki/Gustafson's_law}}, 20007 year = {2015} 20008} 20009 20010@InProceedings{ amdahl1967, 20011 title = {Validity of the Single Processor Approach to Achieving Large Scale Computing 20012 Capabilities}, 20013 author = {Gene M. Amdahl}, 20014 booktitle = {Proceedings of the April 18-20, 1967, Spring Joint Computer Conference}, 20015 series = {AFIPS '67 (Spring)}, 20016 location = {Atlantic City, New Jersey}, 20017 pages = {483--485}, 20018 numpages = {3}, 20019 doi = {10.1145/1465482.1465560}, 20020 acmid = {1465560}, 20021 publisher = {ACM}, 20022 address = {New York, NY, USA}, 20023 year = {1967} 20024} 20025 20026@Article{ gustafson1988, 20027 title = {Reevaluating {Amdahl}'s Law}, 20028 author = {Gustafson, John L.}, 20029 journal = {Communications of the ACM}, 20030 volume = {31}, 20031 number = {5}, 20032 month = may, 20033 issn = {0001-0782}, 20034 pages = {532--533}, 20035 doi = {10.1145/42411.42415}, 20036 acmid = {42415}, 20037 year = {1988} 20038} 20039 20040@Book{ eijkhout2014, 20041 title = {Introduction to High Performance Scientific Computing}, 20042 author = {Victor Eijkhout}, 20043 url = {http://pages.tacc.utexas.edu/~eijkhout/Articles/EijkhoutIntroToHPC.pdf}, 20044 publisher = {TACC}, 20045 year = {2014} 20046} 20047 20048@Article{ korelc2002multilanguage, 20049 title = {Multi-language and multi-environment generation of nonlinear finite element 20050 codes}, 20051 author = {Korelc, J.}, 20052 journal = {Engineering with Computers}, 20053 volume = {18}, 20054 number = {4}, 20055 pages = {312--327}, 20056 year = {2002}, 20057 publisher = {Springer} 20058} 20059 20060@TechReport{ taylor2011feap, 20061 title = {{FEAP}: A Finite Element Analysis Program}, 20062 subtitle = {Version 8.3 User Manual}, 20063 author = {R. L. Taylor}, 20064 year = {2011}, 20065 institution = {University of California, Berkeley} 20066} 20067 20068@Article{ bergeraftosmismurman2005, 20069 title = {Analysis of slope limiters on irregular grids}, 20070 author = {Berger, Marsha and Aftosmis, Michael J and Murman, Scott M}, 20071 journal = {AIAA paper}, 20072 volume = {490}, 20073 pages = {2005}, 20074 year = {2005} 20075} 20076 20077@InProceedings{ ferreirabridgesbrightwell08, 20078 author = {Kurt B. Ferreira and Patrick Bridges and Ron Brightwell}, 20079 title = {Characterizing Application Sensitivity to OS Interference Using Kernel-level 20080 Noise Injection}, 20081 booktitle = {Proceedings of the 2008 ACM/IEEE Conference on Supercomputing}, 20082 series = {SC '08}, 20083 year = {2008}, 20084 isbn = {978-1-4244-2835-9}, 20085 location = {Austin, Texas}, 20086 pages = {19:1--19:12}, 20087 articleno = {19}, 20088 numpages = {12}, 20089 url = {http://dl.acm.org/citation.cfm?id=1413370.1413390}, 20090 acmid = {1413390}, 20091 publisher = {IEEE Press}, 20092 address = {Piscataway, NJ} 20093} 20094 20095@Article{ banach22, 20096 author = {Stefan Banach}, 20097 title = {Sur les op\'erations dans les ensembles abstraits et leur application aux 20098 \'equations int\'egrales}, 20099 journal = {Fund. Math.}, 20100 volume = {3}, 20101 pages = {133--181}, 20102 year = {1922} 20103} 20104 20105@Article{ bangerthbursteddeheisterkronbichler2012, 20106 author = {Wolfgang Bangerth and Carsten Burstedde and Timo Heister and Martin Kronbichler}, 20107 title = {Algorithms and Data Structures for Massively Parallel Generic Adaptive Finite 20108 Element Codes}, 20109 journal = {ACM Trans. Math. Softw.}, 20110 issue_date = {December 2011}, 20111 volume = {38}, 20112 number = {2}, 20113 month = jan, 20114 year = {2012}, 20115 issn = {0098-3500}, 20116 pages = {14:1--14:28}, 20117 articleno = {14}, 20118 numpages = {28}, 20119 doi = {10.1145/2049673.2049678}, 20120 acmid = {2049678}, 20121 publisher = {ACM}, 20122 address = {New York, NY, USA}, 20123 keywords = {Adaptive mesh refinement, object-orientation, parallel algorithms, software 20124 design} 20125} 20126 20127@Article{ eisenstatwalker1994, 20128 author = {Stanley Eisenstat and Homer Walker}, 20129 title = {Globally Convergent Inexact {N}ewton Methods}, 20130 journal = {SIAM Journal on Optimization}, 20131 volume = {4}, 20132 number = {2}, 20133 pages = {393--422}, 20134 year = {1994}, 20135 doi = {10.1137/0804022} 20136} 20137 20138@Book{ blumcuckershubsmale98, 20139 title = {Complexity and Real Computation}, 20140 author = {Lenore Blum and Felipe Cucker and Michael Shub and Steve Smale}, 20141 year = {1998}, 20142 publisher = {Springer} 20143} 20144 20145@Article{ caili2011, 20146 author = {Cai, X.-C. and Li, X.}, 20147 title = {Inexact {N}ewton Methods with Restricted Additive {S}chwarz Based Nonlinear 20148 Elimination for Problems with High Local Nonlinearity}, 20149 journal = {SIAM Journal on Scientific Computing}, 20150 volume = {33}, 20151 number = {2}, 20152 pages = {746-762}, 20153 year = {2011}, 20154 doi = {10.1137/080736272} 20155} 20156 20157@Article{ cai2009, 20158 author = {X.-C. Cai}, 20159 title = { Nonlinear overlapping domain decomposition methods}, 20160 journal = {Lecture Notes in Computational Science}, 20161 volume = {70}, 20162 pages = {217-224}, 20163 year = {2009} 20164} 20165 20166@Article{ lanzkronrosewilkes1996, 20167 title = {An analysis of approximate nonlinear elimination}, 20168 author = {Lanzkron, Paul J and Rose, Donald J and Wilkes, James T}, 20169 journal = {SIAM Journal on Scientific Computing}, 20170 volume = {17}, 20171 number = {2}, 20172 pages = {538--559}, 20173 year = {1996}, 20174 publisher = {SIAM} 20175} 20176 20177@TechReport{ gropp1993sowing, 20178 title = {Users manual for bfort: Producing {F}ortran interfaces to {C} source code}, 20179 author = {Gropp, W}, 20180 year = {1995}, 20181 number = {ANL/MCS-TM-208}, 20182 institution = {Argonne National Laboratory} 20183} 20184 20185@TechReport{ gropp1993sowing2, 20186 title = {Users Manual for doctext: Producing Documentation from Source Code}, 20187 author = {Gropp, W}, 20188 year = {1995}, 20189 number = {ANL/MCS-TM-206}, 20190 institution = {Argonne National Laboratory} 20191} 20192 20193@TechReport{ gropp1993simplified, 20194 title = {Simplified Linear Equation Solvers users manual}, 20195 author = {Gropp, W and Smith, B}, 20196 year = {1993}, 20197 number = {ANL--93/8}, 20198 institution = {Argonne National Laboratory} 20199} 20200 20201@Misc{ simplifiedbsd, 20202 author = {{University of California, Berkeley}}, 20203 title = {Simplified {Berkeley} Software Distribution License}, 20204 note = {see 20205 \url{http://en.wikipedia.org/wiki/BSD_licenses#2-clause_license_.28.22Simplified_BSD_License.22_or_.22FreeBSD_License.22.29}} 20206} 20207 20208@Book{ chaconstraub14, 20209 author = {Scott Chacon and Ben Straub}, 20210 title = {Pro Git}, 20211 publisher = {Apress}, 20212 year = {2014}, 20213 pages = {456}, 20214 note = {Available online at \url{http://git-scm.com/book/}} 20215} 20216 20217@Misc{ bitbucket, 20218 author = {Atlassian}, 20219 title = {Bitbucket}, 20220 note = {Platform available from \url{http://bitbucket.org}} 20221} 20222 20223@Misc{ gitworkflows, 20224 author = {GitWorkflows}, 20225 note = {Available at 20226 \url{https://www.kernel.org/pub/software/scm/git/docs/gitworkflows.html}} 20227} 20228 20229@Misc{ figshare, 20230 author = {FigShare}, 20231 note = {Available at \url{http://palgrave.figshare.com/}} 20232} 20233 20234@InProceedings{ beazley1996swig, 20235 title = {{SWIG}: An easy to use tool for integrating scripting languages with {C} and 20236 {C++}}, 20237 author = {Beazley, David M}, 20238 booktitle = {Proceedings of the 4th USENIX Tcl/Tk workshop}, 20239 pages = {129--139}, 20240 year = {1996} 20241} 20242 20243@Misc{ softwareproductivityworkshopreport14, 20244 author = {H. Johansen and L. C. McInnes and D. Bernholdt and J. Carver and M. Heroux and R. 20245 Hornung and P. Jones and B. Lucas and A. Siegel and T. Ndousse-Fetter}, 20246 title = {Software Productivity for Extreme-Scale Science}, 20247 note = {Report on DOE Workshop, January 13-14, 2014}, 20248 url = {http://www.orau.gov/swproductivity2014/SoftwareProductivityWorkshopReport2014.pdf}, 20249 year = {2014} 20250} 20251 20252@Misc{ softwareproductivitywhitepaper13, 20253 author = {H. Johansen and D. Bernholdt and B. Collins and M. Heroux and R. Jacob and P. 20254 Jones and L. C. McInnes and J. D. Moulton and T. Ndousse-Fetter and D. Post and W. 20255 Tang}, 20256 title = {Extreme-Scale Scientific Application Software Productivity: Harnessing the Full 20257 Capability of Extreme-Scale Computing}, 20258 note = {whitepaper submitted to DOE, available via 20259 \url{http://www.orau.gov/swproductivity2014/reference.htm}}, 20260 year = {2013} 20261} 20262 20263@Misc{ ideas:project, 20264 author = {Michael Heroux and Lois Curfman McInnes and J. David {Moulton (PIs)}}, 20265 title = {{Interoperable Design of Extreme-Scale Application Software (IDEAS)}}, 20266 howpublished = {\url{http://ideas-productivity.org}}, 20267 year = {2015} 20268} 20269 20270@TechReport{ keyesmcinneswoodwardetal2012, 20271 author = {D. E. Keyes and L. C. McInnes and C. Woodward and E. Constantinescu and D. Estep 20272 and B. Sheehan}, 20273 title = {First Steps Toward a Multiphysics Exemplars and Benchmarks Suite}, 20274 institution = {Argonne National Laboratory}, 20275 number = {ANL/MCS-TM-330}, 20276 month = oct, 20277 year = {2012} 20278} 20279 20280@Misc{ sawsfs-web-page, 20281 author = {Surtai Han and Barry Smith and Hong Zhang}, 20282 title = {{{SAWs Tutorial: Fieldsplit Preconditioner}}}, 20283 note = {\url{https://www.youtube.com/watch?v=-w0fPhmZT3c}}, 20284 year = {2015} 20285} 20286 20287@Misc{ sawshk-web-page, 20288 author = {Surtai Han and Barry Smith and Hong Zhang}, 20289 title = {{{SAWs Tutorial: Hierarchical Krylov Method}}}, 20290 note = {\url{https://www.youtube.com/watch?v=hWbqppTrcOw}}, 20291 year = {2015} 20292} 20293 20294@Misc{ sawsnestk-web-page, 20295 author = {Surtai Han and Barry Smith and Hong Zhang}, 20296 title = {{{SAWs Tutorial: Nested Krylov Method}}}, 20297 note = {\url{https://www.youtube.com/watch?v=kqPXZxMOJmA}}, 20298 year = {2015} 20299} 20300 20301@Misc{ m2acs:project, 20302 author = {M. {Anitescu et al.}}, 20303 title = {{Multifaceted Mathematics for Complex Energy Systems (M2ACS) {W}eb page}}, 20304 howpublished = {\url{http://www.mcs.anl.gov/MACS}}, 20305 year = {2015} 20306} 20307 20308@Misc{ hssmn13, 20309 author = {P. Hovland and B. Smith and M. Snir and L. C. McInnes and B. Norris}, 20310 title = {Exposing and Expanding Compiler Technologies to Improve Software Productivity in 20311 Developing Mathematical Libraries and Simulation Codes}, 20312 note = {whitepaper submitted to DOE Workshop on Software Productivity for Extreme-Scale 20313 Science, available via \url{http://www.orau.gov/swproductivity2014/papers.htm}}, 20314 year = {2013} 20315} 20316 20317@Misc{ atpesc:website, 20318 key = {{Argonne Training Program for Extreme-Scale Computing}}, 20319 title = {{Argonne Training Program for Extreme-Scale Computing (ATPESC)}}, 20320 howpublished = {\url{http://extremecomputingtraining.anl.gov}}, 20321 year = {2018} 20322} 20323 20324@Article{ barraultmadaynguyenpatera2004, 20325 author = {Maxime Barrault and Yvon Maday and Ngoc Cuong Nguyen and Anthony T. Patera}, 20326 title = {An empirical interpolation method: application to efficient reduced-basis 20327 discretization of partial differential equations}, 20328 journal = {Comptes Rendus Mathematique}, 20329 volume = {339}, 20330 number = {9}, 20331 pages = {667--672}, 20332 year = {2004}, 20333 issn = {1631-073X}, 20334 doi = {10.1016/j.crma.2004.08.006} 20335} 20336 20337@Article{ simongogotsi08, 20338 title = {Materials for electrochemical capacitors}, 20339 author = {Patrice Simon and Yury Gogotsi}, 20340 journal = {Nature Materials}, 20341 volume = {7}, 20342 number = {11}, 20343 pages = {845--854}, 20344 year = {2008}, 20345 doi = {10.1038/nmat2297} 20346} 20347 20348@Article{ vladsinghrollandmelinteajayangohy14, 20349 title = {Hybrid supercapacitor-battery materials for fast electrochemical charge storage}, 20350 author = {A. Vlad and N. Singh and J. Rolland and S. Melinte and P. M. Ajayan and J.-F. 20351 Gohy}, 20352 journal = {Scientific Reports}, 20353 volume = {4}, 20354 year = {2014}, 20355 doi = {10.1038/srep04315} 20356} 20357 20358@Article{ lichengshashurinkeidar12, 20359 title = {Review of Electrochemical Capacitors Based on Carbon Nanotubes and Graphene}, 20360 author = {J. Li and X. Cheng and A. Shashurin and M. Keidar}, 20361 journal = {Graphene}, 20362 volume = {1}, 20363 number = {1}, 20364 pages = {1--13}, 20365 year = {2012}, 20366 doi = {10.4236/graphene.2012.11001} 20367} 20368 20369@Article{ miller07, 20370 title = {A Brief History of Supercapacitors}, 20371 author = {John R. Miller}, 20372 journal = {Battery and Energy Storage Technology}, 20373 pages = {61--78}, 20374 year = {2007} 20375} 20376 20377@Book{ deshpande14, 20378 title = {Ultracapacitors: Future of Energy Storage}, 20379 author = {R. P. Deshpande}, 20380 publisher = {McGraw Hill Education}, 20381 isbn = {978-9339214050}, 20382 pages = {452}, 20383 year = {2014} 20384} 20385 20386@Article{ hojowboggs10, 20387 title = {Historical introduction to capacitor technology}, 20388 author = {J. Ho and T.R. Jow and S. Boggs}, 20389 journal = {IEEE Electrical Insulation Magazine}, 20390 month = jan, 20391 volume = {26}, 20392 number = {1}, 20393 pages = {20--25}, 20394 year = {2010}, 20395 doi = {10.1109/MEI.2010.5383924}, 20396 issn = {0883-7554} 20397} 20398 20399@Article{ gillespie14, 20400 title = {A review of steric interactions of ions: Why some theories succeed and others 20401 fail to acount for ion size}, 20402 author = {Dirk Gillespie}, 20403 journal = {Microfluidics and Nanofluidics}, 20404 volume = {18}, 20405 number = {5-6}, 20406 pages = {717--738}, 20407 year = {2015} 20408} 20409 20410@Article{ gillespievaliskoboda05, 20411 author = {Dirk Gillespie and Monica Valisk\'{o} and Dezs\H{o} Boda}, 20412 title = {Density functional theory of the electrical double layer: the RFD functional}, 20413 journal = {J. Phys.: Condens. Matter}, 20414 volume = {17}, 20415 pages = {6609--6626}, 20416 year = {2005} 20417} 20418 20419@Article{ valiskobodagillespie07, 20420 author = {Monica Valisk\'{o} and Dezs\H{o} Boda and Dirk Gillespie}, 20421 title = {Selective adsorption of ions with different diameter and valence at 20422 highly-charged interfaces}, 20423 journal = {J. Phys. Chem. C}, 20424 volume = {111}, 20425 pages = {15575--15585}, 20426 year = {2007} 20427} 20428 20429@Article{ gillespie08, 20430 author = {Dirk Gillespie}, 20431 title = {Energetics of divalent selectivity in a calcium channel: the ryanodine receptor 20432 case study}, 20433 journal = {Biophys. J.}, 20434 volume = {94}, 20435 pages = {1169--1184}, 20436 year = {2008} 20437} 20438 20439@Article{ liwuwang15, 20440 title = {Osmotic Pressure and Packaging Structure of Caged DNA}, 20441 author = {Zhidong Li and Jianzhong Wu and Zhen-Gang Wang}, 20442 journal = {Biophysical Journal}, 20443 volume = {94}, 20444 number = {3}, 20445 pages = {737--746}, 20446 doi = {10.1529/biophysj.107.112508}, 20447 url = {http://www.cell.com/biophysj/abstract/S0006-3495(08)70675-1}, 20448 year = {2015} 20449} 20450 20451@Article{ gillespie12, 20452 title = {High energy conversion efficiency in nanofluidic channels}, 20453 author = {Dirk Gillespie}, 20454 journal = {Nano Letters}, 20455 volume = {12}, 20456 pages = {1410--1416}, 20457 year = {2012} 20458} 20459 20460@Article{ dieterich79, 20461 title = {Modeling of rock friction: 1. Experimental results and constitutive equations}, 20462 author = {James H. Dieterich}, 20463 journal = {Journal of Geophysical Research: Solid Earth}, 20464 volume = {84}, 20465 number = {B5}, 20466 pages = {2161--2168}, 20467 year = {1979}, 20468 publisher = {Wiley Online Library} 20469} 20470 20471@Article{ bodakovacsgillespiekristof14, 20472 title = {Selective transport through a model calcium channel studied by Local Equilibrium 20473 Monte Carlo simulations coupled to the Nernst--Planck equation}, 20474 author = {Dezs{\H{o}} Boda and R{\'o}bert Kov{\'a}cs and Dirk Gillespie and Tam{\'a}s 20475 Krist{\'o}f}, 20476 journal = {Journal of Molecular Liquids}, 20477 volume = {189}, 20478 pages = {100--112}, 20479 year = {2014}, 20480 publisher = {Elsevier} 20481} 20482 20483@Article{ brandt05, 20484 title = {Multiscale solvers and systematic upscaling in computational physics}, 20485 author = {Brandt, A}, 20486 journal = {Computer Physics Communications}, 20487 volume = {169}, 20488 number = {1}, 20489 pages = {438--441}, 20490 year = {2005}, 20491 publisher = {Elsevier} 20492} 20493 20494@Article{ rosenfeld89, 20495 title = {Free-energy model for the inhomogeneous hard-sphere fluid mixture and 20496 density-functional theory of freezing}, 20497 author = {Yaakov Rosenfeld}, 20498 journal = {Physical review letters}, 20499 volume = {63}, 20500 number = {9}, 20501 pages = {980}, 20502 year = {1989}, 20503 publisher = {APS} 20504} 20505 20506@Article{ schindlermitchellmccabecummingslevan13, 20507 title = {Adsorption of Chain Molecules in Slit-Shaped Pores: Development of a SAFT-FMT-DFT 20508 Approach}, 20509 author = {Bryan J Schindler and Lucas A Mitchell and Clare McCabe and Peter T Cummings and 20510 M Douglas LeVan}, 20511 journal = {The Journal of Physical Chemistry C}, 20512 volume = {117}, 20513 number = {41}, 20514 pages = {21337--21350}, 20515 year = {2013}, 20516 publisher = {ACS Publications} 20517} 20518 20519@Misc{ tramonto, 20520 author = {Laura Frink and et. al.}, 20521 title = {TRAMONTO 3.0 web site}, 20522 url = {https://software.sandia.gov/DFTfluids/tramonto3_0.html}, 20523 year = {2014} 20524} 20525 20526@InCollection{ zhongyuenmoresiknepley15, 20527 author = {Shijie Zhong and David A. Yuen and Louis N. Moresi and Matthew G. Knepley}, 20528 title = {Numerical Methods for Mantle Convection}, 20529 booktitle = {Treatise on Geophysics}, 20530 publisher = {Elsevier}, 20531 volume = {7}, 20532 editor = {Gerald Schubert}, 20533 edition = {Second Edition}, 20534 year = {2015} 20535} 20536 20537@Article{ richarson1911, 20538 author = {Lewis Fry Richardson}, 20539 title = {The approximate arithmetical solution by finite differences of physical problems 20540 including differential equations, with an application to the stresses in a masonry 20541 dam}, 20542 journal = {Philosophical Transactions of the Royal Society A}, 20543 volume = {210}, 20544 number = {459--470}, 20545 pages = {307--357}, 20546 doi = {10.1098/rsta.1911.0009}, 20547 year = {1911} 20548} 20549 20550@Article{ kirkwood34, 20551 author = {John G. Kirkwood}, 20552 title = {Theory of Solutions of Molecules Containing Widely Separated Charges with Special 20553 Application to Zwitterions}, 20554 journal = {The Journal of Chemical Physics}, 20555 volume = {2}, 20556 number = {7}, 20557 year = {1934} 20558} 20559 20560@TechReport{ schoof1994exodus, 20561 title = {{EXODUS II}: a finite element data model}, 20562 author = {Larry A Schoof and Victor R Yarberry}, 20563 institution = {Sandia National Laboratories}, 20564 number = {SAND92-2137}, 20565 address = {Albuquerque, NM}, 20566 year = {1994} 20567} 20568 20569@Misc{ poirier1998cgns, 20570 author = {Diane Poirier and Steven R Allmaras and Douglas R McCarthy and Matthew F Smith 20571 and Fancis Y Enomoto}, 20572 title = {The CGNS system}, 20573 note = {AIAA Paper 98-3007}, 20574 year = {1998} 20575} 20576 20577@Article{ geuzaine2009gmsh, 20578 title = {Gmsh: A 3-D finite element mesh generator with built-in pre-and post-processing 20579 facilities}, 20580 author = {Christophe Geuzaine and Jean-Fran{\c{c}}ois Remacle}, 20581 journal = {International Journal for Numerical Methods in Engineering}, 20582 volume = {79}, 20583 number = {11}, 20584 pages = {1309--1331}, 20585 year = {2009}, 20586 publisher = {Wiley Online Library} 20587} 20588 20589@Article{ si2015, 20590 title = {{TetGen}, a {Delaunay}-Based Quality Tetrahedral Mesh Generator}, 20591 author = {Hang Si}, 20592 journal = {ACM Trans. on Mathematical Software}, 20593 volume = {41}, 20594 number = {2}, 20595 month = feb, 20596 doi = {10.1145/2629697}, 20597 year = {2015} 20598} 20599 20600@TechReport{ blackerbohnhoffedwards1994, 20601 title = {CUBIT mesh generation environment. Volume 1: Users manual}, 20602 author = {Ted D Blacker and William J Bohnhoff and Tony L Edwards}, 20603 institution = {Sandia National Labs., Albuquerque, NM (United States)}, 20604 year = {1994} 20605} 20606 20607@Article{ bjorck1994, 20608 title = {Numerics of Gram-Schmidt orthogonalization}, 20609 author = {{\AA}ke Bj{\"o}rck}, 20610 journal = {Linear Algebra and Its Applications}, 20611 volume = {197}, 20612 pages = {297--316}, 20613 year = {1994}, 20614 publisher = {Elsevier} 20615} 20616 20617@PhDThesis{ yood05, 20618 author = {Charles Nelson Yood}, 20619 title = {Argonne National Laboratory and the Emergence of Computer and Computational 20620 Science, 1946--1992}, 20621 school = {The Pennsylvania State University}, 20622 month = aug, 20623 year = {2005} 20624} 20625 20626@Article{ fearnleysander79, 20627 title = {Hermann Grassmann and the Creation of Linear Algebra}, 20628 author = {Desmond Fearnley-Sander}, 20629 journal = {The American Mathematical Monthly}, 20630 volume = {86}, 20631 pages = {809--817}, 20632 url = {http://www.maa.org/sites/default/files/pdf/upload_library/22/Ford/DesmondFearnleySander.pdf}, 20633 year = {1979} 20634} 20635 20636@InCollection{ knepley2012, 20637 author = {Matthew G. Knepley}, 20638 title = {Programming Languages for Scientific Computing}, 20639 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20640 publisher = {Springer}, 20641 year = {2012}, 20642 editor = {Bj\"orn Engquist}, 20643 doi = {10.1007/978-3-540-70529-1}, 20644 url = {http://arxiv.org/abs/1209.1711} 20645} 20646 20647@InBook{ knepley2015, 20648 title = {Programming Languages for Scientific Computing}, 20649 author = {Matthew G. Knepley}, 20650 booktitle = {Encyclopedia of Applied and Computational Mathematics}, 20651 editor = {Bj{\"o}rn Engquist}, 20652 publisher = {Springer Berlin Heidelberg}, 20653 address = {Berlin, Heidelberg}, 20654 pages = {1173--1181}, 20655 isbn = {978-3-540-70529-1}, 20656 doi = {10.1007/978-3-540-70529-1_250}, 20657 year = {2015} 20658} 20659 20660@Book{ hughes2000, 20661 author = {Thomas J. R. Hughes}, 20662 title = {The Finite Element Method: Linear Static and Dynamic Finite Element Analysis}, 20663 series = {Dover Civil and Mechanical Engineering}, 20664 pages = {704}, 20665 year = {2000}, 20666 isbn = {978-0486411811}, 20667 publisher = {Dover} 20668} 20669 20670@Article{ roache2002, 20671 title = {Code verification by the method of manufactured solutions}, 20672 author = {Patrick J. Roache}, 20673 journal = {Journal of Fluids Engineering}, 20674 volume = {124}, 20675 number = {1}, 20676 pages = {4--10}, 20677 year = {2002}, 20678 publisher = {American Society of Mechanical Engineers} 20679} 20680 20681@InCollection{ rokosgorman13, 20682 title = {PRAgMaTIc - Parallel Anisotropic Adaptive Mesh Toolkit}, 20683 author = {Georgios Rokos and Gerard Gorman}, 20684 booktitle = {Facing the Multicore-Challenge III}, 20685 series = {Lecture Notes in Computer Science}, 20686 editor = {Keller, Rainer and Kramer, David and Weiss, Jan-Philipp}, 20687 publisher = {Springer Berlin Heidelberg}, 20688 volume = {7686}, 20689 pages = {143-144}, 20690 doi = {10.1007/978-3-642-35893-7_22}, 20691 isbn = {978-3-642-35892-0}, 20692 year = {2013} 20693} 20694 20695@Misc{ hdf5:homepage, 20696 author = {{The HDF Group}}, 20697 title = {The {HDF5} Homepage}, 20698 howpublished = {\url{https://www.hdfgroup.org/HDF5/}}, 20699 year = {2015} 20700} 20701 20702@Misc{ paraview:homepage, 20703 author = {Kitware}, 20704 title = {The {ParaView} Homepage}, 20705 howpublished = {\url{http://www.paraview.org/}}, 20706 year = {2015} 20707} 20708 20709@Misc{ xdmf:homepage, 20710 author = {Kitware}, 20711 title = {The Extensible Data Model and Format ({XDMF})}, 20712 howpublished = {\url{http://www.xdmf.org/}}, 20713 year = {2015} 20714} 20715 20716@Article{ cullerkarp1993, 20717 title = {LogP: Towards a realistic model of parallel computation}, 20718 author = {David Culler and Richard Karp and David Patterson and Abhijit Sahay and Klaus 20719 Erik Schauser and Eunice Santos and Ramesh Subramonian and Thorsten Von Eicken}, 20720 journal = {SIGPLAN Notices}, 20721 volume = {28}, 20722 number = {7}, 20723 pages = {1--12}, 20724 year = {1993}, 20725 publisher = {ACM} 20726} 20727 20728@Article{ aggarwalvitter1988, 20729 title = {The input/output complexity of sorting and related problems}, 20730 author = {Alok Aggarwal and Jeffrey Vitter}, 20731 journal = {Communications of the ACM}, 20732 volume = {31}, 20733 number = {9}, 20734 pages = {1116--1127}, 20735 year = {1988}, 20736 publisher = {ACM} 20737} 20738 20739@InProceedings{ czechowskibattaglinomcclanahanchandramowlishwaranvuduc2011, 20740 author = {Kenneth Czechowski and Casey Battaglino and Chris McClanahan and Aparna 20741 Chandramowlishwaran and Richard Vuduc}, 20742 title = {Balance principles for algorithm-architecture co-design}, 20743 booktitle = {Proc.~USENIX Wkshp. Hot Topics in Parallelism (HotPar)}, 20744 month = may, 20745 address = {Berkeley, CA, USA}, 20746 url = {http://www.usenix.org/events/hotpar11/tech/final_files/Czechowski.pdf}, 20747 year = {2011} 20748} 20749 20750@Article{ williamswatermanpatterson2009, 20751 title = {Roofline: an insightful visual performance model for multicore architectures}, 20752 author = {Samuel Williams and Andrew Waterman and David Patterson}, 20753 journal = {Communications of the ACM}, 20754 volume = {52}, 20755 number = {4}, 20756 pages = {65--76}, 20757 year = {2009}, 20758 publisher = {ACM} 20759} 20760 20761@Misc{ roofline-web-page, 20762 author = {Samuel Williams and {et. al.}}, 20763 title = {{R}oofline {P}erformance {M}odel}, 20764 key = {Roofline}, 20765 url = {http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}, 20766 howpublished = {\url{http://crd.lbl.gov/departments/computer-science/performance-and-algorithms-research/research/roofline/}} 20767} 20768 20769@Misc{ roofline-talk2008, 20770 author = {Samuel Williams and David Patterson}, 20771 title = {{R}oofline {P}erformance {M}odel}, 20772 key = {Roofline}, 20773 year = {2008}, 20774 note = {ParLab Summer Retreat}, 20775 url = {http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}, 20776 howpublished = {\url{http://crd.lbl.gov/assets/pubs_presos/parlab08-roofline-talk.pdf}} 20777} 20778 20779@Article{ lee2006, 20780 title = {The problem with threads}, 20781 author = {Edward A Lee}, 20782 journal = {Computer}, 20783 volume = {39}, 20784 number = {5}, 20785 pages = {33--42}, 20786 year = {2006}, 20787 url = {http://ptolemy.eecs.berkeley.edu/publications/papers/06/problemwithThreads/}, 20788 publisher = {IEEE Computer Society Press} 20789} 20790 20791@Article{ hoefler2012, 20792 title = {{Optimization principles for collective neighborhood communications}}, 20793 author = {Torsten Hoefler and Timo Schneider}, 20794 journal = {International Conference for High Performance Computing, Networking, Storage and 20795 Analysis, SC}, 20796 doi = {10.1109/SC.2012.86}, 20797 isbn = {9781467308069}, 20798 issn = {21674329}, 20799 year = {2012} 20800} 20801 20802@Book{ grahamknuthpatashnik1989, 20803 title = {Concrete Mathematics}, 20804 author = {Ronald L Graham and Donald E Knuth and Oren Patashnik}, 20805 publisher = {Addison-Wesley}, 20806 year = {1989} 20807} 20808 20809@Book{ jackson1962, 20810 title = {Classical Electrodynamics}, 20811 author = {John David Jackson}, 20812 publisher = {John Wiley \& Sons}, 20813 year = {1962} 20814} 20815 20816@Article{ leveque2013, 20817 title = {Top Ten Reasons to Not Share Your Code (and why you should anyway)}, 20818 author = {Randall J. LeVeque}, 20819 journal = {SIAM News}, 20820 volume = {46}, 20821 number = {3}, 20822 month = apr, 20823 url = {http://faculty.washington.edu/rjl/pubs/topten/}, 20824 year = {2013} 20825} 20826 20827@InProceedings{ wang2014, 20828 title = {Fjos: Practical, predictable, and efficient system support for fork/join 20829 parallelism}, 20830 author = {Qi Wang and Gabriel Parmer}, 20831 booktitle = {Real-Time and Embedded Technology and Applications Symposium (RTAS), 2014 IEEE 20832 20th}, 20833 pages = {25--36}, 20834 year = {2014}, 20835 organization = {IEEE} 20836} 20837 20838@Article{ fangsaad2009, 20839 author = {Haw-ren Fang and Yousef Saad}, 20840 title = {Two classes of multisecant methods for nonlinear acceleration}, 20841 journal = {Numerical Linear Algebra with Applications}, 20842 volume = {16}, 20843 number = {3}, 20844 pages = {197--221}, 20845 year = {2009}, 20846 doi = {10.1002/nla.617} 20847} 20848 20849@Misc{ hpcchallenge, 20850 title = {HPC Challenge}, 20851 author = {Jack Dongarra and Piotr Luszczek and others}, 20852 url = {http://icl.cs.utk.edu/hpcc/hpcc_results_lat_band.cgi?display=opt}, 20853 year = {2015} 20854} 20855 20856@InProceedings{ hoeflerschneiderlumsdaine2008, 20857 title = {Accurately measuring collective operations at massive scale}, 20858 author = {Torsten Hoefler and Timo Schneider and Andrew Lumsdaine}, 20859 booktitle = {Proceedings of the 22nd IEEE International Symposium on Parallel and Distributed 20860 Processing (IPDPS)}, 20861 pages = {1--8}, 20862 year = {2008}, 20863 doi = {10.1109/IPDPS.2008.4536494}, 20864 organization = {IEEE} 20865} 20866 20867@Book{ potraptak1984, 20868 title = {Nondiscrete Induction and Iterative Processes}, 20869 author = {Florian A. Potra and Vlastimil Pt{\'a}k}, 20870 series = {Research Notes in Mathematics}, 20871 year = {1984}, 20872 publisher = {Pitman} 20873} 20874 20875@Book{ pilz1977, 20876 title = {Near-rings: the theory and its applications}, 20877 author = {G{\"u}nter Pilz}, 20878 year = {1977}, 20879 publisher = {New York} 20880} 20881 20882@Article{ birkenjameson2009, 20883 title = {{On nonlinear preconditioners in {N}ewton-{K}rylov methods for unsteady flows}}, 20884 author = {Philipp Birken and Antony Jameson}, 20885 journal = {International Journal for Numerical Methods in Fluids}, 20886 volume = {62}, 20887 number = {5}, 20888 pages = {565--573}, 20889 publisher = {John Wiley \& Sons, Ltd.}, 20890 doi = {10.1002/fld.2030}, 20891 issn = {1097-0363}, 20892 year = {2010} 20893} 20894 20895@Article{ anderson1965, 20896 title = {Iterative procedures for nonlinear integral equations}, 20897 author = {Donald G Anderson}, 20898 journal = {Journal of the ACM (JACM)}, 20899 volume = {12}, 20900 number = {4}, 20901 pages = {547--560}, 20902 year = {1965}, 20903 publisher = {ACM} 20904} 20905 20906@Article{ ptak1966, 20907 title = {Some metric aspects of the open mapping and closed graph theorems}, 20908 author = {Vlastimil Pt{\'a}k}, 20909 journal = {Mathematische Annalen}, 20910 volume = {163}, 20911 number = {2}, 20912 pages = {95--104}, 20913 year = {1966}, 20914 publisher = {Springer} 20915} 20916 20917@Article{ ptak1974, 20918 title = {A quantitative refinement of the closed graph theorem}, 20919 author = {Vlastimil Pt{\'a}k}, 20920 journal = {Czechoslovak Mathematical Journal}, 20921 volume = {24}, 20922 number = {3}, 20923 pages = {503--506}, 20924 year = {1974}, 20925 publisher = {Institute of Mathematics, Academy of Sciences of the Czech Republic} 20926} 20927 20928@Article{ ptak1975, 20929 title = {The rate of convergence of {Newton's} process}, 20930 author = {Vlastimil Pt{\'a}k}, 20931 journal = {Numerische Mathematik}, 20932 volume = {25}, 20933 number = {3}, 20934 pages = {279--285}, 20935 year = {1975}, 20936 publisher = {Springer} 20937} 20938 20939@Article{ ptak1976, 20940 title = {Nondiscrete mathematical induction and iterative existence proofs}, 20941 author = {Vlastimil Pt{\'a}k}, 20942 journal = {Linear algebra and its applications}, 20943 volume = {13}, 20944 number = {3}, 20945 pages = {223--238}, 20946 year = {1976}, 20947 publisher = {Elsevier} 20948} 20949 20950@Article{ ptak1977, 20951 title = {What should be a rate of convergence?}, 20952 author = {Vlastimil Pt{\'a}k}, 20953 journal = {RAIRO-Analyse num{\'e}rique}, 20954 volume = {11}, 20955 number = {3}, 20956 pages = {279--286}, 20957 year = {1977} 20958} 20959 20960@Article{ potraptak1980, 20961 title = {Sharp error bounds for {Newton's} process}, 20962 author = {Florian A Potra and Vlastimil Pt{\'a}k}, 20963 journal = {Numerische Mathematik}, 20964 volume = {34}, 20965 number = {1}, 20966 pages = {63--72}, 20967 year = {1980}, 20968 publisher = {Springer} 20969} 20970 20971@Article{ liesen2014, 20972 title = {Pt\'ak's nondiscrete induction and its application to matrix iterations}, 20973 author = {J{\"o}rg Liesen}, 20974 journal = {IMA Journal of Numerical Analysis}, 20975 doi = {10.1093/imanum/drv037}, 20976 archiveprefix = {arXiv}, 20977 eprint = {1405.2683}, 20978 primaryclass = {math-na}, 20979 year = {2015} 20980} 20981 20982@Book{ traub1964, 20983 title = {Iterative Methods for the Solution of Equations}, 20984 author = {Joseph F Traub}, 20985 year = {1964}, 20986 publisher = {Prentice-Hall, Englewood Cliffs, NJ} 20987} 20988 20989@InProceedings{ shalfvecpar2010, 20990 title = {Exascale Computing Technology Challenges}, 20991 author = {John Shalf and Sudip Dosanjh and John Morrison}, 20992 booktitle = {J.M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449}, 20993 pages = {1–-25}, 20994 year = {2010} 20995} 20996 20997@Article{ frechet1907, 20998 title = {Sur les ensembles de fonctions et les op\'erations lin\'eaires}, 20999 author = {Maurice Ren\'e Fr\'echet}, 21000 journal = {C. R. Acad. Sci. Paris}, 21001 volume = {144}, 21002 pages = {1414--1416}, 21003 year = {1907} 21004} 21005 21006@Article{ riesz1907, 21007 title = {Sur une esp\'ece de g\'eom\'etrie analytique des syst\'emes de fonctions sommables}, 21008 author = {Frigyes Riesz}, 21009 journal = {C. R. Acad. Sci. Paris}, 21010 volume = {144}, 21011 pages = {1409--1411}, 21012 year = {1907} 21013} 21014 21015@Article{ riesz1909, 21016 title = {Sur les op\'erations fonctionnelles lin\'eaires}, 21017 author = {Frigyes Riesz}, 21018 journal = {C. R. Acad. Sci. Paris}, 21019 volume = {149}, 21020 pages = {974--977}, 21021 year = {1909} 21022} 21023 21024@Misc{ rieszmarkovkakutanirepresentationtheorem, 21025 author = {Wikipedia}, 21026 title = {Riesz-Markov-Kakutani Representation Theorem}, 21027 url = {http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}, 21028 note = {\url{http://en.wikipedia.org/wiki/Riesz-Markov-Kakutani_representation_theorem}}, 21029 year = {2015} 21030} 21031 21032@Article{ markov1938, 21033 title = {On mean values and exterior densities}, 21034 author = {Andrey Markov}, 21035 journal = {Rec. Math. Moscou}, 21036 volume = {4}, 21037 pages = {165--190}, 21038 year = {1938} 21039} 21040 21041@Article{ kakutani1941, 21042 title = {Concrete representation of abstract {(M)}-spaces. (A characterization of the 21043 space of continuous functions.)}, 21044 author = {Shizuo Kakutani}, 21045 journal = {Ann. of Math.}, 21046 volume = {2}, 21047 number = {42}, 21048 pages = {994--1024}, 21049 doi = {10.2307/1968778}, 21050 year = {1941} 21051} 21052 21053@Article{ michoskimeyersonisaacwaelbroeck2014, 21054 title = {Discontinuous Galerkin methods for plasma physics in the scrape-off layer of 21055 tokamaks}, 21056 author = {Craig Michoski and D. Meyerson and Tobin Isaac and F. Waelbroeck}, 21057 journal = {Journal of Computational Physics}, 21058 volume = {274}, 21059 pages = {898--919}, 21060 year = {2014}, 21061 publisher = {Elsevier} 21062} 21063 21064@InProceedings{ bursteddeghattasgurnisisaacstadlerwarburtonwilcox2010, 21065 title = {Extreme-scale AMR}, 21066 author = {Carsten Burstedde and Omar Ghattas and Michael Gurnis and Tobin Isaac and Georg 21067 Stadler and Tim Warburton and Lucas Wilcox}, 21068 booktitle = {Proceedings of the 2010 ACM/IEEE International Conference for High Performance 21069 Computing, Networking, Storage and Analysis}, 21070 pages = {1--12}, 21071 year = {2010}, 21072 organization = {IEEE Computer Society}, 21073 doi = {10.1109/SC.2010.25} 21074} 21075 21076@InProceedings{ isaacbursteddeghattas2012, 21077 title = {Low-cost parallel algorithms for 2: 1 octree balance}, 21078 author = {Tobin Isaac and Carsten Burstedde and Omar Ghattas}, 21079 booktitle = {Parallel \& Distributed Processing Symposium (IPDPS), 2012 IEEE 26th 21080 International}, 21081 pages = {426--437}, 21082 year = {2012}, 21083 organization = {IEEE}, 21084 doi = {10.1109/IPDPS.2012.47} 21085} 21086 21087@Article{ isaacpetrastadlerghattas2015, 21088 title = {Scalable and efficient algorithms for the propagation of uncertainty from data 21089 through inference to prediction for large-scale problems, with application to flow 21090 of the {Antarctic} ice sheet}, 21091 author = {Tobin Isaac and Noemi Petra and Georg Stadler and Omar Ghattas}, 21092 journal = {Journal of Computational Physics}, 21093 volume = {296}, 21094 pages = {348--368}, 21095 year = {2015}, 21096 publisher = {Elsevier}, 21097 doi = {10.1016/j.jcp.2015.04.047} 21098} 21099 21100@Article{ isaacbursteddewilcoxghattas2015, 21101 title = {Recursive Algorithms for Distributed Forests of Octrees}, 21102 author = {Tobin Isaac and Carsten Burstedde and Lucas C Wilcox and Omar Ghattas}, 21103 journal = {SIAM Journal on Scientific Computing}, 21104 volume = {37}, 21105 number = {5}, 21106 pages = {C497-C531}, 21107 eprint = {1406.0089}, 21108 eprinttype = {arXiv}, 21109 year = {2015}, 21110 doi = {10.1137/140970963} 21111} 21112 21113@Article{ isaacstadlerghattas2015, 21114 title = {Solution of nonlinear {S}tokes equations discretized by high-order finite 21115 elements on nonconforming and anisotropic meshes, with application to ice sheet 21116 dynamics}, 21117 author = {Isaac, Tobin and Stadler, Georg and Ghattas, Omar}, 21118 journal = {SIAM Journal on Scientific Computing}, 21119 number = {6}, 21120 pages = {804--833}, 21121 volume = {37}, 21122 year = {2015}, 21123 doi = {10.1137/140974407} 21124} 21125 21126@InProceedings{ rudimalossiisaacstadlergurnisstaarineichenbekascurionighattas2015, 21127 title = {An extreme-scale implicit solver for complex {PDEs}: highly heterogeneous flow in 21128 earth's mantle}, 21129 author = {Johann Rudi and A Cristiano I Malossi and Tobin Isaac and Georg Stadler and 21130 Michael Gurnis and Peter WJ Staar and Yves Ineichen and Costas Bekas and 21131 Alessandro Curioni and Omar Ghattas}, 21132 booktitle = {Proceedings of the International Conference for High Performance Computing, 21133 Networking, Storage and Analysis}, 21134 pages = {5}, 21135 year = {2015}, 21136 organization = {ACM}, 21137 doi = {10.1145/2807591.2807675} 21138} 21139 21140@Article{ bunchhopcroft1974, 21141 title = {Triangular factorization and inversion by fast matrix multiplication}, 21142 author = {James R Bunch and John E Hopcroft}, 21143 journal = {Mathematics of Computation}, 21144 volume = {28}, 21145 number = {125}, 21146 pages = {231--236}, 21147 doi = {10.2307/2005828}, 21148 year = {1974} 21149} 21150 21151@Article{ nemirovsky1991, 21152 title = {On optimality of Krylov's information when solving linear operator equations}, 21153 author = {A.S Nemirovsky}, 21154 journal = {Journal of Complexity}, 21155 volume = {7}, 21156 number = {2}, 21157 pages = {121--130}, 21158 doi = {10.1016/0885-064X(91)90001-E}, 21159 year = {1991} 21160} 21161 21162@Misc{siamcseprize, 21163 author = {{PETSc Team}}, 21164 title = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21165 key = {{SIAM/ACM} {P}rize in {C}omputational {S}cience and {E}ngineering}, 21166 url = {https://www.siam.org/prizes/sponsored/cse.php}, 21167 year = {2015} 21168} 21169 21170@Article{ rathgeber2017, 21171 title = {Firedrake: automating the finite element method by composing abstractions}, 21172 author = {Rathgeber, Florian and Ham, David A and Mitchell, Lawrence and Lange, Michael and 21173 Luporini, Fabio and McRae, Andrew TT and Bercea, Gheorghe-Teodor and Markall, 21174 Graham R and Kelly, Paul HJ}, 21175 archiveprefix = {arXiv}, 21176 journal = {ACM Transaction on Mathematical Software}, 21177 eprint = {1501.01809}, 21178 volume = {43}, 21179 issue = {3}, 21180 number = {24}, 21181 year = {2017}, 21182 url = {http://arxiv.org/abs/1501.01809} 21183} 21184 21185@Article{ kirby2006b, 21186 title = {Topological optimization of the evaluation of finite element matrices}, 21187 author = {Robert C Kirby and Anders Logg and L Ridgway Scott and Andy R. Terrel}, 21188 journal = {SIAM Journal on Scientific Computing}, 21189 volume = {28}, 21190 number = {1}, 21191 pages = {224--240}, 21192 year = {2006}, 21193 publisher = {SIAM} 21194} 21195 21196@Article{ luporini2015, 21197 author = {Luporini, Fabio and Varbanescu, Ana Lucia and Rathgeber, Florian and Bercea, 21198 Gheorghe-Teodor and Ramanujam, J. and Ham, David A. and Kelly, Paul H. J.}, 21199 title = {Cross-Loop Optimization of Arithmetic Intensity for Finite Element Local 21200 Assembly}, 21201 journal = {ACM Trans. Archit. Code Optim.}, 21202 issue_date = {January 2015}, 21203 volume = {11}, 21204 number = {4}, 21205 month = jan, 21206 year = {2015}, 21207 issn = {1544-3566}, 21208 pages = {57:1--57:25}, 21209 articleno = {57}, 21210 numpages = {25}, 21211 doi = {10.1145/2687415}, 21212 acmid = {2687415}, 21213 publisher = {ACM}, 21214 address = {New York, NY, USA}, 21215 keywords = {Finite element integration, SIMD vectorization, compilers, local assembly, 21216 optimizations} 21217} 21218 21219@Article{ markall2012, 21220 title = {Finite element assembly strategies on multi- and many-core architectures}, 21221 author = {Markall, G. R. and Slemmer, A. and Ham, D. A. and Kelly, P. H. J. and Cantwell, 21222 C. D. and Sherwin, S. J.}, 21223 journal = {International Journal for Numerical Methods in Fluids}, 21224 year = {2013}, 21225 volume = {71}, 21226 pages = {80--97}, 21227 doi = {10.1002/fld.3648} 21228} 21229 21230@Article{ markall2010, 21231 title = {Towards generating optimised finite element solvers for GPUs from high-level 21232 specifications}, 21233 author = {Graham R. Markall and David A. Ham and Paul H. J. Kelly}, 21234 journal = {Procedia Computer Science}, 21235 volume = {1}, 21236 number = {1}, 21237 pages = {1815--1823}, 21238 year = {2010}, 21239 note = {{ICCS} 2010}, 21240 doi = {10.1016/j.procs.2010.04.203} 21241} 21242 21243@Article{ longkirbywaanders2010, 21244 title = {Unified embedded parallel finite element computations via software-based 21245 Fr{\'e}chet differentiation}, 21246 author = {Kevin Long and Robert Kirby and Bart van Bloemen Waanders}, 21247 journal = {SIAM Journal on Scientific Computing}, 21248 volume = {32}, 21249 number = {6}, 21250 pages = {3323--3351}, 21251 year = {2010}, 21252 publisher = {SIAM} 21253} 21254 21255@Article{ kirby2010, 21256 title = {From functional analysis to iterative methods}, 21257 author = {Robert C Kirby}, 21258 journal = {SIAM review}, 21259 volume = {52}, 21260 number = {2}, 21261 pages = {269--293}, 21262 year = {2010}, 21263 publisher = {SIAM} 21264} 21265 21266@Article{ kirby2014, 21267 title = {Low-Complexity Finite Element Algorithms for the de Rham Complex on Simplices}, 21268 author = {Robert C Kirby}, 21269 journal = {SIAM Journal on Scientific Computing}, 21270 volume = {36}, 21271 number = {2}, 21272 pages = {A846--A868}, 21273 year = {2014}, 21274 publisher = {SIAM} 21275} 21276 21277@Article{ kirby2011, 21278 title = {Fast simplicial finite element algorithms using Bernstein polynomials}, 21279 author = {Robert C Kirby}, 21280 journal = {Numerische Mathematik}, 21281 volume = {117}, 21282 number = {4}, 21283 pages = {631--652}, 21284 year = {2011}, 21285 publisher = {Springer} 21286} 21287 21288@Article{ arnoldfalkwinther2006, 21289 title = {Finite element exterior calculus, homological techniques, and applications}, 21290 author = {Arnold, Douglas N and Falk, Richard S and Winther, Ragnar}, 21291 journal = {Acta numerica}, 21292 volume = {15}, 21293 pages = {1--155}, 21294 year = {2006}, 21295 publisher = {Cambridge Univ Press} 21296} 21297 21298@Article{ arnoldlogg2014, 21299 title = {Periodic table of the finite elements}, 21300 author = {Douglas Arnold and Anders Logg}, 21301 month = nov, 21302 journal = {SIAM News}, 21303 year = {2014} 21304} 21305 21306@Article{ janssonhoffmanjansson2012, 21307 title = {Framework for massively parallel adaptive finite element computational fluid 21308 dynamics on tetrahedral meshes}, 21309 author = {Jansson, Niclas and Hoffman, Johan and Jansson, Johan}, 21310 journal = {SIAM Journal on Scientific Computing}, 21311 volume = {34}, 21312 number = {1}, 21313 pages = {C24--C41}, 21314 year = {2012}, 21315 publisher = {SIAM} 21316} 21317 21318@Article{ rogneshamcottermcrae2013, 21319 title = {Automating the solution of PDEs on the sphere and other manifolds in FEniCS 1.2}, 21320 author = {Rognes, Marie E and Ham, David A and Cotter, Colin J and McRae, Andrew TT}, 21321 journal = {Geoscientific Model Development}, 21322 volume = {6}, 21323 number = {6}, 21324 pages = {2099--2119}, 21325 year = {2013}, 21326 publisher = {Copernicus GmbH} 21327} 21328 21329@Book{ loggmardalwells2012, 21330 title = {Automated solution of differential equations by the finite element method: The 21331 {FEniCS} book}, 21332 author = {Logg, Anders and Mardal, Kent-Andre and Wells, Garth}, 21333 volume = {84}, 21334 year = {2012}, 21335 publisher = {Springer Science \& Business Media} 21336} 21337 21338@Article{ cotterkirby2014, 21339 title = {Mixed finite elements for global tide models}, 21340 author = {Colin J Cotter and Robert C Kirby}, 21341 archiveprefix = {arXiv}, 21342 journal = {Submitted}, 21343 eprint = {1410.0045}, 21344 year = {2014}, 21345 url = {http://arxiv.org/abs/1410.0045} 21346} 21347 21348@Article{ kirbykieu2015, 21349 title = {Symplectic-mixed finite element approximation of linear acoustic wave equations}, 21350 author = {Robert C Kirby and Thinh Tri Kieu}, 21351 journal = {Numerische Mathematik}, 21352 volume = {130}, 21353 number = {2}, 21354 pages = {257--291}, 21355 year = {2015}, 21356 publisher = {Springer} 21357} 21358 21359@Article{ brennankirby2015, 21360 title = {Finite element approximation and preconditioners for a coupled thermo-acoustic 21361 model}, 21362 author = {Brian Brennan and Robert C Kirby}, 21363 journal = {Submitted to Computers and Mathematics with Applications}, 21364 year = {2015} 21365} 21366 21367@Article{ howlekirbydillon2013, 21368 title = {Block preconditioners for coupled physics problems}, 21369 author = {Victoria E Howle and Robert C Kirby and Geoffrey Dillon}, 21370 journal = {SIAM Journal on Scientific Computing}, 21371 volume = {35}, 21372 number = {5}, 21373 pages = {S368--S385}, 21374 year = {2013}, 21375 publisher = {SIAM} 21376} 21377 21378@Book{ malekstrakos2014, 21379 title = {Preconditioning and the conjugate gradient method in the context of solving 21380 PDEs}, 21381 author = {Josef M{\'a}lek and Zden\u{e}k Strako\u{s}}, 21382 volume = {1}, 21383 year = {2014}, 21384 publisher = {SIAM} 21385} 21386 21387@Article{ desturler1995, 21388 title = {Reducing the effect of global communication in GMRES(m) and \{CG\} on parallel 21389 distributed memory computers}, 21390 author = {E. de Sturler and H.A. van der Vorst}, 21391 journal = {Applied Numerical Mathematics}, 21392 volume = {18}, 21393 number = {4}, 21394 pages = {441--459}, 21395 year = {1995}, 21396 doi = {10.1016/0168-9274(95)00079-A} 21397} 21398 21399@Article{ velicmaymoresi2009, 21400 title = {A fast robust algorithm for computing discrete voronoi diagrams}, 21401 author = {Velic, Mirko and May, Dave and Moresi, Louis}, 21402 journal = {Journal of Mathematical Modelling and Algorithms}, 21403 volume = {8}, 21404 number = {3}, 21405 pages = {343--355}, 21406 year = {2009}, 21407 publisher = {Springer} 21408} 21409 21410@Article{ may2012, 21411 title = {Volume reconstruction of point cloud data sets derived from computational 21412 geodynamic simulations}, 21413 author = {May, DA}, 21414 journal = {Geochemistry, Geophysics, Geosystems}, 21415 volume = {13}, 21416 number = {5}, 21417 year = {2012}, 21418 publisher = {Wiley Online Library} 21419} 21420 21421@Article{ quenettehodkinson2010, 21422 title = {StgDomain--scalable parallel domain software components for particle-in-cell 21423 finite element methods}, 21424 author = {Quenette, Steve and Hodkinson, Luke}, 21425 journal = {Concurrency and Computation: Practice and Experience}, 21426 volume = {22}, 21427 number = {12}, 21428 pages = {1593--1603}, 21429 year = {2010}, 21430 publisher = {Wiley Online Library} 21431} 21432 21433@Book{ velic2005, 21434 title = {Gauge Invariant Integration and Perturbation of Petrov Type D Spacetimes}, 21435 author = {Velic, Mirko}, 21436 year = {2005}, 21437 publisher = {Monash University} 21438} 21439 21440@Article{ velicknepleymay2016, 21441 title = {Numerically Stable Exact Solutions for Variable-Viscosity Stokes Equations}, 21442 author = {Mirko Velic and Louis Moresi and Dave May and Matthew Knepley}, 21443 note = {in preparation}, 21444 year = {2016} 21445} 21446 21447@Article{ traubwozniakowski1979, 21448 title = {Convergence and complexity of Newton iteration for operator equations}, 21449 author = {Joseph Frederick Traub and H. Wo{\'z}niakowski}, 21450 journal = {Journal of the ACM (JACM)}, 21451 volume = {26}, 21452 number = {2}, 21453 pages = {250--258}, 21454 year = {1979}, 21455 publisher = {ACM} 21456} 21457 21458@Article{ sterck2013, 21459 title = {Steepest descent preconditioning for nonlinear {GMRES} optimization}, 21460 author = {Hans De Sterck}, 21461 journal = {Numerical Linear Algebra with Applications}, 21462 volume = {20}, 21463 number = {3}, 21464 pages = {453--471}, 21465 year = {2013} 21466} 21467 21468@Article{ sterckwinlaw2015, 21469 title = {A nonlinearly preconditioned conjugate gradient algorithm for {rank-R} canonical 21470 tensor approximation}, 21471 author = {Hans De Sterck and Manda Winlaw}, 21472 journal = {Numerical Linear Algebra with Applications}, 21473 volume = {22}, 21474 number = {3}, 21475 pages = {410--432}, 21476 year = {2015} 21477} 21478 21479@Article{ sterckhowse2015, 21480 title = {Nonlinearly preconditioned optimization on {Grassman} manifolds for computing 21481 approximate {Tucker} tensor decompositions}, 21482 author = {Hans De Sterck and Alexander Howse}, 21483 journal = {SIAM Journal on Scientific Computing}, 21484 note = {submitted}, 21485 year = {2015} 21486} 21487 21488@Book{ ladevezesimmonds1999, 21489 title = {Nonlinear computational structural mechanics: {N}ew approaches and 21490 non-incremental methods of calculation}, 21491 author = {P. Ladev{\`e}ze and J.G. Simmonds}, 21492 series = {{M}echanical {E}ngineering {S}eries}, 21493 url = {http://books.google.com/books?id=McZRAAAAMAAJ}, 21494 isbn = {9780387985947}, 21495 lccn = {98029990}, 21496 year = {1999}, 21497 publisher = {Springer} 21498} 21499 21500@InProceedings{ walkerwoodwardyang2010, 21501 title = {An accelerated fixed-point iteration for solution of variably saturated flow}, 21502 author = {Homer F Walker and Carol S Woodward and Ulrike M Yang}, 21503 booktitle = {Proc. XVIII International Conference on Water Resources, Barcelona}, 21504 year = {2010} 21505} 21506 21507@Article{ lottwalkerwoodwardyang2012, 21508 title = {An accelerated {P}icard method for nonlinear systems related to variably 21509 saturated flow}, 21510 author = {P. A. Lott and H. F. Walker and C. S. Woodward and U. M. Yang}, 21511 journal = {Advances in Water Resources}, 21512 volume = {38}, 21513 number = {0}, 21514 pages = {92--101}, 21515 doi = {10.1016/j.advwatres.2011.12.013}, 21516 year = {2012} 21517} 21518 21519@TechReport{ mohrrude1998, 21520 title = {Communication Reduced Parallel Multigrid: Analysis and Experiments}, 21521 author = {Marcus Mohr and Ulrich R\"ude}, 21522 type = {Technical Report}, 21523 number = {394}, 21524 institution = {University of Augsburg}, 21525 year = {1998} 21526} 21527 21528@InProceedings{ mohr2000, 21529 title = {Low Communication Parallel Multigrid}, 21530 author = {Mohr, Marcus}, 21531 booktitle = {Euro-Par 2000 Parallel Processing}, 21532 pages = {806--814}, 21533 year = {2000}, 21534 organization = {Springer} 21535} 21536 21537@Article{ brandtdiskin1994, 21538 title = {Multigrid solvers on decomposed domains}, 21539 author = {Achi Brandt and Boris Diskin}, 21540 journal = {Contemporary Mathematics}, 21541 volume = {157}, 21542 year = {1994}, 21543 publisher = {AMERICAN MATHEMATICAL SOCIETY} 21544} 21545 21546@InProceedings{ prabhuetal2011, 21547 title = {A Survey of the Practice of Computational Science}, 21548 author = {Prabhu, Prakash and Jablin, Thomas B. and Raman, Arun and Zhang, Yun and Huang, 21549 Jialu and Kim, Hanjun and Johnson, Nick P. and Liu, Feng and Ghosh, Soumyadeep and 21550 Beard, Stephen and Oh, Taewook and Zoufaly, Matthew and Walker, David and August, 21551 David I.}, 21552 booktitle = {State of the Practice Reports}, 21553 series = {SC '11}, 21554 year = {2011}, 21555 isbn = {978-1-4503-1139-7}, 21556 location = {Seattle, Washington}, 21557 pages = {19:1--19:12}, 21558 articleno = {19}, 21559 numpages = {12}, 21560 doi = {10.1145/2063348.2063374}, 21561 acmid = {2063374}, 21562 publisher = {ACM}, 21563 address = {New York, NY, USA} 21564} 21565 21566@PhDThesis{ dinarthesis1979, 21567 title = {Fast methods for the numerical solution of boundary value problems}, 21568 author = {N. Dinar}, 21569 school = {Weizmann Institute of Science}, 21570 year = {1979} 21571} 21572 21573@Article{ thomasdiskinbrandt2001, 21574 title = {Textbook multigrid efficiency for the incompressible Navier--Stokes equations: 21575 high Reynolds number wakes and boundary layers}, 21576 author = {James L Thomas and Boris Diskin and Achi Brandt}, 21577 journal = {Computers \& fluids}, 21578 volume = {30}, 21579 number = {7}, 21580 pages = {853--874}, 21581 year = {2001}, 21582 publisher = {Elsevier} 21583} 21584 21585@Article{ greenbaumptakstrakos1996, 21586 title = {Any nonincreasing convergence curve is possible for {GMRES}}, 21587 author = {Anne Greenbaum and Vlastimil Pt{\'a}k and Zden{\v{e}}k Strako{\v{s}}}, 21588 journal = {SIAM Journal on Matrix Analysis and Applications}, 21589 volume = {17}, 21590 number = {3}, 21591 pages = {465--469}, 21592 year = {1996}, 21593 publisher = {SIAM} 21594} 21595 21596@Article{ nangiapatankarbhalla2019, 21597 title = {A {DLM} immersed boundary method based wave-structure interaction solver for high 21598 density ratio multiphase flows}, 21599 author = {Nishant Nangia and Neelesh A Patankar and Amneet Pal Singh Bhalla}, 21600 journal = {Journal of Computational Physics}, 21601 volume = {398}, 21602 pages = {108804}, 21603 year = {2019} 21604} 21605 21606@Article{ bhallanangiadafnakisbraccomattiazzo2019, 21607 title = {Simulating water-entry/exit problems using {Eulerian}-{Lagrangian} and 21608 fully-{Eulerian} fictitious domain methods within the open-source {IBAMR} 21609 library}, 21610 author = {Amneet Pal Singh Bhalla and Nishant Nangia and Panagiotis Dafnakis and Giovanni 21611 Bracco and Giuliana Mattiazzo}, 21612 journal = {Applied Ocean Research}, 21613 note = {In press}, 21614 year = {2019} 21615} 21616 21617@Article{ bhallagriffithpatankardonev2013, 21618 title = {A minimally-resolved immersed boundary model for reaction-diffusion problems}, 21619 author = {Amneet Pal Singh Bhalla and Boyce E. Griffith and Neelesh A. Patankar and 21620 Alexander Donev}, 21621 journal = {Journal of Chemical Physics}, 21622 volume = {139}, 21623 number = {21}, 21624 pages = {214112}, 21625 year = {2013} 21626} 21627 21628@Article{ bhallabalegriffithpatankar2014, 21629 title = {Fully resolved immersed electrohydrodynamics for particle motion, 21630 electrolocation, and self-propulsion}, 21631 author = {Amneet Pal Singh Bhalla and R. Bale and Boyce E. Griffith and Neelesh A. 21632 Patankar}, 21633 journal = {Journal of Computational Physics}, 21634 volume = {256}, 21635 pages = {88--108}, 21636 year = {2014} 21637} 21638 21639@Article{ usabiagakallemovdelmottebhallagriffithdonev2016, 21640 title = {Hydrodynamics of suspensions of passive and active rigid particles: a rigid 21641 multiblob approach}, 21642 author = {F. Balboa Usabiaga and B. Kallemov and B. Delmotte and Amneet Pal Singh Bhalla 21643 and Boyce E. Griffith and Alexander Donev}, 21644 journal = {Communications in Applied Mathematics and Computational Science}, 21645 volume = {11}, 21646 number = {2}, 21647 pages = {217--296}, 21648 year = {2016} 21649} 21650 21651@Article{ koubhallagriffithpandolfinokahrilaspatankar2015, 21652 title = {A fully resolved active musculo-mechanical model for esophageal transport}, 21653 author = {W. Kou and Amneet Pal Singh Bhalla and Boyce E. Griffith and J.E. Pandolfino and 21654 P.J. Kahrilas and Neelesh A. Patankar}, 21655 journal = {Journal of Computational Physics}, 21656 volume = {298}, 21657 pages = {446--465}, 21658 year = {2015} 21659} 21660 21661@Article{ balenevelnbhallamaciverpatankar2015, 21662 title = {Convergent evolution of mechanically optimal locomotion in aquatic invertebrates 21663 and vertebrates}, 21664 author = {R. Bale and I. D. Neveln and Amneet Pal Singh Bhalla and M.A. MacIver and Neelesh 21665 A. Patankar}, 21666 journal = {PLoS Biology}, 21667 volume = {13}, 21668 number = {4}, 21669 pages = {1--22}, 21670 year = {2015} 21671} 21672 21673@Article{ balehaobhallapatankar2014, 21674 title = {Energy efficiency and allometry of movement of swimming and flying animals}, 21675 author = {Rahul Bale and Max Hao and Amneet Pal Singh Bhalla and Neelesh A Patankar}, 21676 journal = {Proceedings of the National Academy of Sciences}, 21677 volume = {111}, 21678 number = {21}, 21679 pages = {7517--7521}, 21680 year = {2014} 21681} 21682 21683@Article{ bhallabalegriffithpatankar2013, 21684 title = {A unified mathematical framework and an adaptive numerical method for 21685 fluid--structure interaction with rigid, deforming, and elastic bodies}, 21686 author = {Amneet Pal Singh Bhalla and Rahul Bale and Boyce E Griffith and Neelesh A 21687 Patankar}, 21688 journal = {Journal of Computational Physics}, 21689 volume = {250}, 21690 pages = {446--476}, 21691 year = {2013}, 21692 publisher = {Elsevier} 21693} 21694 21695@Article{ takeikatz2013, 21696 title = {Consequences of viscous anisotropy in a deforming, two-phase aggregate. Part 1. 21697 Governing equations and linearized analysis}, 21698 author = {Yasuko Takei and Richard F. Katz}, 21699 journal = {Journal of Fluid Mechanics}, 21700 volume = {734}, 21701 issn = {1469-7645}, 21702 pages = {424--455}, 21703 numpages = {32}, 21704 doi = {10.1017/jfm.2013.482}, 21705 month = nov, 21706 year = {2013} 21707} 21708 21709@Misc{ stewart2011, 21710 title = {Fredholm, Hilbert, Schmidt: Three Fundamental Papers on Integral Equations}, 21711 author = {G. W. Stewart}, 21712 note = {Translated with commentary by G. W. Stewart}, 21713 url = {http://www.cs.umd.edu/~stewart/FHS.pdf}, 21714 year = {2011} 21715} 21716 21717@Article{ douglisnirenberg1955, 21718 title = {nterior Estimates for Elliptic Systems of Partial Differential Equations}, 21719 author = {Avron Douglis and Louis Nirenberg}, 21720 journal = {Communications on Pure and Applied Mathematics}, 21721 volume = {8}, 21722 pages = {503--538}, 21723 year = {1955} 21724} 21725 21726@Article{ gorelickgalunsharonbasribrandt2006, 21727 title = {Shape Representation and Classification Using the Poisson Equation}, 21728 author = {Lena Gorelick and Meirav Galun and Eitan Sharon and Ronen Basri and Achi Brandt}, 21729 journal = {IEEE Transactions on Pattern Analysis and Machine Intelligence}, 21730 volume = {28}, 21731 number = {12}, 21732 pages = {1991--2005}, 21733 year = {2006} 21734} 21735 21736@Article{ salsbury2006, 21737 title = {Analysis of errors in {Still's} equation for macromolecular electrostatic 21738 solvation energies}, 21739 author = {Freddie R. Salsbury Jr.}, 21740 journal = {Molecular Physics}, 21741 volume = {104}, 21742 number = {08}, 21743 pages = {1299--1309}, 21744 year = {2006} 21745} 21746 21747@Article{ sigalov2006, 21748 title = {Analytical electrostatics for biomolecules: {Beyond} the generalized {Born} 21749 approximation}, 21750 author = {G. Sigalov and A. Fenley and A. Onufriev}, 21751 journal = {Journal of Chemical Physics}, 21752 volume = {124}, 21753 number = {124902}, 21754 year = {2006} 21755} 21756 21757@Article{ dennard1974, 21758 title = {Design of ion-implanted {MOSFET's} with very small physical dimensions}, 21759 author = {Robert H Dennard and Fritz H Gaensslen and V Leo Rideout and Ernest Bassous and 21760 Andre R LeBlanc}, 21761 journal = {IEEE Journal of Solid-State Circuits}, 21762 volume = {9}, 21763 number = {5}, 21764 pages = {256--268}, 21765 year = {1974} 21766} 21767 21768@Article{ zeegeijn2015, 21769 author = {Field G. {V}an~{Z}ee and Robert A. {v}an~{d}e~{G}eijn}, 21770 title = {{BLIS}: A Framework for Rapidly Instantiating {BLAS} Functionality}, 21771 journal = {ACM Transactions on Mathematical Software}, 21772 volume = {41}, 21773 number = {3}, 21774 pages = {14:1--14:33}, 21775 month = jun, 21776 year = {2015}, 21777 issue_date = {jun}, 21778 doi = {10.1145/2764454} 21779} 21780 21781@Article{ campbell1976, 21782 title = {Assessing the Impact of Planned Social Change}, 21783 author = {Donald T. Campbell}, 21784 journal = {Occasional Paper Series, The Public Affairs Center}, 21785 number = {8}, 21786 publisher = {Dartmouth College}, 21787 year = {1976} 21788} 21789 21790@Article{ smaldinomcelreath2016, 21791 title = {The natural selection of bad science}, 21792 author = {Paul E. Smaldino and Richard McElreath}, 21793 journal = {Royal Society Open Science}, 21794 volume = {3}, 21795 number = {9}, 21796 url = {http://rsos.royalsocietypublishing.org/content/3/9/160384}, 21797 eprint = {http://rsos.royalsocietypublishing.org/content/3/9/160384.full.pdf}, 21798 doi = {10.1098/rsos.160384}, 21799 year = {2016}, 21800 publisher = {The Royal Society} 21801} 21802 21803@Article{ harlowwelch1965, 21804 title = {Numerical calculation of time-dependent viscous incompressible flow of fluid with 21805 free surface}, 21806 author = {Francis H Harlow and J Eddie Welch}, 21807 journal = {Physics of fluids}, 21808 volume = {8}, 21809 number = {12}, 21810 pages = {2182--2189}, 21811 url = {http://www.cs.rpi.edu/~cutler/classes/advancedgraphics/S12/papers/harlow_welch.pdf}, 21812 year = {1965} 21813} 21814 21815@Article{ diskinthomasmineck2005, 21816 title = {{On Quantitative Analysis Methods for Multigrid Solutions}}, 21817 author = {Boris Diskin and James L. Thomas and Raymond E. Mineck}, 21818 journal = {SIAM Journal on Scientific Computing}, 21819 volume = {27}, 21820 number = {1}, 21821 pages = {108--129}, 21822 doi = {10.1137/030601521}, 21823 issn = {1064-8275}, 21824 year = {2005} 21825} 21826 21827@TechReport{ scott2012, 21828 title = {Fostering Interactions Between the Geosciences and Mathematics, Statistics, and 21829 Computer Science}, 21830 author = {L. Ridgway Scott and Jed Brown and George W. Bergantz and Dan Cooley and Clint 21831 Dawson and Maarten de Hoop and Donald Estep and Natasha Flyer and Efi 21832 Foufoula-Georgiou and Michael Ghil and Matthew G. Knepley and Randall J. LeVeque 21833 and Lek-Heng Lim and Serge Prudhomme and Adrian Sandu and Frederik J. Simons and 21834 Philip B. Stark and Michael Stein and Seth Stein and Toshiro Tanimoto and Daniel 21835 Tartakovsky and Jonathan Weare and Robert Weiss and Grady B. Wright and Dave 21836 Yuen}, 21837 institution = {University of Chicago}, 21838 number = {2012-02}, 21839 url = {http://cs.uchicago.edu/files/tr_authentic/TR-2012-02.pdf}, 21840 year = {2012} 21841} 21842 21843@Article{ roth2010, 21844 title = {Fundamental measure theory for hard-sphere mixtures: a review}, 21845 author = {Roland Roth}, 21846 journal = {J. Phys. Cond. Mat.}, 21847 volume = {22}, 21848 pages = {063102}, 21849 year = {2010} 21850} 21851 21852@Article{ wu2008, 21853 title = {Density functional theory for liquid structure and thermodynamics}, 21854 author = {J. Z. Wu}, 21855 journal = {Struct. Bond.}, 21856 doi = {10.1007/430_2008_3}, 21857 year = {2008} 21858} 21859 21860@Article{ goel2008, 21861 title = {Molecular solvent model of cylindrical electric double layers: a systematic study 21862 by {Monte Carlo} simulations and density functional theory}, 21863 author = {T. Goel and C. N. Patra and S. K. Ghosh and T. Mukherjee}, 21864 journal = {J. Chem. Phys.}, 21865 volume = {129}, 21866 pages = {154707}, 21867 year = {2008} 21868} 21869 21870@Article{ marchxiaoyubiros2015, 21871 title = {{ASKIT:} An efficient, parallel library for high-dimensional kernel summations}, 21872 author = {William B March and Bo Xiao and Chenhan D Yu and George Biros}, 21873 journal = {SIAM Journal on Scientific Computing (to appear)}, 21874 year = {2015} 21875} 21876 21877@InProceedings{ yangduraiswamigumerovdavis2003, 21878 title = {Improved fast gauss transform and efficient kernel density estimation}, 21879 author = {Changjiang Yang and Ramani Duraiswami and Nail A Gumerov and Larry Davis}, 21880 booktitle = {Proceedings of the Ninth IEEE International Conference on Computer Vision}, 21881 pages = {664--671}, 21882 year = {2003}, 21883 organization = {IEEE} 21884} 21885 21886@Article{ fornberglarssonflyer2011, 21887 title = {Stable computations with Gaussian radial basis functions}, 21888 author = {Bengt Fornberg and Elisabeth Larsson and Natasha Flyer}, 21889 journal = {SIAM Journal on Scientific Computing}, 21890 volume = {33}, 21891 number = {2}, 21892 pages = {869--892}, 21893 year = {2011}, 21894 publisher = {SIAM} 21895} 21896 21897@InProceedings{ srinivasanqiduraiswami2010, 21898 title = {GPUML: Graphical processors for speeding up kernel machines}, 21899 author = {Balaji Vasan Srinivasan and H Qi and Ramani Duraiswami}, 21900 booktitle = {SIAM Conf. on Data Mining. Workshop on High Performance Analytics-Algorithms, 21901 Implementations, and Applications}, 21902 year = {2010} 21903} 21904 21905@Article{ jadamecbillen2010, 21906 title = {Reconciling surface plate motions with rapid three-dimensional mantle flow around 21907 a slab edge}, 21908 author = {Margarete A Jadamec and Magali I Billen}, 21909 journal = {Nature}, 21910 volume = {465}, 21911 number = {7296}, 21912 pages = {338--341}, 21913 year = {2010} 21914} 21915 21916@Article{ jadamecbillen2012, 21917 title = {The role of rheology and slab shape on rapid mantle flow: Three-dimensional 21918 numerical models of the Alaska slab edge}, 21919 author = {Margarete A Jadamec and Magali I Billen}, 21920 journal = {Journal of Geophysical Research: Solid Earth}, 21921 volume = {117}, 21922 number = {B2}, 21923 year = {2012} 21924} 21925 21926@Article{ jadamec2015, 21927 title = {Slab-driven Mantle Weakening and Rapid Mantle Flow}, 21928 author = {Margarete A Jadamec}, 21929 journal = {Subduction Dynamics: From Mantle Flow to Mega Disasters}, 21930 volume = {211}, 21931 pages = {135}, 21932 year = {2015} 21933} 21934 21935@Article{ durancejadamecfalloonnicholls2012, 21936 title = {Magmagenesis within the {H}unter {R}idge {R}ift {Z}one resolved from 21937 olivine-hosted melt inclusions and geochemical modelling with insights from 21938 geodynamic models}, 21939 author = {Patricia MJ Durance and Margarete A Jadamec and TJ Falloon and IA Nicholls}, 21940 journal = {Australian Journal of Earth Sciences}, 21941 volume = {59}, 21942 number = {6}, 21943 pages = {913--931}, 21944 year = {2012} 21945} 21946 21947@Article{ sharplesmoresijadamecrevote2015, 21948 title = {Styles of rifting and fault spacing in numerical models of crustal extension}, 21949 author = {Wendy Sharples and Louis N Moresi and Margarete A Jadamec and Jerico Revote}, 21950 journal = {Journal of Geophysical Research: Solid Earth}, 21951 volume = {120}, 21952 number = {6}, 21953 pages = {4379--4404}, 21954 year = {2015} 21955} 21956 21957@Article{ hayniejadamec2017, 21958 title = {Tectonic drivers of the {Wrangell}-block forearc sliver: Insights from 3D 21959 geodynamic models}, 21960 author = {Kirstie L Haynie and Margarete A Jadamec}, 21961 journal = {Tectonics}, 21962 note = {in review}, 21963 year = {2017} 21964} 21965 21966@Article{ cammaranoromanowiczstixrudelithgowbertellonixu2009, 21967 title = {Inferring the thermochemical structure of the upper mantle from seismic data}, 21968 author = {Fabio Cammarano and Barbara Romanowicz and Lars Stixrude and Carolina 21969 Lithgow-Bertelloni and Wenbo Xu}, 21970 journal = {Geophysical Journal International}, 21971 volume = {179}, 21972 number = {2}, 21973 pages = {1169--1185}, 21974 year = {2009} 21975} 21976 21977@Article{ zhong2006, 21978 title = {Constraints on thermochemical convection of the mantle from plume heat flux, 21979 plume excess temperature, and upper mantle temperature}, 21980 author = {Shijie Zhong}, 21981 journal = {Journal of Geophysical Research: Solid Earth}, 21982 volume = {111}, 21983 number = {B4}, 21984 year = {2006} 21985} 21986 21987@Article{ billenhirth2007, 21988 title = {Rheologic controls on slab dynamics}, 21989 author = {Magali I Billen and Greg Hirth}, 21990 journal = {Geochemistry, Geophysics, Geosystems}, 21991 volume = {8}, 21992 number = {8}, 21993 year = {2007} 21994} 21995 21996@Article{ hirthkohlstedt2003, 21997 title = {Rheology of the upper mantle and the mantle wedge: A view from the 21998 experimentalists}, 21999 author = {Greg Hirth and David Kohlstedt}, 22000 journal = {Inside the subduction Factory}, 22001 pages = {83--105}, 22002 year = {2003} 22003} 22004 22005@Article{ longsilver2008, 22006 title = {The subduction zone flow field from seismic anisotropy: A global view}, 22007 author = {Maureen D Long and Paul G Silver}, 22008 journal = {science}, 22009 volume = {319}, 22010 number = {5861}, 22011 pages = {315--318}, 22012 year = {2008} 22013} 22014 22015@Article{ karatowu1993, 22016 title = {Rheology of the upper mantle: A synthesis}, 22017 author = {Shun-ichiro Karato and Patrick Wu}, 22018 journal = {Science}, 22019 volume = {260}, 22020 number = {5109}, 22021 pages = {771--778}, 22022 year = {1993} 22023} 22024 22025@Article{ long2013mantle, 22026 title = {Mantle flow in subduction systems: The mantle wedge flow field and implications 22027 for wedge processes}, 22028 author = {Long, Maureen D and Wirth, Erin A}, 22029 journal = {Journal of Geophysical Research: Solid Earth}, 22030 volume = {118}, 22031 number = {2}, 22032 pages = {583--606}, 22033 year = {2013}, 22034 publisher = {Wiley Online Library} 22035} 22036 22037@Article{ hoernle2008arc, 22038 title = {Arc-parallel flow in the mantle wedge beneath Costa Rica and Nicaragua}, 22039 author = {Hoernle, Kaj and Abt, David L and Fischer, Karen M and Nichols, Holly and Hauff, 22040 Folkmar and Abers, Geoffrey A and van den Bogaard, Paul and Heydolph, Ken and 22041 Alvarado, Guillermo and Protti, Marino and others}, 22042 journal = {Nature}, 22043 volume = {451}, 22044 number = {7182}, 22045 pages = {1094--1097}, 22046 year = {2008}, 22047 publisher = {Nature Publishing Group} 22048} 22049 22050@Article{ savage1999, 22051 title = {Seismic anisotropy and mantle deformation: what have we learned from shear wave 22052 splitting?}, 22053 author = {MK Savage}, 22054 journal = {Reviews of Geophysics}, 22055 volume = {37}, 22056 number = {1}, 22057 pages = {65--106}, 22058 year = {1999} 22059} 22060 22061@InProceedings{ akcelikbirosdraganescuhillghattaswaanders2005, 22062 title = {Dynamic data-driven inversion for terascale simulations: Real-time identification 22063 of airborne contaminants}, 22064 author = {Volkan Ak{\c{c}}elik and George Biros and Andrei Draganescu and Judith Hill and 22065 Omar Ghattas and Bart Van Bloemen Waanders}, 22066 booktitle = {Proceedings of the 2005 ACM/IEEE conference on Supercomputing}, 22067 pages = {43}, 22068 year = {2005}, 22069 organization = {IEEE Computer Society} 22070} 22071 22072@Article{ draganescusoane2013, 22073 title = {Multigrid solution of a distributed optimal control problem constrained by the 22074 {Stokes} equations}, 22075 author = {Andrei Dr{\u{a}}g{\u{a}}nescu and Ana Maria Soane}, 22076 journal = {Applied Mathematics and Computation}, 22077 volume = {219}, 22078 number = {10}, 22079 pages = {5622--5634}, 22080 year = {2013} 22081} 22082 22083@Article{ zhonggurnis1995, 22084 title = {Mantle convection with plates and mobile, faulted plate margins}, 22085 author = {Shijie Zhong and Michael Gurnis}, 22086 journal = {Science}, 22087 volume = {267}, 22088 number = {5199}, 22089 pages = {838}, 22090 year = {1995} 22091} 22092 22093@Article{ studerbobinchahidmousavicandesdahan2012, 22094 title = {Compressive fluorescence microscopy for biological and hyperspectral imaging}, 22095 author = {Vincent Studer and J{\'e}rome Bobin and Makhlad Chahid and Hamed Shams Mousavi 22096 and Emmanuel Candes and Maxime Dahan}, 22097 journal = {Proceedings of the National Academy of Sciences}, 22098 volume = {109}, 22099 number = {26}, 22100 pages = {E1679--E1687}, 22101 year = {2012} 22102} 22103 22104@Article{ borsukhigdonstowreckhow2001, 22105 title = {A {Bayesian} hierarchical model to predict benthic oxygen demand from organic 22106 matter loading in estuaries and coastal zones}, 22107 author = {Mark E Borsuk and David Higdon and Craig A Stow and Kenneth H Reckhow}, 22108 journal = {Ecological Modelling}, 22109 volume = {143}, 22110 number = {3}, 22111 pages = {165--181}, 22112 year = {2001} 22113} 22114 22115@Article{ liebermanwillcox2012, 22116 title = {Goal-oriented inference: Approach, linear theory, and application to advection 22117 diffusion}, 22118 author = {Chad Lieberman and Karen Willcox}, 22119 journal = {SIAM Journal on Scientific Computing}, 22120 volume = {34}, 22121 number = {4}, 22122 pages = {A1880--A1904}, 22123 year = {2012} 22124} 22125 22126@Article{ chaillatbiros2012, 22127 title = {{FaIMS}: A fast algorithm for the inverse medium problem with multiple 22128 frequencies and multiple sources for the scalar {Helmholtz} equation}, 22129 author = {St{\'e}phanie Chaillat and George Biros}, 22130 journal = {Journal of Computational Physics}, 22131 volume = {231}, 22132 number = {12}, 22133 pages = {4403--4421}, 22134 year = {2012} 22135} 22136 22137@Article{ farhattezaurdjellouli2002, 22138 title = {On the solution of three-dimensional inverse obstacle acoustic scattering 22139 problems by a regularized {Newton} method}, 22140 author = {Charbel Farhat and Radek Tezaur and Rabia Djellouli}, 22141 journal = {Inverse problems}, 22142 volume = {18}, 22143 number = {5}, 22144 pages = {1229}, 22145 year = {2002} 22146} 22147 22148@Article{ orozcoghattas1992, 22149 title = {Massively parallel aerodynamic shape optimization}, 22150 author = {Orozco, Carlos E and Ghattas, ON}, 22151 journal = {Computing Systems in Engineering}, 22152 volume = {3}, 22153 number = {1-4}, 22154 pages = {311--320}, 22155 year = {1992} 22156} 22157 22158@Article{ reutheralonsorimlingerjameson1999, 22159 title = {Aerodynamic shape optimization of supersonic aircraft configurations via an 22160 adjoint formulation on distributed memory parallel computers}, 22161 author = {James Reuther and Juan Jose Alonso and Mark J Rimlinger and Antony Jameson}, 22162 journal = {Computers \& fluids}, 22163 volume = {28}, 22164 number = {4}, 22165 pages = {675--700}, 22166 year = {1999} 22167} 22168 22169@Article{ rudistadlerghattas2016, 22170 title = {Weighted {BFBT} Preconditioner for {Stokes} Flow Problems with Highly 22171 Heterogeneous Viscosity}, 22172 author = {Johan Rudi and Georg Stadler and Omar Ghattas}, 22173 journal = {ArXiv e-prints}, 22174 archiveprefix = {arXiv}, 22175 primaryclass = {math.NA}, 22176 eprint = {1607.03936}, 22177 month = jul, 22178 year = {2016} 22179} 22180 22181@Article{ borzikunisch2006, 22182 title = {A globalization strategy for the multigrid solution of elliptic optimal control 22183 problems}, 22184 author = {Borzi, A and Kunisch, K}, 22185 journal = {Optimisation Methods and Software}, 22186 volume = {21}, 22187 number = {3}, 22188 pages = {445--459}, 22189 year = {2006} 22190} 22191 22192@Article{ nash2000, 22193 title = {A multigrid approach to discretized optimization problems}, 22194 author = {Stephen G Nash}, 22195 journal = {Optimization Methods and Software}, 22196 volume = {14}, 22197 number = {1-2}, 22198 pages = {99--116}, 22199 year = {2000} 22200} 22201 22202@Article{ jameson1983, 22203 title = {Solution of the Euler equations for two dimensional transonic flow by a multigrid 22204 method}, 22205 author = {Antony Jameson}, 22206 journal = {Applied mathematics and computation}, 22207 volume = {13}, 22208 number = {3-4}, 22209 pages = {327--355}, 22210 year = {1983} 22211} 22212 22213@Article{ billen2008, 22214 title = {Modeling the dynamics of subducting slabs}, 22215 author = {Magali I Billen}, 22216 journal = {Annu. Rev. Earth Planet. Sci.}, 22217 volume = {36}, 22218 pages = {325--356}, 22219 year = {2008} 22220} 22221 22222@Article{ gerya2011, 22223 title = {Future directions in subduction modeling}, 22224 author = {Taras Gerya}, 22225 journal = {Journal of Geodynamics}, 22226 volume = {52}, 22227 number = {5}, 22228 pages = {344--378}, 22229 year = {2011} 22230} 22231 22232@Article{ tackley2000, 22233 title = {Mantle convection and plate tectonics: Toward an integrated physical and chemical 22234 theory}, 22235 author = {Paul J Tackley}, 22236 journal = {Science}, 22237 volume = {288}, 22238 number = {5473}, 22239 pages = {2002--2007}, 22240 year = {2000} 22241} 22242 22243@Article{ caseydewey1984, 22244 title = {Initiation of subduction zones along transform and accreting plate boundaries, 22245 triple-junction evolution, and forearc spreading centres—implications for 22246 ophiolitic geology and obduction}, 22247 author = {JF Casey and JF Dewey}, 22248 journal = {Geological Society, London, Special Publications}, 22249 volume = {13}, 22250 number = {1}, 22251 pages = {269--290}, 22252 year = {1984} 22253} 22254 22255@Article{ doughertyclayton2014, 22256 title = {Seismicity and structure in central {Mexico}: Evidence for a possible slab tear 22257 in the {South Cocos} plate}, 22258 author = {Sara L Dougherty and Robert W Clayton}, 22259 journal = {Journal of Geophysical Research: Solid Earth}, 22260 volume = {119}, 22261 number = {4}, 22262 pages = {3424--3447}, 22263 year = {2014} 22264} 22265 22266@Article{ syracusemaceiraprietozhangammon2016, 22267 title = {Multiple plates subducting beneath Colombia, as illuminated by seismicity and 22268 velocity from the joint inversion of seismic and gravity data}, 22269 author = {Ellen M Syracuse and Monica Maceira and German A Prieto and Haijiang Zhang and 22270 Charles J Ammon}, 22271 journal = {Earth and Planetary Science Letters}, 22272 volume = {444}, 22273 pages = {139--149}, 22274 year = {2016} 22275} 22276 22277@Article{ bowergurnisflament2015, 22278 title = {Assimilating lithosphere and slab history in 4-D Earth models}, 22279 author = {Dan J Bower and Michael Gurnis and Nicolas Flament}, 22280 journal = {Physics of the Earth and Planetary Interiors}, 22281 volume = {238}, 22282 pages = {8--22}, 22283 year = {2015} 22284} 22285 22286@Book{ ciarlet1976, 22287 title = {Numerical analysis of the finite element method}, 22288 author = {Philippe G Ciarlet}, 22289 volume = {59}, 22290 year = {1976}, 22291 publisher = {Presses de l'Universit{\'e} de Montr{\'e}al} 22292} 22293 22294@InProceedings{ liumellorcrummey2013, 22295 title = {A data-centric profiler for parallel programs}, 22296 author = {Xu Liu and John Mellor-Crummey}, 22297 booktitle = {2013 SC-International Conference for High Performance Computing, Networking, 22298 Storage and Analysis (SC)}, 22299 pages = {1--12}, 22300 year = {2013}, 22301 organization = {IEEE} 22302} 22303 22304@InCollection{ ernstgander2012, 22305 title = {Why it is difficult to solve Helmholtz problems with classical iterative 22306 methods}, 22307 author = {Oliver G Ernst and Martin J Gander}, 22308 booktitle = {Numerical analysis of multiscale problems}, 22309 pages = {325--363}, 22310 url = {http://www.mathe.tu-freiberg.de/~ernst/PubArchive/helmholtzDurham.pdf}, 22311 year = {2012} 22312} 22313 22314@Article{ warburtonkarniadakis1999, 22315 title = {A discontinuous {G}alerkin method for the viscous {MHD} equations}, 22316 author = {Timothy C Warburton and George E Karniadakis}, 22317 journal = {Journal of Computational Physics}, 22318 volume = {152}, 22319 number = {2}, 22320 pages = {608--641}, 22321 year = {1999} 22322} 22323 22324@Article{ salahsoulaimanihabashi2001, 22325 title = {A finite element method for magnetohydrodynamics}, 22326 author = {Nizar Ben Salah and Azzeddine Soulaimani and Wagdi G Habashi}, 22327 journal = {Computer Methods in Applied Mechanics and Engineering}, 22328 volume = {43}, 22329 number = {190}, 22330 pages = {5867--5892}, 22331 year = {2001} 22332} 22333 22334@Article{ nesliturktezersezgin2005, 22335 title = {The finite element method for {MHD} flow at high {Hartmann} numbers}, 22336 author = {Ali I Nesliturk and M Tezer-Sezgin}, 22337 journal = {Computer methods in applied mechanics and engineering}, 22338 volume = {194}, 22339 number = {9}, 22340 pages = {1201--1224}, 22341 year = {2005} 22342} 22343 22344@Article{ strakschellart2016, 22345 title = {Control of Slab Width on Subduction-Induced Upper Mantle Flow and Associated 22346 Upwellings: Insights from Analog Models}, 22347 author = {Vincent Strak and Wouter P Schellart}, 22348 journal = {Journal of Geophysical Research: Solid Earth}, 22349 year = {2016} 22350} 22351 22352@InBook{ kirbyloggrognesterrel2012, 22353 title = {Common and unusual finite elements}, 22354 author = {Robert C. Kirby and Anders Logg and Marie E. Rognes and Andy R. Terrel}, 22355 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22356 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22357 {FEniCS} Book}, 22358 publisher = {Springer Berlin Heidelberg}, 22359 address = {Berlin, Heidelberg}, 22360 pages = {95--119}, 22361 isbn = {978-3-642-23099-8}, 22362 doi = {10.1007/978-3-642-23099-8_3}, 22363 year = {2012} 22364} 22365 22366@InBook{ kirbymardal2012, 22367 author = {Robert C. Kirby and Kent-Andre Mardal}, 22368 title = {Constructing general reference finite elements}, 22369 editor = {Anders Logg and Kent-Andre Mardal and Garth Wells}, 22370 booktitle = {Automated Solution of Differential Equations by the Finite Element Method: The 22371 {FEniCS} Book}, 22372 publisher = {Springer Berlin Heidelberg}, 22373 address = {Berlin, Heidelberg}, 22374 pages = {121--132}, 22375 isbn = {978-3-642-23099-8}, 22376 doi = {10.1007/978-3-642-23099-8_4}, 22377 year = {2012} 22378} 22379 22380@Book{ wriggers2008, 22381 title = {Nonlinear finite element methods}, 22382 author = {Peter Wriggers}, 22383 publisher = {Springer Science \& Business Media}, 22384 year = {2008} 22385} 22386 22387@Book{ zienkiewicztaylor1977, 22388 title = {The finite element method}, 22389 author = {Zienkiewicz, Olgierd Cecil and Taylor, Robert Leroy and Taylor, Robert Lee}, 22390 publisher = {McGraw-hill London}, 22391 volume = {3}, 22392 year = {1977} 22393} 22394 22395@Article{ rogneskirbylogg2009, 22396 title = {Efficient assembly of {H(div)} and {H(curl)} conforming finite elements}, 22397 author = {Marie E Rognes and Robert C Kirby and Anders Logg}, 22398 journal = {SIAM Journal on Scientific Computing}, 22399 volume = {31}, 22400 number = {6}, 22401 pages = {4130--4151}, 22402 year = {2009} 22403} 22404 22405@Book{ kelley03, 22406 title = {Solving nonlinear equations with Newton's method}, 22407 author = {Carl T. Kelley}, 22408 publisher = {SIAM}, 22409 year = {2003} 22410} 22411 22412@Article{ turing1937, 22413 title = {The Chemical Basis of Morphogenesis}, 22414 author = {A. M. Turing}, 22415 journal = {Philosophical Transactions of the Royal Society B: Biological Sciences}, 22416 volume = {237}, 22417 number = {641}, 22418 pages = {37--72}, 22419 doi = {10.1098/rstb.1952.0012}, 22420 issn = {0080-4622}, 22421 url = {http://rstb.royalsocietypublishing.org/content/237/641/37}, 22422 eprint = {http://rstb.royalsocietypublishing.org/content/237/641/37.full.pdf}, 22423 year = {1952} 22424} 22425 22426@Article{ fabienknepleymillsriviere2017, 22427 title = {Manycore parallel computing for a hybridizable discontinuous {Galerkin} nested 22428 multigrid method}, 22429 author = {Maurice S. Fabien and Matthew G. Knepley and Richard Mills and B\'eatrice M. 22430 Rivi\`ere}, 22431 journal = {SIAM Journal on Scientific Computing}, 22432 url = {https://arxiv.org/abs/1705.09907}, 22433 volume = {41}, 22434 number = {2}, 22435 pages = {C73--C96}, 22436 doi = {10.1137/17M1128903}, 22437 year = {2018} 22438} 22439 22440@Article{ fabienknepleyriviere2018, 22441 title = {A hybridizable discontinuous Galerkin method for two-phase flow in heterogeneous 22442 porous media}, 22443 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivier\'e}, 22444 journal = {International Journal for Numerical Methods in Engineering}, 22445 volume = {116}, 22446 number = {3}, 22447 pages = {161--177}, 22448 doi = {10.1002/nme.5919}, 22449 year = {2018} 22450} 22451 22452@Article{ fabienknepleyriviere2020, 22453 title = {A high order hybridizable discontinuous Galerkin method for incompressible 22454 miscible displacement in heterogeneous media}, 22455 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22456 journal = {Results in Applied Mathematics}, 22457 url = {https://arxiv.org/abs/1809.00747}, 22458 volume = {8}, 22459 pages = {100089}, 22460 doi = {10.1016/j.rinam.2019.100089}, 22461 year = {2020} 22462} 22463 22464@Article{ fabienknepleyriviere2019b, 22465 title = {Families of Interior Penalty Hybridizable discontinuous Galerkin methods for 22466 second order elliptic problems}, 22467 author = {Maurice S. Fabien and Matthew G. Knepley and B\'eatrice M. Rivi\`ere}, 22468 journal = {Journal of Numerical Mathematics}, 22469 volume = {28}, 22470 number = {3}, 22471 pages = {161--174}, 22472 doi = {10.1515/jnma-2019-0027}, 22473 year = {2019} 22474} 22475 22476@Article{ fabien2019, 22477 title = {A {GPU}-Accelerated Hybridizable Discontinuous {Galerkin} Method for Linear 22478 Elasticity}, 22479 author = {Maurice S. Fabien}, 22480 journal = {Communications in Computational Physics}, 22481 volume = {27}, 22482 number = {2}, 22483 pages = {513--545}, 22484 issn = {1991-7120}, 22485 doi = {10.4208/cicp.OA-2018-0235}, 22486 year = {2019} 22487} 22488 22489@Unpublished{ awanoufabienguzmanstern2020, 22490 title = {Hybridization and postprocessing in finite element exterior calculus}, 22491 author = {Gerard Awanou and Maurice Fabien and Johnny Guzm\'an and Ari Stern}, 22492 eprint = {2008.00149}, 22493 note = {preprint}, 22494 primaryclass = {math.NA}, 22495 year = {2020} 22496} 22497 22498@Article{ chaabanegiraultrivierethompson2018, 22499 title = {A stable enriched {G}alerkin element for the {S}tokes problem}, 22500 author = {Nabil Chaabane and Vivette Girault and B\'eatrice Rivi\`ere and Travis Thompson}, 22501 journal = {Applied Numerical Mathematics}, 22502 volume = {132}, 22503 pages = {1--21}, 22504 issn = {0168-9274}, 22505 doi = {https://doi.org/10.1016/j.apnum.2018.04.008}, 22506 url = {http://www.sciencedirect.com/science/article/pii/S0168927418300977}, 22507 year = {2018} 22508} 22509 22510@Article{ thompsonriviereknepley2018, 22511 title = {An Implicit Discontinuous Galerkin Method For Modeling Acute Edema and 22512 Resuscitation In The Small Intestine}, 22513 author = {Travis Thompson and B\'eatrice M. Rivi\`ere and Matthew G. Knepley}, 22514 journal = {Mathematical Medicine and Biology}, 22515 volume = {36}, 22516 number = {4}, 22517 pages = {513--548}, 22518 doi = {10.1093/imammb/dqz00}, 22519 year = {2019} 22520} 22521 22522@Article{ kevrekidisthompsongoriely2020, 22523 title = {Anisotropic Diffusion and Traveling Waves of Toxic Proteins in Neurodegenerative 22524 Diseases}, 22525 author = {P. G. Kevrekidis and Travis Thompson and Alain Goriely}, 22526 journal = {Physics Letters A}, 22527 volume = {384}, 22528 number = {36}, 22529 pages = {126935}, 22530 year = {2020} 22531} 22532 22533@Article{ mardalrognesthompson2021, 22534 title = {Accurate Discretization Of Poroelasticity Without {Darcy} Stability -- 22535 {Stokes-Biot} Stability Revisited}, 22536 author = {Kent-Andre Mardal and Marie E. Rognes and Travis B. Thompson}, 22537 journal = {BIT Numerical Mathematics}, 22538 pages = {1--36}, 22539 year = {2021} 22540} 22541 22542@Article{ piersantileethompsonmardalrognes2021, 22543 title = {Parameter robust preconditioning by congruence for multiple-network 22544 poroelasticity}, 22545 author = {Piersanti, Eleonora and Lee, Jeonghun J and Thompson, Travis and Mardal, K-A and 22546 Rognes, Marie E}, 22547 journal = {SIAM Journal on Scientific Computing}, 22548 volume = {43}, 22549 number = {4}, 22550 pages = {B984--B1007}, 22551 year = {2021}, 22552 publisher = {SIAM} 22553} 22554 22555@Article{ walkerknepleyaagaardwilliams2023, 22556 title = {Multiphysics Modeling in {PyLith}: Poroelasticity}, 22557 author = {Robert L. Walker and Matthew G. Knepley and Brad T. Aagaard and Charles A. Williams}, 22558 journal = {Geophysical Journal International}, 22559 volume = {235}, 22560 number = {3}, 22561 pages = {2442--2475}, 22562 doi = {10.1093/gji/ggad370}, 22563 year = {2023} 22564} 22565 22566@InProceedings{ actorfuentesriviere2020b, 22567 title = {Identification of Kernels in a Convolutional Neural Network: Connections Between 22568 Level Set Equation and Deep Learning for Image Segmentation}, 22569 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22570 booktitle = {Proceedings of the SPIE Medical Imaging Conference}, 22571 year = {2020} 22572} 22573 22574@Article{ actorfuentesriviere2020, 22575 title = {Robust Regularized Networks in the Presence of Noise}, 22576 author = {Jonas A. Actor and David T. Fuentes and B\'eatrice M. Rivi\`ere}, 22577 journal = {Medical Image Analysis}, 22578 note = {In revision}, 22579 year = {2020} 22580} 22581 22582@Book{ byerly1893, 22583 title = {An elementary treatise on Fourier's series: and spherical, cylindrical, and 22584 ellipsoidal harmonics, with applications to problems in mathematical physics}, 22585 author = {William Elwood Byerly}, 22586 publisher = {Dover}, 22587 year = {1893} 22588} 22589 22590@Book{ hobson1931, 22591 title = {The theory of spherical and ellipsoidal harmonics}, 22592 author = {Ernest William Hobson}, 22593 year = {1931}, 22594 publisher = {CUP Archive} 22595} 22596 22597@Book{ dassios2012, 22598 title = {Ellipsoidal harmonics: theory and applications}, 22599 author = {George Dassios}, 22600 volume = {146}, 22601 year = {2012}, 22602 publisher = {Cambridge University Press} 22603} 22604 22605@Book{ miller1977, 22606 title = {Symmetry and separation of variables}, 22607 author = {Miller, Jr, Willard}, 22608 year = {1977}, 22609 address = {Reading, MA}, 22610 publisher = {Addison-Wesley Publishing Co., Inc.} 22611} 22612 22613@TechReport{ epanet-users-manual, 22614 author = {Lewis A. Rossman}, 22615 title = {{EPANET 2} Users Manual}, 22616 institution = {Water Supply and Water Resources Division, National Risk Management Research 22617 Laboratory, Cincinnati, OH 45268}, 22618 year = {2000} 22619} 22620 22621@Article{ klocknerbarnettgreengardoneil2013, 22622 title = {Quadrature by expansion: A new method for the evaluation of layer potentials}, 22623 author = {Andreas Kl{\"o}ckner and Alexander Barnett and Leslie Greengard and Michael 22624 O'Neil}, 22625 journal = {Journal of Computational Physics}, 22626 volume = {252}, 22627 pages = {332--349}, 22628 year = {2013} 22629} 22630 22631@Article{ turcksinkronbichlerbangerth2016, 22632 title = {WorkStream--A Design Pattern for Multicore-Enabled Finite Element Computations}, 22633 author = {Bruno Turcksin and Martin Kronbichler and Wolfgang Bangerth}, 22634 journal = {ACM Transactions on Mathematical Software)}, 22635 volume = {43}, 22636 number = {1}, 22637 pages = {2}, 22638 year = {2016} 22639} 22640 22641@Article{ vitushkin1954, 22642 title = {On {Hilbert's} thirteenth problem}, 22643 author = {A. G. Vitushkin}, 22644 journal = {Dokl. Akad. Nauk SSSR}, 22645 volume = {95}, 22646 pages = {701--704}, 22647 year = {1954} 22648} 22649 22650@Article{ kolmogorov1957, 22651 title = {On the representation of continuous functions of several variables as 22652 superpositions of continuous functions of one variable and addition}, 22653 author = {Andrei N. Kolmogorov}, 22654 journal = {Dokl. Akad. Nauk SSSR}, 22655 pages = {953--956}, 22656 volume = {114:5}, 22657 note = {English transl. Amer. Math. Soc. Transl. (2) 28 (1963), 55}, 22658 year = {1957} 22659} 22660 22661@Article{ fridman1967, 22662 title = {Improvement in the smoothness of functions in the {Kolmogorov Superposition 22663 Theorem}}, 22664 author = {B. L. Fridman}, 22665 journal = {Dokl. Akad. Nauk SSR}, 22666 volume = {177:5}, 22667 pages = {1019--1022}, 22668 note = {English transl. Soviet Math. Dokl. 8, 6 (1967), 1550-1553}, 22669 year = {1967} 22670} 22671 22672@Article{ sprecher1972, 22673 title = {An improvement in The {Superposition Theorem of Kolmogorov}}, 22674 author = {David Sprecher}, 22675 journal = {Journal of Mathematical Analysis and Applications}, 22676 volume = {38}, 22677 pages = {208--213}, 22678 year = {1972} 22679} 22680 22681@Article{ diaconisshahshahani1984, 22682 title = {On nonlinear functions of linear combinations}, 22683 author = {Persi Diaconis and Mehrdad Shahshahani}, 22684 journal = {SIAM Journal on Scientific and Statistical Computing}, 22685 volume = {5}, 22686 number = {1}, 22687 pages = {175--191}, 22688 year = {1984}, 22689 publisher = {SIAM} 22690} 22691 22692@InProceedings{ hechtnielsen1987, 22693 title = {Kolmogorov's mapping neural network existence theorem}, 22694 author = {R. Hecht-Nielsen}, 22695 booktitle = {Proceedings of the International Conference on Neural Networks}, 22696 volume = {III}, 22697 pages = {11--14}, 22698 publisher = {IEEE Press}, 22699 year = {1987} 22700} 22701 22702@InProceedings{ hechtnielsen1989, 22703 title = {Theory of the back-propagation neural network}, 22704 author = {R. Hecht-Nielsen}, 22705 booktitle = {Proceedings of the International Joint Conference on Neural Networks}, 22706 volume = {I}, 22707 pages = {593--608}, 22708 publisher = {IEEE Press}, 22709 year = {1989} 22710} 22711 22712@Article{ girosipoggio1989, 22713 title = {Representation properties of networks: {Kolmogorov's} theorem is irrelevant}, 22714 author = {Federico Girosi and Tomaso Poggio}, 22715 journal = {Neural Computation}, 22716 volume = {1}, 22717 number = {4}, 22718 pages = {465--469}, 22719 year = {1989}, 22720 publisher = {MIT Press} 22721} 22722 22723@InBook{ koppen2002, 22724 title = {On the Training of a Kolmogorov Network}, 22725 author = {Mario K\"oppen}, 22726 pages = {474--9}, 22727 publisher = {ICANN 2002, LNCS 2415}, 22728 year = {2002} 22729} 22730 22731@PhDThesis{ bryant2008, 22732 title = {Analysis of {Kolmogorov's} superposition theorem and its implementation in 22733 applications with low and high dimensional data}, 22734 author = {Donald W Bryant}, 22735 school = {University of Central Florida}, 22736 year = {2008} 22737} 22738 22739@InCollection{ griebel2006, 22740 title = {Sparse Grids for Higher Dimensional Problems}, 22741 author = {Michael Griebel}, 22742 booktitle = {Foundations of Computational Mathematics}, 22743 editor = {Luis M. Pardo and Allan Pinkus and Endre Suli and Michael J. Todd}, 22744 publisher = {Cambridge University Press}, 22745 pages = {106--161}, 22746 doi = {10.1017/CBO9780511721571.004}, 22747 url = {https://www.cambridge.org/core/books/foundations-of-computational-mathematics-santander-2005/sparse-grids-for-higher-dimensional-problems/C6E91FFE07DF5F6C069B80805B216B50}, 22748 month = jun, 22749 day = {29}, 22750 year = {2006} 22751} 22752 22753@Article{ braungriebel2009, 22754 title = {On a constructive proof of {Kolmogorov}'s superposition theorem}, 22755 author = {Jurgen Bra\"un and Michael Griebel}, 22756 journal = {Constructive Approximation}, 22757 pages = {653--675}, 22758 volume = {30}, 22759 year = {2009} 22760} 22761 22762@InProceedings{ lenifougerolletruchetet2009, 22763 title = {Kolmogorov superposition theorem and its application to wavelet image 22764 decompositions}, 22765 author = {Pierre-Emmanuel Leni and Yohan D Fougerolle and Fr{\'{e}}d{\'{e}}ric Truchetet}, 22766 booktitle = {Electronic Imaging-Wavelet Applications in Industrial Processing VI, Proceedings 22767 of the SPIE}, 22768 pages = {724804--724804}, 22769 doi = {10.1117/12.805916}, 22770 url = {http://le2i.cnrs.fr/IMG/publications/2228{\_}main.pdf{\%}5Cnhttp://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1335035}, 22771 year = {2009} 22772} 22773 22774@Article{ oseledets2011, 22775 title = {Tensor-train decomposition}, 22776 author = {Ivan V Oseledets}, 22777 journal = {SIAM Journal on Scientific Computing}, 22778 volume = {33}, 22779 number = {5}, 22780 pages = {2295--2317}, 22781 year = {2011} 22782} 22783 22784@PhDThesis{ liu2015, 22785 title = {Kolmogorov superposition theorem and its applications}, 22786 author = {Xing Liu}, 22787 school = {Imperial College London}, 22788 year = {2015} 22789} 22790 22791@Article{ lecunbengiohinton2015, 22792 title = {Deep learning}, 22793 author = {Yann LeCun and Yoshua Bengio and Geoffrey Hinton}, 22794 journal = {Nature}, 22795 volume = {521}, 22796 number = {7553}, 22797 pages = {436--444}, 22798 year = {2015} 22799} 22800 22801@Book{ trefethen2013, 22802 title = {Approximation theory and approximation practice}, 22803 author = {Lloyd N Trefethen}, 22804 publisher = {SIAM}, 22805 year = {2013} 22806} 22807 22808@Article{ butlergrahammattiswalsh2017, 22809 title = {A measure-theoretic interpretation of sample based numerical integration with 22810 applications to inverse and prediction problems under uncertainty}, 22811 author = {Troy Butler and Lindsey Graham and S. Mattis and S. Walsh}, 22812 journal = {SIAM Journal on Scientific Computing}, 22813 volume = {39}, 22814 number = {5}, 22815 pages = {A2072--A2098}, 22816 year = {2017} 22817} 22818 22819@Article{ logg2009, 22820 title = {Efficient representation of computational meshes}, 22821 author = {Anders Logg}, 22822 journal = {International Journal of Computational Science and Engineering}, 22823 volume = {4}, 22824 number = {4}, 22825 pages = {283--295}, 22826 year = {2009} 22827} 22828 22829@Article{ agelekandersonbangerthbarth2017, 22830 title = {On orienting edges of unstructured two-and three-dimensional meshes}, 22831 author = {Rainer Agelek and Michael Anderson and Wolfgang Bangerth and William L Barth}, 22832 journal = {ACM Transactions on Mathematical Software (TOMS)}, 22833 volume = {44}, 22834 number = {1}, 22835 pages = {5}, 22836 year = {2017} 22837} 22838 22839@Article{ actorknepley2018, 22840 title = {An Algorithm for Computing {Lipschitz} Inner Functions in {Kolmogorov's 22841 Superposition Theorem}}, 22842 author = {Jonas Actor and Matthew G. Knepley}, 22843 eprint = {1712.08286}, 22844 archiveprefix = {arXiv}, 22845 primaryclass = {math.na}, 22846 note = {\url{http://arxiv.org/abs/1712.08286}}, 22847 year = {2018} 22848} 22849 22850@Book{ driscollhaletrefethen2014, 22851 title = {Chebfun guide}, 22852 author = {Tobin A Driscoll and Nicholas Hale and Lloyd N Trefethen}, 22853 publisher = {Pafnuty Publications, Oxford}, 22854 year = {2014} 22855} 22856 22857@Article{ johntobiska2000, 22858 title = {Numerical performance of smoothers in coupled multigrid methods for the parallel 22859 solution of the incompressible Navier-Stokes equations}, 22860 author = {Volker John and Lutz Tobiska}, 22861 journal = {International Journal for Numerical Methods in Fluids}, 22862 volume = {33}, 22863 number = {4}, 22864 pages = {453--473}, 22865 year = {2000} 22866} 22867 22868@Article{ vanka1986, 22869 title = {Block-implicit multigrid calculation of two-dimensional recirculating flows}, 22870 author = {S. P. Vanka}, 22871 journal = {Computer Methods in Applied Mechanics and Engineering}, 22872 volume = {59}, 22873 number = {1}, 22874 pages = {29--48}, 22875 year = {1986} 22876} 22877 22878@Article{ bartelgunther2018, 22879 author = {Andreas Bartel and Michael G\"unther}, 22880 title = {{PDAEs} in refined electrical network modeling}, 22881 journal = {SIAM Review}, 22882 volume = {60}, 22883 number = {1}, 22884 pages = {56--91}, 22885 doi = {10.1137/17M1113643}, 22886 year = {2018} 22887} 22888 22889@Article{ matpower, 22890 author = {Ray D. Zimmerman and Carlos E. Murillo-S{\'a}nchez and Robert J. Thomas}, 22891 title = {{MATPOWER}: Steady-state operations, planning and analysis tools for power 22892 systems research and education}, 22893 journal = {IEEE Transactions on Power Systems}, 22894 volume = {26}, 22895 number = {1}, 22896 pages = {12--19}, 22897 year = {2011}, 22898 doi = {10.1109/TPWRS.2010.2051168} 22899} 22900 22901@Article{ betrieyan2018, 22902 author = {G. Betrie and E. Yan}, 22903 title = {Development and Verification of Thermoelectric Power Plant Model for Assessing 22904 Energy and Water Nexus}, 22905 journal = {Applied Energy, Submitted}, 22906 volume = {}, 22907 number = {}, 22908 pages = {}, 22909 doi = {}, 22910 year = {2018} 22911} 22912 22913@Article{ faeth2012, 22914 author = {P. Faeth}, 22915 title = {{U.S.} Energy Security and Water: The Challenges We Face}, 22916 journal = {Environment: Science and Policy for Sustainable Development}, 22917 volume = {54(1)}, 22918 number = {1}, 22919 pages = {4--19}, 22920 year = {2012}, 22921 doi = {10.1080/00139157.2012.639595} 22922} 22923 22924@InProceedings{ hagberg2008, 22925 title = {Exploring network structure, dynamics, and function using {NetworkX}}, 22926 author = {Hagberg, Aric A. and Schult, Daniel A. and Swart, Pieter J.}, 22927 booktitle = {Proceedings of the 7th Python in Science Conference (SciPy2008), Ga\"{e}l 22928 Varoquaux, Travis Vaught, and Jarrod Millman (Eds), (Pasadena, CA USA)}, 22929 year = {2008}, 22930 pages = {11--15} 22931} 22932 22933@Misc{ simulink-web-page, 22934 author = {Mathworks}, 22935 title = {{SIMULINK} web page}, 22936 note = {\url{https://www.mathworks.com/products/simulink.html}}, 22937 year = {2017} 22938} 22939 22940@Misc{ labview-web-page, 22941 author = {National Instruments}, 22942 title = {{LabVIEW} web page}, 22943 note = {\url{http://www.ni.com/labview/}}, 22944 key = {labview}, 22945 year = {2017} 22946} 22947 22948@Misc{ modelica-web-page, 22949 author = {Modelica Association}, 22950 title = {Modelica web page}, 22951 note = {\url{https://www.modelica.org/}}, 22952 year = {2017} 22953} 22954 22955@InProceedings{ yangsc16, 22956 author = {C. Yang and W. Xue and H. Fu and H. You and X. Wang and Y. Ao and F. Liu and L. 22957 Gan and P. Xu and L. Wang and G. Yang and W. Zheng}, 22958 booktitle = {{SC '16}: Proceedings of the International Conference for High Performance 22959 Computing, Networking, Storage and Analysis}, 22960 title = {{10M-Core} Scalable Fully-Implicit Solver for Nonhydrostatic Atmospheric 22961 Dynamics}, 22962 note = {Gordon Bell Award}, 22963 year = {2016} 22964} 22965 22966@InProceedings{ bekassc15, 22967 author = {C. Bekas and A. Curioni and O. Ghattas and M. Gurnis and Y. Ineichen and T. Isaac 22968 and C. Malossi and J. Rudi and G. Stadler and P.W.J. Staar}, 22969 booktitle = {{SC '15}: Proceedings of the International Conference for High Performance 22970 Computing, Networking, Storage and Analysis}, 22971 title = {An Extreme-Scale Implicit Solver for Complex {PDEs}: Highly Heterogeneous Flow in 22972 Earth's Mantle}, 22973 note = {Gordon Bell Award}, 22974 year = {2015} 22975} 22976 22977@Misc{ improving-software-whitepaper2017, 22978 author = {M. Heroux and L.C. McInnes}, 22979 title = {Improving and accelerating scientific discovery through better software}, 22980 note = {whitepaper for 2017 ASCR Applied Mathematics PI Meeting}, 22981 doi = {10.6084/m9.figshare.5339692}, 22982 year = {2017} 22983} 22984 22985@Misc{ doe:40thanniversarycollection, 22986 title = {{DOE Office of Science} 40th anniversary collection of 40 major papers that have 22987 changed the face of science}, 22988 key = {Department of Energy, Office of Science}, 22989 howpublished = {\url{https://science.energy.gov/news/doe-science-at-40}}, 22990 year = {2017} 22991} 22992 22993@Misc{ siam:fellowsprogram, 22994 title = {{Society for Industrial and Applied Mathematics, Fellows Program}}, 22995 key = {SIAM}, 22996 howpublished = {\url{http://www.siam.org/prizes/fellows}} 22997} 22998 22999@Misc{ r-and-d100:awards2009, 23000 title = {{R\&D100 Award Winners 2009}}, 23001 key = {{R\&D100 Award Winners 2009}}, 23002 howpublished = {\url{https://www.rdmag.com/2009/08/2009-r-d-100-award-winners}} 23003} 23004 23005@Misc{ xsdk:website, 23006 title = {{xSDK: Extreme-scale Scientific Software Development Kit}}, 23007 key = {xSDK: Extreme-scale Scientific Software Development Kit}, 23008 howpublished = {\url{https://xsdk.info}} 23009} 23010 23011@Misc{ xsdk-community-installation-policies2017, 23012 title = {{xSDK} Community Installation Policies: {GNU Autoconf} and {CMake} Options}, 23013 author = {R. Bartlett and J. Sarich and B. Smith and T. Gamblin and {xSDK developers}}, 23014 note = {version 0.3, November 7, 2017}, 23015 doi = {10.6084/m9.figshare.4495133}, 23016 year = {2017} 23017} 23018 23019@Misc{ xsdk-community-package-policies2017, 23020 title = {{xSDK} Community Package Policies}, 23021 author = {B. Smith and R. Bartlett and {xSDK developers}}, 23022 note = {version 0.3, November 7, 2017}, 23023 doi = {10.6084/m9.figshare.4495136}, 23024 year = {2017} 23025} 23026 23027@Misc{ ideas-what-are-interoperable-libraries, 23028 title = {What Are Interoperable Software Libraries: Introducing the {xSDK}}, 23029 author = {Lois Curfman McInnes and Michael A. Heroux and Xiaoye Li and Barry Smith and 23030 Ulrike Yang and {all xSDK developers}}, 23031 note = {IDEAS {\em WhatIs} document, version 0.2, April 25, 2016, available via 23032 \url{https://ideas-productivity.org/resources/howtos/}}, 23033 year = {2016} 23034} 23035 23036@Misc{ ideas-productivity:website, 23037 title = {{IDEAS Scientific Software Productivity Project}}, 23038 key = {IDEAS Scientific Software Productivity Project}, 23039 howpublished = {\url{https://ideas-productivity.org}} 23040} 23041 23042@Misc{ ecp:website, 23043 key = {{U.S. DOE Exascale Computing Project (ECP)}}, 23044 title = {{U.S. DOE Exascale Computing Project (ECP)}}, 23045 note = {\url{https://exascaleproject.org}}, 23046 year = {2018} 23047} 23048 23049@Misc{ siam-cse-jan2018, 23050 author = {Ulrich R\"{u}de and Karen Willcox and Lois Curfman McInnes and Hans {De Sterck} 23051 and George Biros and Hans Bungartz and James Corones and Evin Cramer and James 23052 Crowley and Omar Ghattas and Max Gunzburger and Michael Hanke and Robert Harrison 23053 and Michael Heroux and Jan Hesthaven and Peter Jimack and Chris Johnson and Kirk 23054 E. Jordan and David E. Keyes and Rolf Krause and Vipin Kumar and Stefan Mayer and 23055 Juan Meza and Knut Martin M{\o}rken and J. Tinsley Oden and Linda Petzold and 23056 Padma Raghavan and Suzanne M. Shontz and Anne Trefethen and Peter Turner and 23057 Vladimir Voevodin and Barbara Wohlmuth and Carol S. Woodward}, 23058 title = {Research and Education in Computational Science and Engineering}, 23059 note = {available via \url{https://arxiv.org/abs/1610.02608}, to appear in {\em SIAM 23060 Review}}, 23061 year = {2018} 23062} 23063 23064@Misc{ doe-appliedmathpimeeting2017, 23065 author = {Jeff Hittinger and Lois Curfman McInnes and Abani Patra and Nathan Baker and 23066 Miranda Holmes-Cerfon and Barney Maccabe and Esmong Ng and Pieter Swart and Karen 23067 Willcox and Steven Lee}, 23068 title = {{Report on the 2017 ASCR Applied Mathematics Principal Investigators Meeting}}, 23069 note = {\url{http://www.orau.gov/ascr-appliedmath-pi2017}}, 23070 year = {2017} 23071} 23072 23073@Misc{ doe-fusionintegratedsimulationsworkshopreport2015, 23074 author = {P. Bonoli and L. C. {McInnes (Chairs)}}, 23075 title = {{Report on the DOE Workshop on Integrated Simulations for Magnetic Fusion Energy 23076 Sciences}}, 23077 note = {available via 23078 \url{http://science.energy.gov/~/media/fes/pdf/workshop-reports/2016/ISFusionWorkshopReport_11-12-2015.pdf}}, 23079 year = {2015} 23080} 23081 23082@Misc{ sisc-specialissueintro, 23083 title = {Introduction to {SISC} Special section associated with {CSE15} on {'CSE 23084 Software'} and {'Big Data in CSE'}}, 23085 author = {H. {De Sterck} and C. Johnson and L.C. McInnes}, 23086 month = nov, 23087 year = {2016}, 23088 journal = {SIAM J. Sci. Comput.}, 23089 doi = {10.1137/16N974188} 23090} 23091 23092@Article{ xsdk-foundations2017, 23093 title = {{xSDK} Foundations: Toward an Extreme-scale Scientific Software Development Kit}, 23094 author = {R. Bartlett and I. Demeshko and T. Gamblin and G. Hammond and M. Heroux and J. 23095 Johnson and A. Klinvex and X. Li and L.C. McInnes and J.D. Moulton and D. 23096 Osei-Kuffuor and J. Sarich and B. Smith and J. Willenbring and U.M. Yang}, 23097 journal = {Supercomputing Frontiers and Innovations}, 23098 month = feb, 23099 year = {2017}, 23100 note = {available via \url{https://arxiv.org/abs/1702.08425}} 23101} 23102 23103@Misc{ openfoam:website, 23104 title = {{OpenFOAM}}, 23105 author = {OpenFOAM Team}, 23106 key = {OpenFOAM}, 23107 howpublished = {\url{https://openfoam.com}} 23108} 23109 23110@Misc{ mfem:website, 23111 title = {{MFEM}}, 23112 author = {Tzanio Kolev and MFEM Team}, 23113 key = {MFEM}, 23114 howpublished = {\url{https://mfem.org}} 23115} 23116 23117@Misc{ deal.ii:website, 23118 title = {{{deal.II}: An open-source finite element library}}, 23119 author = {Wolfgang Bangerth and Deal.II Team}, 23120 howpublished = {\url{http://www.dealii.org}}, 23121 year = {2018} 23122} 23123 23124@Misc{ ibamr:website, 23125 title = {{{IBAMR}: Immersed Boundary Method Adaptive Mesh Refinement Software Infrastructure}}, 23126 author = {Boyce Griffith and IBAMR Team}, 23127 howpublished = {\url{https://ibamr.github.io/}}, 23128 year = {2023} 23129} 23130 23131@Misc{ fission-gas-scidac:website, 23132 title = {{Simulation of Fission Gas in Uranium Oxide Nuclear Fuel}}, 23133 author = {A. David {Andersson (PI)}}, 23134 howpublished = {SciDAC project, \url{https://collab.cels.anl.gov/display/FissionGasSciDAC2}}, 23135 year = {2018} 23136} 23137 23138@Misc{ tokamak-disruption-scidac:project, 23139 title = {{Tokamak Disruption Simulation}}, 23140 author = {Xianzhu {Tang (PI)}}, 23141 howpublished = {SciDAC project}, 23142 year = {2018} 23143} 23144 23145@InProceedings{ duplyakin2018memory, 23146 title = {Evaluating Active Learning with Cost and Memory Awareness}, 23147 author = {Duplyakin, Dmitry and Brown, Jed and Calhoun, Donna}, 23148 booktitle = {2018 IEEE International Parallel and Distributed Processing Symposium (IPDPS)}, 23149 pages = {214--223}, 23150 year = {2018}, 23151 organization = {IEEE}, 23152 pdf = {https://jedbrown.org/files/DuplyakinBrownCalhoun-ActiveLearningCostMemoryAware-2018.pdf} 23153} 23154 23155@InProceedings{ duplyakin2016active, 23156 author = {Dmitry Duplyakin and Jed Brown and Robert Ricci}, 23157 title = {Active Learning in Performance Analysis}, 23158 booktitle = {Proceedings of the IEEE Cluster Conference}, 23159 year = {2016}, 23160 month = sep, 23161 url = {http://www.flux.utah.edu/paper/duplyakin-cluster16}, 23162 pdf = {https://jedbrown.org/files/DuplyakinBrownRicci-ActiveLearningPerformanceAnalysis-2016.pdf} 23163} 23164 23165@Misc{ xgc1:website, 23166 title = {{XGC1 project website}}, 23167 author = {C. S. Chang and others}, 23168 howpublished = {\url{https://epsi.pppl.gov/computing/xgc-1}}, 23169 year = {2018} 23170} 23171 23172@Misc{ wdmapp-bhattacharjee-ecp:website, 23173 title = {{WDMApp: High-Fidelity Whole Device Modeling of Magnetically Confined Fusion 23174 Plasmas}}, 23175 author = {A. Bhattacharjee and others}, 23176 note = {ECP application project}, 23177 howpublished = {\url{https://www.exascaleproject.org/activity/energy-applications}}, 23178 year = {2018} 23179} 23180 23181@Misc{ subsurface-steefel-ecp:website, 23182 title = {{Subsurface: Exascale Subsurface Simulator of Coupled Flow, Transport, Reactions, 23183 and Mechanics}}, 23184 note = {ECP application project}, 23185 author = {C. Steefel and others}, 23186 howpublished = {\url{https://www.exascaleproject.org/activity/earth-space-science-applications}}, 23187 year = {2018} 23188} 23189 23190@Article{ chombo-crunch:2014, 23191 title = {High-Resolution Simulation of Pore-Scale Reactive Transport Processes Associated 23192 with Carbon Sequestration}, 23193 author = {D. Trebotich and M. F. Adams and S. Molins and C. Steefel and C. Shen}, 23194 journal = {Computing in Science and Engineering}, 23195 volume = {16}, 23196 issue = {6}, 23197 year = {2014}, 23198 pages = {22--31}, 23199 doi = {10.1109/MCSE.2014.77} 23200} 23201 23202@Article{ courantfriedrichslewy1967, 23203 title = {On the partial difference equations of mathematical physics}, 23204 author = {Richard Courant and Kurt Friedrichs and Hans Lewy}, 23205 journal = {IBM journal of Research and Development}, 23206 volume = {11}, 23207 number = {2}, 23208 pages = {215--234}, 23209 year = {1967}, 23210 publisher = {IBM} 23211} 23212 23213@Article{ erway2017solving, 23214 title = {On solving large-scale limited-memory quasi-Newton equations}, 23215 author = {Erway, Jennifer B and Marcia, Roummel F}, 23216 journal = {Linear Algebra and its Applications}, 23217 volume = {515}, 23218 pages = {196--225}, 23219 year = {2017}, 23220 publisher = {Elsevier} 23221} 23222 23223@Article{ griewank2012broyden, 23224 title = {Broyden updating, the good and the bad!}, 23225 author = {Griewank, Andreas}, 23226 journal = {Optimization Stories, Documenta Mathematica. Extra Volume: Optimization Stories}, 23227 pages = {301--315}, 23228 year = {2012} 23229} 23230 23231@Book{ tarantola2005, 23232 title = {Inverse problem theory and methods for model parameter estimation}, 23233 author = {Albert Tarantola}, 23234 volume = {89}, 23235 year = {2005}, 23236 publisher = {SIAM} 23237} 23238 23239@Article{ rutkaikristof2010, 23240 title = {Dynamic Monte Carlo simulation in mixtures}, 23241 author = {G{\'a}bor Rutkai and Tam{\'a}s Krist{\'o}f}, 23242 journal = {The Journal of Chemical Physics}, 23243 volume = {132}, 23244 number = {10}, 23245 pages = {104107}, 23246 year = {2010}, 23247 publisher = {AIP} 23248} 23249 23250@Book{ vogel2002, 23251 title = {Computational methods for inverse problems}, 23252 author = {Curtis R Vogel}, 23253 volume = {23}, 23254 year = {2002}, 23255 publisher = {SIAM} 23256} 23257 23258@Article{ malqvistpeterseim2014, 23259 title = {Localization of elliptic multiscale problems}, 23260 author = {Axel M{\aa}lqvist and Daniel Peterseim}, 23261 journal = {Mathematics of Computation}, 23262 volume = {83}, 23263 number = {290}, 23264 pages = {2583--2603}, 23265 year = {2014} 23266} 23267 23268@Article{ brandtbrannickkahllivshits2011, 23269 title = {Bootstrap {AMG}}, 23270 author = {Achi Brandt and James Brannick and Karsten Kahl and Irene Livshits}, 23271 journal = {SIAM Journal on Scientific Computing}, 23272 volume = {33}, 23273 number = {2}, 23274 pages = {612--632}, 23275 year = {2011} 23276} 23277 23278@InProceedings{ barralalauzet2014, 23279 title = {Large displacement body-fitted {FSI} simulations using a mesh-connectivity-change 23280 moving mesh strategy}, 23281 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet}, 23282 booktitle = {44th AIAA Fluid Dynamics Conference}, 23283 pages = {2773}, 23284 year = {2014} 23285} 23286 23287@InProceedings{ barralalauzetloseille2015, 23288 title = {Metric-based anisotropic mesh adaptation for three-dimensional time-dependent 23289 problems involving moving geometries}, 23290 author = {Nicolas Barral and Fr{\'e}d{\'e}ric Alauzet and Adrien Loseille}, 23291 booktitle = {53rd AIAA Aerospace Sciences Meeting}, 23292 pages = {2039}, 23293 year = {2015} 23294} 23295 23296@Article{ barralolivieralauzet2017, 23297 title = {Time-accurate anisotropic mesh adaptation for three-dimensional time-dependent 23298 problems with body-fitted moving geometries}, 23299 author = {Nicolas Barral and G{\'e}raldine Olivier and Fr{\'e}d{\'e}ric Alauzet}, 23300 journal = {Journal of Computational Physics}, 23301 volume = {331}, 23302 pages = {157--187}, 23303 year = {2017} 23304} 23305 23306@Article{ ibanezbarralkrakosloseillemichalpark2017, 23307 title = {First Benchmark of the Unstructured Grid Adaptation Working Group}, 23308 author = {Daniel Ibanez and Nicolas Barral and Joshua Krakos and Adrien Loseille and Todd 23309 Michal and Mike Park}, 23310 journal = {Procedia engineering}, 23311 volume = {203}, 23312 pages = {154--166}, 23313 year = {2017} 23314} 23315 23316@InProceedings{ parkbarralibanezkamenetskiykrakosmichalloseille2018, 23317 title = {Unstructured Grid Adaptation and Solver Technology for Turbulent Flows}, 23318 author = {Michael A Park and Nicolas Barral and Daniel Ibanez and Dmitry S Kamenetskiy and 23319 Joshua A Krakos and Todd R Michal and Adrien Loseille}, 23320 booktitle = {2018 AIAA Aerospace Sciences Meeting}, 23321 pages = {1103}, 23322 year = {2018} 23323} 23324 23325@InProceedings{ barralangeloudiskramergormanpiggott2018, 23326 title = {An anisotropic mesh adaptation approach for regional tidal energy hydrodynamics 23327 modelling}, 23328 author = {Nicolas Barral and Athanasios Angeloudis and Stephan C Kramer and Gerard J Gorman 23329 and Matthew D Piggott}, 23330 booktitle = {EGU General Assembly Conference Abstracts}, 23331 volume = {20}, 23332 pages = {19168}, 23333 year = {2018} 23334} 23335 23336@Article{ principe2009, 23337 title = {{Mathematical models for thermally coupled low speed flows}}, 23338 author = {Javier Principe and Ramon Codina}, 23339 journal = {Advances in Theoretical and Applied Mechanics}, 23340 volume = {2}, 23341 number = {1-4}, 23342 pages = {93--112}, 23343 url = {http://www.m-hikari.com/atam/atam2009/atam1-4-2009/principeATAM1-4-2009.pdf}, 23344 year = {2009} 23345} 23346 23347@Book{ vandervorst2003, 23348 title = {Iterative {K}rylov Methods for Large Linear Systems}, 23349 author = {van der Vorst, H.}, 23350 isbn = {9780521818285}, 23351 publisher = {Cambridge University Press}, 23352 year = {2003} 23353} 23354 23355@Book{ peres2006, 23356 author = {Asher Peres}, 23357 title = {Quantum theory: concepts and methods}, 23358 volume = {57}, 23359 publisher = {Springer Science \& Business Media}, 23360 year = {2006} 23361} 23362 23363@Book{ kuttler2012, 23364 title = {Linear algebra: theory and applications}, 23365 author = {Kenneth Kuttler}, 23366 url = {http://www.math.byu.edu/~klkuttle/Linearalgebra.pdf}, 23367 year = {2012} 23368} 23369 23370@Book{ elman_silvester_wathen_2014, 23371 place = {Oxford}, 23372 title = {Finite elements and fast iterative solvers: with applications in incompressible 23373 fluid dynamics}, 23374 publisher = {Oxford University Press}, 23375 author = {Elman, Howard C. and Silvester, David J. and Wathen, Andrew J.}, 23376 url = {https://global.oup.com/academic/product/finite-elements-and-fast-iterative-solvers-9780199678792?cc=us&lang=en&}, 23377 year = {2014} 23378} 23379 23380@Article{ alametal2007, 23381 title = {An evaluation of the ORNL Cray XT3}, 23382 author = {S. R. Alam and R. F. Barrett and M. R. Fahey and J. A. Kuehn and O. E. B. Messer 23383 and R. T. Mills and P. C. Roth and J. S. Vetter and P. H. Worley}, 23384 journal = {International Journal of High Performance Computing Applications}, 23385 volume = {22}, 23386 number = {1}, 23387 pages = {52--80}, 23388 doi = {10.1177/1094342007085019}, 23389 year = {2007} 23390} 23391 23392@Article{ plazacarey2000, 23393 title = {Local refinement of simplicial grids based on the skeleton}, 23394 author = {Plaza, A. and Carey, Graham F.}, 23395 journal = {Applied Numerical Mathematics}, 23396 doi = {10.1016/S0168-9274(99)00022-7}, 23397 issn = {01689274}, 23398 volume = {32}, 23399 number = {2}, 23400 pages = {195--218}, 23401 year = {2000} 23402} 23403 23404@Article{ carsonstrakos2020, 23405 title = {On the cost of iterative computations}, 23406 author = {Eric Carson and Zden\v{e}k Strako\v{s}}, 23407 journal = {Phil. Trans. R. Soc. A}, 23408 volume = {378}, 23409 number = {20190050}, 23410 doi = {10.1098/rsta.2019.0050}, 23411 url = {https://royalsocietypublishing.org/doi/full/10.1098/rsta.2019.0050}, 23412 year = {2020} 23413} 23414 23415@Article{ schoberl1999, 23416 title = {Multigrid methods for a parameter dependent problem in primal variables}, 23417 author = {Joachim Sch{\"o}berl}, 23418 journal = {Numerische Mathematik}, 23419 volume = {84}, 23420 number = {1}, 23421 pages = {97--119}, 23422 year = {1999} 23423} 23424 23425@Article{ wuleexuzikatanov2008, 23426 title = {Convergence analysis on iterative methods for semidefinite systems}, 23427 author = {Jinbiao Wu and Young-Ju Lee and Jinchao Xu and Ludmil Zikatanov}, 23428 journal = {Journal of Computational Mathematics}, 23429 pages = {797--815}, 23430 year = {2008} 23431} 23432 23433@Article{ maierrannacher2016, 23434 title = {Duality-based adaptivity in finite element discretization of heterogeneous 23435 multiscale problems}, 23436 author = {Maier, Matthias and Rannacher, Rolf}, 23437 journal = {Journal of Numerical Mathematics}, 23438 volume = {24}, 23439 number = {3}, 23440 pages = {167--187}, 23441 year = {2016} 23442} 23443 23444@Article{ maierrannacher2018, 23445 title = {A duality-based optimization approach for model adaptivity in heterogeneous 23446 multiscale problems}, 23447 author = {Maier, Matthias and Rannacher, Rolf}, 23448 journal = {Multiscale Modeling \& Simulation}, 23449 volume = {16}, 23450 number = {1}, 23451 pages = {412--428}, 23452 year = {2018} 23453} 23454 23455@Article{ margetismaierluskin2017, 23456 title = {On the Wiener--Hopf method for surface plasmons: Diffraction from semiinfinite 23457 metamaterial sheet}, 23458 author = {Margetis, Dionisios and Maier, Matthias and Luskin, Mitchell}, 23459 journal = {Studies in Applied Mathematics}, 23460 volume = {139}, 23461 number = {4}, 23462 pages = {599--625}, 23463 year = {2017} 23464} 23465 23466@Article{ maiermargetisluskin2017b, 23467 title = {Dipole excitation of surface plasmon on a conducting sheet: Finite element 23468 approximation and validation}, 23469 author = {Maier, Matthias and Margetis, Dionisios and Luskin, Mitchell}, 23470 journal = {Journal of Computational Physics}, 23471 volume = {339}, 23472 pages = {126--145}, 23473 year = {2017} 23474} 23475 23476@Article{ maiermargetisluskin2018, 23477 title = {Generation of surface plasmon-polaritons by edge effects}, 23478 author = {Matthias Maier and Dionisios Margetis and Mitchell Luskin}, 23479 journal = {Communications in Mathematical Sciences}, 23480 volume = {16}, 23481 number = {1}, 23482 pages = {77--95}, 23483 url = {http://arxiv.org/abs/1702.00848}, 23484 year = {2018} 23485} 23486 23487@Article{ maiermattheakiskaxirasluskinmargetis2018, 23488 title = {Universal behavior of a dispersive Dirac cone in gradient-index plasmonic 23489 metamaterials}, 23490 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23491 Mitchell and Margetis, Dionisios}, 23492 journal = {Physical Review B}, 23493 volume = {97}, 23494 number = {3}, 23495 pages = {035307}, 23496 year = {2018} 23497} 23498 23499@Article{ maiermattheakiskaxirasluskinmargetis2019, 23500 title = {Homogenization of plasmonic crystals: seeking the epsilon-near-zero effect}, 23501 author = {Maier, Matthias and Mattheakis, Marios and Kaxiras, Efthimios and Luskin, 23502 Mitchell and Margetis, Dionisios}, 23503 journal = {Proceedings of the Royal Society A}, 23504 volume = {475}, 23505 number = {2230}, 23506 pages = {20190220}, 23507 year = {2019} 23508} 23509 23510@Article{ maiermargetisluskin2020, 23511 title = {Finite-size effects in wave transmission through plasmonic crystals: A tale of 23512 two scales}, 23513 author = {Maier, Matthias and Luskin, Mitchell and Margetis, Dionisios}, 23514 journal = {Physical Review B}, 23515 volume = {102}, 23516 number = {7}, 23517 pages = {075308}, 23518 year = {2020} 23519} 23520 23521@Article{ margetismaierstauberlowluskin2020, 23522 title = {Nonretarded edge plasmon-polaritons in anisotropic two-dimensional materials}, 23523 author = {Margetis, Dionisios and Maier, Matthias and Stauber, Tobias and Low, Tony and 23524 Luskin, Mitchell}, 23525 journal = {Journal of Physics A: Mathematical and Theoretical}, 23526 volume = {53}, 23527 number = {5}, 23528 pages = {055201}, 23529 year = {2020} 23530} 23531 23532@Article{ maiermargetismellet2020, 23533 title = {Homogenization of time-harmonic Maxwell’s equations in nonhomogeneous plasmonic 23534 structures}, 23535 author = {Maier, Matthias and Margetis, Dionisios and Mellet, Antoine}, 23536 journal = {Journal of Computational and Applied Mathematics}, 23537 volume = {377}, 23538 pages = {112909}, 23539 year = {2020} 23540} 23541 23542@Article{ maierkronbichler2021, 23543 title = {Efficient parallel 3D computation of the compressible Euler equations with an 23544 invariant-domain preserving second-order finite-element scheme}, 23545 author = {Maier, Matthias and Kronbichler, Martin}, 23546 journal = {ACM Transactions on Parallel Computing}, 23547 volume = {8}, 23548 number = {3}, 23549 pages = {1--30}, 23550 year = {2021} 23551} 23552 23553@Article{ guermondmaierpopovtomas2021, 23554 title = {Second-order invariant domain preserving approximation of the compressible 23555 Navier--Stokes equations}, 23556 author = {Guermond, Jean-Luc and Maier, Matthias and Popov, Bojan and Tomas, Ignacio}, 23557 journal = {Computer Methods in Applied Mechanics and Engineering}, 23558 volume = {375}, 23559 pages = {113608}, 23560 year = {2021} 23561} 23562 23563@Article{ liliptonmaier2021, 23564 title = {Lorentz Resonance in the Homogenization of Plasmonic Crystals}, 23565 author = {Li, Wei and Lipton, Robert and Maier, Matthias}, 23566 eprint = {2009.12166}, 23567 archiveprefix = {arXiv}, 23568 primaryclass = {phys.optics}, 23569 year = {2021} 23570} 23571 23572@Article{ songmaierluskin2020, 23573 title = {Nonlinear eigenvalue problems for coupled Helmholtz equations modeling 23574 gradient-index graphene waveguides}, 23575 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23576 journal = {Journal of Computational Physics}, 23577 volume = {423}, 23578 pages = {109871}, 23579 year = {2020} 23580} 23581 23582@Article{ songmaierluskin2019, 23583 title = {Adaptive finite element simulations of waveguide configurations involving 23584 parallel 2D material sheets}, 23585 author = {Song, Jung Heon and Maier, Matthias and Luskin, Mitchell}, 23586 journal = {Computer Methods in Applied Mechanics and Engineering}, 23587 volume = {351}, 23588 pages = {20--34}, 23589 year = {2019} 23590} 23591 23592% 23593% <a name="consults"></a><H3><center>Users Who have Visited ANL for Consulting on PETSc</center></H3> 23594% 23595% 23596@Unpublished{ rob1, 23597 author = {Rob Kunz}, 23598 institution = {Computational Mechanics Division, Applied Research Laboratory, The Pennsylvania 23599 State University}, 23600 url = {http://www.arl.psu.edu/areas/compmech/compmech.html}, 23601 sponsors = {U.S. Navy, NRC}, 23602 note = {Using the PETSc and hypre linear solvers to solve pressure equations in CFD 23603 simulations, including lake warming by power plants}, 23604 dates = {Oct 3 and 4, 2002}, 23605 email = {rfk@wt.arl.psu.edu} 23606} 23607 23608@Unpublished{ au1, 23609 author = {Feng Wang and William Appelbe}, 23610 institution = {VPAC, Victorian Partnership for Advanced Computing, Melbourne, Australia}, 23611 url = {http://www.vpac.org}, 23612 sponsors = { }, 23613 note = {Using PETSc for a Variety of Geophysical Simulations}, 23614 dates = {Nov 22, 2002} 23615} 23616 23617@Unpublished{ carl1, 23618 author = {Carl Sovinec}, 23619 institution = {Applied Physics, University of Wisconsin}, 23620 url = {http://nimrodteam.org}, 23621 sponsors = {DOE Office of Fusion Research}, 23622 note = {Investigating using PETSc for NIMROD}, 23623 dates = {Nov 21, 2002}, 23624 email = {sovinec@engr.wisc.edu} 23625} 23626 23627@Unpublished{ au1b, 23628 author = {Pablo Carrica and Robert Wilson}, 23629 institution = {INSTITUTE HYDRAULIC RESEARCH, University of Iowa}, 23630 url = {http://}, 23631 sponsors = {Office of Naval Research}, 23632 note = {Using PETSc for a hydrodynamics of ships and submarines}, 23633 dates = {Sept, 2002}, 23634 email = {pablo-carrica@uiowa.edu and robert-wilson@uiowa.edu} 23635} 23636 23637% ------------------- TAO References ---------------------- 23638@Article{ benson:2001:csp, 23639 author = {Steven J. Benson and Lois Curfman McInnes and Jorge J. More'}, 23640 title = {A Case Study in the Performance and Scalability of Optimization Algorithms}, 23641 journal = {{ACM} Transactions on Mathematical Software}, 23642 volume = {27}, 23643 number = {3}, 23644 month = sep, 23645 year = {2001}, 23646 pages = {361--376} 23647} 23648 23649@TechReport{ tao-user-ref-2000, 23650 author = {Steve Benson and Lois Curfman McInnes and Jorge Mor\'{e}}, 23651 title = {{TAO} Users Manual}, 23652 year = {2000}, 23653 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23654 number = {ANL/MCS-TM-242}, 23655 note = {See \url{http://www.mcs.anl.gov/tao}} 23656} 23657 23658% ------------------- Optimization References ---------------------- 23659@Book{ optguide93, 23660 title = {Optimization Software Guide}, 23661 author = {Jorge J. Mor\'{e} and Stephen J. Wright}, 23662 publisher = {SIAM Publications}, 23663 address = {Philadelphia}, 23664 year = {1993} 23665} 23666 23667@InProceedings{ more84, 23668 author = {Jorge J. Mor\'{e} and Danny C. Sorenson and Burton S. Garbow and Kenneth E. 23669 Hillstrom}, 23670 title = {The {MINPACK} Project}, 23671 booktitle = {Sources and Development of Mathematical Software}, 23672 editor = {Wayne R. Cowell}, 23673 year = {1984}, 23674 pages = {88--111} 23675} 23676 23677@Article{ steihaug:83, 23678 author = {Trond Steihaug}, 23679 title = {The Conjugate Gradient Method and Trust Regions in Large Scale Optimization}, 23680 journal = {SIAM J. Numer. Anal.}, 23681 volume = {20}, 23682 year = {1983}, 23683 pages = {626--637}, 23684 key = {steihaug92 ! trust_region} 23685} 23686 23687@TechReport{ minpack2test, 23688 author = {Brett M. Averick and Richard G. Carter and Jorge J. Mor\'{e}}, 23689 title = {The {MINPACK-2} Test Problem Collection}, 23690 institution = {Argonne National Laboratory}, 23691 year = {1991}, 23692 number = {ANL/MCS-TM-150}, 23693 key = {more91 ! MINPACK-2} 23694} 23695 23696@TechReport{ hohmann:94, 23697 author = {Andreas Hohmann}, 23698 title = {Object Oriented Design of Multilevel {N}ewton and Continuation Methods}, 23699 institution = {Konrad-Zuse-Zentrum fur Informationstechnik Berlin}, 23700 year = {1994}, 23701 number = {SC-94-4}, 23702 key = {Hohmann94} 23703} 23704 23705@TechReport{ meza:94, 23706 author = {Juan C. Meza}, 23707 title = {{OPT}++: An Object-Oriented Class Library for Nonlinear Optimization}, 23708 institution = {Sandia National Laboratory}, 23709 year = {1994}, 23710 number = {SAND94-8225}, 23711 key = {Meza94} 23712} 23713 23714@Book{ dennis:83, 23715 author = {J. E. {Dennis Jr.} and Robert B. Schnabel}, 23716 title = {Numerical Methods for Unconstrained Optimization and Nonlinear Equations}, 23717 publisher = {Prentice-Hall, Inc.}, 23718 address = {Englewood Cliffs, NJ}, 23719 year = {1983} 23720} 23721 23722@TechReport{ more:92, 23723 author = {Jorge J. Mor\'{e} and David Thuente}, 23724 title = {Line search algorithms with guaranteed sufficient decrease}, 23725 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23726 year = {1992}, 23727 number = {MCS-P330-1092} 23728} 23729 23730@Article{ more-toraldo, 23731 author = {Jorge J. Mor\'e and G. Toraldo}, 23732 journal = {SIOPT}, 23733 pages = {93--113}, 23734 title = {On the solution of large quadratic programming problems with bound constraints}, 23735 volume = {1}, 23736 year = {1991} 23737} 23738 23739@Article{ byrd:1995:lma, 23740 author = {Richard H. Byrd and Peihuang Lu and Jorge Nocedal and Ci You Zhu}, 23741 title = {A Limited Memory Algorithm for Bound Constrained Optimization}, 23742 journal = {SIAM Journal on Scientific Computing}, 23743 volume = {16}, 23744 number = {5}, 23745 pages = {1190--1208}, 23746 month = sep, 23747 year = {1995}, 23748 coden = {SJOCE3}, 23749 issn = {1064-8275 (print), 1095-7197 (electronic)}, 23750 mrclass = {90C30 (65K05)}, 23751 mrnumber = {96e:90039}, 23752 mrreviewer = {Henry Wolkowicz}, 23753 bibdate = {Fri Dec 4 16:17:35 MST 1998} 23754} 23755 23756@Article{ lin_c3, 23757 author = {C.-J. Lin and J. J. Mor\'e}, 23758 title = {Newton's method for large bound-constrained optimization problems}, 23759 year = {1999}, 23760 journal = {SIOPT}, 23761 volume = {9(4)}, 23762 pages = {1100--1127}, 23763 url = {http://www.mcs.anl.gov/home/more/papers/nb.ps.gz} 23764} 23765 23766@TechReport{ dolan2, 23767 author = {E. Dolan and J. J. Mor\'{e}}, 23768 title = {Benchmarking Optimization Software with Performance Profiles}, 23769 year = {2001}, 23770 month = jan, 23771 number = {ANL/MCS-P861-1200}, 23772 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 23773 address = {Argonne, IL}, 23774 url = {http://www.mcs.anl.gov/~more/cops/} 23775} 23776 23777@InProceedings{ owlqn, 23778 author = {Galen Andrew and Jianfeng Gao}, 23779 title = {Scalable training of L1-regularized log-linear models}, 23780 booktitle = {Proceedings of the 24th international conference on Machine learning (ICML)}, 23781 pages = {33--40}, 23782 year = {2007} 23783} 23784 23785@Article{ bmrm, 23786 author = {Choon Hue Teo and S.V.N. Vishwanathan and Alex J. Smola and Quoc V. Le}, 23787 title = {Bundle methods for regularized risk minimization}, 23788 year = {2010}, 23789 journal = {Journal of Machine Learning Research}, 23790 volume = {11}, 23791 pages = {311--365} 23792} 23793 23794% ------------------- Component Software References ---------------------- 23795@InProceedings{ cca99, 23796 author = {R. Armstrong and D. Gannon and A. Geist and K. Keahey and S. Kohn and L. C. 23797 McInnes and S. Parker and B. Smolinski}, 23798 title = {Toward a Common Component Architecture for High-Performance Scientific 23799 Computing}, 23800 booktitle = {Proceedings of {High Performance Distributed Computing}}, 23801 pages = {115--124}, 23802 year = {1999}, 23803 note = {See \url{http://cca-forum.org}} 23804} 23805 23806@Book{ szyperski98, 23807 author = {Clemens Szyperski}, 23808 title = {Component Software: Beyond Object-Oriented Programming}, 23809 publisher = {ACM Press}, 23810 address = {New York}, 23811 year = {1998} 23812} 23813 23814@Article{ broy98, 23815 author = {Manfred Broy and Anton Deimel and Juergen Henn and Kai Koskimies and 23816 Franti\v{s}ek Pl\'{a}\v{s}il and Gustave Pomberger and Wolfgang Pree and Michael 23817 Stal and Clemens Szyperski}, 23818 title = {What Characterizes a (Software) Component?}, 23819 journal = {Software -- Concepts and Tools}, 23820 publisher = {Springer-Verlag}, 23821 year = {1998}, 23822 volume = {19}, 23823 pages = {49--56} 23824} 23825 23826@Article{ componentware:94, 23827 author = {Jon Udell}, 23828 title = {Componentware}, 23829 journal = {Byte}, 23830 volume = {may}, 23831 pages = {46--56}, 23832 year = {1994}, 23833 key = {Udell94 ! componentware} 23834} 23835 23836@Misc{ cca-web-page, 23837 author = {{Common Component Architecture Forum}}, 23838 note = {See \url{http://cca-forum.org}} 23839} 23840 23841% --------------- References for Tools Used by TAO Developers ----------------- 23842 23843% 23844% tohtml: Used to generate on-line TAO users manual and manual pages 23845% 23846@TechReport{ tohtml, 23847 author = {William Gropp}, 23848 title = {Users Manual for tohtml: Producing true hypertext documents from {LaTeX}}, 23849 institution = {Argonne National Laboratory}, 23850 number = {ANL/MCS-TM-00}, 23851 month = jan, 23852 year = {1995}, 23853 key = {tohtml} 23854} 23855 23856% 23857% doctext: Used to generate tex version of TAO manual pages 23858% 23859@TechReport{ doctext, 23860 author = {William Gropp}, 23861 title = {Users Manual for doctext: Producing documentation from {C} source code}, 23862 institution = {Argonne National Laboratory}, 23863 number = {ANL/MCS-TM-00}, 23864 month = jan, 23865 year = {1995}, 23866 key = {doctext} 23867} 23868 23869% 23870% bfort: Used to generate TAO Fortran interface 23871% 23872@TechReport{ bfort, 23873 author = {William Gropp}, 23874 title = {Users Manual for bfort: Producing {F}ortran interfaces to {C} source code}, 23875 institution = {Argonne National Laboratory}, 23876 number = {ANL/MCS-TM-208}, 23877 month = mar, 23878 year = {1995}, 23879 key = {doctext} 23880} 23881 23882% ------------------------- PETSc References ------------------------------ 23883@InProceedings{ petsc, 23884 author = {Satish Balay and William D. Gropp and Lois Curfman McInnes and Barry F. Smith}, 23885 title = {Efficient Management of Parallelism in Object Oriented Numerical Software 23886 Libraries}, 23887 booktitle = {Modern Software Tools in Scientific Computing}, 23888 editor = {E. Arge and A. M. Bruaset and H. P. Langtangen}, 23889 publisher = {Birkhauser Press}, 23890 pages = {163--202}, 23891 year = {1997} 23892} 23893 23894% ------------------------- Misc Other References ------------------------------ 23895@Misc{ indeps-web-page, 23896 title = {{InDEPS} {W}eb page}, 23897 note = {http://z.ca.sandia.gov/\~{ }indeps/}, 23898 author = {et al. Robert Armstrong}, 23899 institution = {Sandia National Laboratory}, 23900 key = {{InDEPS} {W}eb page} 23901} 23902 23903@Misc{ pooma, 23904 title = {{POOMA}: {A} FrameWork for scientific computing applications on parallel ar 23905 chitectures}, 23906 year = {1996}, 23907 author = {J. V. W. Reynders and J. C. Cummings and P. J. Hinker and M. Tholburn a nd M. S. 23908 S. Banerjee and S. Karmesin and S. Atlas and K. Keahey and W. F. Humphr ey} 23909} 23910 23911@Misc{ isis++-web-page, 23912 title = {{ISIS++} {W}eb Page}, 23913 note = {See \url{http://ca.sandia.gov/isis}}, 23914 author = {Robert L. Clay and Kyran Mish and Alan B. Williams}, 23915 institution = {Sandia National Laboratories} 23916} 23917 23918@Misc{ trilinos-web-page, 23919 title = {{Trilinos} {W}eb Page}, 23920 note = {See 23921 \url{http://www.cs.sandia.gov/\~mheroux/Trilinos/doc/TrilinosIntroduction.htm}}, 23922 author = {Mike Heroux et al.}, 23923 institution = {Sandia National Laboratories} 23924} 23925 23926@Misc{ alice-web-page, 23927 title = {{ALICE} {W}eb page}, 23928 note = {http://www.mcs.anl.gov/\-alice, Mathematics and Computer Science Division, 23929 Argonne National Laboratory}, 23930 key = {{ALICE} {W}eb page} 23931} 23932 23933@Misc{ autodiff-webpage, 23934 author = {{Computational Differentiation Project}}, 23935 note = {See \url{http://www.mcs.anl.gov/autodiff}} 23936} 23937 23938@Misc{ coool-home-page, 23939 author = {Lydia Deng and Wences Gouveia and John Scales}, 23940 title = {{The CWP Object-Oriented Optimization Library}}, 23941 note = {See \url{http://www.cwp.mines.edu/cwpcodes/coool}} 23942} 23943 23944@Misc{ rice-inversion-home-page, 23945 author = {Mark S. Gokenbach and William W. Symes}, 23946 title = {{The Hilbert Class Library}}, 23947 note = {See \url{http://www.trip.caam.rice.edu/}} 23948} 23949 23950@Misc{ opt++-home-page, 23951 author = {{OPT++: An Object-Oriented Nonlinear Optimization Library}}, 23952 note = {See \url{http://csmr.ca.sandia.gov/projects/opt/opt++.html}} 23953} 23954 23955@Article{ gockenbach:1999:ccl, 23956 author = {Mark S. Gockenbach and Matthew J. Petro and William W. Symes}, 23957 title = {C++ Classes for Linking Optimization with Complex Simulations}, 23958 journal = {{ACM} Transactions on Mathematical Software}, 23959 volume = {25}, 23960 number = {2}, 23961 month = jun, 23962 year = {1999}, 23963 pages = {191-212}, 23964 abstract = {The object-oriented programming paradigm can be used to overcome the 23965 incompatibilities between off-the-shelf optimization software and application 23966 software. The Hilbert Class Library (HCL) defines the fundamental mathematical 23967 objects arising in optimization problems, such as vectors, linear operators, and 23968 so forth, as C++ classes, making it possible to write optimization code in a 23969 natural fashion, while allowing application software such as simulators to use the 23970 most convenient data structures and programming style. In spite of the poor 23971 reputation C++ has for runtime performance, the use of mixed-language programming 23972 allows performance equal to that achieved by standard Fortran packages, as 23973 comparisons with the popular code LBFGS and ARPACK demonstrate.}, 23974 accepted = {April 1999}, 23975 url = {http://www.acm.org/pubs/citations/journals/toms/1999-25-2/p191-gockenbach/} 23976} 23977 23978@Misc{ neos-guide, 23979 author = {{The Optimization Software Guide}}, 23980 note = {See \url{http://www.mcs.anl.gov/otc/Guide/}} 23981} 23982 23983@Article{ boyd, 23984 title = {Distributed optimization and statistical learning via the alternating direction 23985 method of multipliers}, 23986 author = {Boyd, Stephen and Parikh, Neal and Chu, Eric and Peleato, Borja and Eckstein, 23987 Jonathan and others}, 23988 journal = {Foundations and Trends{\textregistered} in Machine learning}, 23989 volume = {3}, 23990 number = {1}, 23991 pages = {1-122}, 23992 year = {2011}, 23993 publisher = {Now Publishers, Inc.} 23994} 23995 23996@Misc{ :alertsys, 23997 title = {page{ALERT}}, 23998 organization = {Alert Systems, Inc}, 23999 address = {Madison, Wisconsin}, 24000 note = {http://www.alertsys.com/} 24001} 24002 24003@Manual{ :cmfortran, 24004 title = {{CM} {F}ortran Language Reference Manual}, 24005 organization = {Thinking Machines Corporation}, 24006 year = {1994}, 24007 address = {Cambridge, MA} 24008} 24009 24010@Manual{ :cmmd, 24011 title = {{CMMD} Reference Manual, Version 3.0}, 24012 organization = {Thinking Machines Corporation}, 24013 year = {1993}, 24014 address = {Cambridge, MA} 24015} 24016 24017@Manual{ :cmssl, 24018 title = {{CMSSL} for {CM} {F}ortran}, 24019 volume = {I}, 24020 organization = {Thinking Machines Corporation}, 24021 year = {1994}, 24022 address = {Cambridge, MA} 24023} 24024 24025@Misc{ :condor, 24026 author = {M. Livny}, 24027 title = {{PI}, The {Condor} Project, High Throughput Computing}, 24028 howpublished = {www.cs.wisc.edu/condor} 24029} 24030 24031@Manual{ :connection, 24032 title = {Connection Machine {CM}--5 Technical Summary}, 24033 organization = {Thinking Machines Corporation}, 24034 year = {1993}, 24035 address = {Cambridge, MA} 24036} 24037 24038@Manual{ :cplex, 24039 title = {{CPLEX} Optimizer}, 24040 organization = {ILOG CPLEX Division}, 24041 address = {889 Alder Avenue, Incline Village, Nevada}, 24042 note = {http://www.cplex.com/} 24043} 24044 24045@Manual{ :cplextm, 24046 title = {Using the {CPLEX(TM)} Linear Optimizer and {CPLEX(TM)} Mixed Integer Optimizer 24047 (Version 2.0)}, 24048 organization = {CPLEX Optimization Inc.}, 24049 year = {1992}, 24050 address = {Incline Village, Nevada} 24051} 24052 24053@Misc{ :fatcop, 24054 author = {M. C. Ferris}, 24055 title = {{PI}, {FATCOP}: {A} Fault Tolerant {Condor} {PVM} Mixed Integer Programming 24056 Solver}, 24057 howpublished = {www.cs.wisc.edu/math-prog/fatcop} 24058} 24059 24060@Misc{ :metaneos, 24061 author = {S. J. Wright}, 24062 title = {{metaNEOS}: Metacomputing Environments for Optimization}, 24063 howpublished = {www-unix.mcs.anl.gov/metaneos} 24064} 24065 24066@InCollection{ gropp.more:optimization, 24067 author = {W. Gropp and J. J. Mor\'e}, 24068 title = {Optimization environments and the {NEOS} Server}, 24069 booktitle = {Approximation Theory and Optimization}, 24070 pages = {167--182}, 24071 publisher = {Cambridge University Press}, 24072 year = {1997}, 24073 editor = {M. D. Buhmann and A. Iserles} 24074} 24075 24076@Article{ czyzyk.mesnier.ea:neos, 24077 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 24078 title = {The {NEOS} Server}, 24079 journal = {IEEE Journal on Computational Science and Engineering}, 24080 volume = {5}, 24081 year = {1998}, 24082 pages = {68--75} 24083} 24084 24085@Book{ :osl, 24086 title = {Handbook for {IBM OSL}}, 24087 author = {M. S. Hung and W. O. Rom and A. D. Warren}, 24088 year = {1994}, 24089 publisher = {Boyd and Fraser}, 24090 address = {Danvers, Massachusetts} 24091} 24092 24093@Manual{ :pro-matlab, 24094 title = {{PRO}--{MATLAB} User's Guide}, 24095 organization = {The MathWorks, Inc.}, 24096 year = {1989}, 24097 address = {21 Eliot Street, South Natick, MA 01760} 24098} 24099 24100@Misc{ :prostate, 24101 key = {Biomedical}, 24102 title = {Biomedical Business International Newsletter}, 24103 howpublished = {pp. 72--75}, 24104 year = {1996} 24105} 24106 24107@Misc{ :sipcase, 24108 key = {Natural}, 24109 title = {Natural Gas Planning: An Application of Stochastic Linear Programming}, 24110 howpublished = {http://www-fp.mcs.anl.gov/otc/Guide/CaseStudies/slp/index.html} 24111} 24112 24113@Book{ aarts.korst:simulated, 24114 author = {E. Aarts and J. Korst}, 24115 title = {Simulated Annealing and Boltzman Machines}, 24116 year = {1990}, 24117 publisher = {John Wiley \& Sons}, 24118 address = {Chichester} 24119} 24120 24121@TechReport{ aarts.laarhoven.ea:local-search-based, 24122 author = {E. H. L. Aarts and P. J. M. van Laarhoven and N. L. J. Ulder}, 24123 title = {Local-Search-Based Algorithms for Job Shop Scheduling}, 24124 institution = {Centre for Quantitative Methods}, 24125 year = {1991}, 24126 address = {Nederlandse Philips Bedrijven B.V., P.O. Box 218, NL-5600 MD Eindhoven}, 24127 number = {106}, 24128 type = {CQM-Not} 24129} 24130 24131@Article{ aashtiani.magnanti:equilibria, 24132 author = {H. Z. Aashtiani and T. L. Magnanti}, 24133 title = {Equilibria on a congested transportation network}, 24134 journal = {SIAM Journal on Algebraic and Discrete Methods}, 24135 volume = {2}, 24136 year = {1981}, 24137 pages = {213--226} 24138} 24139 24140@Article{ ablow.brigham:analog, 24141 author = {C. M. Ablow and G. Brigham}, 24142 title = {An Analog Solution of Programming Problems}, 24143 journal = {Operations Research}, 24144 year = {1955}, 24145 volume = {3}, 24146 pages = {388--394} 24147} 24148 24149@Article{ achuthan.grabowski.ea:optimal, 24150 author = {N. R. Achuthan and J. Grabowski and J. B. Sidney}, 24151 title = {Optimal Flow--Shop Scheduling with Earliness and Tardiness Penalties}, 24152 journal = {Opsearch}, 24153 year = {1981}, 24154 volume = {18}, 24155 pages = {117--138} 24156} 24157 24158@Book{ adelman.robinson:income, 24159 author = {I. Adelman and S. Robinson}, 24160 title = {Income Distribution Policy in Developing Countries}, 24161 publisher = {Stanford University Press}, 24162 year = {1978}, 24163 address = {Stanford, California} 24164} 24165 24166@Article{ adler.resende.ea:implementation, 24167 author = {I. Adler and M. G. C. Resende and G. Veiga and N. K. Karmarkar}, 24168 title = {An Implementation of {K}armarkar's Algorithm for Linear Programming}, 24169 journal = {Mathematical Programming}, 24170 year = {1989}, 24171 volume = {44}, 24172 pages = {297--336} 24173} 24174 24175@TechReport{ aeberhard.coomans.ea:comparison, 24176 author = {S. Aeberhard and D. Coomans and O. de Vel}, 24177 title = {Comparison of Classifiers in High Dimensional Settings}, 24178 institution = {Departments of Computer Science and of Mathematics and Statistics, James Cook 24179 University of North Queensland}, 24180 year = {1992}, 24181 number = {92-02}, 24182 type = {Technical Report} 24183} 24184 24185@Article{ aganagic.cottle:constructive, 24186 author = {M. Aganagi\'{c} and R. W. Cottle}, 24187 title = {A Constructive Characterization of ${Q}_0$ Matrices with Nonnegative Principal 24188 Minors}, 24189 journal = {Mathematical Programming}, 24190 year = {1987}, 24191 volume = {37}, 24192 pages = {223--231} 24193} 24194 24195@TechReport{ aganagic:iterative, 24196 author = {M. Aganagi\'{c}}, 24197 title = {Iterative Methods for the Linear Complementarity Problem}, 24198 institution = {Systems Optimization Laboratory, Department of Operations Research, Stanford 24199 University}, 24200 year = {1978}, 24201 type = {SOL}, 24202 number = {78-10}, 24203 address = {Stanford, California} 24204} 24205 24206@Book{ ahlfors:complex, 24207 author = {L. V. Ahlfors}, 24208 title = {Complex Analysis}, 24209 publisher = {McGraw--Hill Book Company}, 24210 address = {New York}, 24211 series = {International Series in Pure and Applied Mathematics}, 24212 edition = {Second}, 24213 year = {1966} 24214} 24215 24216@Article{ ahn:solution, 24217 author = {B--H. Ahn}, 24218 title = {Solution of Non--Symmetric Linear Complementarity Problems by Iterative Methods}, 24219 journal = {Journal of Optimization Theory and Applications}, 24220 year = {1981}, 24221 volume = {33}, 24222 pages = {175--185} 24223} 24224 24225@Article{ al-fahed.stavroulakis.ea:hard, 24226 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24227 title = {Hard and soft fingered robot grippers. The linear complementarity approach}, 24228 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 24229 volume = {71}, 24230 year = {1991}, 24231 pages = {257--265} 24232} 24233 24234@Article{ al-fahed.stavroulakis.ea:linear, 24235 author = {A. M. Al-Fahed and G. E. Stavroulakis and P. D. Panagiotopoulos}, 24236 title = {A linear complementarity approach to the frictionless gripper}, 24237 journal = {International Journal of Robotic Research}, 24238 volume = {11}, 24239 year = {1992}, 24240 pages = {112--122} 24241} 24242 24243@Article{ al-khayyal.falk:jointly, 24244 author = {F. A. Al--Khayyal and J. E. Falk}, 24245 title = {Jointly Constrained Biconvex Programming}, 24246 journal = {Mathematics of Operations Research}, 24247 year = {1983}, 24248 volume = {8}, 24249 pages = {273--286} 24250} 24251 24252@Article{ al-khayyal.kyparisis:finite, 24253 author = {F. A. Al--Khayyal and J. Kyparisis}, 24254 title = {Finite Convergence of Algorithms for Nonlinear Programs and Variational 24255 Inequalities}, 24256 journal = {Journal of Optimization Theory and Applications}, 24257 year = {1991}, 24258 volume = {70}, 24259 pages = {319--332} 24260} 24261 24262@PhDThesis{ al-khayyal:biconvex, 24263 author = {F. A. Al--Khayyal}, 24264 title = {Biconvex Programming and Biconcave Minimization}, 24265 year = {1977}, 24266 school = {The George Washington University} 24267} 24268 24269@Article{ alart.curnier:mixed, 24270 author = {P. Alart and A. Curnier}, 24271 title = {A mixed formulation for frictional contact problems prone to {N}ewton like 24272 solution methods}, 24273 journal = {Computer Methods in Applied Mechanics and Engineering}, 24274 volume = {92}, 24275 year = {1991}, 24276 pages = {353--375} 24277} 24278 24279@Misc{ alexander.kellog.ea:piecewise, 24280 author = {J.~C. Alexander and R.~B. Kellog and T.-Y. Li and J~.A. Yorke}, 24281 title = {Piecewise smooth continuation}, 24282 howpublished = {Manuscript}, 24283 year = {1979} 24284} 24285 24286@InCollection{ alexander.li.ea:piecewise, 24287 author = {J.~C. Alexander and T.-Y. Li and J~.A. Yorke}, 24288 title = {Piecewise smooth homotopies}, 24289 booktitle = {Homotopy Methods and Global Convergence}, 24290 pages = {1--14}, 24291 publisher = {Plenum Press}, 24292 year = {1983}, 24293 editor = {B.~C. Eaves and F.~J. Gould and H.-O. Peitgen and M.~J. Todd}, 24294 address = {New York} 24295} 24296 24297@InCollection{ alexander:topological, 24298 author = {J.~C. Alexander}, 24299 title = {The topological theory of an embedding method}, 24300 booktitle = {Continuation Methods}, 24301 pages = {37--68}, 24302 publisher = {Academic Press}, 24303 year = {1978}, 24304 editor = {H. Wacker}, 24305 address = {New York} 24306} 24307 24308@Book{ allen:probability, 24309 author = {A. O. Allen}, 24310 title = {Probability, Statistics and Queueing Theory}, 24311 publisher = {Academic Press}, 24312 year = {1990}, 24313 address = {London}, 24314 edition = {Second} 24315} 24316 24317@Book{ allgower.georg:numerical, 24318 author = {E. L. Allgower and K. Georg}, 24319 title = {Numerical Continuation Methods, An Introduction}, 24320 publisher = {Springer-Verlag}, 24321 year = {1990}, 24322 address = {Berlin} 24323} 24324 24325@InProceedings{ allgower.georg:predictor-corrector, 24326 crossref = {bachem.grotschel.ea:mathematical}, 24327 author = {E. L. Allgower and K. Georg}, 24328 title = {Predictor--Corrector and Simplicial Methods for Approximating Fixed Points and 24329 Zero Points of Nonlinear Mappings}, 24330 pages = {15--56} 24331} 24332 24333@Article{ aluffi-pentini.parisi.ea:algorithm, 24334 author = {F. Aluffi-Pentini and V. Parisi and F. Zirilli}, 24335 title = {Algorithm 667: {SIGMA}- {A} Stochastic-Integration Global Minimization 24336 Algorithm}, 24337 journal = {ACM Transactions on Mathematical Software}, 24338 year = {1988}, 24339 volume = {14}, 24340 pages = {366--380} 24341} 24342 24343@Article{ anandalingam.friesz:hierarchical, 24344 author = {G. Anandalingam and T. L. Friesz}, 24345 title = {Hierarchical Optimization: An Introduction}, 24346 journal = {Annals of Operations Research}, 24347 year = {1992}, 24348 volume = {34}, 24349 pages = {1--11} 24350} 24351 24352@Article{ anandalingam.white:solution, 24353 author = {G. Anandalingam and D. J. White}, 24354 title = {A Solution Method for the Linear Static Stackelberg Problem Using Penalty 24355 Functions}, 24356 journal = {IEEE Transactions on Automatic Control}, 24357 year = {1990}, 24358 volume = {35}, 24359 number = {10}, 24360 pages = {1170--1173} 24361} 24362 24363@Article{ andersen.andersen:presolving, 24364 author = {E. Andersen and K. Andersen}, 24365 title = {Presolving in Linear Programming}, 24366 year = {1995}, 24367 journal = {Mathematical Programming}, 24368 volume = {71}, 24369 pages = {221--245} 24370} 24371 24372@InProceedings{ andersen.ye:homogeneous, 24373 author = {E. Andersen and Y. Ye}, 24374 title = {On a Homogeneous Algorithm for a Monotone Complementarity Problem with Nonlinear 24375 Equality Constraints}, 24376 crossref = {ferris.pang:complementarity}, 24377 pages = {1--11} 24378} 24379 24380@Book{ anderson.bai.ea:lapack, 24381 author = {E. Anderson and Z. Bai and C. Bischof and J. Demmel and J. Dongarra and J. Du 24382 Cros and A. Greenbaum and S. Hammarling and A. McKenney and S. Ostrouchov and D. 24383 Sorensen}, 24384 title = {{LAPACK} User's Guide}, 24385 publisher = {SIAM}, 24386 year = {1995}, 24387 address = {Philadelphia, Pennsylvania}, 24388 edition = {Second} 24389} 24390 24391@Article{ anderson.ferris:direct, 24392 author = {E. J. Anderson and M. C. Ferris}, 24393 title = {A Direct Search Algorithm for Optimization with Noisy Function Evaluations}, 24394 year = {2001}, 24395 journal = {SIAM Journal on Optimization, forthcoming}, 24396 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-11.ps}, 24397 key = {55} 24398} 24399 24400@InProceedings{ anderson.ferris:genetic, 24401 author = {E. J. Anderson and M. C. Ferris}, 24402 title = {A Genetic Algorithm for the Assembly Line Balancing Problem}, 24403 booktitle = {Proceedings of the Integer Programming / Combinatorial Optimization Conference, 24404 Waterloo, Ontario, Canada, May 28--30}, 24405 publisher = {University of Waterloo Press}, 24406 key = {14}, 24407 year = {1990} 24408} 24409 24410@Article{ anderson.ferris:genetic*1, 24411 author = {E. J. Anderson and M. C. Ferris}, 24412 title = {Genetic Algorithms for Combinatorial Optimization: The Assembly Line Balancing 24413 Problem}, 24414 journal = {ORSA Journal on Computing}, 24415 year = {1994}, 24416 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/93-ga.ps}, 24417 volume = {6}, 24418 pages = {161--173}, 24419 key = {22} 24420} 24421 24422@InProceedings{ anderson.ferris:parallel, 24423 author = {E. J. Anderson and M. C. Ferris}, 24424 title = {Parallel Genetic Algorithms in Optimization}, 24425 booktitle = {Proceedings of the Fourth SIAM conference on Parallel Processing for Scientific 24426 Computing, Chicago, Illinois, December 11-13}, 24427 year = {1989}, 24428 key = {12} 24429} 24430 24431@Unpublished{ anderson.lewis:primal, 24432 author = {E. J. Anderson and A. S. Lewis}, 24433 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24434 note = {In preparation} 24435} 24436 24437@Book{ anderson.nash:linear, 24438 author = {E. J. Anderson and P. Nash}, 24439 title = {Linear Programming in Infinite--Dimensional Spaces}, 24440 year = {1987}, 24441 publisher = {John Wiley \& Sons}, 24442 address = {Chichester} 24443} 24444 24445@InProceedings{ anderson:primal, 24446 author = {E. J. Anderson}, 24447 title = {A New Primal Algorithm for Semi-Infinite Linear Programming}, 24448 booktitle = {Proceedings of an International Symposium on Infinite Dimensional Linear 24449 Programming, Cambridge, September 1984}, 24450 year = {1985}, 24451 editor = {E. J. Anderson and A. B. Philpott}, 24452 publisher = {Springer-Verlag}, 24453 address = {Berlin} 24454} 24455 24456@Article{ andradottir:method, 24457 author = {S. Andrad\'{o}ttir}, 24458 title = {A Method of Discrete Stochastic Optimization}, 24459 journal = {Management Science}, 24460 year = {1995}, 24461 volume = {41}, 24462 pages = {1946--1961} 24463} 24464 24465@Article{ andradottir:global, 24466 author = {S. Andrad\'{o}ttir}, 24467 title = {A Global Search Method for Discrete Stochastic Optimization}, 24468 journal = {SIAM Journal on Optimization}, 24469 year = {1996}, 24470 volume = {6}, 24471 pages = {513--530} 24472} 24473 24474@TechReport{ anitescu.lesaja.ea:infeasible-interior-point, 24475 author = {M. Anitescu and G. Lesaja and F. A. Potra}, 24476 title = {An infeasible--interior--point predictor--corrector algorithm for the 24477 {P}$_x$--geometric {LCP}}, 24478 institution = {Department of Mathematics, The University of Iowa}, 24479 address = {Iowa City, Iowa}, 24480 year = {1994}, 24481 number = {62}, 24482 type = {Reports on Computational Mathematics} 24483} 24484 24485@TechReport{ anitescu.potra:formulating, 24486 author = {M. Anitescu and F. A. Potra}, 24487 title = {Formulating Dynamic Multi-Rigid-Body Contact Problems with Friction as Solvable 24488 Linear Complementarity Problems}, 24489 institution = {Department of Mathematics, The University of Iowa}, 24490 year = {1996}, 24491 type = {Report}, 24492 number = {93}, 24493 address = {Iowa City, Iowa} 24494} 24495 24496@Article{ anstreicher.lee.ea:crashing, 24497 author = {K. M. Anstreicher and J. Lee and T. F. Rutherford}, 24498 title = {Crashing a Maximum-Weight Complementarity Basis}, 24499 journal = {Mathematical Programming}, 24500 year = {1992}, 24501 volume = {54}, 24502 pages = {281--294} 24503} 24504 24505@Article{ anstreicher:combined, 24506 author = {K. M. Anstreicher}, 24507 title = {A combined phase {I}--phase {II} scaled potential algorithm for linear 24508 programming}, 24509 journal = {Mathematical Programming}, 24510 year = {1991}, 24511 volume = {52}, 24512 pages = {429--440} 24513} 24514 24515@Article{ anstreicher:combined*1, 24516 author = {K. M. Anstreicher}, 24517 title = {A combined phase {I}--phase {II} projective algorithm for linear programming}, 24518 journal = {Mathematical Programming}, 24519 year = {1989}, 24520 volume = {43}, 24521 pages = {209--223} 24522} 24523 24524@InCollection{ arbenz.gander.ea:remote, 24525 author = {P. Arbenz and W. Gander and M. Oettli}, 24526 title = {The Remote Computational System}, 24527 booktitle = {High-Performance Computation and Networks}, 24528 publisher = {Springer-Verlag}, 24529 year = {1996}, 24530 volume = {1067}, 24531 series = {Lecture Notes in Computer Science}, 24532 pages = {662--667} 24533} 24534 24535@InCollection{ arcus:comsoal, 24536 author = {A. L. Arcus}, 24537 title = {{COMSOAL}: {A} Computer Method of Sequencing Operations for Assembly Lines}, 24538 booktitle = {Readings in Production and Operations Management}, 24539 year = {1966}, 24540 editor = {E. S. Buffa}, 24541 publisher = {John Wiley \& Sons}, 24542 address = {New York} 24543} 24544 24545@TechReport{ arioli.chan.ea:computing, 24546 author = {M. Arioli and T. F. Chan and I. S. Duff and N. I. M. Gould and J. K. Reid}, 24547 title = {Computing a Search Direction for Large-Scale Linearly-Constrained Nonlinear 24548 Optimization Calculations}, 24549 institution = {CERFACS}, 24550 year = {1993}, 24551 number = {TR/PA/93/34} 24552} 24553 24554@Article{ armijo:minimization, 24555 author = {L. Armijo}, 24556 title = {Minimization of Functions having {L}ipschitz-continuous First Partial 24557 Derivatives}, 24558 journal = {Pacific Journal of Mathematics}, 24559 year = {1966}, 24560 volume = {16}, 24561 pages = {1--3} 24562} 24563 24564@Article{ arrow.debreu:existence, 24565 author = {K. Arrow and G. Debreu}, 24566 title = {Existence of Equilibrium for a Competitive Economy}, 24567 journal = {Econometrica}, 24568 year = {1954}, 24569 volume = {22}, 24570 pages = {265--290} 24571} 24572 24573@InCollection{ arrow.solow:gradient, 24574 author = {K. J. Arrow and R. M. Solow}, 24575 title = {Gradient Methods for Constrained Maxima with Weakened Assumptions}, 24576 booktitle = {Studies in Linear and Nonlinear Programming}, 24577 year = {1958}, 24578 editor = {K. J. Arrow and L. Hurwicz and H. Uzawa}, 24579 publisher = {Stanford University Press}, 24580 address = {Stanford, California}, 24581 pages = {166--176} 24582} 24583 24584@Book{ aubin.ekeland:nonlinear, 24585 author = {J.-P. Aubin and I. Ekeland}, 24586 title = {Applied nonlinear analysis}, 24587 publisher = {John Wiley \& Sons}, 24588 address = {New York}, 24589 year = {1984} 24590} 24591 24592@Article{ auchmuty:variational, 24593 author = {G. Auchmuty}, 24594 title = {Variational Principles for Variational Inequalities}, 24595 journal = {Numerical Functional Analysis and Optimization}, 24596 year = {1989}, 24597 volume = {10}, 24598 pages = {863--874} 24599} 24600 24601@Book{ auerbach.kotlikoff:dynamic, 24602 author = {A. J. Auerbach and L. J. Kotlikoff}, 24603 title = {Dynamic Fiscal Policy}, 24604 publisher = {Cambridge University Press}, 24605 address = {Cambridge, England}, 24606 year = {1987} 24607} 24608 24609@InProceedings{ ault.deutsch.ea:interpolating, 24610 author = {D. A. Ault and F. R. Deutsch and P. D. Morris and J. E. Olson}, 24611 title = {Interpolating Subspaces in Approximation Theory}, 24612 booktitle = {Approximation Theory}, 24613 year = {1970}, 24614 editor = {A. Talbot}, 24615 publisher = {Academic Press}, 24616 address = {London} 24617} 24618 24619@Article{ auslender.crouzeix:global, 24620 author = {A. A. Auslender and J.--P. Crouzeix}, 24621 title = {Global Regularity Theorems}, 24622 journal = {Mathematics of Operations Research}, 24623 year = {1988}, 24624 volume = {13}, 24625 pages = {243--253} 24626} 24627 24628@Article{ auslender.haddou:interior-proximal, 24629 author = {A. Auslender and M. Haddou}, 24630 title = {An interior-proximal method for convex linearly constrained problems and its 24631 extension to variational inequalities}, 24632 year = {1995}, 24633 journal = {Mathematical Programming}, 24634 pages = {77--100}, 24635 volume = {71} 24636} 24637 24638@Article{ auslender:convergence, 24639 author = {A. Auslender}, 24640 title = {Convergence of stationary sequences for variational inequalities with maximal 24641 monotone operators}, 24642 journal = {Applied Mathematics and Optimization}, 24643 volume = {28}, 24644 year = {1993}, 24645 pages = {161--172} 24646} 24647 24648@Book{ auslender:optimization, 24649 author = {A. Auslender}, 24650 title = {Optimization {M}\'{e}thodes Num\'{e}riques}, 24651 year = {1976}, 24652 publisher = {Masson}, 24653 address = {Paris} 24654} 24655 24656@TechReport{ averick.carter.ea:minpack-2, 24657 author = {B. M. Averick and R. G. Carter and J. J. Mor\'e and G. -L. Xue}, 24658 title = {The {MINPACK-2} Test Problem Collection}, 24659 institution = {Argonne National Laboratory}, 24660 year = {1992}, 24661 address = {Argonne, Illinois}, 24662 number = {MCS-P153-0692} 24663} 24664 24665@TechReport{ axline.billups.ea:guidelines, 24666 author = {R. A. Axline and S. C. Billups and M. F. Grady}, 24667 title = {Guidelines for Software Security ({U})}, 24668 institution = {SNL}, 24669 year = {1989}, 24670 month = oct, 24671 address = {Albuquerque, New Mexico}, 24672 number = {SAND88-2955} 24673} 24674 24675@Article{ ayres.walter:greenhouse, 24676 author = {R. U. Ayres and J. Walter}, 24677 title = {The Greenhouse Effect: Damages, Costs and Abatement}, 24678 journal = {Environmental and Resource Economics}, 24679 year = {1991}, 24680 volume = {1}, 24681 pages = {237--270} 24682} 24683 24684@PhDThesis{ bagley:behaviour, 24685 author = {J. D. Bagley}, 24686 title = {The Behaviour of Adaptive Systems which employ Genetic and Correlation 24687 Algorithms}, 24688 year = {1967}, 24689 school = {University of Michigan} 24690} 24691 24692@Article{ bain.stewart:application, 24693 author = {R. S. Bain and W. E. Stewart}, 24694 title = {Application of Robust Nonmonotonic Descent Criteria to the Solution of Nonlinear 24695 Algebraic Equation Systems}, 24696 journal = {Computers in Chemical Engineering}, 24697 year = {1991}, 24698 volume = {15}, 24699 pages = {203--208} 24700} 24701 24702@Article{ baker.lasdon:successive, 24703 author = {T. E. Baker and L. S. Lasdon}, 24704 title = {Successive Linear Programming at {E}xxon}, 24705 journal = {Management Science}, 24706 year = {1985}, 24707 volume = {31}, 24708 pages = {264--274} 24709} 24710 24711@InProceedings{ baker:reducing, 24712 crossref = {grefenstette:genetic}, 24713 author = {J. E. Baker}, 24714 title = {Reducing Bias and Inefficiency in the Selection Algorithm}, 24715 pages = {14--21} 24716} 24717 24718@Article{ balas.zemel:algorithm, 24719 author = {E. Balas and E. Zemel}, 24720 title = {An Algorithm for Large Zero--One Knapsack Problems}, 24721 journal = {Operations Research}, 24722 year = {1980}, 24723 volume = {28}, 24724 pages = {1132--1154} 24725} 24726 24727@Book{ ballard.fullerton.ea:general, 24728 author = {C. Ballard and D. Fullerton and J. B. Shoven and J. Whalley}, 24729 title = {A General Equilibrium Model for Tax Policy Evaluation}, 24730 publisher = {The University of Chicago Press}, 24731 year = {1985}, 24732 series = {National Bureau of Economic Research Monograph} 24733} 24734 24735@InProceedings{ balog.angelos.ea:dose, 24736 author = {J. Balog and L. Angelos and T. R. Mackie and P. Reckwerdt}, 24737 title = {Dose Computation for a One-Dimensional Multileaf Collimator}, 24738 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 24739 Radiation Therapy, Salt Lake City}, 24740 year = {1997}, 24741 editor = {D. D. Leavitt and G. Starkshall}, 24742 publisher = {Medical Physics Publishing}, 24743 address = {St. Louis, Missouri}, 24744 pages = {323--326} 24745} 24746 24747@Article{ baraff:fast, 24748 author = {D. Baraff}, 24749 title = {Fast contact force computation for nonpenetrating rigid bodies}, 24750 journal = {Computer Graphics (Proceedings SIGRAPH)}, 24751 year = {1994}, 24752 pages = {23--34}, 24753 volume = {28} 24754} 24755 24756@Article{ baraff:issues, 24757 author = {D. Baraff}, 24758 title = {Issues in computing contact forces for nonpenetrating rigid bodies}, 24759 journal = {Algorithmica}, 24760 volume = {10}, 24761 year = {1993}, 24762 pages = {292--352} 24763} 24764 24765@Book{ barrett.berry.ea:templates, 24766 title = {Templates for the Solution of Linear Systems: Building Blocks for Iterative 24767 Methods}, 24768 author = {R. Barrett and M. Berry and T. F. Chan and J. Demmel and J. Donato and J. 24769 Dongarra and V. Eijkhout and R. Pozo and C. Romine and H. van der Vorst}, 24770 year = {1994}, 24771 publisher = {SIAM}, 24772 address = {Philadelphia, Pennsylvania} 24773} 24774 24775@Article{ bard:algorithm, 24776 author = {J. F. Bard}, 24777 title = {An Algorithm for Solving the General Bi--Level Programming Problem}, 24778 journal = {Mathematics of Operations Research}, 24779 year = {1983}, 24780 volume = {8}, 24781 pages = {260--272} 24782} 24783 24784@Article{ bard:convex, 24785 author = {J. F. Bard}, 24786 title = {Convex Two-Level Optimization}, 24787 journal = {Mathematical Programming}, 24788 year = {1988}, 24789 volume = {40}, 24790 pages = {15--27} 24791} 24792 24793@InCollection{ bard:eclectic, 24794 author = {Y. Bard}, 24795 title = {An Eclectic Approach to Nonlinear Programming}, 24796 booktitle = {Optimization}, 24797 publisher = {University of Queensland Press}, 24798 editor = {R. S. Anderson and L. S. Jennings and D. M. Ryan}, 24799 year = {1972}, 24800 address = {St. Lucia, Queensland, Australia}, 24801 pages = {116--128} 24802} 24803 24804@Article{ barnes:variation, 24805 author = {E. R. Barnes}, 24806 title = {A Variation on {K}armarkar's Algorithm for Solving Linear Programming Problems}, 24807 journal = {Mathematical Programming}, 24808 year = {1986}, 24809 volume = {36}, 24810 pages = {174--182} 24811} 24812 24813@Article{ bartels.golub:simplex, 24814 author = {R. H. Bartels and G. H. Golub}, 24815 title = {The Simplex Method of Linear Programming using {LU} Decomposition}, 24816 journal = {Communications of the Asociation for Computing Machinery}, 24817 year = {1969}, 24818 volume = {12}, 24819 pages = {266--268} 24820} 24821 24822@Article{ barton.ivey:nelder, 24823 author = {R. Barton and J. S. Ivey}, 24824 title = {{N}elder {M}ead Simplex Modifications for Simulation Optimization}, 24825 journal = {Management Science}, 24826 year = {1996}, 24827 volume = {42}, 24828 number = {7}, 24829 pages = {954--973} 24830} 24831 24832@Article{ battiti:first-, 24833 author = {R. Battiti}, 24834 title = {First- and Second-Order Methods for Learning: Between Steepest Descent and 24835 {N}ewton's Method}, 24836 journal = {Neural Computation}, 24837 year = {1992}, 24838 volume = {4}, 24839 pages = {141--166} 24840} 24841 24842@Article{ baudet:asynchronous, 24843 author = {G. M. Baudet}, 24844 title = {Asynchronous iterative methods for multiprocesors}, 24845 journal = {Journal of the Association for Computing Machinery}, 24846 year = {1978}, 24847 volume = {25}, 24848 pages = {226--244} 24849} 24850 24851@InProceedings{ baum.haussler:what, 24852 author = {E. B. Baum and D. Haussler}, 24853 title = {What Size Net Gives Valid Generalization}, 24854 booktitle = {Advances in Neural Information Processing Systems I}, 24855 year = {1989}, 24856 editor = {D. S. Touretzky}, 24857 publisher = {Morgan Kaufmann}, 24858 address = {San Mateo, California}, 24859 pages = {81--90} 24860} 24861 24862@Misc{ baum:private, 24863 author = {E. B. Baum}, 24864 title = {Private Communication}, 24865 year = {1992}, 24866 address = {NEC Research Institute, Princeton, New Jersey} 24867} 24868 24869@Book{ bazaraa.sherali.ea:nonlinear, 24870 author = {M. S. Bazaraa and H. D. Sherali and C. M. Shetty}, 24871 title = {Nonlinear Programming}, 24872 edition = {Second}, 24873 publisher = {John Wiley and Sons}, 24874 address = {New York}, 24875 year = {1993} 24876} 24877 24878@Book{ bazaraa.shetty:nonlinear, 24879 author = {M. S. Bazaraa and C. M. Shetty}, 24880 title = {Nonlinear Programming: Theory and Algorithms}, 24881 publisher = {John Wiley \& Sons}, 24882 year = {1979}, 24883 address = {New York, New York} 24884} 24885 24886@Article{ beale:cycling, 24887 author = {E. M. L. Beale}, 24888 title = {Cycling in the Dual Simplex Method}, 24889 journal = {Naval Research Logistics Quarterly}, 24890 year = {1955}, 24891 volume = {2}, 24892 pages = {103--107} 24893} 24894 24895@InProceedings{ becker.cun:improving, 24896 author = {S. Becker and Y. le Cun}, 24897 title = {Improving the Convergence of Backpropagation Learning with Second Order Methods}, 24898 booktitle = {Proceedings of 1988 Connectionist Models Summer School}, 24899 year = {1988}, 24900 editor = {D. S. Touretzky}, 24901 publisher = {Morgan Kaufmann}, 24902 address = {San Mateo, California}, 24903 pages = {29--37} 24904} 24905 24906@Book{ ben-israel.ben-tal.ea:optimality, 24907 author = {A. Ben--Israel and A. Ben--Tal and S. Zlobec}, 24908 title = {Optimality in Nonlinear Programming: {A} Feasible Directions Approach}, 24909 year = {1981}, 24910 publisher = {John Wiley \& Sons}, 24911 address = {New York} 24912} 24913 24914@Article{ ben-israel:newton-raphson, 24915 author = {A. Ben--Israel}, 24916 title = {A {N}ewton--{R}aphson Method for the Solution of Systems of Equations}, 24917 journal = {Journal of Mathematical Analysis and its Applications}, 24918 year = {1966}, 24919 volume = {15}, 24920 pages = {243--252} 24921} 24922 24923@Article{ ben-tal.melman.ea:curved, 24924 author = {A. Ben--Tal and A. Melman and J. Zowe}, 24925 title = {Curved Search Methods for Unconstrained Optimization}, 24926 journal = {Optimization}, 24927 year = {1990}, 24928 volume = {21}, 24929 pages = {669--695}, 24930 publisher = {John Wiley \& Sons}, 24931 address = {New York} 24932} 24933 24934@InProceedings{ bennett.ferris.ea:genetic, 24935 crossref = {belew.booker:fourth}, 24936 author = {K. Bennett and M. C. Ferris and Y. E. Ioannidis}, 24937 title = {A Genetic Algorithm for Database Query Optimization}, 24938 pages = {400--407}, 24939 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1004.ps}, 24940 key = {19} 24941} 24942 24943@Article{ bennett.mangasarian:bilinear, 24944 author = {K. P. Bennett and O. L. Mangasarian}, 24945 title = {Bilinear Separation of Two Sets in n-Space}, 24946 journal = {Computational Optimization and Applications}, 24947 year = {1993}, 24948 volume = {2}, 24949 pages = {207--227} 24950} 24951 24952@Article{ bennett.mangasarian:multicategory, 24953 author = {K. P. Bennett and O. L. Mangasarian}, 24954 title = {Multicategory Separation via Linear Programming}, 24955 journal = {Optimization Methods and Software}, 24956 year = {1993}, 24957 volume = {3}, 24958 pages = {27--39} 24959} 24960 24961@InProceedings{ bennett.mangasarian:neural, 24962 author = {K. P. Bennett and O. L. Mangasarian}, 24963 title = {Neural Network Training via Linear Programming}, 24964 booktitle = {Advances in Optimization and Parallel Computing}, 24965 year = {1992}, 24966 editor = {P. M. Pardalos}, 24967 publisher = {North Holland}, 24968 address = {Amsterdam}, 24969 pages = {56--67} 24970} 24971 24972@Article{ bennett.mangasarian:robust, 24973 author = {K. P. Bennett and O. L. Mangasarian}, 24974 title = {Robust Linear Programming Discrimination of Two Linearly Inseparable Sets}, 24975 journal = {Optimization Methods and Software}, 24976 year = {1992}, 24977 volume = {1}, 24978 pages = {23--34} 24979} 24980 24981@Article{ bennett.mangasarian:serial, 24982 author = {K. P. Bennett and O. L. Mangasarian}, 24983 title = {Serial and Parallel Multicategory Separation}, 24984 journal = {SIAM Journal on Optimization}, 24985 year = {1994}, 24986 volume = {4}, 24987 pages = {722--734} 24988} 24989 24990@TechReport{ bennett.wu.ea:support, 24991 author = {K. P. Bennett and D. Wu and L. Auslender}, 24992 title = {On Support Vector Decision Trees for Database Marketing}, 24993 institution = {Department of Mathematical Sciences, Rensselaer Polytechnic Institute}, 24994 year = {1998}, 24995 optkey = {}, 24996 opttype = {RPI Math Report}, 24997 optnumber = {98-100}, 24998 optaddress = {Troy, New York}, 24999 optmonth = {}, 25000 optnote = {}, 25001 optannote = {} 25002} 25003 25004@InProceedings{ bennett:decision, 25005 author = {K. P. Bennett}, 25006 title = {Decision Tree Construction Via Linear Programming}, 25007 booktitle = {Proceedings of the 4th Midwest Artificial Intelligence and Cognitive Science 25008 Society Conference}, 25009 year = {1992}, 25010 editor = {M. Evans}, 25011 address = {Utica, Illinois}, 25012 pages = {97--101} 25013} 25014 25015@Book{ berge.ghouila-houri:programming, 25016 author = {C. Berge and A. Ghouila-Houri}, 25017 title = {Programming, Games and Transportation Networks}, 25018 year = {1965}, 25019 publisher = {John Wiley \& Sons}, 25020 address = {New York} 25021} 25022 25023@Book{ berge:topological, 25024 author = {C. Berge}, 25025 title = {Topological Spaces}, 25026 year = {1963}, 25027 publisher = {McMillan}, 25028 address = {New York} 25029} 25030 25031@TechReport{ berkelaar.jansen.ea:basis, 25032 author = {A. B. Berkelaar and B. Jansen and C. Roos and T. Terlaky}, 25033 title = {Basis and Tripartition Identification for Quadratic Programming and Linear 25034 Complementarity Problems}, 25035 institution = {Department of Econometrics and Operations Research}, 25036 year = {1996}, 25037 address = {Erasmus University, Rotterdam, The Netherlands} 25038} 25039 25040@Article{ bertsekas.baz:distributed, 25041 author = {D. P. Bertsekas and D. El Baz}, 25042 title = {Distributed Asynchronous Relaxation Methods for the Convex Network Flow Problem}, 25043 journal = {SIAM Journal on Control and Optimization}, 25044 year = {1987}, 25045 volume = {25}, 25046 pages = {74--85} 25047} 25048 25049@Article{ bertsekas.gafni:projection, 25050 author = {D. P. Bertsekas and E. M. Gafni}, 25051 title = {Projection Methods for Variational Inequalities with Application to the Traffic 25052 Assignment Problem}, 25053 journal = {Mathematical Programming Study}, 25054 year = {1982}, 25055 volume = {17}, 25056 pages = {139--159} 25057} 25058 25059@Article{ bertsekas.hossein.ea:relaxation, 25060 author = {D. P. Bertsekas and P. Hossein and P. Tseng}, 25061 title = {Relaxation Methods for Network Flow Problems with Convex Arc Costs}, 25062 journal = {SIAM Journal on Control and Optimization}, 25063 year = {1987}, 25064 volume = {25}, 25065 pages = {1219--1243} 25066} 25067 25068@Unpublished{ bertsekas.tseng:partial, 25069 author = {D. P. Bertsekas and P. Tseng}, 25070 title = {Partial Proximal Minimization for Convex Programming}, 25071 year = {1991}, 25072 note = {Manuscript} 25073} 25074 25075@Article{ bertsekas.tsitsiklis:analysis, 25076 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25077 title = {An Analysis of Stochastic Shortest Path Problems}, 25078 journal = {Mathematics of Operations Research}, 25079 year = {1991}, 25080 volume = {16}, 25081 pages = {580--595} 25082} 25083 25084@Book{ bertsekas.tsitsiklis:parallel, 25085 author = {D. P. Bertsekas and J. N. Tsitsiklis}, 25086 title = {Parallel and Distributed Computation: Numerical Methods}, 25087 publisher = {Prentice-Hall, Inc}, 25088 year = {1989}, 25089 address = {Englewood Cliffs, New Jersey} 25090} 25091 25092@Book{ bertsekas:constrained, 25093 author = {D. P. Bertsekas}, 25094 title = {Constrained Optimization and Lagrange Multiplier Methods}, 25095 year = {1982}, 25096 publisher = {Academic Press}, 25097 address = {New York} 25098} 25099 25100@Book{ bertsekas:dynamic, 25101 author = {D. P. Bertsekas}, 25102 title = {Dynamic Programming and Optimal Control}, 25103 publisher = {Athena Scientific}, 25104 year = {1995}, 25105 address = {Belmont MA} 25106} 25107 25108@Article{ bertsekas:enlarging, 25109 author = {D. P. Bertsekas}, 25110 title = {Enlarging the Region of Convergence of {N}ewton's Method for Constrained 25111 Optimization}, 25112 journal = {Journal of Optimization Theory and Applications}, 25113 year = {1982}, 25114 volume = {36}, 25115 pages = {221--252} 25116} 25117 25118@Article{ bertsekas:goldstein-levitin-poljak, 25119 author = {D. P. Bertsekas}, 25120 title = {On the {G}oldstein-{L}evitin-{P}oljak Gradient Projection Algorithm}, 25121 journal = {IEEE Transactions on Automatic Control}, 25122 year = {1976}, 25123 volume = {AC-21}, 25124 pages = {174--184} 25125} 25126 25127@Article{ bertsekas:multiplier, 25128 author = {D. P. Bertsekas}, 25129 title = {Multiplier Methods: {A} Survey}, 25130 journal = {Automatica}, 25131 year = {1976}, 25132 volume = {12}, 25133 pages = {133--145} 25134} 25135 25136@Article{ bertsekas:necessary, 25137 author = {D. P. Bertsekas}, 25138 title = {Necessary and Sufficient Conditions for a Penalty Method to be Exact}, 25139 journal = {Mathematical Programming}, 25140 year = {1975}, 25141 volume = {9}, 25142 pages = {87--99} 25143} 25144 25145@Book{ bertsekas:nonlinear, 25146 author = {D. P. Bertsekas}, 25147 title = {Nonlinear Programming}, 25148 publisher = {Athena Scientific}, 25149 year = {1995}, 25150 address = {Belmont, Massachusetts} 25151} 25152 25153@Article{ bertsekas:projected, 25154 author = {Dimitri P. Bertsekas}, 25155 title = {Projected {N}ewton Methods for Optimization Problems with Simple Constraints}, 25156 journal = {SIAM Journal on Control and Optimization}, 25157 year = {1982}, 25158 volume = {20}, 25159 pages = {221--246} 25160} 25161 25162@Article{ billups.dirkse.ea:comparison, 25163 author = {S. C. Billups and S. P. Dirkse and M. C. Ferris}, 25164 title = {A Comparison of Large Scale Mixed Complementarity Problem Solvers}, 25165 journal = {Computational Optimization and Applications}, 25166 year = {1997}, 25167 pages = {3--25}, 25168 volume = {7}, 25169 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-16.ps}, 25170 key = {51} 25171} 25172 25173@Article{ billups.ferris:convergence, 25174 author = {S. C. Billups and M. C. Ferris}, 25175 title = {Convergence of an Infeasible Interior--Point Algorithm from Arbitrary Positive 25176 Starting Points}, 25177 journal = {SIAM Journal on Optimization}, 25178 year = {1996}, 25179 volume = {6}, 25180 pages = {316--325}, 25181 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1180.ps}, 25182 key = {34} 25183} 25184 25185@TechReport{ billups.ferris:convergence*1, 25186 author = {S. C. Billups and M. C. Ferris}, 25187 title = {Convergence of Infeasible Interior--Point Algorithms from Arbitrary Starting 25188 Points}, 25189 institution = {Computer Sciences Department, University of Wisconsin}, 25190 year = {1993}, 25191 address = {Madison, Wisconsin}, 25192 number = {1180}, 25193 note = {Revised version in SIAM Journal on Optimization.} 25194} 25195 25196@Article{ billups.ferris:qpcomp, 25197 author = {S. C. Billups and M. C. Ferris}, 25198 title = {{QPCOMP}: {A} Quadratic Program Based Solver for Mixed Complementarity Problems}, 25199 year = {1997}, 25200 journal = {Mathematical Programming}, 25201 pages = {533--562}, 25202 volume = {76}, 25203 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-09.ps}, 25204 key = {47} 25205} 25206 25207@Article{ billups.ferris:solutions, 25208 author = {S. C. Billups and M. C. Ferris}, 25209 title = {Solutions to Affine Generalized Equations Using Proximal Mappings}, 25210 journal = {Mathematics of Operations Research}, 25211 volume = {24}, 25212 pages = {219--236}, 25213 year = {1999}, 25214 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-15.ps}, 25215 key = {42}, 25216 institution = {Computer Sciences Department, University of Wisconsin}, 25217 address = {Madison, Wisconsin}, 25218 type = {Mathematical Programming Technical Report}, 25219 number = {94--15} 25220} 25221 25222@TechReport{ billups.murata.ea:users, 25223 author = {S. C. Billups and K. K. Murata and K. E. Washington and D. L. Y. Louie}, 25224 title = {User's manual for {CONTAIN--HWR/0}, Rev. 1: {A} Computer Code for the Analysis of 25225 Heavy Water Nuclear Reactor Containments Under Accident Conditions}, 25226 institution = {SNL}, 25227 year = {1994}, 25228 month = jan, 25229 address = {Albuquerque, New Mexico}, 25230 number = {SAND91--1482} 25231} 25232 25233@TechReport{ billups.speight.ea:nonmonotone, 25234 author = {S. C. Billups and A. L. Speight and L. T. Watson}, 25235 title = {Nonmonotone Path Following Methods for Nonsmooth Equations and Complementarity 25236 Problems}, 25237 institution = {Department of Mathematics, University of Colorado}, 25238 year = {1999}, 25239 address = {Denver, Colorado} 25240} 25241 25242@PhDThesis{ billups:algorithms, 25243 author = {S. C. Billups}, 25244 title = {Algorithms for Complementarity Problems and Generalized Equations}, 25245 school = {University of Wisconsin--Madison}, 25246 year = {1995}, 25247 address = {Madison, Wisconsin}, 25248 month = aug 25249} 25250 25251@MastersThesis{ billups:augmented, 25252 author = {S. C. Billups}, 25253 title = {An Augmented Jacobian Matrix Algorithm for Tracking Homotopy Zero Curves}, 25254 school = {Virginia Tech}, 25255 year = {1985}, 25256 address = {Blacksburg, Virginia} 25257} 25258 25259@TechReport{ billups:homotopy, 25260 author = {S. C. Billups}, 25261 title = {A Homotopy Based Algorithm for Mixed Complementarity Problems}, 25262 institution = {Department of Mathematics, University of Colorado}, 25263 year = {1998}, 25264 address = {Denver, Colorado} 25265} 25266 25267@Article{ billups:improving, 25268 author = {S. C. Billups}, 25269 title = {Improving the Robustness of Descent-Based Methods for Semi-Smooth Equations Using 25270 Proximal Perturbations}, 25271 year = {2000}, 25272 journal = {Mathematical Programming}, 25273 volume = {87}, 25274 pages = {153--176} 25275} 25276 25277@Book{ birge.louveaux:introduction, 25278 author = {J. R. Birge and R. Louveaux}, 25279 title = {Introduction to Stochastic Programming}, 25280 publisher = {Springer}, 25281 address = {New York}, 25282 year = {1997} 25283} 25284 25285@TechReport{ bischof.carle.ea:adifor, 25286 author = {C. Bischof and A. Carle and P. Khademi and A. Mauer and P. Hovland}, 25287 title = {{ADIFOR} 2.0 User's Guide}, 25288 institution = {Argonne National Laboratory}, 25289 year = {1995}, 25290 address = {Argonne, Illinois}, 25291 number = {ANL/MCS--TM--192}, 25292 type = {Mathematics and Computer Science Division Report} 25293} 25294 25295@Book{ bisschop.entriken:aimms, 25296 author = {J. Bisschop and R. Entriken}, 25297 title = {{AIMMS} -- The Modeling System}, 25298 year = {1993}, 25299 publisher = {Paragon Decision Technology}, 25300 address = {Haarlem, The Netherlands} 25301} 25302 25303@Article{ bisschop.meeraus:development, 25304 author = {J. Bisschop and A. Meeraus}, 25305 title = {On the Development of a General Algebraic Modeling System in a Strategic Planning 25306 Environment}, 25307 journal = {Mathematical Programming Study}, 25308 year = {1982}, 25309 volume = {20}, 25310 pages = {1--29} 25311} 25312 25313@Misc{ bixby.ceria.ea:miplib, 25314 author = {R. E. Bixby and S. Ceria and C. M. McZeal and M. W. P. Savelsbergh}, 25315 title = {{MIPLIB} 3.0}, 25316 howpublished = {http://www.caam.rice.edu/\~bixby/miplib/miplib.html} 25317} 25318 25319@InProceedings{ bjorkman.klarbring.ea:sequential, 25320 author = {G. Bj{\"{o}}rkman and A. Klarbring and T. Larsson and M. R{\"{o}}nnqvist and B. 25321 Sj{\"{o}}din}, 25322 title = {Sequential quadratic programming for non-linear elastic contact problems}, 25323 editor = {J. Herskovits}, 25324 booktitle = {Structural Optimization 93, The World Congress on Optimal Design of Structural 25325 Systems}, 25326 volume = {2}, 25327 year = {1993}, 25328 pages = {301--308} 25329} 25330 25331@Article{ bjorkman:path, 25332 author = {G. Bj{\"o}rkman}, 25333 title = {Path Following and Critical Points for Contact Problems}, 25334 journal = {Computational Mechanics}, 25335 volume = {10}, 25336 pages = {231--246}, 25337 year = {1992} 25338} 25339 25340@Article{ bjorkman:solution, 25341 author = {G. Bj{\"o}rkman}, 25342 title = {The Solution of Large Displacement Frictionless Contact Problems using a Sequence 25343 of Linear Complementarity Problems}, 25344 journal = {International Journal for Numerical Methods in Engineering}, 25345 volume = {31}, 25346 pages = {1553--1566}, 25347 year = {1991} 25348} 25349 25350@Article{ bland:pivot, 25351 author = {R. G. Bland}, 25352 title = {New Pivot Rules for the Simplex Method}, 25353 journal = {Mathematics of Operations Research}, 25354 year = {1977}, 25355 volume = {2}, 25356 pages = {103--107} 25357} 25358 25359@Article{ block.levin:boundedness, 25360 author = {H. D. Block and S. A. Levin}, 25361 title = {On the Boundedness of an Iterative Procedure for Solving a System of Linear 25362 Inequalities}, 25363 journal = {Proceedings of the American Mathematical Society}, 25364 year = {1970}, 25365 volume = {26}, 25366 pages = {229--235} 25367} 25368 25369@Book{ bloomer:power, 25370 author = {J. Bloomer}, 25371 title = {Power Programming with {RPC}}, 25372 publisher = {O'Reilly and Associates, Inc.}, 25373 address = {Sebastopol, CA}, 25374 year = {1992} 25375} 25376 25377@InProceedings{ blum.rivest:training, 25378 author = {A. Blum and R. L. Rivest}, 25379 title = {Training a 3-Node Neural Network is {NP}-Complete}, 25380 booktitle = {Advances in Neural Information Processing Systems I}, 25381 year = {1989}, 25382 editor = {D. S. Touretzky}, 25383 publisher = {Morgan Kaufmann}, 25384 address = {San Mateo, California}, 25385 pages = {494--501} 25386} 25387 25388@InProceedings{ boehringer.ferris.ea:exemptions, 25389 author = {C. B{\"{o}}ehringer and M. C. Ferris and T. F. Rutherford}, 25390 title = {Exemptions, Grandfathered Permits and the Costs of Emission Restrictions: Results 25391 from a General Equilibrium Model for Six {EU} Countries}, 25392 key = {49}, 25393 booktitle = {Economic Aspects of Environmental Policy Making in a Federal System}, 25394 year = {1995} 25395} 25396 25397@Article{ boender.kan:bayesian, 25398 author = {C. G. E. Boender and A. H. G. Rinooy Kan}, 25399 title = {Bayesian Stopping Rules for Global Optimization}, 25400 journal = {Mathematical Programming}, 25401 year = {1987}, 25402 volume = {37}, 25403 pages = {59--80} 25404} 25405 25406@Article{ boggs:convergence, 25407 author = {P. T. Boggs}, 25408 title = {The Convergence of the {B}en--{I}srael Iteration for Nonlinear Least Squares 25409 Problems}, 25410 journal = {Mathematics of Computation}, 25411 year = {1976}, 25412 volume = {30}, 25413 pages = {512--522} 25414} 25415 25416@InProceedings{ bolzon.cochetti.ea:computing, 25417 author = {G. Bolzon and G. Cochetti and G. Maier and F. Tin-Loi}, 25418 title = {On computing all solutions in decohesion}, 25419 booktitle = {IUTAM (International Union of Theoretical and Applied Mechanics), 19th 25420 International Congress of Theoretical and Applied Mechanics}, 25421 year = {1996}, 25422 address = {Kyoto} 25423} 25424 25425@InProceedings{ bolzon.maier.ea:holonomic, 25426 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25427 title = {Holonomic and nonholonomic simulations of quasi-brittle fracture: a comparative 25428 study of mathematical programming approaches}, 25429 booktitle = {Fracture Mechanics of Concrete Structures}, 25430 editor = {F. H. Wittmann}, 25431 series = {Second International Conference on Fracture Mechanics of Concrete Structures 25432 (FRAMCOS 2)}, 25433 year = {1995}, 25434 publisher = {Aedificatio Publishers}, 25435 pages = {885--898} 25436} 25437 25438@InProceedings{ bolzon.maier.ea:holonomic*1, 25439 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25440 title = {On holonomic structural analysis as a complementarity problem}, 25441 booktitle = {APCOM96, Seoul}, 25442 year = {1996} 25443} 25444 25445@Article{ bolzon.maier.ea:multiplicity, 25446 author = {G. Bolzon and G. Maier and F. Tin-Loi}, 25447 title = {On the Multiplicity of Solutions in Quasi-Brittle Fracture Computations}, 25448 journal = {Computational Mechanics}, 25449 year = {1997}, 25450 volume = {19}, 25451 pages = {511--516} 25452} 25453 25454@Article{ bongartz.conn.ea:cute, 25455 author = {I. Bongartz and A. R. Conn and N. Gould and Ph. L. Toint}, 25456 title = {{CUTE}: Constrained and Unconstrained Testing Environment}, 25457 year = {1995}, 25458 journal = {{ACM} Transactions on Mathematical Software}, 25459 volume = {21}, 25460 pages = {123--160} 25461} 25462 25463@Article{ boppana:eigenvalues, 25464 author = {R. Boppana}, 25465 title = {Eigenvalues and Graph Bisection: An Average Case Analysis}, 25466 journal = {Proc. 28th Annual Symposium on Foundations of Computer Science}, 25467 pages = {280--285}, 25468 year = {1987} 25469} 25470 25471@Article{ bortfeld.kahler.ea:x-ray, 25472 author = {T. R. Bortfeld and D. L. Kahler and T. J. Waldron and A. L. Boyer}, 25473 title = {{X}-ray field compensation with multileaf collimators}, 25474 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25475 year = {1994}, 25476 volume = {28}, 25477 number = {3}, 25478 pages = {723--730} 25479} 25480 25481@Article{ bortfeld.schlegel:optimization, 25482 author = {T. Bortfeld and W. Schlegel}, 25483 title = {Optimization of beam orientations in radiation therapy: some theoretical 25484 considerations}, 25485 journal = {Physics in Medicine and Biology}, 25486 year = {1993}, 25487 volume = {38}, 25488 number = {2}, 25489 pages = {291--304} 25490} 25491 25492@Article{ borwein:stability, 25493 author = {J. M. Borwein}, 25494 title = {Stability and regular points of inequality systems}, 25495 journal = {Journal of Optimization Theory and Applications}, 25496 year = {1986}, 25497 volume = {48}, 25498 pages = {9--52} 25499} 25500 25501@Article{ boyer:present, 25502 author = {A. L. Boyer}, 25503 title = {Present and Future Developments in Radiotherapy Treatment Units}, 25504 journal = {Seminars in Radiation Oncology}, 25505 year = {1995}, 25506 volume = {5}, 25507 number = {2}, 25508 pages = {146--155} 25509} 25510 25511@Article{ bracken.mcgill:mathematical, 25512 author = {J. Bracken and J. T. McGill}, 25513 title = {Mathematical programs with optimization problems in the constraints}, 25514 journal = {Operations Research}, 25515 volume = {21}, 25516 year = {1973}, 25517 pages = {37--44} 25518} 25519 25520@Article{ bradley.fayyad.ea:mathematical, 25521 author = {P. S. Bradley and U. M. Fayyad and O. L. Mangasarian}, 25522 title = {Mathematical Programming for Data Mining: Formulations and Challenges}, 25523 journal = {INFORMS Journal on Computing}, 25524 year = {1999}, 25525 volume = {11}, 25526 pages = {217--238} 25527} 25528 25529@TechReport{ bradley.mangasarian.ea:clustering, 25530 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25531 title = {Clustering via Concave Minimization}, 25532 institution = {Computer Sciences Department, University of Wisconsin}, 25533 year = {1996}, 25534 type = {Mathematical Programming Technical Report}, 25535 number = {96-03}, 25536 address = {Madison, Wisconsin} 25537} 25538 25539@TechReport{ bradley.mangasarian.ea:feature, 25540 author = {P. S. Bradley and O. L. Mangasarian and W. N. Street}, 25541 title = {Feature Selection via Mathematical Programming}, 25542 institution = {Computer Sciences Department, University of Wisconsin}, 25543 year = {1995}, 25544 type = {Mathematical Programming Technical Report}, 25545 number = {95-21}, 25546 address = {Madison, Wisconsin} 25547} 25548 25549@Article{ bradley.mangasarian:massive, 25550 author = {P. S. Bradley and O. L. Mangasarian}, 25551 title = {Massive Data Discrimination via Linear Support Vector Machines}, 25552 year = {2000}, 25553 journal = {Optimization Methods and Software}, 25554 volume = {13}, 25555 pages = {1-10} 25556} 25557 25558@PhDThesis{ brady:condition, 25559 author = {L. Brady}, 25560 title = {Condition Constants for Solutions of Convex Inequalities}, 25561 year = {1988}, 25562 address = {Madison, Wisconsin}, 25563 school = {Computer Sciences Department, University of Wisconsin} 25564} 25565 25566@Article{ braess:uber, 25567 author = {D. Braess}, 25568 title = {{\"{U}}ber ein {P}aradoxon aus der {V}erkehrsplanung}, 25569 journal = {Unternehmensforschung}, 25570 year = {1968}, 25571 volume = {12}, 25572 pages = {258--268} 25573} 25574 25575@Article{ brahme:optimization, 25576 author = {A. Brahme}, 25577 title = {Optimization of Radiation Therapy and the Development of Multileaf Collimation}, 25578 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25579 year = {1993}, 25580 volume = {25}, 25581 pages = {373--375} 25582} 25583 25584@Article{ brahme:stationary, 25585 author = {A. Brahme}, 25586 title = {Optimization of stationary and moving beam radiation therapy techniques}, 25587 journal = {Radiother. Oncol.}, 25588 year = {1988}, 25589 volume = {12}, 25590 pages = {129--140} 25591} 25592 25593@InCollection{ brahme:treatment, 25594 author = {A. Brahme}, 25595 title = {Treatment Optimization: Using Physical and Radiobiological Objective Functions}, 25596 booktitle = {Radiation Therapy Physics}, 25597 publisher = {Springer-Verlag}, 25598 year = {1995}, 25599 editor = {A. R. Smith}, 25600 address = {Berlin}, 25601 pages = {209--246} 25602} 25603 25604@TechReport{ branch:getting, 25605 author = {M. A. Branch}, 25606 title = {Getting {CUTE} with {M}atlab}, 25607 institution = {Cornell University}, 25608 year = {1994}, 25609 type = {Cornell Theory Center Report}, 25610 number = {CTC94TR194}, 25611 address = {Ithaca, New York} 25612} 25613 25614@Article{ brearley.mitra.ea:analysis, 25615 author = {A. Brearley and G. Mitra and H. Williams}, 25616 title = {Analysis of Mathematical Programming Problems Prior to Applying the Simplex 25617 Algorithm}, 25618 journal = {Mathematical Programming}, 25619 year = {1975}, 25620 volume = {8}, 25621 pages = {54--83} 25622} 25623 25624@Article{ bredensteiner.bennett:feature, 25625 author = {E. Bredensteiner and K. Bennett}, 25626 title = {Feature Minimization within Decision Trees}, 25627 journal = {Computational Optimization and Applications}, 25628 year = {1998}, 25629 volume = {10}, 25630 pages = {111--126} 25631} 25632 25633@Article{ bregman:relaxation, 25634 author = {L. M. Bregman}, 25635 title = {The Relaxation Method of Finding the Common Point of Convex Sets and its 25636 Application to the Solution of Problems in Convex Programming}, 25637 journal = {USSR Computational Mathematics and Mathematical Physics}, 25638 year = {1967}, 25639 volume = {7}, 25640 pages = {200--217} 25641} 25642 25643@Book{ brenner.hall:making, 25644 author = {D. J. Brenner and E. J. Hall}, 25645 title = {Making the Radiation Therapy Decision}, 25646 publisher = {Contemporary Books}, 25647 year = {1996}, 25648 address = {Chicago, IL} 25649} 25650 25651@Book{ brent:algorithms, 25652 author = {R. P. Brent}, 25653 title = {Algorithms for Minimization without Derivatives}, 25654 publisher = {Prentice-Hall, Inc}, 25655 year = {1973}, 25656 address = {Englewood Cliffs, New Jersey} 25657} 25658 25659@Article{ brewster.mohan.ea:three, 25660 author = {L. Brewster and R. Mohan and G. Mageras and C. Burman and S. Leibel and Z. Fuks}, 25661 title = {Three dimensional conformal treatment planning with multileaf collimators}, 25662 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25663 year = {1995}, 25664 volume = {33}, 25665 number = {5}, 25666 pages = {1081--1089} 25667} 25668 25669@Article{ brezis.lions:produits, 25670 author = {H. Br\'{e}zis and P.--L. Lions}, 25671 title = {Produits Infinis de Resolvantes}, 25672 journal = {Israel Journal of Mathematics}, 25673 year = {1978}, 25674 volume = {29}, 25675 pages = {329--345} 25676} 25677 25678@Book{ brezis:operateurs, 25679 author = {H. Br\'{e}zis}, 25680 title = {Op\'{e}rateurs Maximaux Monotones et Semi-Groupes de Contractions dans les 25681 Espaces de Hilbert}, 25682 publisher = {North-Holland}, 25683 address = {Amsterdam}, 25684 year = {1973} 25685} 25686 25687@Book{ brooke.kendrick.ea:gams, 25688 author = {A. Brooke and D. Kendrick and A. Meeraus}, 25689 title = {{GAMS}: {A} User's Guide}, 25690 year = {1988}, 25691 publisher = {The Scientific Press}, 25692 address = {South San Francisco, CA} 25693} 25694 25695@Article{ brown.demarzo.ea:computing, 25696 author = {D. J. Brown and P. M. DeMarzo and B. C. Eaves}, 25697 title = {Computing Equilibria when Asset Markets Are Incomplete}, 25698 journal = {Econometrica}, 25699 year = {1996}, 25700 volume = {64}, 25701 pages = {1--28} 25702} 25703 25704@Article{ bruck:iterative, 25705 author = {R. E. Bruck}, 25706 title = {An Iterative Solution of a Variational Inequality for Certain Monotone Operators 25707 in {H}ilbert Space}, 25708 journal = {Bulletin of the American Mathematical Society}, 25709 year = {1975}, 25710 volume = {81}, 25711 pages = {890--892} 25712} 25713 25714@Article{ bunch.parlett:direct, 25715 author = {J. R. Bunch and B. N. Parlett}, 25716 title = {Direct Methods for Solving Symmetric Indefinite Systems of Linear Equations}, 25717 journal = {SIAM Journal on Numerical Analysis}, 25718 year = {1971}, 25719 volume = {8}, 25720 pages = {639--655} 25721} 25722 25723@Article{ burachik.iusem.ea:enlargement, 25724 author = {R. S. Burachik and A. N. Iusem and B. F. Svaiter}, 25725 title = {Enlargement of Monotone Operators with Applications to Variational Inequalities}, 25726 year = {1997}, 25727 journal = {Set-Valued Analysis, forthcoming} 25728} 25729 25730@TechReport{ burachik.iusem:generalized, 25731 author = {R. S. Burachik and A. N. Iusem}, 25732 title = {A Generalized Proximal Point Algorithm for the Nonlinear Complementarity 25733 Problem}, 25734 institution = {Instituto de Matem\'{a}tica Pura e Aplicada}, 25735 year = {1995}, 25736 type = {Working Paper}, 25737 address = {Rio de Janeiro} 25738} 25739 25740@Article{ burachik.iusem:generalized*1, 25741 author = {R. S. Burachik and A. N. Iusem}, 25742 title = {A Generalized Proximal Point Algorithm for the Variational Inequality Problem in 25743 {A} {H}ilbert Space}, 25744 year = {1998}, 25745 journal = {SIAM Journal on Optimization}, 25746 volume = {8}, 25747 pages = {197--216} 25748} 25749 25750@Article{ burdakov:globally, 25751 author = {O. P. Burdakov}, 25752 title = {Some Globally Convergent Modifications of {N}ewton's Method for Solving Systems 25753 of Nonlinear Equations}, 25754 journal = {Soviet Mathematics Doklady}, 25755 year = {1980}, 25756 volume = {22}, 25757 pages = {376--379} 25758} 25759 25760@Article{ burges:tutorial, 25761 author = {C. J. C. Burges}, 25762 title = {A Tutorial on Support Vector Machines for Pattern Recognition}, 25763 journal = {Data Mining and Knowledge Discovery}, 25764 volume = {2}, 25765 number = {2}, 25766 pages = {121-167}, 25767 year = {1998} 25768} 25769 25770@Article{ burke.ferris.ea:clarke, 25771 author = {J. V. Burke and M. C. Ferris and M. Qian}, 25772 title = {On the {C}larke Subdifferential of the Distance Function to a Closed Set}, 25773 journal = {Journal of Mathematical Analysis and its Applications}, 25774 year = {1992}, 25775 volume = {166}, 25776 pages = {199--213}, 25777 key = {16} 25778} 25779 25780@Unpublished{ burke.ferris.ea:least, 25781 author = {J. V. Burke and M. C. Ferris and L. Qi}, 25782 title = {A Least Squares Algorithm for Nonlinear Complementarity Problems}, 25783 year = {1994}, 25784 month = mar, 25785 note = {Manuscript}, 25786 key = {999} 25787} 25788 25789@Article{ burke.ferris:characterization, 25790 author = {J. V. Burke and M. C. Ferris}, 25791 title = {Characterization of Solution Sets of Convex Programs}, 25792 journal = {Operations Research Letters}, 25793 year = {1991}, 25794 volume = {10}, 25795 pages = {57--60}, 25796 key = {10} 25797} 25798 25799@Article{ burke.ferris:gauss-newton, 25800 author = {J. V. Burke and M. C. Ferris}, 25801 title = {A {G}auss--{N}ewton Method for Convex Composite Optimization}, 25802 journal = {Mathematical Programming}, 25803 year = {1995}, 25804 volume = {71}, 25805 pages = {179--194}, 25806 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1176.ps}, 25807 key = {32} 25808} 25809 25810@Article{ burke.ferris:weak, 25811 author = {J. V. Burke and M. C. Ferris}, 25812 title = {Weak Sharp Minima in Mathematical Programming}, 25813 journal = {SIAM Journal on Control and Optimization}, 25814 year = {1993}, 25815 volume = {31}, 25816 pages = {1340--1359}, 25817 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1050a.ps}, 25818 key = {23} 25819} 25820 25821@Article{ burke.more.ea:convergence, 25822 author = {J. V. Burke and J. J. Mor\'{e} and G. Toraldo}, 25823 title = {Convergence Properties of Trust Region Methods for Linear and Convex 25824 Constraints}, 25825 journal = {Mathematical Programming}, 25826 year = {1990}, 25827 volume = {47}, 25828 pages = {305--336} 25829} 25830 25831@Article{ burke.more:exposing, 25832 author = {J. V. Burke and J. J. Mor\'{e}}, 25833 title = {Exposing Constraints}, 25834 journal = {SIAM Journal on Optimization}, 25835 year = {1994}, 25836 volume = {4}, 25837 pages = {573--595} 25838} 25839 25840@Article{ burke.more:identification, 25841 author = {J. V. Burke and J. J. Mor\'{e}}, 25842 title = {On the Identification of Active Constraints}, 25843 journal = {SIAM Journal on Numerical Analysis}, 25844 year = {1988}, 25845 volume = {25}, 25846 pages = {1197--1211} 25847} 25848 25849@Article{ burke.poliquin:optimality, 25850 author = {J. V. Burke and R. A. Poliquin}, 25851 title = {Optimality Conditions for Non Finite--Valued Convex Composite Functions}, 25852 journal = {Mathematical Programming}, 25853 year = {1992}, 25854 volume = {57}, 25855 pages = {103--120} 25856} 25857 25858@Article{ burke.tseng:unified, 25859 author = {J. V. Burke and P. Tseng}, 25860 title = {A Unified Analysis of {H}offman's Bound via {F}enchel Duality}, 25861 journal = {SIAM Journal on Optimization}, 25862 year = {1996}, 25863 volume = {6}, 25864 pages = {265--282} 25865} 25866 25867@Article{ burke.xu:global, 25868 author = {J. V. Burke and S. Xu}, 25869 title = {The Global Linear Convergence of a Non-Interior Path-Following Algorithm for 25870 Linear Complementarity Problems}, 25871 year = {1998}, 25872 journal = {Mathematics of Operations Research}, 25873 volume = {23}, 25874 pages = {719--735} 25875} 25876 25877@TechReport{ burke:algorithms, 25878 author = {J. V. Burke}, 25879 title = {Algorithms for Solving Finite Dimensional Systems of Nonlinear Equations and 25880 Inequalities that have both Global and Quadratic Convergence Properties}, 25881 institution = {Argonne National Laboratory}, 25882 year = {1985}, 25883 address = {Argonne, Illinois}, 25884 number = {ANL/MCS--TM--54}, 25885 type = {Mathematics and Computer Science Division Report} 25886} 25887 25888@Article{ burke:descent, 25889 author = {J. V. Burke}, 25890 title = {Descent Methods for Composite Nondifferentiable Optimization Problems}, 25891 journal = {Mathematical Programming}, 25892 year = {1985}, 25893 volume = {33}, 25894 pages = {260--279} 25895} 25896 25897@Article{ burke:exact, 25898 author = {J. V. Burke}, 25899 title = {An Exact Penalization Viewpoint of Constrained Optimization}, 25900 journal = {SIAM Journal on Control and Optimization}, 25901 year = {1991}, 25902 volume = {29}, 25903 pages = {968--998} 25904} 25905 25906@Article{ burke:identification, 25907 author = {J. V. Burke}, 25908 title = {On the Identification of Active Constraints {II}: The Nonconvex Case}, 25909 journal = {SIAM Journal on Numerical Analysis}, 25910 year = {1990}, 25911 volume = {27}, 25912 pages = {1081--1102} 25913} 25914 25915@Article{ burke:robust, 25916 author = {J. V. Burke}, 25917 title = {A Robust Trust Region Method for Constrained Nonlinear Programming Problem}, 25918 journal = {SIAM Journal on Optimization}, 25919 year = {1992}, 25920 volume = {2}, 25921 pages = {325--347} 25922} 25923 25924@Article{ burke:second, 25925 author = {J. V. Burke}, 25926 title = {Second Order Necessary and Sufficient Conditions for Convex Composite {NDO}}, 25927 journal = {Mathematical Programming}, 25928 year = {1987}, 25929 volume = {38}, 25930 pages = {287--302} 25931} 25932 25933@Article{ burke:sequential, 25934 author = {J. V. Burke}, 25935 title = {A Sequential Quadratic Programming Method for Potentially Infeasible Mathematical 25936 Programs}, 25937 journal = {Journal of Mathematical Analysis and its Applications}, 25938 year = {1989}, 25939 volume = {139}, 25940 pages = {319--351} 25941} 25942 25943@Article{ burman.kutcher.ea:fitting, 25944 author = {C. Burman and G. J. Kutcher and B. Emami and M. Goitein}, 25945 title = {Fitting of Normal Tissue Tolerance Data to an Analytical Function}, 25946 journal = {International Journal of Radiation Oncology, Biology and Physics}, 25947 year = {1991}, 25948 optvolume = {21}, 25949 optpages = {123-135} 25950} 25951 25952@TechReport{ busovaca:handling, 25953 author = {S. Busovaca}, 25954 title = {Handling Degeneracy in a Nonlinear $\ell_1$ algorithm}, 25955 institution = {University of Waterloo}, 25956 year = {1985}, 25957 address = {Ontario}, 25958 number = {CS85 34}, 25959 type = {Technical Report} 25960} 25961 25962@Article{ butler.martin:method, 25963 author = {T. Butler and A. V. Martin}, 25964 title = {On a Method of {C}ourant for Minimizing Functionals}, 25965 journal = {Journal of Mathematical Physics}, 25966 year = {1962}, 25967 volume = {41}, 25968 pages = {291--299} 25969} 25970 25971@Article{ calamai.more:projected, 25972 author = {P. H. Calamai and J. J. Mor\'{e}}, 25973 title = {Projected Gradient Methods for Linearly Constrained Problems}, 25974 journal = {Mathematical Programming}, 25975 year = {1987}, 25976 volume = {39}, 25977 pages = {93--116} 25978} 25979 25980@Article{ cao.ferris:genetic, 25981 author = {M. Cao and M. C. Ferris}, 25982 title = {Genetic Algorithms in Optimization}, 25983 journal = {Journal of Undergraduate Mathematics and its Applications}, 25984 year = {1991}, 25985 volume = {12}, 25986 pages = {81--90}, 25987 key = {17} 25988} 25989 25990@Article{ cao.ferris:interior, 25991 author = {M. Cao and M. C. Ferris}, 25992 title = {An Interior Point Algorithm for Monotone Affine Variational Inequalities}, 25993 journal = {Journal of Optimization Theory and Applications}, 25994 year = {1994}, 25995 volume = {83}, 25996 pages = {269--283}, 25997 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1101.ps}, 25998 key = {28} 25999} 26000 26001@Article{ cao.ferris:lineality, 26002 author = {M. Cao and M. C. Ferris}, 26003 title = {Lineality Removal for Copositive--Plus Normal Maps}, 26004 year = {1995}, 26005 volume = {2}, 26006 pages = {1--10}, 26007 journal = {Communications on Applied Nonlinear Analysis}, 26008 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-02.ps}, 26009 key = {38} 26010} 26011 26012@Article{ cao.ferris:pc, 26013 author = {M. Cao and M. C. Ferris}, 26014 title = {{$P_C$} Matrices and the Linear Complementarity Problem}, 26015 journal = {Linear Algebra and Its Applications}, 26016 year = {1996}, 26017 volume = {246}, 26018 pages = {299--312}, 26019 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-01.ps}, 26020 key = {37} 26021} 26022 26023@Article{ cao.ferris:pivotal, 26024 author = {M. Cao and M. C. Ferris}, 26025 title = {A Pivotal Method for Affine Variational Inequalities}, 26026 journal = {Mathematics of Operations Research}, 26027 year = {1996}, 26028 volume = {21}, 26029 pages = {44--64}, 26030 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1992/tr1114.ps}, 26031 key = {29} 26032} 26033 26034@PhDThesis{ cao:piecewise, 26035 author = {M. Cao}, 26036 title = {Piecewise Linear Homotopies and Affine Variational Inequalities}, 26037 school = {Computer Sciences Department, University of Wisconsin}, 26038 year = {1994}, 26039 address = {Madison, Wisconsin}, 26040 note = {Technical Report 1210} 26041} 26042 26043@Article{ caroe.schultz:dual, 26044 author = {C. C. Car{\o}e and R. Schultz}, 26045 title = {Dual Decomposition in Stochastic Integer Programming}, 26046 journal = {Operations Research Letters}, 26047 volume = {24}, 26048 pages = {37-45}, 26049 year = {1999} 26050} 26051 26052@Article{ carol.targovnik.ea:initial, 26053 author = {M. Carol and W. H. Grant and D. Pavord and P. Eddy and H. S. Targovnik and B. 26054 Butler and S. Woo and J. Figura and V. Onufrey and R. Grossman and R. Selkar}, 26055 title = {Initial clinical experience with the Peacock intensity modulation of a 3-{D} 26056 conformal radiation therapy system}, 26057 journal = {Stereotactic and Functional Neurosurgery}, 26058 year = {1996}, 26059 volume = {66}, 26060 pages = {30--34} 26061} 26062 26063@Article{ carolan.hill.ea:empirical, 26064 author = {W. J. Carolan and J. E. Hill and J. L. Kennington and S. Niemi and S. J. 26065 Wichmann}, 26066 title = {An Empirical Evaluation of the {KORBX} Algorithms for Military Airlift 26067 Applications}, 26068 journal = {Operations Research}, 26069 year = {1990}, 26070 volume = {38}, 26071 pages = {240--248} 26072} 26073 26074@Article{ carroll:created, 26075 author = {C. W. Carroll}, 26076 title = {The Created Response Surface Technique for Optimizing Nonlinear Restrained 26077 Systems}, 26078 journal = {Operations Research}, 26079 year = {1961}, 26080 volume = {9}, 26081 pages = {169--184} 26082} 26083 26084@PhDThesis{ carroll:operations, 26085 author = {C. W. Carroll}, 26086 title = {An Operations Research Approach to the Economic Optimization of a Kraft Pulping 26087 Process}, 26088 year = {1959}, 26089 address = {Appleton, Wisconsin}, 26090 school = {Institute of Paper Chemistry} 26091} 26092 26093@TechReport{ casanova.dongarra:netsolve, 26094 author = {H. Casanova and J. Dongarra}, 26095 title = {{N}et{S}olve: {A} Network Server for Solving Computational Science Problems}, 26096 institution = {University of Tennessee}, 26097 year = {1996}, 26098 type = {Technical Report} 26099} 26100 26101@TechReport{ cavalier.soyster:computational, 26102 author = {T. M. Cavalier and A. L. Soyster}, 26103 title = {Some Computational Experience and a Modification of the {K}armarkar Algorithm}, 26104 institution = {Pennsylvania State University}, 26105 year = {1985}, 26106 address = {Pennsylvania}, 26107 number = {85-105}, 26108 type = {ISME Working Paper} 26109} 26110 26111@TechReport{ censor.iusem.ea:interior-point, 26112 author = {Y. Censor and A. N. Iusem and S. A. Zenios}, 26113 title = {An Interior-Point Method with {B}regman Functions for the Variational Inequality 26114 Problem with Paramonotone Operators}, 26115 institution = {University of Haifa}, 26116 year = {1994}, 26117 type = {Working Paper} 26118} 26119 26120@Article{ censor.lent:iterative, 26121 author = {Y. Censor and A. Lent}, 26122 title = {An Iterative Row-Action Method for Interval Convex Programming}, 26123 journal = {Journal of Optimization Theory and Applications}, 26124 year = {1981}, 26125 volume = {34}, 26126 pages = {275--291} 26127} 26128 26129@InCollection{ censor.pierro.ea:iterative, 26130 author = {Y. Censor and A. R. {De~Pierro} and T. Elfving and G. T. Herman and A. N. Iusem}, 26131 title = {On Iterative Methods for Linearly Constrained Entropy Maximization}, 26132 booktitle = {Numerical Analysis and Mathematical Modeling, Banach Center Publication Volume 26133 XXIV}, 26134 publisher = {Banach Center}, 26135 year = {1987}, 26136 editor = {A. J. Wakulicz}, 26137 address = {Warsaw, Poland} 26138} 26139 26140@Article{ censor.segman:block-iterative, 26141 author = {Y. Censor and J. Segman}, 26142 title = {On Block-Iterative Entropy Maximization}, 26143 journal = {Journal of Information and Optimization Science}, 26144 year = {1987}, 26145 volume = {8}, 26146 pages = {275--291} 26147} 26148 26149@Article{ censor.zenios:proximal, 26150 author = {Y. Censor and S. A. Zenios}, 26151 title = {The Proximal Minimization Algorithm with ${D}$-functions}, 26152 journal = {Journal of Optimization Theory and Applications}, 26153 year = {1992}, 26154 volume = {73}, 26155 pages = {451--464} 26156} 26157 26158@Article{ censor:parallel, 26159 author = {Yair Censor}, 26160 title = {Parallel Application of Block-Iterative Methods in Medical Imaging and Radiation 26161 Therapy}, 26162 journal = {Mathematical Programming}, 26163 year = {1988}, 26164 volume = {42}, 26165 pages = {307--325} 26166} 26167 26168@Article{ censor:row-action, 26169 author = {Yair Censor}, 26170 title = {Row-action Methods for Huge and Sparse Systems and their Applications}, 26171 journal = {SIAM Review}, 26172 year = {1981}, 26173 volume = {23}, 26174 pages = {444--466} 26175} 26176 26177@Article{ chajakis.zenios:synchronous, 26178 author = {E. D. Chajakis and S. A. Zenios}, 26179 title = {Synchronous and Asynchronous Implementations of Relaxation Algorithms for 26180 Nonlinear Network Optimization}, 26181 journal = {Parallel Computing}, 26182 year = {1990}, 26183 note = {To appear} 26184} 26185 26186@Article{ chamberlain.powell.ea:watchdog, 26187 author = {R. M. Chamberlain and M. J. D. Powell and C. Lemar\'{e}chal}, 26188 title = {The Watchdog Technique for Forcing Convergence in Algorithms for Constrained 26189 Optimization}, 26190 journal = {Mathematical Programming Study}, 26191 year = {1982}, 26192 volume = {16}, 26193 pages = {1--17} 26194} 26195 26196@Article{ chan.pang:generalized, 26197 author = {D. Chan and J. S. Pang}, 26198 title = {The Generalized Quasi-Variational Inequality Problem}, 26199 journal = {Mathematics of Operations Research}, 26200 volume = {7}, 26201 pages = {211--222}, 26202 year = {1982} 26203} 26204 26205@Article{ charalambous:nonlinear, 26206 author = {C. Charalambous}, 26207 title = {Nonlinear Least p--th Optimization and Nonlinear Programming}, 26208 journal = {Mathematical Programming}, 26209 year = {1977}, 26210 volume = {12}, 26211 pages = {195--225} 26212} 26213 26214@Article{ charnes.cooper.ea:duality, 26215 author = {A. Charnes and W. W. Cooper and K. O. Kortanek}, 26216 title = {Duality, {H}aar Programs and Finite Sequence Spaces}, 26217 journal = {Proceedings of the National Academy of Sciences of the United States}, 26218 year = {1962}, 26219 pages = {783--786} 26220} 26221 26222@Book{ charnes.cooper.ea:introduction, 26223 author = {A. Charnes and W. W. Cooper and A. Henderson}, 26224 title = {An Introduction to Linear Programming}, 26225 year = {1953}, 26226 publisher = {John Wiley \& Sons}, 26227 address = {New York} 26228} 26229 26230@TechReport{ charnes.semple:practical, 26231 author = {A. Charnes and J. Semple}, 26232 title = {Practical Error Bounds for a Class of Quadratic Programming Problems}, 26233 institution = {CCS}, 26234 year = {1991}, 26235 address = {Austin, Texas}, 26236 number = {663}, 26237 type = {Research Report} 26238} 26239 26240@InProceedings{ charnes:fundamental, 26241 author = {A. Charnes}, 26242 title = {Some Fundamental Theorems of Perceptron Theory and Their Geometry}, 26243 booktitle = {Computer and Information Sciences}, 26244 year = {1964}, 26245 editor = {J. T. Lou and R. H. Wilcox}, 26246 publisher = {Spartan Books}, 26247 address = {Washington, D.C.}, 26248 pages = {67--74} 26249} 26250 26251@TechReport{ chen.chen.ea:penalized, 26252 author = {B. Chen and X. Chen and C. Kanzow}, 26253 title = {A Penalized {F}ischer-{B}urmeister {NCP}-Function: Theoretical Investigation and 26254 Numerical Results}, 26255 institution = {Institute of Applied Mathematics, University of Hamburg}, 26256 year = {1997}, 26257 type = {Preprint}, 26258 number = {126}, 26259 address = {Hamburg, Germany} 26260} 26261 26262@Article{ chen.chen:global, 26263 author = {B. Chen and X. Chen}, 26264 title = {A Global and Local Superlinear Continuation-Smoothing Method for ${P}_0$ + 26265 ${R}_0$ {NCP} or Monotone {NCP}}, 26266 journal = {SIAM Journal on Optimization}, 26267 year = {1999}, 26268 volume = {9}, 26269 pages = {624--645} 26270} 26271 26272@Article{ chen.ferris.ea:fatcop, 26273 author = {Q. Chen and M. C. Ferris and J. T. Linderoth}, 26274 title = {{FATCOP} 2.0: Advanced Features in an Opportunistic Mixed Integer Programming 26275 Solver}, 26276 journal = {Annals of Operations Research, forthcoming}, 26277 year = {2000}, 26278 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/99-11.ps}, 26279 key = {89}, 26280 type = {Data Mining Institute Technical Report}, 26281 institution = {Computer Sciences Department, University of Wisconsin}, 26282 address = {Madison, Wisconsin}, 26283 number = {99-11} 26284} 26285 26286@TechReport{ chen.ferris:fatcop, 26287 author = {Q. Chen and M. C. Ferris}, 26288 title = {{FATCOP}: {A} Fault Tolerant {C}ondor-{PVM} Mixed Integer Program Solver}, 26289 type = {Mathematical Programming Technical Report}, 26290 institution = {Computer Sciences Department, University of Wisconsin}, 26291 address = {Madison, Wisconsin}, 26292 year = {1999}, 26293 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-05.ps}, 26294 number = {99-05}, 26295 key = {81}, 26296 annote = {Submitted to {\em SIOPT}} 26297} 26298 26299@Article{ chen.florian:nonlinear, 26300 author = {Y. Chen and M. Florian}, 26301 title = {The Nonlinear Bilevel Programming Problem: Formulations, Regularity, and 26302 Optimality Conditions}, 26303 journal = {Optimization}, 26304 year = {1995}, 26305 volume = {32}, 26306 pages = {193--209} 26307} 26308 26309@TechReport{ chen.florian:o-d, 26310 author = {Y. Chen and M. Florian}, 26311 title = {{O}-{D} demand adjustment problem with congestion: Part {I}. Model analysis and 26312 optimality conditions}, 26313 type = {Publication}, 26314 number = {CRT-94-56}, 26315 institution = {Centre de Recherche sur les Transports, Universit\'e de Montr\'eal}, 26316 address = {Montr\'eal, Canada}, 26317 year = {1994} 26318} 26319 26320@Article{ chen.harker:continuation, 26321 author = {B. Chen and P. T. Harker}, 26322 title = {A Continuation Method for Monotone Variational Inequalities}, 26323 journal = {Mathematical Programming}, 26324 volume = {69}, 26325 pages = {237--253}, 26326 year = {1995} 26327} 26328 26329@Article{ chen.harker:non-interior, 26330 author = {B. Chen and P. T. Harker}, 26331 title = {A Non-Interior-Point Continuation Method for Linear Complementarity Problems}, 26332 journal = {SIAM Journal on Matrix Analysis and Applications}, 26333 year = {1993}, 26334 volume = {14}, 26335 pages = {1168--1190} 26336} 26337 26338@Article{ chen.harker:smooth, 26339 author = {B. Chen and P. T. Harker}, 26340 title = {Smooth Approximations to Nonlinear Complementarity Problems}, 26341 journal = {SIAM Journal on Optimization}, 26342 year = {1997}, 26343 volume = {7}, 26344 pages = {403--420} 26345} 26346 26347@Article{ chen.mangasarian:class, 26348 author = {Chunhui Chen and O. L. Mangasarian}, 26349 title = {A Class of Smoothing Functions for Nonlinear and Mixed Complementarity Problems}, 26350 journal = {Computational Optimization and Applications}, 26351 year = {1996}, 26352 volume = {5}, 26353 pages = {97--138} 26354} 26355 26356@Article{ chen.mangasarian:smoothing, 26357 author = {Chunhui Chen and O. L. Mangasarian}, 26358 title = {Smoothing Methods for Convex Inequalities and Linear Complementarity Problems}, 26359 journal = {Mathematical Programming}, 26360 year = {1995}, 26361 volume = {78}, 26362 pages = {51--70} 26363} 26364 26365@Article{ chen.nashed.ea:convergence, 26366 author = {X. Chen and Z. Nashed and L. Qi}, 26367 title = {Convergence of {N}ewton's Method for Singular Smooth and Nonsmooth Equations 26368 using Adaptive Outer Inverses}, 26369 year = {1997}, 26370 journal = {SIAM Journal on Optimization}, 26371 volume = {7}, 26372 pages = {445--462} 26373} 26374 26375@Article{ chen.qi.ea:global, 26376 author = {X. Chen and L. Qi and D. Sun}, 26377 title = {Global and Superlinear Convergence of the Smoothing {N}ewton Method and its 26378 Application to General Box Constrained Variational Inequalities}, 26379 year = {1998}, 26380 journal = {Mathematics of Computation}, 26381 volume = {67}, 26382 pages = {519--540} 26383} 26384 26385@Article{ chen.teboulle:convergence, 26386 author = {G. Chen and M. Teboulle}, 26387 title = {A Convergence Analysis of Proximal-Like Minimization Algorithms Using {B}regman 26388 Functions}, 26389 journal = {SIAM Journal on Optimization}, 26390 year = {1993}, 26391 volume = {3}, 26392 pages = {538--543} 26393} 26394 26395@Article{ chen.ye:homotopy-smoothing, 26396 author = {X.~Chen and Y.~Ye}, 26397 title = {On Homotopy-Smoothing Methods for Variational Inequalities}, 26398 year = {1999}, 26399 journal = {SIAM Journal on Control and Optimization}, 26400 volume = {37}, 26401 pages = {589--616} 26402} 26403 26404@PhDThesis{ chen:forward-backward, 26405 author = {G. H.--G. Chen}, 26406 title = {Forward--Backward Splitting Techniques: Theory and Applications}, 26407 school = {University of Washington}, 26408 year = {1994} 26409} 26410 26411@PhDThesis{ chen:smoothing, 26412 author = {Chunhui Chen}, 26413 title = {Smoothing Methods in Mathematical Programming}, 26414 school = {Computer Sciences Department, University of Wisconsin}, 26415 year = {1995}, 26416 address = {Madison, Wisconsin}, 26417 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 26418 annote = {Mathematical Programming Technical Report 95-12} 26419} 26420 26421@Book{ cheney:introduction, 26422 author = {E. W. Cheney}, 26423 title = {Introduction to Approximation Theory}, 26424 year = {1966}, 26425 publisher = {McGraw--Hill}, 26426 address = {New York} 26427} 26428 26429@Article{ cho.kuterdem.ea:spherical, 26430 author = {P. S. Cho and H. G. Kuterdem and R. J. Marks}, 26431 title = {A spherical dose model for radiosurgery treatment planning}, 26432 journal = {Physics in Medicine and Biology}, 26433 year = {1998}, 26434 volume = {43}, 26435 pages = {3145--3148} 26436} 26437 26438@Article{ cho.lee.ea:optimization, 26439 author = {P. S. Cho and S. Lee and R. J. Marks and S. Oh and S. Sutlief and H. Phillips}, 26440 title = {Optimization of intensity modulated beams with volume constraints using two 26441 methods: cost function minimization and projection onto convex sets}, 26442 journal = {Medical Physics}, 26443 year = {1998}, 26444 volume = {25}, 26445 number = {4}, 26446 pages = {435--443} 26447} 26448 26449@Article{ choi.desarbo.ea:product, 26450 author = {S. C. Choi and W. S. DeSarbo and P. T. Harker}, 26451 title = {Product Positioning Under Price Competition}, 26452 journal = {Management Science}, 26453 year = {1990}, 26454 volume = {36}, 26455 pages = {175--199} 26456} 26457 26458@Article{ chow.mallet-parret.ea:finding, 26459 author = {S. N. Chow and J. Mallet--Parret and J. A. Yorke}, 26460 title = {Finding Zeroes of Maps: Homotopy Methods that are Constructive with Probability 26461 One}, 26462 journal = {Mathematics of Computing}, 26463 year = {1978}, 26464 volume = {32}, 26465 pages = {887--899} 26466} 26467 26468@Article{ christopherson:mathematical, 26469 author = {D. G. Christopherson}, 26470 title = {A new mathematical method for the solution of film lubrication problems}, 26471 journal = {Proceedings of the Institute of Mechanical Engineers}, 26472 volume = {146}, 26473 year = {1941}, 26474 pages = {126--135} 26475} 26476 26477@TechReport{ chun.lee.ea:implementation, 26478 author = {B. J. Chun and S. J. Lee and S. M. Robinson}, 26479 title = {An Implementation of the Bundle Decomposition Algorithm}, 26480 institution = {Department of Industrial Engineering, University of Wisconsin}, 26481 year = {1991}, 26482 address = {Madison, Wisconsin}, 26483 number = {91-6} 26484} 26485 26486@Article{ chung:np-completeness, 26487 author = {S.--J. Chung}, 26488 title = {{NP}-Completeness of the Linear Complementarity Problem}, 26489 journal = {Journal of Optimization Theory and Applications}, 26490 volume = {60}, 26491 year = {1989}, 26492 pages = {393--399} 26493} 26494 26495@Book{ chvatal:linear, 26496 author = {V. Chv\'atal}, 26497 title = {Linear Programming}, 26498 year = {1983}, 26499 publisher = {W. H. Freeman and Company}, 26500 address = {New York} 26501} 26502 26503@Book{ ciarlet:finite, 26504 author = {P. G. Ciarlet}, 26505 title = {The Finite Element Method for Elliptic Problems}, 26506 year = {1978}, 26507 publisher = {North-Holland}, 26508 address = {New York} 26509} 26510 26511@Article{ cinquini.contro:optimal, 26512 author = {C. Cinquini and R. Contro}, 26513 title = {Optimal design of beams discretized by elastic plastic finite element}, 26514 journal = {Computers \& Structures}, 26515 volume = {20}, 26516 year = {1985}, 26517 pages = {475--585} 26518} 26519 26520@Book{ clarke:optimization, 26521 author = {F. H. Clarke}, 26522 title = {Optimization and Nonsmooth Analysis}, 26523 year = {1983}, 26524 publisher = {John Wiley \& Sons}, 26525 address = {New York} 26526} 26527 26528@InProceedings{ cleveland.smith:genetic, 26529 crossref = {schaeffer:third}, 26530 author = {G. A. Cleveland and S. F. Smith}, 26531 title = {Using Genetic Algorithms to Schedule Flow Shop Releases}, 26532 pages = {160--169} 26533} 26534 26535@Book{ cochran:sampling, 26536 author = {W. Cochran}, 26537 title = {Sampling Techniques}, 26538 publisher = {Wiley}, 26539 year = {1977}, 26540 address = {New York}, 26541 edition = {Third} 26542} 26543 26544@Article{ coleman.conn:nonlinear, 26545 author = {T. F. Coleman and A. R. Conn}, 26546 title = {Nonlinear Programming via an Exact Penalty Function Method: Asymptotic Analysis}, 26547 journal = {Mathematical Programming}, 26548 year = {1982}, 26549 volume = {24}, 26550 pages = {123--136} 26551} 26552 26553@Article{ coleman.conn:nonlinear*1, 26554 author = {T. F. Coleman and A. R. Conn}, 26555 title = {Nonlinear Programming via an Exact Penalty Function Method: Global Analysis}, 26556 journal = {Mathematical Programming}, 26557 year = {1982}, 26558 volume = {24}, 26559 pages = {137--161} 26560} 26561 26562@TechReport{ coleman.liu:interior, 26563 author = {T. F. Coleman and J. Liu}, 26564 title = {An interior newton method for quadratic programming}, 26565 institution = {Dept. of Computer Science, Cornell University}, 26566 year = {1993}, 26567 number = {TR 93-1388}, 26568 address = {Ithaca, NY}, 26569 month = oct 26570} 26571 26572@Article{ coleman.more:estimation, 26573 author = {T. F. Coleman and J. J. Mor\'{e}}, 26574 title = {Estimation of Sparse {J}acobian Matrices and Graph Coloring Problems}, 26575 journal = {SIAM Journal on Numerical Analysis}, 26576 year = {1983}, 26577 volume = {20}, 26578 pages = {187--209} 26579} 26580 26581@Manual{ coleman.verma:admat, 26582 author = {T. F. Coleman and A. Verma}, 26583 title = {{ADMAT} User Guide}, 26584 year = {2000} 26585} 26586 26587@TechReport{ colville:comparative, 26588 author = {A. R. Colville}, 26589 title = {A Comparative Study on Nonlinear Programming Codes}, 26590 institution = {IBM New York Scientific Center}, 26591 year = {1968}, 26592 month = jun, 26593 number = {320--2949}, 26594 type = {Technical Report} 26595} 26596 26597@Article{ comi.maier:extremum, 26598 author = {C. Comi and G. Maier}, 26599 title = {Extremum Theorem and Convergence Criterion for an Iterative Solution to the 26600 Finite-Step Problem in Elastoplasticity with Mixed Nonlinear Hardening}, 26601 journal = {European Journal Mechanics A/Solids}, 26602 volume = {9}, 26603 year = {1990}, 26604 pages = {563--585} 26605} 26606 26607@Misc{ condon.dahl.ea:implementing, 26608 author = {T. Condon and H. Dahl and S. Devarajan}, 26609 title = {Implementing a Computable General Equilibrium Model on {GAMS} -- The {C}ameroon 26610 Model}, 26611 year = {1987}, 26612 howpublished = {{DRD} Discussion Paper 290}, 26613 note = {The World Bank, Washington DC} 26614} 26615 26616@Book{ conn.gould.ea:lancelot, 26617 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26618 title = {{LANCELOT}: {A} {F}ortran package for Large--Scale Nonlinear Optimization 26619 (Release {A})}, 26620 year = {1992}, 26621 publisher = {Springer Verlag}, 26622 address = {Heidelberg, Berlin}, 26623 series = {Springer Series in Computational Mathematics}, 26624 number = {17} 26625} 26626 26627@Article{ conn.gould.ea:numerical, 26628 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26629 title = {Numerical Experiments with the {LANCELOT} Package (Release {A}) for Large-Scale 26630 Nonlinear Optimization}, 26631 journal = {Mathematical Programming}, 26632 year = {1996}, 26633 volume = {75}, 26634 pages = {73--110} 26635} 26636 26637@Book{ cgt, 26638 author = {A. R. Conn and N. I. M. Gould and Ph. L. Toint}, 26639 title = {Trust-Region Methods}, 26640 year = {2000}, 26641 publisher = {SIAM}, 26642 address = {Philadelphia, Pennsylvania} 26643} 26644 26645@InCollection{ conn.toint:algorithm, 26646 author = {A. R. Conn and Ph. L. Toint}, 26647 title = {An Algorithm using Quadratic Interpolation for Unconstrained Derivative Free 26648 Optimization}, 26649 booktitle = {Nonlinear Optimization and Applications}, 26650 editor = {G. Di Pillo and F. Giannessi}, 26651 year = {1996}, 26652 publisher = {Plenum Press}, 26653 address = {New York} 26654} 26655 26656@Article{ conry.seireg:mathematical, 26657 author = {T. F. Conry and A. Seireg}, 26658 title = {A Mathematical Programming Method for Design for Elastic Bodies in Contact}, 26659 journal = {{ASME} Transactions Journal of Applied Mechanics}, 26660 volume = {93}, 26661 year = {1971}, 26662 pages = {387--392} 26663} 26664 26665@Article{ cook.gerards.ea:sensitivity, 26666 author = {W. Cook and A. M. H. Gerards and A. Schrijver and \'{E}. Tardos}, 26667 title = {Sensitivity Results in Integer Linear Programming}, 26668 journal = {Mathematical Programming}, 26669 year = {1986}, 26670 volume = {34}, 26671 pages = {251--264} 26672} 26673 26674@Article{ cook:taxonomy, 26675 author = {S. A. Cook}, 26676 title = {A Taxonomy of Problems with Fast Parallel Algorithms}, 26677 journal = {Information and Control}, 26678 year = {1985}, 26679 volume = {64}, 26680 pages = {2--22} 26681} 26682 26683@Article{ cooper:gradient, 26684 author = {R. E. M. Cooper}, 26685 title = {A gradient method of optimizing external-beam radiotherapy treatment plans}, 26686 journal = {Radiology}, 26687 year = {1978}, 26688 volume = {128}, 26689 pages = {235--243} 26690} 26691 26692@Article{ cormack:problem, 26693 author = {A. M. Cormack}, 26694 title = {A problem in roatation therapy with x-rays}, 26695 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26696 year = {1987}, 26697 volume = {13}, 26698 pages = {623--630} 26699} 26700 26701@Article{ cormack:problem*1, 26702 author = {A. M. Cormack}, 26703 title = {A problem in roatation therapy with x-rays2: dose distributions with an axis of 26704 symmetry}, 26705 journal = {International Journal of Radiation Oncology, Biology and Physics}, 26706 year = {1987}, 26707 volume = {13}, 26708 pages = {1921--1925} 26709} 26710 26711@Article{ cottle.dantzig:complementary, 26712 author = {R. W. Cottle and G. B. Dantzig}, 26713 title = {Complementary Pivot Theory of Mathematical Programming}, 26714 journal = {Linear Algebra and Its Applications}, 26715 year = {1968}, 26716 volume = {1}, 26717 pages = {103--125} 26718} 26719 26720@Article{ cottle.dantzig:generalization, 26721 author = {R. W. Cottle and G. B. Dantzig}, 26722 title = {A Generalization of the Linear Complementarity Problem}, 26723 journal = {Journal of Combinatorial Theory}, 26724 year = {1970}, 26725 volume = {8}, 26726 pages = {79--90} 26727} 26728 26729@Book{ cottle.giannessi.ea:variational, 26730 author = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 26731 title = {Variational Inequalities and Complementarity Problems: Theory and Applications}, 26732 year = {1980}, 26733 publisher = {John Wiley \& Sons}, 26734 address = {New York} 26735} 26736 26737@InCollection{ cottle.goheen:special, 26738 author = {R. W. Cottle and M. S. Goheen}, 26739 title = {A Special Class of Large Quadratic Programs}, 26740 pages = {361--390}, 26741 crossref = {mangasarian.meyer.ea:nonlinear*3} 26742} 26743 26744@Article{ cottle.golub.ea:solution, 26745 author = {R. W. Cottle and G. H. Golub and R. S. Sacher}, 26746 title = {On the Solution of Large Structured Complementarity Problems: The Block 26747 Partitioned Case}, 26748 journal = {Applied Mathematics and Optimization}, 26749 year = {1978}, 26750 volume = {4}, 26751 pages = {347--363} 26752} 26753 26754@Book{ cottle.pang.ea:linear, 26755 author = {R. W. Cottle and J. S. Pang and R. E. Stone}, 26756 title = {The Linear Complementarity Problem}, 26757 year = {1992}, 26758 publisher = {Academic Press}, 26759 address = {Boston} 26760} 26761 26762@Article{ cottle.pang.ea:sufficient, 26763 author = {R. W. Cottle and J. S. Pang and V. Venkateswaran}, 26764 title = {Sufficient Matrices and the Linear Complementarity Problem}, 26765 journal = {Linear Algebra and Its Applications}, 26766 year = {1989}, 26767 volume = {114/115}, 26768 pages = {231--249} 26769} 26770 26771@PhDThesis{ cottle:nonlinear, 26772 author = {R. W. Cottle}, 26773 title = {Nonlinear programs with positively bounded {J}acobians}, 26774 school = {Department of Mathematics, University of California}, 26775 year = {1964}, 26776 address = {Berkeley, California} 26777} 26778 26779@Article{ cottle:nonlinear*1, 26780 author = {R. W. Cottle}, 26781 title = {Nonlinear programs with positively bounded {J}acobians}, 26782 journal = {Journal of the Society for Industrial and Applied Mathematics}, 26783 volume = {14}, 26784 year = {1966}, 26785 pages = {147--158} 26786} 26787 26788@InCollection{ cottle:principal, 26789 author = {R. W. Cottle}, 26790 title = {The principal pivoting method of quadratic programming}, 26791 booktitle = {Mathematics of the Decision Sciences, Part 1}, 26792 publisher = {American Mathematical Society}, 26793 editor = {G. B. Dantzig and Jr. A. F. Veinott}, 26794 address = {Providence, Rhode Island}, 26795 year = {1968}, 26796 pages = {144--162} 26797} 26798 26799@Unpublished{ courant:calculus, 26800 author = {R. Courant}, 26801 title = {Calculus of Variations and Supplementary Notes and Exercises}, 26802 year = {1956}, 26803 note = {Supplementary notes by M. Kruskal and H. Rubin, revised and amended by J. Moser, 26804 New York University} 26805} 26806 26807@Article{ courant:variational, 26808 author = {R. Courant}, 26809 title = {Variational Methods for the Solution of Problems of Equilibrium and Vibration}, 26810 journal = {Bulletin of the American Mathematical Society}, 26811 year = {1943}, 26812 volume = {49}, 26813 pages = {1--23} 26814} 26815 26816@Book{ cristianini.shawe-taylor:introduction, 26817 author = {N. Cristianini and J. Shawe-Taylor}, 26818 title = {An Introduction to Support Vector Machines}, 26819 publisher = {Cambridge University Press}, 26820 address = {Cambridge}, 26821 year = {2000} 26822} 26823 26824@Article{ cromme:strong, 26825 author = {L. Cromme}, 26826 title = {Strong Uniqueness}, 26827 journal = {Numerische Mathematik}, 26828 year = {1978}, 26829 volume = {29}, 26830 pages = {179--193} 26831} 26832 26833@Article{ crowder.johnson.ea:solving, 26834 author = {H. Crowder and E. L. Johnson and M. W. Padberg}, 26835 title = {Solving Large Scale Zero-One Linear Programming Problems}, 26836 journal = {Operations Research}, 26837 year = {1983}, 26838 volume = {31}, 26839 pages = {803--834} 26840} 26841 26842@Article{ cryer.dempster:equivalence, 26843 author = {C. W. Cryer and M. A. H. Dempster}, 26844 title = {Equivalence of Linear Complementarity Problems and Linear Programs in Vector 26845 Lattice {H}ilbert Spaces}, 26846 journal = {SIAM Journal on Control and Optimization}, 26847 year = {1980}, 26848 volume = {18}, 26849 pages = {76--89} 26850} 26851 26852@Article{ cryer:method, 26853 author = {C. W. Cryer}, 26854 title = {The method of {C}hristopherson for solving free boundary problems for infinite 26855 journal bearings by means of finite differences}, 26856 journal = {Mathematics of Computation}, 26857 volume = {25}, 26858 year = {1971}, 26859 pages = {435--553} 26860} 26861 26862@Article{ cryer:solution, 26863 author = {C. W. Cryer}, 26864 title = {The Solution of a Quadratic Programming Problem Using Systematic Overrelaxation}, 26865 journal = {SIAM Journal on Control and Optimization}, 26866 year = {1971}, 26867 volume = {9}, 26868 pages = {385--392} 26869} 26870 26871@Article{ cryer:solution*1, 26872 author = {C. W. Cryer}, 26873 title = {The Solution of a Quadratic Programming Using Systematic Overrelaxation}, 26874 journal = {SIAM Journal on Control}, 26875 year = {1971}, 26876 volume = {9}, 26877 pages = {385--392} 26878} 26879 26880@Manual{ culler:split-c, 26881 author = {D. Culler}, 26882 title = {The Split--{C} Programming Language}, 26883 organization = {Computer Science Department, University of California, Berkeley} 26884} 26885 26886@InProceedings{ cun.denker.ea:optimal, 26887 author = {Y. le Cun and J. S. Denker and S. A. Solla}, 26888 title = {Optimal Brain Damage}, 26889 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 26890 year = {1990}, 26891 editor = {D. S. Touretzky}, 26892 publisher = {Morgan Kaufmann}, 26893 address = {San Mateo, California}, 26894 pages = {598--605} 26895} 26896 26897@TechReport{ czyzyk.mehrotra.ea:pcx, 26898 author = {J. Czyzyk and S. Mehrotra and S. J. Wright}, 26899 title = {{PCx} Users Guide}, 26900 institution = {Optimization Technology Center, Argonne National Laboratory and Northwestern 26901 University}, 26902 year = {1996}, 26903 type = {Technical Report}, 26904 number = {OTC 96/01} 26905} 26906 26907@TechReport{ czyzyk.mesnier.ea:network-enabled, 26908 address = {Argonne, Illinois}, 26909 author = {J. Czyzyk and M. P. Mesnier and J. J. Mor\'e}, 26910 institution = {Argonne National Laboratory}, 26911 number = {MCS-P615-0996}, 26912 title = {The {N}etwork-{E}nabled {O}ptimization {S}erver}, 26913 type = {Preprint}, 26914 year = {1996} 26915} 26916 26917@Article{ czyzyk.wisniewski.ea:optimization, 26918 title = {Optimization Case Studies in the {NEOS} Guide}, 26919 author = {J. Czyzyk and T. Wisniewski and S. J. Wright}, 26920 journal = {SIAM Review}, 26921 volume = {41}, 26922 pages = {148--163}, 26923 year = {1999} 26924} 26925 26926@Article{ dai.laan.ea:simplicial, 26927 author = {Y. Dai and G. van der Laan and A. J. J. Talman and Y. Yamamoto}, 26928 title = {A Simplicial Algorithm for the Nonlinear Stationary Problem on an Unbounded 26929 Polyhedron}, 26930 journal = {SIAM Journal on Optimization}, 26931 year = {1991}, 26932 volume = {1}, 26933 pages = {151--165} 26934} 26935 26936@Article{ dai.talman:linear, 26937 author = {Y. Dai and D. Talman}, 26938 title = {Linear Stationary Point Problems on Unbounded Polyhedra}, 26939 journal = {Mathematics of Operations Research}, 26940 year = {1993}, 26941 pages = {635--644} 26942} 26943 26944@Book{ daniel:approximate, 26945 author = {J. W. Daniel}, 26946 title = {The approximate minimization of functionals}, 26947 year = {1971}, 26948 publisher = {Prentice-Hall, Inc}, 26949 address = {Englewood Cliffs, New Jersey} 26950} 26951 26952@Article{ danskin:theory, 26953 author = {J. M. Danskin}, 26954 title = {The Theory of Min--Max, with Applications}, 26955 journal = {SIAM Journal on Applied Mathematics}, 26956 year = {1964}, 26957 volume = {14}, 26958 pages = {641--664} 26959} 26960 26961@Book{ danskin:theory*1, 26962 author = {J. M. Danskin}, 26963 title = {The Theory of Min--Max}, 26964 year = {1967}, 26965 publisher = {Springer-Verlag}, 26966 address = {New York} 26967} 26968 26969@InCollection{ dantzig.cottle:positive, 26970 author = {G. B. Dantzig and R. W. Cottle}, 26971 title = {Positive (semi-)definite programming}, 26972 booktitle = {Nonlinear Programming}, 26973 publisher = {North-Holland}, 26974 editor = {J. Abadie}, 26975 address = {Amsterdam}, 26976 year = {1967}, 26977 pages = {55--73} 26978} 26979 26980@Article{ dantzig.manne:complementarity, 26981 author = {G. B. Dantzig and A. S. Manne}, 26982 title = {A Complementarity Algorithm for an Optimal Captial Path with Invariant 26983 Proportions}, 26984 journal = {Journal of Economic Theory}, 26985 year = {1974}, 26986 volume = {9}, 26987 pages = {312--323} 26988} 26989 26990@Article{ dantzig.wolfe:decomposition, 26991 author = {G. B. Dantzig and P. Wolfe}, 26992 title = {Decomposition Principle for Linear Programs}, 26993 journal = {Operations Research}, 26994 year = {1960}, 26995 volume = {8}, 26996 pages = {101--111} 26997} 26998 26999@Book{ dantzig:linear, 27000 author = {G. B. Dantzig}, 27001 title = {Linear Programming and Extensions}, 27002 year = {1963}, 27003 publisher = {Princeton University Press}, 27004 address = {Princeton, New Jersey} 27005} 27006 27007@Manual{ dash:xpress-mp, 27008 title = {{XPRESS-MP} User Guide}, 27009 organization = {Dash Associates}, 27010 address = {Blisworth House, Blisworth, Northants, UK}, 27011 note = {http://www.dashopt.com/} 27012} 27013 27014@Book{ davis:handbook, 27015 author = {L. D. Davis}, 27016 title = {The Handbook of Genetic Algorithms}, 27017 year = {1990}, 27018 publisher = {Van Nostrand Reinhold} 27019} 27020 27021@TechReport{ davis:users, 27022 author = {T. A. Davis}, 27023 title = {Users' guide for the unsymmetric-pattern multifrontal Package ({UMFPACK})}, 27024 type = {{Technical Report}}, 27025 year = {1993}, 27026 institution = {Computer and Information Sciences Department, University of Florida}, 27027 address = {Gainesville, Florida} 27028} 27029 27030@TechReport{ dax:computation, 27031 author = {A. Dax}, 27032 title = {The Computation of Descent Directions at Degenerate Points}, 27033 institution = {Hydrological Service of Israel}, 27034 year = {1985}, 27035 type = {Technical Report} 27036} 27037 27038@Article{ dax:note, 27039 author = {A. Dax}, 27040 title = {A Note on Optimality Conditions for the Euclidean Multifacility Location 27041 Problem}, 27042 journal = {Mathematical Programming}, 27043 year = {1986}, 27044 volume = {36}, 27045 pages = {72--80} 27046} 27047 27048@Article{ deasy:multiple, 27049 author = {J. O. Deasy}, 27050 title = {Multiple local minima in radiotherapy optimization problems with dose volume 27051 constraints}, 27052 journal = {Medical Physics}, 27053 year = {1997}, 27054 optvolume = {24}, 27055 optnumber = {7}, 27056 optpages = {1157-1161} 27057} 27058 27059@Article{ deboor.ron:computational, 27060 author = {C. {deBoor} and A. Ron}, 27061 title = {Computational Aspects of Polynomial Interpolation in Several Variables}, 27062 journal = {Mathematics of Computation}, 27063 year = {1992}, 27064 volume = {58}, 27065 pages = {705--727} 27066} 27067 27068@Article{ debremaecker.ferris.ea:compressional, 27069 author = {J.--C. {De~Bremaecker} and M. C. Ferris and D. Ralph}, 27070 title = {Compressional Fractures considered as Contact Problems and Mixed Complementarity 27071 Problems}, 27072 year = {2000}, 27073 key = {82}, 27074 journal = {Engineering Fracture Mechanics}, 27075 volume = {66}, 27076 pages = {287--303} 27077} 27078 27079@Article{ debremaecker.ferris:comparison, 27080 author = {J.--C. {De~Bremaecker} and M. C. Ferris}, 27081 title = {A Comparison of Two Algorithms for Solving Closed Crack Problems}, 27082 year = {2000}, 27083 key = {90}, 27084 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/00-01.ps}, 27085 journal = {Engineering Fracture Mechanics}, 27086 volume = {66}, 27087 pages = {601--605}, 27088 institution = {Computer Sciences Department, University of Wisconsin}, 27089 address = {Madison, Wisconsin}, 27090 number = {00-01} 27091} 27092 27093@Article{ dedonato.maier:mathematical, 27094 author = {O. {De~Donato} and G. Maier}, 27095 title = {Mathematical programming methods for the inelastic analysis of reinforced 27096 concrete frames allowing for limited rotation capacity}, 27097 journal = {International Journal for Numerical Methods in Engineering}, 27098 volume = {4}, 27099 year = {1972}, 27100 pages = {307--329} 27101} 27102 27103@Book{ deimling:nonlinear, 27104 author = {K. Deimling}, 27105 title = {Nonlinear Functional Analysis}, 27106 publisher = {Springer-Verlag}, 27107 year = {1985} 27108} 27109 27110@PhDThesis{ dejong:analysis, 27111 author = {K. A. De~Jong}, 27112 title = {An Analysis of the Behavior of a Class of Genetic Adaptive Systems}, 27113 year = {1975}, 27114 school = {University of Michigan}, 27115 note = {Dissertation Abstracts International 36(10), 5140B} 27116} 27117 27118@Article{ deleone.mangasarian.ea:multi-sweep, 27119 author = {R. {De~Leone} and O. L. Mangasarian and T.-H. Shiau}, 27120 title = {Multi-Sweep Asynchronous Parallel Successive Overelaxation for the Nonsymmetric 27121 Linear Complementarity Problem}, 27122 journal = {Annals of Operations Research}, 27123 year = {1990}, 27124 volume = {22}, 27125 pages = {43--54} 27126} 27127 27128@InCollection{ deleone.mangasarian:serial, 27129 author = {R. {De~Leone} and O. L. Mangasarian}, 27130 title = {Serial and Parallel Solution of Large Scale Linear Programs by Augmented 27131 {L}agrangian Successive Overrelaxation}, 27132 booktitle = {Optimization, Parallel Processing and Applications}, 27133 publisher = {Springer-Verlag}, 27134 year = {1988}, 27135 editor = {A. Kurzhanski and K. Neumann and D. Pallaschke}, 27136 volume = {304}, 27137 series = {Lecture Notes in Economics and Mathematical Systems}, 27138 pages = {103--124}, 27139 address = {Berlin} 27140} 27141 27142@TechReport{ deluca.facchinei.ea:combining, 27143 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27144 title = {Combining Equation-Based Methods for the Solution of Large-Scale Nonlinear 27145 Complementarity Problems: Theory and Numerical Results}, 27146 type = {Preprint}, 27147 institution = {Institute of Applied Mathematics, University of Hamburg}, 27148 year = {1996} 27149} 27150 27151@TechReport{ deluca.facchinei.ea:general, 27152 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27153 title = {A General Framework for Solving Nonlinear Complementarity Problems: Theory and 27154 Numerical Results}, 27155 type = {Preprint}, 27156 institution = {Institute of Applied Mathematics, University of Hamburg}, 27157 year = {1997} 27158} 27159 27160@Article{ deluca.facchinei.ea:semismooth, 27161 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27162 title = {A Semismooth Equation Approach to the Solution of Nonlinear Complementarity 27163 Problems}, 27164 journal = {Mathematical Programming}, 27165 volume = {75}, 27166 pages = {407--439}, 27167 year = {1996} 27168} 27169 27170@Article{ deluca.facchinei.ea:theoretical, 27171 author = {T. {De~Luca} and F. Facchinei and C. Kanzow}, 27172 title = {A Theoretical and Numerical Comparison of some Semismooth Algorithms for 27173 Complementarity Problems}, 27174 year = {1999}, 27175 journal = {Computational Optimization and Applications, forthcoming} 27176} 27177 27178@Article{ demarzo.eaves:computing, 27179 author = {P. M. DeMarzo and B. C. Eaves}, 27180 title = {Computing Equilibria of {GEI} by Relocalization on a Grassmann Manifold}, 27181 journal = {Journal of Mathematical Economics}, 27182 year = {1996}, 27183 volume = {26}, 27184 pages = {479--497} 27185} 27186 27187@Article{ dembo.steihaug:truncated, 27188 author = {R. S. Dembo and T. Steihaug}, 27189 title = {Truncated {N}ewton Method Algorithms for Large--Scale Unconstrained 27190 Optimization}, 27191 journal = {Mathematical Programming}, 27192 year = {1983}, 27193 volume = {26}, 27194 pages = {190--212} 27195} 27196 27197@Article{ dembo:performance, 27198 author = {R. S. Dembo}, 27199 title = {The Performance of {NLPNET}, {A} Large--Scale Nonlinear Network Optimizer}, 27200 journal = {Mathematical Programming Study}, 27201 year = {1986}, 27202 volume = {26}, 27203 pages = {245--248} 27204} 27205 27206@Article{ demoor.vandenberghe.ea:generalized, 27207 author = {B. {De~Moor} and L. Vandenberghe and J. Vandewalle}, 27208 title = {The generalized linear complementarity problem and an algorithm to find all its 27209 solutions}, 27210 journal = {Mathematical Programming}, 27211 volume = {57}, 27212 year = {1992}, 27213 pages = {415--426} 27214} 27215 27216@Book{ demyanov.vasilev:nondifferentiable, 27217 author = {V. F. Dem\'{y}anov and L. V. Vasil\'{e}v}, 27218 title = {Nondifferentiable Optimization}, 27219 publisher = {Optimization Software, Inc.}, 27220 year = {1985}, 27221 address = {New York} 27222} 27223 27224@Article{ dennis.torczon:direct, 27225 author = {J. E. Dennis and V. Torczon}, 27226 title = {Direct Search Methods on Parallel Machines}, 27227 journal = {SIAM Journal on Optimization}, 27228 year = {1991}, 27229 volume = {1}, 27230 pages = {448--474} 27231} 27232 27233@TechReport{ depierro.iusem:convergence, 27234 author = {A. R. {De~Pierro} and A. N. Iusem}, 27235 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 27236 Linear Complementarity Problems}, 27237 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 27238 year = {1990}, 27239 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 27240} 27241 27242@Article{ depierro.iusem:relaxed, 27243 author = {A. R. {De~Pierro} and A. N. Iusem}, 27244 title = {A Relaxed Version of {B}regman's Method for Convex Programming}, 27245 journal = {Journal of Optimization Theory and Applications}, 27246 year = {1986}, 27247 volume = {51}, 27248 pages = {421--440} 27249} 27250 27251@Book{ dervis.melo.ea:general, 27252 author = {K. Dervis and J. de Melo and S. Robinson}, 27253 title = {General Equilibrium Models of Development Policy}, 27254 publisher = {Cambridge University Press}, 27255 year = {1982}, 27256 address = {Cambridge, England} 27257} 27258 27259@Article{ deschutter.demoor:minimal, 27260 author = {B. {De~Schutter} and B. {De~Moor}}, 27261 title = {Minimal Realization in the Max Algebra is an Extended Linear Complementarity 27262 Problem}, 27263 journal = {Systems \& Control Letters}, 27264 year = {1995}, 27265 pages = {103--111} 27266} 27267 27268@Article{ desilets.golden.ea:predicting, 27269 author = {L. DeSilets and B. Golden and Q. Wang and R. Kumar}, 27270 title = {Predicting Salinity in the {C}hesapeake {B}ay Using Backpropagation}, 27271 journal = {Computers \& Operations Research}, 27272 year = {1992}, 27273 volume = {19}, 27274 pages = {277--285} 27275} 27276 27277@PhDThesis{ desilva:sensitivity, 27278 author = {A. H. DeSilva}, 27279 title = {Sensitivity Formulas for Nonlinear Factorable Programming and their Application 27280 to the Solution of an Implicitly Defined Optimization Model of {US} Crude Oil 27281 Production}, 27282 school = {George Washington University}, 27283 address = {Washington, D.C.}, 27284 year = {1978} 27285} 27286 27287@TechReport{ dijkstra:cooperating, 27288 author = {E. W. Dijkstra}, 27289 title = {Cooperating Sequential Processes}, 27290 institution = {Technological University}, 27291 year = {1965}, 27292 address = {Eindhoven, The Netherlands}, 27293 number = {EWD--123}, 27294 type = {Technical Report} 27295} 27296 27297@Article{ dikin:iterative, 27298 author = {I. I. Dikin}, 27299 title = {Iterative Solution of Problems of Linear and Quadratic Programming}, 27300 journal = {Soviet Mathematics Doklady}, 27301 year = {1967}, 27302 volume = {8}, 27303 pages = {674--675} 27304} 27305 27306@InCollection{ dipillo.grippo.ea:class, 27307 author = {G. Di~Pillo and L. Grippo and F. Lampariello}, 27308 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 27309 booktitle = {System Modelling and Optimization}, 27310 year = {1981}, 27311 editor = {R. F. Drenick and F. Kozin}, 27312 publisher = {Springer-Verlag}, 27313 address = {Berlin} 27314} 27315 27316@Article{ dipillo.grippo:augmented, 27317 author = {G. Di~Pillo and L. Grippo}, 27318 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 27319 Problems}, 27320 journal = {Journal of Optimization Theory and Applications}, 27321 year = {1982}, 27322 volume = {36}, 27323 pages = {495--519} 27324} 27325 27326@Article{ dipillo.grippo:class, 27327 author = {G. Di~Pillo and L. Grippo}, 27328 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 27329 journal = {SIAM Journal on Control and Optimization}, 27330 year = {1979}, 27331 volume = {17}, 27332 pages = {618--628} 27333} 27334 27335@Article{ dipillo.grippo:continuously, 27336 author = {G. Di~Pillo and L. Grippo}, 27337 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 27338 Problems with Inequality Constraints}, 27339 journal = {SIAM Journal on Control and Optimization}, 27340 year = {1985}, 27341 volume = {23}, 27342 pages = {72--84} 27343} 27344 27345@Article{ dipillo.grippo:exact, 27346 author = {G. Di~Pillo and L. Grippo}, 27347 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 27348 Programming Problems}, 27349 journal = {Mathematical Programming}, 27350 year = {1986}, 27351 volume = {36}, 27352 pages = {1--18} 27353} 27354 27355@TechReport{ dirkse.ferris.ea:gams, 27356 author = {S. P. Dirkse and M. C. Ferris and P. V. Preckel and T. Rutherford}, 27357 title = {The {GAMS} Callable Program Library for Variational and Complementarity Solvers}, 27358 institution = {Computer Sciences Department, University of Wisconsin}, 27359 year = {1994}, 27360 address = {Madison, Wisconsin}, 27361 number = {94-07}, 27362 type = {Mathematical Programming Technical Report}, 27363 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-07.ps}, 27364 key = {25} 27365} 27366 27367@InProceedings{ dirkse.ferris:crash, 27368 crossref = {ferris.pang:complementarity}, 27369 author = {S. P. Dirkse and M. C. Ferris}, 27370 title = {Crash Techniques for Large-Scale Complementarity Problems}, 27371 pages = {40--61}, 27372 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/95-22.ps}, 27373 key = {52} 27374} 27375 27376@Article{ dirkse.ferris:mcplib, 27377 author = {S. P. Dirkse and M. C. Ferris}, 27378 title = {{MCPLIB}: {A} Collection of Nonlinear Mixed Complementarity Problems}, 27379 journal = {Optimization Methods and Software}, 27380 pages = {319--345}, 27381 volume = {5}, 27382 year = {1995}, 27383 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1994/tr1215.ps}, 27384 key = {36} 27385} 27386 27387@InCollection{ dirkse.ferris:modeling, 27388 author = {S. P. Dirkse and M. C. Ferris}, 27389 title = {Modeling and Solution Environments for {MPEC}: {GAMS} \& {MATLAB}}, 27390 year = {1999}, 27391 pages = {127--148}, 27392 editor = {M. Fukushima and L. Qi}, 27393 booktitle = {Reformulation: Nonsmooth, Piecewise Smooth, Semismooth and Smoothing Methods}, 27394 publisher = {Kluwer Academic Publishers}, 27395 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-09.ps}, 27396 key = {62} 27397} 27398 27399@Article{ dirkse.ferris:path, 27400 author = {S. P. Dirkse and M. C. Ferris}, 27401 title = {The {PATH} Solver: {A} Non-Monotone Stabilization Scheme for Mixed 27402 Complementarity Problems}, 27403 journal = {Optimization Methods and Software}, 27404 pages = {123--156}, 27405 volume = {5}, 27406 year = {1995}, 27407 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1993/tr1179.ps}, 27408 key = {33} 27409} 27410 27411@Article{ dirkse.ferris:pathsearch, 27412 author = {S. P. Dirkse and M. C. Ferris}, 27413 title = {A Pathsearch Damped {N}ewton Method for Computing General Equilibria}, 27414 journal = {Annals of Operations Research}, 27415 vol = {68}, 27416 year = {1996}, 27417 pages = {211--232}, 27418 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-03.ps}, 27419 key = {39} 27420} 27421 27422@InCollection{ dirkse.ferris:traffic, 27423 author = {S. P. Dirkse and M. C. Ferris}, 27424 title = {Traffic Modeling and Variational Inequalities using {GAMS}}, 27425 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 27426 Management}, 27427 publisher = {Springer-Verlag}, 27428 year = {1998}, 27429 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte}, 27430 series = {NATO ASI Series F}, 27431 volume = {166}, 27432 pages = {136--163}, 27433 key = {61}, 27434 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-06.ps} 27435} 27436 27437@PhDThesis{ dirkse:robust, 27438 author = {S. P. Dirkse}, 27439 title = {Robust Solution of Mixed Complementarity Problems}, 27440 school = {Computer Sciences Department, University of Wisconsin}, 27441 year = {1994}, 27442 address = {Madison, Wisconsin}, 27443 note = {Available from ftp://ftp.cs.wisc.edu/math-prog/tech-reports/}, 27444 annote = {Mathematical Programming Technical Report 94-12} 27445} 27446 27447@TechReport{ dixon.mills:neural, 27448 author = {L. C. Dixon and D. J. Mills}, 27449 title = {Neural Nets for Massively Parallel Optimisation}, 27450 institution = {Hatfield Polytechnic}, 27451 year = {1992}, 27452 address = {Hatfield, Hertforshire, England}, 27453 number = {Numerical Optimisation Centre Technical Report No. 259} 27454} 27455 27456@Article{ dontchev:local, 27457 author = {A. L. Dontchev}, 27458 title = {Local Convergence of the {N}ewton method for Generalized Equations}, 27459 journal = {C.R. Acad. Sci. Paris Series I}, 27460 year = {1996}, 27461 volume = {332}, 27462 pages = {327--331} 27463} 27464 27465@Article{ douglas.rachford:numerical, 27466 author = {J. Douglas and H. H. Rachford}, 27467 title = {On the Numerical Solution of Heat Conduction Problems in Two and Three Space 27468 Variables}, 27469 journal = {Transactions of the American Mathematical Society}, 27470 year = {1956}, 27471 volume = {82}, 27472 pages = {421--439} 27473} 27474 27475@Article{ drud:conopt, 27476 author = {A. Drud}, 27477 title = {{CONOPT}: {A} {GRG} Code for Large Sparse Dynamic Nonlinear Optimization 27478 Problems}, 27479 journal = {Mathematical Programming}, 27480 year = {1985}, 27481 volume = {31}, 27482 pages = {153--191} 27483} 27484 27485@Article{ dsouza.meyer.ea:mixed, 27486 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27487 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27488 Optimization}, 27489 journal = {Medical Physics}, 27490 year = {1999}, 27491 key = {85}, 27492 volume = {26}, 27493 number = {6}, 27494 pages = {1099} 27495} 27496 27497@TechReport{ dsouza.meyer.ea:mixed*1, 27498 author = {W. D. D'Souza and R. R. Meyer and M. C. Ferris and B. R. Thomadsen}, 27499 title = {Mixed Integer Programming Models for Prostate Brachytherapy Treatment 27500 Optimization}, 27501 year = {1999}, 27502 key = {87}, 27503 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-08.ps}, 27504 institution = {Computer Sciences Department, University of Wisconsin}, 27505 address = {Madison, Wisconsin}, 27506 number = {99-08}, 27507 type = {Mathematical Programming Technical Report}, 27508 annote = {Submitted to } 27509} 27510 27511@Article{ dsouza.meyer.ea:iterative, 27512 author = {W. D. D'Souza and R. R. Meyer and B. R. Thomadsen and M. C. Ferris}, 27513 title = {An Iterative Sequential Mixed-Integer Approach to Automated Prostate 27514 Brachytherapy Treatment Optimization}, 27515 year = {2000}, 27516 key = {96}, 27517 journal = {Physics and Medicine in Biology, forthcoming} 27518} 27519 27520@Article{ du.yu.ea:multileaf, 27521 author = {M. N. Du and C. X. Yu and M. Symons and D. Yan and R. Taylor and R. C. Matter and 27522 G. Gustafson and A. Martinez and J. W. Wong}, 27523 title = {A multileaf collimator field prescription preparation system for conventional 27524 radiotherapy}, 27525 journal = {International Journal of Radiation Oncology, Biology and Physics}, 27526 year = {1994}, 27527 volume = {30}, 27528 number = {3}, 27529 pages = {707--714} 27530} 27531 27532@Article{ duda.fossum:pattern, 27533 author = {R. O. Duda and H. Fossum}, 27534 title = {Pattern Classification by Iteratively Determined Linear and Piecewise Linear 27535 Discriminant Functions}, 27536 journal = {IEEE Transactions on Electronic Computers}, 27537 year = {1966}, 27538 volume = {15}, 27539 pages = {220--232} 27540} 27541 27542@Book{ duda.hart:pattern, 27543 author = {R. O. Duda and P. E. Hart}, 27544 title = {Pattern Classification and Scene Analysis}, 27545 year = {1973}, 27546 publisher = {John Wiley \& Sons}, 27547 address = {New York} 27548} 27549 27550@Book{ duff.erisman.ea:direct, 27551 author = {I. S. Duff and A. M. Erisman and J. K. Reid}, 27552 title = {Direct Methods for Sparse Matrices}, 27553 publisher = {Oxford University Press}, 27554 year = {1986}, 27555 address = {Oxford, England} 27556} 27557 27558@InCollection{ duffin:infinite, 27559 author = {R. J. Duffin}, 27560 title = {Infinite Programs}, 27561 booktitle = {Linear Inequalities and Related Systems}, 27562 year = {1975}, 27563 editor = {H. W. Kuhn and A. W. Tucker}, 27564 publisher = {Princeton University Press}, 27565 address = {Princeton, New Jersey}, 27566 pages = {157--170} 27567} 27568 27569@Article{ dunn.sachs:effect, 27570 author = {J. C. Dunn and E. Sachs}, 27571 title = {The Effect of Perturbations on the Convergence Rates of Optimization Algorithms}, 27572 journal = {Applied Mathematics and Optimization}, 27573 year = {1983}, 27574 volume = {10}, 27575 pages = {143--157} 27576} 27577 27578@Article{ dunn:convergence, 27579 author = {J. C. Dunn}, 27580 title = {On the Convergence of Projected Gradient Processes to Singular Critical Points}, 27581 journal = {Journal of Optimization Theory and Applications}, 27582 year = {1987}, 27583 volume = {55}, 27584 pages = {203--216} 27585} 27586 27587@Article{ dunn:global, 27588 author = {J. C. Dunn}, 27589 title = {Global and Asymptotic Convergence Rate Estimates for a Class of Projected 27590 Gradient Processes}, 27591 journal = {SIAM Journal on Control and Optimization}, 27592 year = {1981}, 27593 volume = {19}, 27594 pages = {368--400} 27595} 27596 27597@Article{ dunn:rates, 27598 author = {J. C. Dunn}, 27599 title = {Rates of Convergence for Conditional Gradient Algorithms Near Singular and 27600 Nonsingular Extremals}, 27601 journal = {SIAM Journal on Control and Optimization}, 27602 year = {1979}, 27603 volume = {17}, 27604 pages = {187--211} 27605} 27606 27607@Article{ dupuis.simha:sampling, 27608 author = {P. Dupuis and R. Simha}, 27609 title = {On Sampling-Controlled Stochastic Approximation}, 27610 journal = {{IEEE} Transactions on Automatic Control}, 27611 year = {1991}, 27612 volume = {36}, 27613 pages = {915--924} 27614} 27615 27616@TechReport{ eager.ferris.ea:models, 27617 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27618 title = {Models for Optimized Regional Caching in Heterogeneous Video-On-Demand Systems}, 27619 institution = {Computer Sciences Department, University of Wisconsin}, 27620 year = {1999}, 27621 type = {Technical Report}, 27622 number = {1402}, 27623 address = {Madison, Wisconsin}, 27624 url = {http: //www.cs.wisc.edu/tech-reports/reports/1999/tr1402.ps.Z}, 27625 key = {84} 27626} 27627 27628@InProceedings{ eager.ferris.ea:optimized, 27629 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27630 title = {Optimized Regional Caching for On-Demand Data Delivery}, 27631 year = {1999}, 27632 booktitle = {Multimedia Computing and Networking, Proceedings of {SPIE}}, 27633 volume = {3654}, 27634 address = {Bellingham, Washington}, 27635 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-10.ps}, 27636 key = {69}, 27637 pages = {301--316}, 27638 annote = {18 percent acceptance rate} 27639} 27640 27641@Article{ eager.ferris.ea:optimized*1, 27642 author = {D. L. Eager and M. C. Ferris and M. K. Vernon}, 27643 title = {Optimized Caching in Systems with Heterogeneous Client Populations}, 27644 journal = {Performance Evaluation}, 27645 year = {2000}, 27646 key = {72}, 27647 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-15.ps}, 27648 volume = {42}, 27649 pages = {163--185} 27650} 27651 27652@InProceedings{ eager.vernon:dynamic, 27653 author = {D. L. Eager and M. K. Vernon}, 27654 title = {Dynamic Skyscraper Broadcasts for Video-On-Demand}, 27655 year = {1998}, 27656 booktitle = {Proceedings of the 4th International Workshop on Multimedia Information Systems 27657 ({MIS '98})}, 27658 pages = {18--32}, 27659 address = {Istanbul, Turkey} 27660} 27661 27662@Article{ eaves.lemke:equivalence, 27663 author = {B. C. Eaves and C. E. Lemke}, 27664 title = {Equivalence of {LCP} and {PLS}}, 27665 journal = {Mathematics of Operations Research}, 27666 year = {1981}, 27667 volume = {6}, 27668 pages = {475--484} 27669} 27670 27671@Article{ eaves.rothblum:relationships, 27672 author = {B. C. Eaves and U. G. Rothblum}, 27673 title = {Relationships of Properties of Piecewise Affine Maps over Ordered Fields}, 27674 journal = {Linear Algebra and Its Applications}, 27675 year = {1990}, 27676 volume = {132}, 27677 pages = {1--63} 27678} 27679 27680@Article{ eaves:basic, 27681 author = {B. C. Eaves}, 27682 title = {On the Basic Theorem of Complementarity}, 27683 journal = {Mathematical Programming}, 27684 year = {1971}, 27685 volume = {1}, 27686 pages = {68--87} 27687} 27688 27689@Article{ eaves:computing, 27690 author = {B. C. Eaves}, 27691 title = {Computing Stationary Points}, 27692 journal = {Mathematical Programming Study}, 27693 year = {1978}, 27694 volume = {7}, 27695 pages = {1--14} 27696} 27697 27698@InCollection{ eaves:computing*1, 27699 author = {B. C. Eaves}, 27700 title = {Computing Stationary Points, Again}, 27701 pages = {391--405}, 27702 crossref = {mangasarian.meyer.ea:nonlinear*3} 27703} 27704 27705@Article{ eaves:homotopies, 27706 author = {B. C. Eaves}, 27707 title = {Homotopies for Computation of Fixed Points}, 27708 journal = {Mathematical Programming}, 27709 year = {1972}, 27710 volume = {3}, 27711 pages = {1--22} 27712} 27713 27714@Article{ eaves:linear, 27715 author = {B. C. Eaves}, 27716 title = {The Linear Complementarity Problem}, 27717 journal = {Management Science}, 27718 year = {1971}, 27719 volume = {17}, 27720 pages = {612--634} 27721} 27722 27723@Article{ eaves:quadratic, 27724 author = {B. C. Eaves}, 27725 title = {On Quadratic Programming}, 27726 journal = {Management Science}, 27727 year = {1971}, 27728 volume = {17}, 27729 pages = {698--711} 27730} 27731 27732@InProceedings{ eaves:short, 27733 author = {B. C. Eaves}, 27734 title = {A Short Course in Solving Equations with {PL} Homotopies}, 27735 booktitle = {Nonlinear Programming}, 27736 organization = {American Mathematical Society}, 27737 year = {1976}, 27738 editor = {R. W. Cottle and C. E. Lemke}, 27739 publisher = {SIAM--AMS Proceedings}, 27740 address = {Providence, RI}, 27741 pages = {73--143} 27742} 27743 27744@InCollection{ ebiefung.kostreva:global, 27745 author = {A. A. Ebiefung and M. M. Kostreva}, 27746 title = {Global Solvability of Generalized Linear Complementarity Problems and a Related 27747 Class of Polynomial Complementarity Problems}, 27748 editors = {C. Floudas and P. Pardalos}, 27749 booktitle = {Recent Advances in Global Optimization}, 27750 publisher = {Princeton University Press}, 27751 pages = {102--124}, 27752 year = {1991} 27753} 27754 27755@TechReport{ ebiefung.kostreva:z-matrices, 27756 author = {A. A. Ebiefung and M. M. Kostreva}, 27757 title = {{Z}--Matrices annd the Generalized Linear Complementarity Problem}, 27758 institution = {Department of Mathematical Sciences, Clemson University}, 27759 year = {1991}, 27760 number = {608}, 27761 address = {Clemson, South Carolina} 27762} 27763 27764@TechReport{ eckstein.bertsekas:alternating, 27765 author = {J. Eckstein and D. P. Bertsekas}, 27766 title = {An Alternating Direction Method for Linear Programming}, 27767 institution = {Harvard Business School}, 27768 year = {1990}, 27769 type = {Working Paper}, 27770 number = {90-063}, 27771 address = {Boston, MA} 27772} 27773 27774@Article{ eckstein.bertsekas:douglas-rachford, 27775 author = {J. Eckstein and D. P. Bertsekas}, 27776 title = {On the {D}ouglas-{R}achford Splitting Method and the Proximal Point Algorithm for 27777 Maximal Monotone Operators}, 27778 journal = {Mathematical Programming}, 27779 year = {1992}, 27780 pages = {293--318}, 27781 volume = {55} 27782} 27783 27784@Article{ eckstein.bertsekas:douglas-rachford*1, 27785 author = {J. Eckstein and D. P. Bertsekas}, 27786 title = {On the {D}ouglas--{R}achford Splitting Method and the Proximal Point Algorithm 27787 for Maximal Monotone Operators}, 27788 journal = {Mathematical Programming}, 27789 year = {1991}, 27790 note = {To appear} 27791} 27792 27793@TechReport{ eckstein.ferris:operator, 27794 author = {J. Eckstein and M. C. Ferris}, 27795 title = {Operator Splitting Methods for Monotone Linear Complementarity Problems}, 27796 institution = {Thinking Machines Corporation}, 27797 year = {1992}, 27798 address = {Cambridge, MA 02142}, 27799 number = {239}, 27800 type = {TMC}, 27801 key = {26} 27802} 27803 27804@Article{ eckstein.ferris:operator*1, 27805 author = {J. Eckstein and M. C. Ferris}, 27806 title = {Operator Splitting Methods for Monotone Affine Variational Inequalities, with a 27807 Parallel Application to Optimal Control}, 27808 volume = {10}, 27809 pages = {218--235}, 27810 year = {1998}, 27811 journal = {INFORMS Journal on Computing}, 27812 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-17.ps}, 27813 key = {44} 27814} 27815 27816@Article{ eckstein.ferris:smooth, 27817 author = {J. Eckstein and M. C. Ferris}, 27818 title = {Smooth Methods of Multipliers for Complementarity Problems}, 27819 key = {58}, 27820 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-01.ps}, 27821 year = {1999}, 27822 journal = {Mathematical Programming}, 27823 volume = {86}, 27824 pages = {65--90} 27825} 27826 27827@InProceedings{ eckstein.hart.ea:resource, 27828 author = {J. Eckstein and W. E. Hart and C. A. Phillips}, 27829 title = {Resource Management in a Parallel Mixed Integer Programming Package}, 27830 booktitle = {Intel Supercomputer Users Group Thirteenth Annual Conference}, 27831 year = {1997}, 27832 note = {www.cs.sandia.gov/ISUG97} 27833} 27834 27835@Article{ eckstein:alternating, 27836 author = {J. Eckstein}, 27837 title = {The Alternating Step Method for Monotropic Programming on the {Connection Machine 27838 CM-2}}, 27839 journal = {ORSA Journal on Computing}, 27840 year = {to appear} 27841} 27842 27843@Article{ eckstein:approximate, 27844 author = {J. Eckstein}, 27845 title = {Approximate Iterations in {B}regman-Function-Based Proximal Algorithms}, 27846 year = {1998}, 27847 journal = {Mathematical Programming}, 27848 volume = {83}, 27849 pages = {113--124} 27850} 27851 27852@Article{ eckstein:communication, 27853 author = {J. Eckstein}, 27854 title = {How Much Communication Does Parallel Branch and Bound Need}, 27855 journal = {{INFORMS} Journal on Computing}, 27856 volume = {9}, 27857 year = {1997}, 27858 pages = {15--29} 27859} 27860 27861@Article{ eckstein:distributed, 27862 author = {J. Eckstein}, 27863 title = {Distributed Versus Centralized Control for Parallel Branch and Bound: {M}ixed 27864 Integer Programming on the {CM}-5}, 27865 journal = {Computational Optimization and Applications}, 27866 volume = {7}, 27867 pages = {199--220}, 27868 year = {1997} 27869} 27870 27871@TechReport{ eckstein:lions-mercier, 27872 author = {J. Eckstein}, 27873 title = {The {L}ions--{M}ercier Splitting Algorithm and the Alternating Direction Method 27874 as instances of the Proximal Point Algorithm}, 27875 institution = {MIT}, 27876 year = {1988}, 27877 address = {Cambridge, Massachusetts}, 27878 number = {LIDS-P-1769} 27879} 27880 27881@Article{ eckstein:nonlinear, 27882 author = {J. Eckstein}, 27883 title = {Nonlinear Proximal Point Algorithms Using {B}regman Functions, with Applications 27884 to Convex Programming}, 27885 journal = {Mathematics of Operations Research}, 27886 year = {1993}, 27887 pages = {202--226}, 27888 volume = {18} 27889} 27890 27891@Article{ eckstein:parallel, 27892 author = {J. Eckstein}, 27893 title = {Parallel Branch-and-Bound Algorithms for General Mixed Integer Programming on the 27894 {CM}-5}, 27895 journal = {SIAM Journal on Optimization}, 27896 volume = {4}, 27897 pages = {794--814}, 27898 year = {1994} 27899} 27900 27901@TechReport{ eckstein:smooth, 27902 author = {J. Eckstein}, 27903 title = {Smooth Methods of Multipliers for Monotone Complementarity Problems}, 27904 institution = {Rutgers Center for Operations Research, Rutgers University}, 27905 address = {New Brunswick, New Jersey}, 27906 year = {1996}, 27907 type = {Research Report}, 27908 number = {27-96} 27909} 27910 27911@PhDThesis{ eckstein:splitting, 27912 author = {J. Eckstein}, 27913 title = {Splitting Methods for Monotone Operators, with Applications to Parallel 27914 Optimization}, 27915 school = {Massachusetts Institute of Technology}, 27916 year = {1989}, 27917 address = {Cambridge, MA}, 27918 note = {Report LIDS-TH-1877, Laboratory for Information and Decision Systems, M.I.T.} 27919} 27920 27921@Article{ eglese:simulated, 27922 author = {R. W. Eglese}, 27923 title = {Simulated Annealing: {A} Tool for Operational Research}, 27924 journal = {European Journal of Operations Research}, 27925 year = {1990}, 27926 volume = {46}, 27927 pages = {271--281} 27928} 27929 27930@Book{ ekeland.temam:convex, 27931 author = {I. Ekeland and R. Temam}, 27932 title = {Convex Analysis and Variational Problems}, 27933 year = {1976}, 27934 publisher = {North--Holland}, 27935 address = {Amsterdam} 27936} 27937 27938@Article{ ekeland:variational, 27939 author = {I. Ekeland}, 27940 title = {On the Variational Principle}, 27941 journal = {Journal of Mathematical Analysis and Applications}, 27942 year = {1974}, 27943 volume = {47}, 27944 pages = {324--353} 27945} 27946 27947@TechReport{ el-bakry.tapia.ea:formulation, 27948 author = {A. S. El-Bakry and R. A. Tapia and T. Tsuchiya and Y. Zhang}, 27949 title = {On the formulation and theory of the primal-dual {N}ewton interior-point method 27950 for nonlinear programming}, 27951 type = {{Technical Report TR92-40}}, 27952 institution = {{Department of Computational and Applied Mathematics, Rice University}}, 27953 year = {1992} 27954} 27955 27956@Article{ eldersveld.saunders:block, 27957 author = {S. K. Eldersveld and M. A. Saunders}, 27958 title = {A Block-{LU} Update for Large--Scale Linear Programming}, 27959 journal = {SIAM Journal on Matrix Analysis and Applications}, 27960 year = {1992}, 27961 volume = {13}, 27962 pages = {191--201} 27963} 27964 27965@Article{ elster.neumaier:grid, 27966 author = {C. Elster and A. Neumaier}, 27967 title = {A Grid Algorithm for Bound Constrained Optimization of Noisy Functions}, 27968 journal = {{IMA} Journal of Numerical Analysis}, 27969 year = {1995}, 27970 volume = {15}, 27971 pages = {585--608} 27972} 27973 27974@Article{ epema.livny.ea:worldwide, 27975 author = {D. H. J. Epema and M. Livny and R. van Dantzig and X. Evers and J. Pruyne}, 27976 title = {A Worldwide Flock of Condors: Load Sharing among Workstation Clusters}, 27977 journal = {Journal on Future Generations of Computer Systems}, 27978 year = {1996}, 27979 volume = {12}, 27980 pages = {53--65} 27981} 27982 27983@Book{ ermoliev.editors:numerical, 27984 author = {Y. Ermoliev and R. J.-B. Wets {(editors)}}, 27985 title = {Numerical Techniques for Stochastic Optimization Problems}, 27986 year = {1988}, 27987 publisher = {Springer-Verlag}, 27988 address = {Berlin} 27989} 27990 27991@TechReport{ evett.spiehler:rule, 27992 author = {I. W. Evett and E. J. Spiehler}, 27993 title = {Rule Induction in Forensic Science}, 27994 institution = {Central Research Establishment, Home Office Forensic Science Service}, 27995 year = {1987}, 27996 address = {Aldermaston, Reading, Berkshire RG7 4PN}, 27997 type = {Technical Report} 27998} 27999 28000@Article{ evtushenko.purtov:sufficient, 28001 author = {Y. G. Evtushenko and V. A. Purtov}, 28002 title = {Sufficient Conditions for a Minimum for Nonlinear Programming Problems}, 28003 journal = {Soviet Mathematics Doklady}, 28004 year = {1984}, 28005 volume = {30}, 28006 pages = {313--316} 28007} 28008 28009@Article{ facchinei.fischer.ea:regularity, 28010 author = {F. Facchinei and A. Fischer and C. Kanzow}, 28011 title = {Regularity Properties of a Semismooth Reformulation of Variational Inequalities}, 28012 journal = {SIAM Journal on Optimization}, 28013 year = {1998}, 28014 volume = {8}, 28015 pages = {850--869} 28016} 28017 28018@Article{ facchinei.fischer.ea:semismooth, 28019 title = {A Semismooth {N}ewton Method for Variational Inequalities: {T}he Case of Box 28020 Constraints}, 28021 author = {Facchinei, Francisco and Fischer, Andreas and Kanzow, Christian}, 28022 journal = {Complementarity and Variational Problems: State of the Art}, 28023 volume = {92}, 28024 pages = {76}, 28025 year = {1997} 28026} 28027 28028@TechReport{ facchinei.fischer.ea:simply, 28029 author = {F. Facchinei and A. Fischer and C. Kanzow and J. -M. Peng}, 28030 title = {A Simply Constrained Optimization Reformulation of {KKT} Systems Arising from 28031 Variational Inequalities}, 28032 institution = {University of Hamburg}, 28033 year = {1996} 28034} 28035 28036@Article{ facchinei.jiang.ea:smoothing, 28037 author = {F. Facchinei and H. Jiang and L. Qi}, 28038 title = {A Smoothing Method for Mathematical Programs with Equilibrium Constraints}, 28039 year = {1999}, 28040 journal = {Mathematical Programming}, 28041 volume = {85}, 28042 pages = {107--134} 28043} 28044 28045@Article{ facchinei.kanzow:nonsmooth, 28046 author = {F. Facchinei and C. Kanzow}, 28047 title = {A Nonsmooth Inexact {N}ewton Method for the solution of Large-Scale Nonlinear 28048 Complementarity Problems}, 28049 year = {1997}, 28050 journal = {Mathematical Programming}, 28051 volume = {76}, 28052 pages = {493--512} 28053} 28054 28055@Article{ facchinei.kanzow:unconstrained, 28056 author = {F. Facchinei and C. Kanzow}, 28057 title = {On Unconstrained and Constrained Stationary Points of the {I}mplicit 28058 {L}agrangian}, 28059 year = {1997}, 28060 journal = {Journal of Optimization Theory and Applications}, 28061 volume = {92}, 28062 pages = {99--115} 28063} 28064 28065@TechReport{ facchinei.pang:total, 28066 author = {F. Facchinei and J. S. Pang}, 28067 title = {Total stability of variational inequalities}, 28068 institution = {Universit\'a di Roma ``La Sapienza'', Dipartimento di Informatica e Sistemistica}, 28069 year = {1988}, 28070 type = {Manuscript}, 28071 address = {Roma, Italy} 28072} 28073 28074@Article{ facchinei.soares:merit, 28075 author = {F. Facchinei and J. Soares}, 28076 title = {A New Merit Function for Nonlinear Complementarity Problems and a Related 28077 Algorithm}, 28078 journal = {SIAM Journal on Optimization}, 28079 year = {1997}, 28080 volume = {7}, 28081 pages = {225--247} 28082} 28083 28084@InCollection{ facchinei.soares:testing, 28085 author = {F. Facchinei and J. Soares}, 28086 title = {Testing a new class of algorithms for nonlinear complementarity problems}, 28087 booktitle = {Variational Inequalities and Network Equilibrium Problems}, 28088 publisher = {Plenum Press}, 28089 address = {New York}, 28090 editor = {F. Giannessi and A. Maugeri}, 28091 year = {1995}, 28092 pages = {69--83} 28093} 28094 28095@InProceedings{ fahlman.lebiere:cascade-correlation, 28096 author = {S. E. Fahlman and C. Lebiere}, 28097 title = {The cascade-correlation learning architecture}, 28098 booktitle = {Advances in Neural Information Processing Systems II {(Denver 1989)}}, 28099 year = {1990}, 28100 editor = {D. S. Touretzky}, 28101 publisher = {Morgan Kaufmann}, 28102 address = {San Mateo, California}, 28103 pages = {524--532} 28104} 28105 28106@InProceedings{ fang.geiser.ea:software, 28107 author = {G. Fang and B. Geiser and T. R. Mackie}, 28108 title = {Software system for {UW}/{GE} tomotherapy prototype}, 28109 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 28110 Radiation Therapy, Salt Lake City}, 28111 year = {1997}, 28112 editor = {D. D. Leavitt and G. Starkshall}, 28113 publisher = {Medical Physics Publishing}, 28114 address = {St. Louis, Missouri}, 28115 pages = {332--334} 28116} 28117 28118@Book{ fang.puthenpura:linear, 28119 author = {S.--C. Fang and S. Puthenpura}, 28120 title = {Linear Optimization and Extensions}, 28121 year = {1993}, 28122 publisher = {Prentice-Hall, Inc}, 28123 address = {Englewood Cliffs, New Jersey} 28124} 28125 28126@Article{ fayard.plateau:algorithm, 28127 author = {D. Fayard and G. Plateau}, 28128 title = {An Algorithm for the Solution of the 0--1 Knapsack Problem}, 28129 journal = {Computing}, 28130 year = {1982}, 28131 volume = {28}, 28132 pages = {269--287} 28133} 28134 28135@Book{ feller:introduction, 28136 author = {W. Feller}, 28137 title = {An Introduction to Probability Theory and its Applications}, 28138 publisher = {John Wiley \& Sons}, 28139 year = {1968}, 28140 address = {New York} 28141} 28142 28143@Article{ ferris.fourer.ea:expressing, 28144 author = {M. C. Ferris and R. Fourer and D. M. Gay}, 28145 title = {Expressing Complementarity Problems and Communicating them to Solvers}, 28146 journal = {SIAM Journal on Optimization}, 28147 volume = {9}, 28148 pages = {991--1009}, 28149 year = {1999}, 28150 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-02.ps}, 28151 key = {65}, 28152 institution = {Computer Sciences Department, University of Wisconsin}, 28153 address = {Madison, Wisconsin}, 28154 number = {98-02}, 28155 type = {Mathematical Programming Technical Report} 28156} 28157 28158@TechReport{ ferris.horn:nlp2mcp, 28159 author = {M. C. Ferris and J. D. Horn}, 28160 title = {{NLP2MCP}: Automatic conversion of nonlinear programs into mixed complementarity 28161 problems}, 28162 year = {1998}, 28163 institution = {Computer Sciences Department, University of Wisconsin}, 28164 note = {In preparation} 28165} 28166 28167@Article{ ferris.horn:partitioning, 28168 author = {M. C. Ferris and J. D. Horn}, 28169 title = {Partitioning Mathematical Programs for Parallel Solution}, 28170 year = {1998}, 28171 volume = {80}, 28172 pages = {35--62}, 28173 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/tr1232.ps}, 28174 journal = {Mathematical Programming}, 28175 key = {40} 28176} 28177 28178@Article{ ferris.kanzow.ea:feasible, 28179 author = {M. C. Ferris and C. Kanzow and T. S. Munson}, 28180 title = {Feasible Descent Algorithms for Mixed Complementarity Problems}, 28181 year = {1999}, 28182 journal = {Mathematical Programming}, 28183 volume = {86}, 28184 pages = {475--497}, 28185 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-04.ps}, 28186 key = {67} 28187} 28188 28189@InCollection{ ferris.kanzow:complementarity, 28190 author = {M. C. Ferris and C. Kanzow}, 28191 title = {Complementarity and Related Problems: {A} Survey}, 28192 booktitle = {Handbook of Applied Optimization, forthcoming}, 28193 key = {74}, 28194 publisher = {Oxford University Press}, 28195 year = {2000}, 28196 editor = {P. M. Pardalos and M. G. C. Resende}, 28197 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-17.ps}, 28198 institution = {Computer Sciences Department, University of Wisconsin}, 28199 address = {Madison, Wisconsin}, 28200 number = {98-17}, 28201 type = {Mathematical Programming Technical Report} 28202} 28203 28204@Article{ ferris.lucidi.ea:nonmonotone, 28205 author = {M. C. Ferris and S. Lucidi and M. Roma}, 28206 title = {Nonmonotone Curvilinear Stabilization Techniques for Unconstrained Optimization}, 28207 journal = {Computational Optimization and Applications}, 28208 volume = {6}, 28209 pages = {117--136}, 28210 year = {1996}, 28211 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/94-16.ps}, 28212 key = {43} 28213} 28214 28215@TechReport{ ferris.lucidi:globally, 28216 author = {M. C. Ferris and S. Lucidi}, 28217 title = {Globally Convergent Methods for Nonlinear Equations}, 28218 institution = {Computer Sciences Department, University of Wisconsin}, 28219 year = {1991}, 28220 address = {Madison, Wisconsin}, 28221 number = {1030}, 28222 url = {ftp: //ftp.cs.wisc.edu/tech-reports/reports/1991/tr1030.ps}, 28223 key = {21} 28224} 28225 28226@Article{ ferris.lucidi:nonmonotone, 28227 author = {M. C. Ferris and S. Lucidi}, 28228 title = {Nonmonotone Stabilization Methods for Nonlinear Equations}, 28229 journal = {Journal of Optimization Theory and Applications}, 28230 year = {1994}, 28231 volume = {81}, 28232 pages = {53--71}, 28233 key = {30} 28234} 28235 28236@Article{ ferris.mangasarian:breast, 28237 author = {M. C. Ferris and O. L. Mangasarian}, 28238 title = {Breast Cancer Diagnosis via Linear Programming}, 28239 key = {50}, 28240 journal = {{IEEE} Computational Science and Engineering}, 28241 year = {1995}, 28242 volume = {2}, 28243 pages = {70--71} 28244} 28245 28246@Article{ ferris.mangasarian:error, 28247 author = {M. C. Ferris and O. L. Mangasarian}, 28248 title = {Error Bounds and Strong Upper Semicontinuity for Monotone Affine Variational 28249 Inequalities}, 28250 journal = {Annals of Operations Research}, 28251 year = {1993}, 28252 volume = {47}, 28253 pages = {293--305}, 28254 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1056a.ps}, 28255 key = {24} 28256} 28257 28258@Article{ ferris.mangasarian:finite, 28259 author = {M. C. Ferris and O. L. Mangasarian}, 28260 title = {Finite Perturbation of Convex Programs}, 28261 journal = {Applied Mathematics and Optimization}, 28262 year = {1991}, 28263 volume = {23}, 28264 pages = {263--273}, 28265 key = {08} 28266} 28267 28268@Book{ ferris.mangasarian:linear, 28269 author = {M. C. Ferris and O. L. Mangasarian}, 28270 title = {Linear Programming via {MATLAB}}, 28271 publisher = {in preparation}, 28272 year = {1995}, 28273 address = {Madison, Wisconsin} 28274} 28275 28276@Article{ ferris.mangasarian:minimum, 28277 author = {M. C. Ferris and O. L. Mangasarian}, 28278 title = {Minimum Principle Sufficiency}, 28279 journal = {Mathematical Programming}, 28280 year = {1992}, 28281 volume = {57}, 28282 pages = {1--14}, 28283 key = {11} 28284} 28285 28286@Article{ ferris.mangasarian:parallel, 28287 author = {M. C. Ferris and O. L. Mangasarian}, 28288 title = {Parallel Constraint Distribution}, 28289 journal = {SIAM Journal on Optimization}, 28290 year = {1991}, 28291 volume = {1}, 28292 pages = {487--500}, 28293 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1990/tr971a.ps}, 28294 key = {18} 28295} 28296 28297@Article{ ferris.mangasarian:parallel*1, 28298 author = {M. C. Ferris and O. L. Mangasarian}, 28299 title = {Parallel Variable Distribution}, 28300 journal = {SIAM Journal on Optimization}, 28301 year = {1994}, 28302 volume = {4}, 28303 pages = {815--832}, 28304 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1993/tr1175.ps}, 28305 key = {31} 28306} 28307 28308@Article{ ferris.meeraus.ea:computing, 28309 title = {Computing {W}ardropian Equilibrium in a Complementarity Framework}, 28310 author = {M. C. Ferris and A. Meeraus and T. F. Rutherford}, 28311 journal = {Optimization Methods and Software}, 28312 year = {1999}, 28313 volume = {10}, 28314 pages = {669--685}, 28315 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-03.ps}, 28316 key = {45} 28317} 28318 28319@Article{ ferris.mesnier.ea:neos, 28320 author = {M. C. Ferris and M. P. Mesnier and J. Mor\'{e}}, 28321 title = {{NEOS} and {C}ondor: Solving Nonlinear Optimization Problems over the 28322 {I}nternet}, 28323 year = {2000}, 28324 journal = {{ACM} Transactions on Mathematical Software}, 28325 key = {54}, 28326 volume = {26}, 28327 pages = {1--18}, 28328 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-08.ps}, 28329 institution = {Computer Sciences Department, University of Wisconsin}, 28330 address = {Madison, Wisconsin}, 28331 number = {96-08}, 28332 type = {Mathematical Programming Technical Report}, 28333 note = {Also available as ANL/MCS-P708-0398, Mathematics and Computer Science Division, 28334 Argonne National Laboratory}, 28335 annote = {Revised version of: The {NEOS} System for Complementarity Problems: {PATH}, 28336 1996} 28337} 28338 28339@InCollection{ ferris.meyer:models, 28340 author = {M. C. Ferris and R. R. Meyer}, 28341 title = {Models and Solution for On-Demand Data Delivery Problems}, 28342 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-04.ps}, 28343 key = {80}, 28344 booktitle = {Approximation and Complexity in Numerical Optimization: Continuous and Discrete 28345 Problems}, 28346 editor = {P. M. Pardalos}, 28347 series = {Nonconvex Optimization and its Applications}, 28348 volume = {42}, 28349 address = {Dordrect}, 28350 year = {2000}, 28351 pages = {175--188}, 28352 publisher = {Kluwer}, 28353 type = {Mathematical Programming Technical Report}, 28354 institution = {Computer Sciences Department, University of Wisconsin}, 28355 number = {99-04} 28356} 28357 28358@InProceedings{ ferris.munson.ea:homotopy, 28359 author = {M. C. Ferris and T. S. Munson and D. Ralph}, 28360 title = {A Homotopy Method for Mixed Complementarity Problems based on the {PATH} Solver}, 28361 booktitle = {Numerical Analysis 1999}, 28362 key = {88}, 28363 year = {2000}, 28364 editor = {D. F. Griffiths and G. A. Watson}, 28365 series = {Research Notes in Mathematics}, 28366 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-09.ps}, 28367 address = {London}, 28368 pages = {143--167}, 28369 publisher = {Chapman and Hall}, 28370 institution = {Computer Sciences Department, University of Wisconsin}, 28371 number = {99-09}, 28372 type = {Mathematical Programming Technical Report} 28373} 28374 28375@TechReport{ ferris.munson.ea:practical, 28376 author = {M. C. Ferris and T. S. Munson and K. Sinapiromsaran}, 28377 title = {A Practical Approach to Sample-Path Simulation Optimization}, 28378 type = {Data Mining Institute Technical Report}, 28379 institution = {Computer Sciences Department, University of Wisconsin}, 28380 address = {Madison, Wisconsin}, 28381 year = {2000}, 28382 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-03.ps}, 28383 number = {00-03}, 28384 key = {92}, 28385 annote = {To appear in WSC 2000} 28386} 28387 28388@InCollection{ ferris.munson:case, 28389 author = {M. C. Ferris and T. S. Munson}, 28390 title = {Case Studies in Complementarity: Improving Model Formulation}, 28391 booktitle = {Ill--Posed Variational Problems and Regularization Techniques}, 28392 key = {73}, 28393 pages = {79--98}, 28394 publisher = {Springer Verlag}, 28395 year = {1999}, 28396 editor = {M. Th\'{e}ra and R. Tichatschke}, 28397 number = {477}, 28398 series = {Lecture Notes in Economics and Mathematical Systems}, 28399 address = {Berlin}, 28400 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-16.ps}, 28401 type = {Mathematical Programming Technical Report}, 28402 institution = {Computer Sciences Department, University of Wisconsin} 28403} 28404 28405@Article{ ferris.munson:complementarity, 28406 author = {M. C. Ferris and T. S. Munson}, 28407 title = {Complementarity Problems in {GAMS} and the {PATH} Solver}, 28408 year = {2000}, 28409 volume = {24}, 28410 pages = {165--188}, 28411 journal = {Journal of Economic Dynamics and Control}, 28412 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-12.ps}, 28413 key = {70}, 28414 type = {Mathematical Programming Technical Report}, 28415 institution = {Computer Sciences Department, University of Wisconsin}, 28416 address = {Madison, Wisconsin}, 28417 number = {98-12} 28418} 28419 28420@Misc{ ferris.munson:condor, 28421 author = {M. C. Ferris and T. S. Munson}, 28422 title = {Condor Modeling Language Interface}, 28423 organization = {Computer Sciences Department, University of Wisconsin}, 28424 address = {Madison, Wisconsin}, 28425 note = {ftp://ftp.cs.wisc.edu/math-prog/condor} 28426} 28427 28428@Manual{ ferris.munson:gams, 28429 author = {M. C. Ferris and T. S. Munson}, 28430 title = {{GAMS}/{PATH} User Guide: Version 4.3}, 28431 organization = {Department of Computer Sciences, University of Wisconsin, Madison} 28432} 28433 28434@Article{ ferris.munson:interfaces, 28435 author = {M. C. Ferris and T. S. Munson}, 28436 title = {Interfaces to {PATH} 3.0: Design, Implementation and Usage}, 28437 journal = {Computational Optimization and Applications}, 28438 volume = {12}, 28439 pages = {207--227}, 28440 year = {1999}, 28441 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-12.ps}, 28442 key = {63}, 28443 institution = {Computer Sciences Department, University of Wisconsin}, 28444 address = {Madison, Wisconsin}, 28445 number = {97-12}, 28446 type = {Mathematical Programming Technical Report} 28447} 28448 28449@TechReport{ ferris.munson:interior, 28450 author = {M. C. Ferris and T. S. Munson}, 28451 title = {Interior Point Methods for Massive Support Vector Machines}, 28452 institution = {Computer Sciences Department, University of Wisconsin}, 28453 year = {2000}, 28454 key = {94}, 28455 type = {Data Mining Institute Technical Report}, 28456 number = {00-05}, 28457 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-05.ps}, 28458 address = {Madison, Wisconsin}, 28459 annote = {Submitted to SIOPT} 28460} 28461 28462@Article{ ferris.munson:linear, 28463 author = {M. C. Ferris and T. S. Munson}, 28464 title = {Linear Programming for Emergency Broadcast Systems}, 28465 year = {1999}, 28466 journal = {{SIAG/OPT} Newsletter}, 28467 volume = {10}, 28468 pages = {6--8}, 28469 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-20.ps}, 28470 key = {76}, 28471 type = {Mathematical Programming Technical Report}, 28472 institution = {Computer Sciences Department, University of Wisconsin}, 28473 address = {Madison, Wisconsin}, 28474 number = {98-20} 28475} 28476 28477@Article{ ferris.munson:modeling, 28478 author = {M. C. Ferris and T. S. Munson}, 28479 title = {Modeling Languages and {C}ondor: Metacomputing for Optimization}, 28480 year = {2000}, 28481 journal = {Mathematical Programming}, 28482 volume = {88}, 28483 pages = {487--506}, 28484 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-13.ps}, 28485 key = {71}, 28486 type = {Mathematical Programming Technical Report}, 28487 institution = {Computer Sciences Department, University of Wisconsin}, 28488 address = {Madison, Wisconsin}, 28489 number = {98-13} 28490} 28491 28492@TechReport{ ferris.munson:preprocessing, 28493 author = {M. C. Ferris and T. S. Munson}, 28494 title = {Preprocessing Complementarity Problems}, 28495 type = {Mathematical Programming Technical Report}, 28496 institution = {Computer Sciences Department, University of Wisconsin}, 28497 address = {Madison, Wisconsin}, 28498 year = {1999}, 28499 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-07.ps}, 28500 number = {99-07}, 28501 key = {86}, 28502 annote = {Submitted to ICCP 99} 28503} 28504 28505@TechReport{ ferris.munson:semismooth, 28506 author = {M. C. Ferris and T. S. Munson}, 28507 title = {Semismooth Support Vector Machines}, 28508 institution = {Computer Sciences Department, University of Wisconsin}, 28509 year = {2000}, 28510 key = {97}, 28511 type = {Data Mining Institute Technical Report}, 28512 number = {00-09}, 28513 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-09.ps}, 28514 address = {Madison, Wisconsin}, 28515 annote = {Submitted to Math Prog B} 28516} 28517 28518@Article{ ferris.pang:engineering, 28519 author = {M. C. Ferris and J. S. Pang}, 28520 title = {Engineering and Economic Applications of Complementarity Problems}, 28521 year = {1997}, 28522 journal = {SIAM Review}, 28523 volume = {39}, 28524 pages = {669--713}, 28525 url = {http: //www.siam.org/journals/sirev/39-4/28596.html}, 28526 key = {46} 28527} 28528 28529@Article{ ferris.pang:nondegenerate, 28530 author = {M. C. Ferris and J. S. Pang}, 28531 title = {Nondegenerate Solutions and Related Concepts in Affine Variational Inequalities}, 28532 journal = {SIAM Journal on Control and Optimization}, 28533 year = {1996}, 28534 volume = {34}, 28535 pages = {244--263}, 28536 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1994/tr1203.ps}, 28537 key = {35} 28538} 28539 28540@Article{ ferris.philpott:affine, 28541 author = {M. C. Ferris and A. B. Philpott}, 28542 title = {On Affine Scaling and Semi--Infinite Programming}, 28543 journal = {Mathematical Programming}, 28544 year = {1992}, 28545 volume = {56}, 28546 pages = {361--364}, 28547 key = {15} 28548} 28549 28550@Article{ ferris.philpott:interior, 28551 author = {M. C. Ferris and A. B. Philpott}, 28552 title = {An Interior Point Algorithm for Semi--Infinite Linear Programming}, 28553 journal = {Mathematical Programming}, 28554 year = {1989}, 28555 volume = {43}, 28556 pages = {257--276}, 28557 key = {04} 28558} 28559 28560@Article{ ferris.philpott:performance, 28561 author = {M. C. Ferris and A. B. Philpott}, 28562 title = {On the Performance of {K}armarkar's Algorithm}, 28563 journal = {Journal of the Operational Research Society}, 28564 year = {1988}, 28565 volume = {39}, 28566 pages = {257--270}, 28567 key = {03} 28568} 28569 28570@InCollection{ ferris.ralph:projected, 28571 author = {M. C. Ferris and D. Ralph}, 28572 title = {Projected Gradient Methods for Nonlinear Complementarity Problems via Normal 28573 Maps}, 28574 booktitle = {Recent Advances in Nonsmooth Optimization}, 28575 publisher = {World Scientific Publishers}, 28576 year = {1995}, 28577 pages = {57--87}, 28578 editor = {D. Du and L. Qi and R. Womersley}, 28579 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/94-08.ps}, 28580 key = {41} 28581} 28582 28583@Article{ ferris.ruszczynski:robust, 28584 author = {M. C. Ferris and A. Ruszczy{\'{n}}ski}, 28585 title = {Robust Path Choice and Vehicle Guidance in Networks with Failures}, 28586 year = {2000}, 28587 journal = {Networks}, 28588 volume = {35}, 28589 pages = {181--194}, 28590 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/97-04.ps}, 28591 key = {60} 28592} 28593 28594@InCollection{ ferris.rutherford:accessing, 28595 author = {M. C. Ferris and T. F. Rutherford}, 28596 title = {Accessing Realistic Complementarity Problems within {Matlab}}, 28597 booktitle = {Nonlinear Optimization and Applications}, 28598 key = {48}, 28599 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/95-10.ps}, 28600 editor = {G. Di Pillo and F. Giannessi}, 28601 year = {1996}, 28602 pages = {141--153}, 28603 publisher = {Plenum Press}, 28604 address = {New York} 28605} 28606 28607@InCollection{ ferris.shepard:optimizing, 28608 author = {M. C. Ferris and D. M. Shepard}, 28609 title = {Optimization of Gamma Knife Radiosurgery}, 28610 booktitle = {Discrete Mathematical Problems with Medical Applications, forthcoming}, 28611 editor = {D.-Z. Du and P. Pardolas and J. Wang}, 28612 publisher = {AMS}, 28613 year = {2000}, 28614 optseries = {DIMACS}, 28615 url = {ftp://ftp.cs.wisc.edu/pub/dmi/tech-reports/00-01.ps}, 28616 key = {91}, 28617 type = {Data Mining Institute Technical Report}, 28618 institution = {Computer Sciences Department, University of Wisconsin}, 28619 address = {Madison, Wisconsin}, 28620 number = {00-01} 28621} 28622 28623@InCollection{ ferris.sinapiromsaran:formulating, 28624 author = {M. C. Ferris and K. Sinapiromsaran}, 28625 title = {Formulating and Solving Nonlinear Programs as Mixed Complementarity Problems}, 28626 booktitle = {Optimization}, 28627 key = {77}, 28628 publisher = {Springer-Verlag}, 28629 year = {2000}, 28630 editor = {V.H. Nguyen and J. J. Strodiot and P. Tossings}, 28631 volume = {481}, 28632 series = {Lecture Notes in Economics and Mathematical Systems}, 28633 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-21.ps}, 28634 type = {Mathematical Programming Technical Report}, 28635 institution = {Computer Sciences Department, University of Wisconsin}, 28636 address = {Madison, Wisconsin}, 28637 number = {98-21} 28638} 28639 28640@Article{ ferris.tin-loi:limit, 28641 author = {M. C. Ferris and F. Tin-Loi}, 28642 title = {Limit Analysis of Frictional Block Assemblies as a Mathematical Program with 28643 Complementarity Constraints}, 28644 year = {2001}, 28645 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/99-01.ps}, 28646 key = {78}, 28647 journal = {International Journal of Mechanical Sciences}, 28648 pages = {209--224}, 28649 volume = {43}, 28650 type = {Mathematical Programming Technical Report}, 28651 institution = {Computer Sciences Department, University of Wisconsin}, 28652 address = {Madison, Wisconsin}, 28653 number = {99-01} 28654} 28655 28656@Article{ ferris.tin-loi:nonlinear, 28657 author = {M. C. Ferris and F. Tin-Loi}, 28658 title = {Nonlinear Programming Approach for a Class of Inverse Problems in 28659 Elastoplasticity}, 28660 year = {1998}, 28661 key = {64}, 28662 volume = {6}, 28663 pages = {857--870}, 28664 journal = {Structural Engineering and Mechanics} 28665} 28666 28667@Article{ ferris.tin-loi:solution, 28668 author = {M. C. Ferris and F. Tin-Loi}, 28669 title = {On the Solution of a Minimum Weight Elastoplastic Problem involving Displacement 28670 and Complementarity Constraints}, 28671 year = {1999}, 28672 journal = {Computer Methods in Applied Mechanics and Engineering}, 28673 volume = {174}, 28674 pages = {107--120}, 28675 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/minwt.ps}, 28676 key = {66} 28677} 28678 28679@Article{ ferris.vlach:scheduling, 28680 author = {M. C. Ferris and M. Vlach}, 28681 title = {Scheduling with Earliness and Tardiness Penalties}, 28682 journal = {Naval Research Logistics Quarterly}, 28683 year = {1992}, 28684 volume = {39}, 28685 pages = {229--245}, 28686 key = {13} 28687} 28688 28689@TechReport{ ferris.zavriev:linear, 28690 author = {M. C. Ferris and S. K Zavriev}, 28691 title = {The Linear Convergence of a Successive Linear Programming Algorithm}, 28692 institution = {Computer Sciences Department, University of Wisconsin}, 28693 year = {1996}, 28694 key = {56}, 28695 address = {Madison, Wisconsin}, 28696 type = {Mathematical Programming Technical Report}, 28697 number = {96--12}, 28698 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/96-12.ps} 28699} 28700 28701@Article{ ferris:finite, 28702 author = {M. C. Ferris}, 28703 title = {Finite Termination of the Proximal Point Algorithm}, 28704 journal = {Mathematical Programming}, 28705 year = {1991}, 28706 volume = {50}, 28707 pages = {359--366}, 28708 key = {06} 28709} 28710 28711@Article{ ferris:iterative, 28712 author = {M. C. Ferris}, 28713 title = {Iterative Linear Programming Solution of Convex Programs}, 28714 journal = {Journal of Optimization Theory and Applications}, 28715 year = {1990}, 28716 volume = {65}, 28717 pages = {53--65}, 28718 key = {07} 28719} 28720 28721@Article{ ferris:linear, 28722 author = {M. C. Ferris}, 28723 title = {The Linear Complementarity Problem}, 28724 journal = {Bulletin of the American Mathematical Society}, 28725 year = {1993}, 28726 volume = {28}, 28727 pages = {169--175}, 28728 key = {27} 28729} 28730 28731@MastersThesis{ ferris:linear*1, 28732 author = {M. C. Ferris}, 28733 title = {Linear Programming and Minimum Weight Design -- {A} Comparison of Methods for 28734 Solving a Class of Structural Optimization Problems}, 28735 year = {1985}, 28736 school = {University of Cambridge}, 28737 address = {England}, 28738 key = {01} 28739} 28740 28741@TechReport{ ferris:matlab, 28742 author = {M. C. Ferris}, 28743 title = {{MATLAB} and {GAMS}: Interfacing Optimization and Visualization Software}, 28744 institution = {Computer Sciences Department, University of Wisconsin}, 28745 year = {1998}, 28746 address = {Madison, Wisconsin}, 28747 type = {Mathematical Programming Technical Report}, 28748 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-19.ps}, 28749 number = {98-19}, 28750 key = {75} 28751} 28752 28753@Article{ ferris:parallel, 28754 author = {M. C. Ferris}, 28755 title = {Parallel Constraint Distribution for Convex Quadratic Programs}, 28756 journal = {Mathematics of Operations Research}, 28757 year = {1994}, 28758 volume = {19}, 28759 pages = {645--658}, 28760 url = {ftp://ftp.cs.wisc.edu/tech-reports/reports/1991/tr1009a.ps}, 28761 key = {20} 28762} 28763 28764@TechReport{ ferris:parallel*1, 28765 author = {M. C. Ferris}, 28766 title = {Parallel Solution of Extremely Large Knapsack Problems}, 28767 institution = {Computer Sciences Department, University of Wisconsin}, 28768 year = {1989}, 28769 address = {Madison, Wisconsin}, 28770 number = {842}, 28771 key = {09} 28772} 28773 28774@PhDThesis{ ferris:weak, 28775 author = {M. C. Ferris}, 28776 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 28777 year = {1988}, 28778 school = {University of Cambridge}, 28779 address = {England}, 28780 key = {02} 28781} 28782 28783@TechReport{ ferris:weak*1, 28784 author = {M. C. Ferris}, 28785 title = {Weak Sharp Minima and Penalty Functions in Mathematical Programming}, 28786 institution = {Computer Sciences Department, University of Wisconsin}, 28787 year = {1988}, 28788 address = {Madison, Wisconsin}, 28789 number = {779}, 28790 key = {05} 28791} 28792 28793@Book{ fiacco.mccormick:nonlinear, 28794 author = {A. V. Fiacco and G. P. McCormick}, 28795 title = {Nonlinear Programming: Sequential Unconstrained Minimization Techniques}, 28796 year = {1968}, 28797 publisher = {John Wiley \& Sons}, 28798 address = {New York}, 28799 note = {SIAM Classics in Applied Mathematics 4, SIAM, Philadelphia, 1990} 28800} 28801 28802@Book{ fiacco:introduction, 28803 author = {A. V. Fiacco}, 28804 title = {Introduction to Sensitivity and Stability Analysis in Nonlinear Programming}, 28805 year = {1983}, 28806 publisher = {Academic Press}, 28807 address = {New York} 28808} 28809 28810@Article{ fiedler.ptak:matrices, 28811 author = {M. Fiedler and V. Pt\'{a}k}, 28812 title = {On matrices with nonpositive off-diagonal elements and positive principal 28813 minors}, 28814 journal = {Czechoslovak Mathematics Journal}, 28815 volume = {12}, 28816 pages = {382--400}, 28817 year = {1962} 28818} 28819 28820@Article{ fischer.kanzow:finite, 28821 author = {A. Fischer and C. Kanzow}, 28822 title = {On Finite Termination of an Iterative Method for Linear Complementarity 28823 Problems}, 28824 journal = {Mathematical Programming}, 28825 volume = {74}, 28826 pages = {279--292}, 28827 year = {1996} 28828} 28829 28830@TechReport{ fischer:constrained, 28831 author = {A. Fischer}, 28832 title = {A New Constrained Optimization Reformulation for Complementarity Problems}, 28833 institution = {Institute of Numerical Mathematics, Technical University of Dresden}, 28834 year = {1995}, 28835 type = {Technical Report}, 28836 number = {MATH-NM-10-1995}, 28837 address = {Dresden} 28838} 28839 28840@Article{ fischer:local, 28841 author = {A. Fischer}, 28842 title = {On the local superlinear convergence of a {N}ewton-type method for {LCP} under 28843 weak conditions}, 28844 journal = {Optimization Methods and Software}, 28845 year = {1995}, 28846 volume = {6}, 28847 pages = {83--107} 28848} 28849 28850@InCollection{ fischer:ncp-function, 28851 author = {A. Fischer}, 28852 title = {An {NCP}--Function and its Use for the Solution of Complementarity Problems}, 28853 booktitle = {Recent Advances in Nonsmooth Optimization}, 28854 publisher = {World Scientific Publishers}, 28855 editor = {D. Z. Du and L. Qi and R. S. Womersley}, 28856 year = {1995}, 28857 pages = {88--105} 28858} 28859 28860@Article{ fischer:newton-type, 28861 author = {A. Fischer}, 28862 title = {A {N}ewton-Type Method for Positive Semidefinite Linear Complementarity 28863 Problems}, 28864 journal = {Journal of Optimization Theory and Applications}, 28865 year = {1995}, 28866 volume = {86}, 28867 pages = {585--608} 28868} 28869 28870@Article{ fischer:solution, 28871 author = {A. Fischer}, 28872 title = {Solution of Monotone Complementarity Problems with Locally {L}ipschitzian 28873 Functions}, 28874 year = {1997}, 28875 journal = {Mathematical Programming}, 28876 pages = {513--532} 28877} 28878 28879@Article{ fischer:special, 28880 author = {A. Fischer}, 28881 title = {A Special {N}ewton--Type Optimization Method}, 28882 journal = {Optimization}, 28883 year = {1992}, 28884 volume = {24}, 28885 pages = {269--284} 28886} 28887 28888@Article{ fisher:use, 28889 author = {R. A. Fisher}, 28890 title = {The Use of Multiple Measurements in Taxonomic Problems}, 28891 journal = {Annual Eugenics}, 28892 year = {1936}, 28893 volume = {7}, 28894 number = {Part II}, 28895 pages = {179--188} 28896} 28897 28898@Book{ fishman:principles, 28899 author = {G. Fishman}, 28900 title = {Principles of Discrete Event Simulation}, 28901 publisher = {Wiley}, 28902 address = {New York, NY}, 28903 year = {1978} 28904} 28905 28906@Article{ fitchard.aldridge.ea:registration, 28907 author = {E. E. Fitchard and J. S. Aldridge and P. J. Reckwerdt and T. R. Mackie}, 28908 title = {Registration of Synthetic Tomographic Projection Data Sets Using 28909 Cross-Correlation}, 28910 journal = {Physics in Medicine and Biology}, 28911 year = {1998}, 28912 volume = {43}, 28913 pages = {1645--1657} 28914} 28915 28916@Article{ fletcher.matthews:stable, 28917 author = {R. Fletcher and S. P. J. Matthews}, 28918 title = {Stable Modifications of Explicit {LU} Factors for Simplex Updates}, 28919 journal = {Mathematical Programming}, 28920 year = {1984}, 28921 volume = {30}, 28922 pages = {267--284} 28923} 28924 28925@TechReport{ fletcher.maza:nonlinear, 28926 author = {R. Fletcher and E. Sainz de la Maza}, 28927 title = {Nonlinear Programming and Nonsmooth Optimization by Successive Linear 28928 Programming}, 28929 institution = {Department of Mathematical Sciences}, 28930 year = {1987}, 28931 address = {The University, Dundee, Scotland}, 28932 number = {NA/100}, 28933 type = {Numerical Analysis Report} 28934} 28935 28936@InCollection{ fletcher:class, 28937 author = {R. Fletcher}, 28938 title = {A Class of Methods for Nonlinear Programming with Termination and Convergence 28939 Properties}, 28940 booktitle = {Integer and Nonlinear Programming}, 28941 year = {1970}, 28942 editor = {J. Abadie}, 28943 publisher = {North--Holland}, 28944 address = {Amsterdam}, 28945 pages = {157--173} 28946} 28947 28948@Article{ fletcher:exact, 28949 author = {R. Fletcher}, 28950 title = {An Exact Penalty Function for Nonlinear Programming with Inequalities}, 28951 journal = {Mathematical Programming}, 28952 year = {1973}, 28953 volume = {5}, 28954 pages = {129--150} 28955} 28956 28957@Article{ fletcher:generalized, 28958 author = {R. Fletcher}, 28959 title = {Generalized Inverse Methods for the Best Least Squares Solution of Non--Linear 28960 Equations}, 28961 journal = {The Computer Journal}, 28962 year = {1968}, 28963 volume = {10}, 28964 pages = {392--399} 28965} 28966 28967@InProceedings{ fletcher:penalty, 28968 crossref = {bachem.grotschel.ea:mathematical}, 28969 author = {R. Fletcher}, 28970 title = {Penalty Functions}, 28971 pages = {87--114} 28972} 28973 28974@Book{ fletcher:practical, 28975 author = {R. Fletcher}, 28976 title = {Practical Methods of Optimization}, 28977 year = {1981}, 28978 publisher = {John Wiley \& Sons}, 28979 address = {Chichester}, 28980 volume = {1} 28981} 28982 28983@Book{ fletcher:practical*1, 28984 author = {R. Fletcher}, 28985 title = {Practical Methods of Optimization}, 28986 year = {1981}, 28987 publisher = {John Wiley \& Sons}, 28988 address = {Chichester}, 28989 volume = {2} 28990} 28991 28992@Book{ fletcher:practical*2, 28993 author = {R. Fletcher}, 28994 title = {Practical Methods of Optimization}, 28995 year = {1987}, 28996 publisher = {John Wiley \& Sons}, 28997 address = {New York}, 28998 edition = {second} 28999} 29000 29001@Unpublished{ fletcher:recent, 29002 author = {R. Fletcher}, 29003 title = {Recent Developments in Nonlinear Programming}, 29004 note = {Presentation at SOR 96, Braunchweig, Germany}, 29005 year = {1996} 29006} 29007 29008@InCollection{ fletcher:second, 29009 author = {R. Fletcher}, 29010 title = {Second Order Correction for Nondifferentiable Optimization}, 29011 booktitle = {Numerical Analysis}, 29012 year = {1982}, 29013 editor = {G. A. Watson}, 29014 publisher = {Springer-Verlag}, 29015 address = {Berlin}, 29016 pages = {85--114} 29017} 29018 29019@InCollection{ florian:mathematical, 29020 author = {M. Florian}, 29021 title = {Mathematical programming applications in national, regional, and urban planning}, 29022 editors = {M. Iri and K. Tanabe}, 29023 booktitle = {Mathematical Programming: Recent Developments and Applications}, 29024 publisher = {Kluwer Academic Publishers}, 29025 address = {Tokyo}, 29026 year = {1989} 29027} 29028 29029@Article{ florian:nonlinear, 29030 author = {M. Florian}, 29031 title = {Nonlinear Cost Network Models in Transportation Analysis}, 29032 journal = {Mathematical Programming Study}, 29033 year = {1986}, 29034 volume = {26}, 29035 pages = {167--196} 29036} 29037 29038@Article{ flynn:computer, 29039 author = {M.~J. Flynn}, 29040 title = {Some Computer Organizations and their Effectiveness}, 29041 journal = {IEEE Transactions on Computers}, 29042 year = {1972}, 29043 volume = {C-21}, 29044 pages = {948--960} 29045} 29046 29047@InProceedings{ fogarty:varying, 29048 crossref = {schaeffer:third}, 29049 author = {T. C. Fogarty}, 29050 title = {Varying the Probability of Mutation in the Genetic Algorithm}, 29051 pages = {422--427} 29052} 29053 29054@Article{ forrest.goldfarb:steepest-edge, 29055 author = {J. J. Forrest and D. Goldfarb}, 29056 title = {Steepest--Edge Simplex Algorithms for Linear Programming}, 29057 journal = {Mathematical Programming}, 29058 year = {1992}, 29059 volume = {57}, 29060 pages = {341--374} 29061} 29062 29063@Article{ forrest.tomlin:updating, 29064 author = {J. J. H. Forrest and J. A. Tomlin}, 29065 title = {Updating Triangular Factors of the Basis to Maintain Sparsity in the Product Form 29066 Simplex Method}, 29067 journal = {Mathematical Programming}, 29068 year = {1972}, 29069 volume = {2}, 29070 pages = {263--278} 29071} 29072 29073@TechReport{ forsgren.gill.ea:computing, 29074 author = {A. Forsgren and P. E. Gill and W. Murray}, 29075 title = {Computing Modified {N}ewton Directions using a Partial {C}holesky Factorization}, 29076 institution = {Department of Mathematics, Royal Institute of Technology}, 29077 year = {1993}, 29078 number = {TRITA-MAT-1993-9}, 29079 address = {Stockholm, Sweden} 29080} 29081 29082@TechReport{ forsgren.gill:primal-dual, 29083 author = {A. Forsgren and P. E. Gill}, 29084 title = {Primal-Dual Interior Methods for Nonconvex Nonlinear Programming}, 29085 institution = {Department of Mathematics, University of California}, 29086 year = {1996}, 29087 type = {Report NA}, 29088 number = {96-3}, 29089 address = {San Diego} 29090} 29091 29092@InCollection{ fortin.glowinski:decomposition-coordination, 29093 author = {M. Fortin and R. Glowinski}, 29094 title = {On Decomposition-Coordination Methods Using an Augmented Lagrangian}, 29095 booktitle = {Augmented Lagrangian methods: Applications to the Solution of Boundary Value 29096 Problems}, 29097 publisher = {North-Holland}, 29098 year = {1983}, 29099 editor = {M. Fortin and R. Glowinski}, 29100 address = {Amsterdam} 29101} 29102 29103@Misc{ foster.kesselman:globus, 29104 author = {I. Foster and C. Kesselman}, 29105 title = {The Globus Project}, 29106 howpublished = {www.globus.org} 29107} 29108 29109@Article{ foster.kesselman:globus*1, 29110 author = {I. Foster and C. Kesselman}, 29111 title = {Globus: A Metacomputing Infrastructure Toolkit}, 29112 journal = {International Journal of Supercomputer Applications}, 29113 volume = {11}, 29114 pages = {115--128}, 29115 year = {1997} 29116} 29117 29118@Book{ foster.kesselman:grid, 29119 editor = {I. Foster and C. Kesselman}, 29120 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 29121 publisher = {Morgan Kaufmann Publishers}, 29122 year = {1999} 29123} 29124 29125@Book{ fourer.gay.ea:ampl, 29126 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29127 title = {{AMPL}: {A} Modeling Language for Mathematical Programming}, 29128 year = {1993}, 29129 publisher = {Duxbury Press} 29130} 29131 29132@Article{ fourer.gay.ea:modeling, 29133 author = {R. Fourer and D. M. Gay and B. W. Kernighan}, 29134 title = {A Modeling Language for Mathematical Programming}, 29135 journal = {Management Science}, 29136 year = {1990}, 29137 volume = {36}, 29138 pages = {519--554} 29139} 29140 29141@Article{ fraass:development, 29142 author = {A. Fraass}, 29143 title = {The development of conformal radiation therapy}, 29144 journal = {Medical Physics}, 29145 year = {1995}, 29146 volume = {22}, 29147 number = {11}, 29148 pages = {1911--1921} 29149} 29150 29151@TechReport{ fraley:algorithms, 29152 author = {C. Fraley}, 29153 title = {Algorithms for Nonlinear Least Squares}, 29154 institution = {Stanford University}, 29155 year = {1988}, 29156 number = {{SOL} 88.16}, 29157 type = {Technical Report} 29158} 29159 29160@InCollection{ francois.mcdonald.ea:uruguay, 29161 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29162 title = {The {U}ruguay Round: {A} Numerically Based Qualitative Assessment}, 29163 booktitle = {The {U}ruguay Round and the Developing Economies}, 29164 address = {New York}, 29165 editors = {W. Martin and L. A. Winters}, 29166 publisher = {Cambridge University Press} 29167} 29168 29169@InCollection{ francois.mcdonald.ea:uruguay*1, 29170 author = {J. F. Francois and B. McDonald and H. Nordstrom}, 29171 title = {The {U}ruguay Round: {A} Global Analysis}, 29172 booktitle = {Challenges and Opportunities for East Asian Trade}, 29173 address = {Cambridge}, 29174 editors = {D. Robertson}, 29175 publisher = {Cambridge University Press} 29176} 29177 29178@Article{ frank.wolfe:algorithm, 29179 author = {M. Frank and P. Wolfe}, 29180 title = {An Algorithm for Quadratic Programming}, 29181 journal = {Naval Research Logistics Quarterly}, 29182 year = {1956}, 29183 volume = {3}, 29184 pages = {95--110} 29185} 29186 29187@Article{ freund.nachtigal:qmrpack, 29188 author = {R. W. Freund and N. M. Nachtigal}, 29189 title = {{QMRPACK}: {A} Package of {QMR} Algorithms}, 29190 journal = {{ACM} Transactions on Mathematical Software}, 29191 year = {1996}, 29192 volume = {22}, 29193 pages = {46--77} 29194} 29195 29196@InProceedings{ freund.schapire:experiments, 29197 author = {Y. Freund and R. E. Schapire}, 29198 title = {Experiments with a New Boosting Algorithm}, 29199 booktitle = {Machine Learning: Proceedings of the Thirteenth National Conference}, 29200 pages = {148--156}, 29201 year = {1996}, 29202 editor = {L. Saitta}, 29203 publisher = {Morgan Kaufmann} 29204} 29205 29206@Unpublished{ freund.todd:barrier, 29207 author = {Robert M. Freund and Michael J. Todd}, 29208 title = {Barrier functions and interior-point algorithms for linear programming with 29209 zero-, one-, or two-sided bounds on the variables}, 29210 year = {1992}, 29211 month = jul 29212} 29213 29214@Article{ friedman.chernina:iterative, 29215 author = {V. M. Friedman and V. S. Chernina}, 29216 title = {Iterative Methods Applied to the Solution of Contact Problems Between Bodies}, 29217 note = {In Russian}, 29218 journal = {Mekhanika Tvergodo Tela Academia Nauk SSSR}, 29219 volume = {1}, 29220 pages = {116--120}, 29221 year = {1967} 29222} 29223 29224@Article{ friesz.bernstein.ea:day-to-day, 29225 author = {T. L. Friesz and D. Bernstein and N. J. Mehta and R. L. Tobin and S. 29226 Ganjalizadeh}, 29227 title = {Day-to-day Dynamic Network Disequilibria and Idealized Traveller Information 29228 Systems}, 29229 journal = {Operations Research}, 29230 year = {1994}, 29231 volume = {42}, 29232 pages = {1120--1136} 29233} 29234 29235@Article{ friesz.tobin.ea:nonlinear, 29236 author = {T. L. Friesz and R. L. Tobin and T. E. Smith and P. T. Harker}, 29237 title = {A Nonlinear Complementarity Formulation and Solution Procedure for the General 29238 Derived Demand Network Equilibrium Problem}, 29239 journal = {Journal of Regional Science}, 29240 year = {1983}, 29241 volume = {23}, 29242 pages = {337--359} 29243} 29244 29245@Article{ friesz:network, 29246 author = {T. L. Friesz}, 29247 title = {Network Equilibrium, Design and Aggregation}, 29248 journal = {Transportation Research}, 29249 volume = {19A}, 29250 year = {1985}, 29251 pages = {413--427} 29252} 29253 29254@Unpublished{ frisch:logarithmic, 29255 author = {K. R. Frisch}, 29256 title = {The Logarithmic Potential Method of Convex Programming}, 29257 year = {1955}, 29258 note = {Unpublished manuscript, University Institute of Economics, Oslo} 29259} 29260 29261@Book{ fukunaga:statistical, 29262 author = {K. Fukunaga}, 29263 title = {Statistical Pattern Recognition}, 29264 year = {1990}, 29265 publisher = {Academic Press}, 29266 address = {New York} 29267} 29268 29269@Article{ fukushima.luo.ea:globally, 29270 author = {M. Fukushima and Z.--Q. Luo and J. S. Pang}, 29271 title = {A Globally Convergent Sequential Quadratic Programming Algorithm for Mathematical 29272 Programs with Linear Complementarity Constraints}, 29273 journal = {Computational Optimization and Applications}, 29274 year = {1998}, 29275 volume = {10}, 29276 pages = {5--34} 29277} 29278 29279@Article{ fukushima:equivalent, 29280 author = {M. Fukushima}, 29281 title = {Equivalent Differentiable Optimization Problems and Descent Methods for 29282 Asymmetric Variational Inequality Problems}, 29283 journal = {Mathematical Programming}, 29284 year = {1992}, 29285 volume = {53}, 29286 pages = {99--110} 29287} 29288 29289@Article{ fukushima:primal, 29290 author = {M. Fukushima}, 29291 title = {The Primal {D}ouglas-{R}achford Splitting Algorithm for a Class of Monotone 29292 Mappings with Application to the Traffic Equilibrium Problem}, 29293 journal = {Mathematical Programming}, 29294 year = {1996}, 29295 volume = {72}, 29296 pages = {1--15} 29297} 29298 29299@Article{ gabay.mercier:dual, 29300 author = {D. Gabay and B. Mercier}, 29301 title = {A Dual Algorithm for the Solution of Nonlinear Variational Inequalities via 29302 Finite Element Approximations}, 29303 journal = {Computational Mathematics and Applications}, 29304 year = {1976}, 29305 volume = {2}, 29306 pages = {17--48} 29307} 29308 29309@InCollection{ gabay:applications, 29310 author = {D. Gabay}, 29311 title = {Applications of the Method of Multipliers to Variational Inequalities}, 29312 booktitle = {Augmented {L}agrangian Methods: Applications to the Solution of Boundary Value 29313 Problems}, 29314 publisher = {North-Holland}, 29315 year = {1983}, 29316 editor = {M. Fortin and R. Glowinski}, 29317 address = {Amsterdam} 29318} 29319 29320@Unpublished{ gabriel.bernstein:path, 29321 author = {S. A. Gabriel and D. Berstein}, 29322 title = {A Path Generation Method for the Nonadditive, Asymmetric, Elastic Traffic 29323 Equilibrium Problem}, 29324 note = {Draft, 1995} 29325} 29326 29327@TechReport{ gabriel.kydes:nonlinear, 29328 author = {S. A. Gabriel and A. S. Kydes}, 29329 title = {A Nonlinear Complementarity Approach for Solving the National Energy Modeling 29330 System}, 29331 institution = {Mathematics and Computer Science Division, Argonne National Laboratory}, 29332 year = {1995}, 29333 type = {Preprint}, 29334 number = {MCS-P504-0395}, 29335 address = {Argonne, Illinois}, 29336 month = mar 29337} 29338 29339@InProceedings{ gabriel.more:smoothing, 29340 crossref = {ferris.pang:complementarity}, 29341 author = {S. A. Gabriel and J. J. Mor\'{e}}, 29342 title = {Smoothing of Mixed Complementarity Problems} 29343} 29344 29345@Article{ gabriel.pang:inexact, 29346 author = {S. A. Gabriel and J. S. Pang}, 29347 title = {An Inexact {NE/SQP} Method for Solving the Nonlinear Complementarity Problem}, 29348 journal = {Computational Optimization and Applications}, 29349 year = {1992}, 29350 volume = {1}, 29351 pages = {67--91} 29352} 29353 29354@InCollection{ gabriel.pang:trust, 29355 author = {S. A. Gabriel and J. S. Pang}, 29356 title = {A Trust Region Method for Constrained Nonsmooth Equations}, 29357 booktitle = {Large--Scale Optimization: State of the Art}, 29358 publisher = {Kluwer Academic Publishers}, 29359 year = {1994}, 29360 editor = {W. W. Hager and D. W. Hearn and P. M. Pardalos}, 29361 pages = {159--186} 29362} 29363 29364@PhDThesis{ gabriel:algorithms, 29365 author = {S. A. Gabriel}, 29366 title = {Algorithms for the Nonlinear Complementarity Problem: The {NE}/{SQP} Method and 29367 Extensions}, 29368 school = {The Johns Hopkins University}, 29369 year = {1992}, 29370 address = {Baltimore, Maryland} 29371} 29372 29373@Article{ gafni.bertsekas:two-metric, 29374 author = {E. M. Gafni and D. P. Bertsekas}, 29375 title = {Two-Metric Projection Methods for Constrained Optimization}, 29376 journal = {SIAM Journal on Control and Optimization}, 29377 year = {1984}, 29378 volume = {22}, 29379 pages = {936--964} 29380} 29381 29382@InProceedings{ gaivoronski:convergence, 29383 author = {A. A. Gaivoronski}, 29384 title = {Convergence of Parallel Backpropagation for Neural Networks}, 29385 booktitle = {SIAM Journal on Optimization}, 29386 year = {1994}, 29387 note = {Proceedings of Symposium on Parallel Optimization 3, Madison July 7-9, 1993, 29388 submitted} 29389} 29390 29391@Misc{ gaivoronski:private, 29392 author = {A. A. Gaivoronski}, 29393 title = {Private Communication}, 29394 year = {1992}, 29395 month = nov, 29396 address = {ITALTEL, Milan} 29397} 29398 29399@Book{ gale:theory, 29400 author = {D. Gale}, 29401 title = {The Theory of Linear Economic Models}, 29402 year = {1960}, 29403 publisher = {McGraw-Hill Book Company}, 29404 address = {New York} 29405} 29406 29407@Book{ gallant:neural, 29408 author = {S. I. Gallant}, 29409 title = {Neural Network Learning and Expert Systems}, 29410 year = {1993}, 29411 publisher = {MIT Press}, 29412 address = {Cambridge, Massachusetts} 29413} 29414 29415@InProceedings{ ganti.gehrke.ea:framework, 29416 author = {V. Ganti and J. Gehrke and R. Ramakrishnan}, 29417 title = {A Framework for Measuring Changes in Data Characteristics}, 29418 booktitle = {Proceedings of the Eighteenth ACM SIGACT-SIGMOD-SIGART Symposium on Principles of 29419 Database Systems, May 31 - June 2, 1999, Philadelphia, Pennsylvania}, 29420 publisher = {ACM Press}, 29421 year = {1999}, 29422 isbn = {1-58113-062-7}, 29423 pages = {126--137} 29424} 29425 29426@Book{ ganz:gamma, 29427 author = {J. C. Ganz}, 29428 title = {Gamma Knife Surgery}, 29429 publisher = {Springer-Verlag Wien}, 29430 year = {1997}, 29431 address = {Austria} 29432} 29433 29434@TechReport{ gao:nonlinear, 29435 author = {Y. Gao}, 29436 title = {Nonlinear Complementarity Problems in Large Deformed Beam Subject to Unilateral 29437 Conditions}, 29438 type = {Manuscript}, 29439 institution = {Department of Mathematics, Virginia Polytechnic Institute and State University}, 29440 month = oct, 29441 year = {1994} 29442} 29443 29444@Article{ garcia-palomares.mangasarian:superlinearly, 29445 author = {U. M. {Garcia--Palomares} and O. L. Mangasarian}, 29446 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 29447 Optimization Problems}, 29448 journal = {Mathematical Programming}, 29449 year = {1976}, 29450 volume = {11}, 29451 pages = {1--13} 29452} 29453 29454@Article{ garcia-palomares.restuccia:global, 29455 author = {U. M. {Garcia--Palomares} and A. Restuccia}, 29456 title = {A Global Quadratic Algorithm for Solving a System of Mixed Equations}, 29457 journal = {Mathematical Programming}, 29458 year = {1981}, 29459 volume = {21}, 29460 pages = {290--300} 29461} 29462 29463@InProceedings{ garcia-palomares:superlinearly, 29464 author = {U. M. {Garcia--Palomares}}, 29465 title = {Superlinearly Convergent Algorithms for Linearly Constrained Optimization}, 29466 crossref = {mangasarian.meyer.ea:nonlinear*2}, 29467 pages = {101--119} 29468} 29469 29470@Article{ garcia.gould:theorem, 29471 author = {C. B. Garcia and F. J. Gould}, 29472 title = {A Theorem on Homotopy Paths}, 29473 journal = {Mathematics of Operations Research}, 29474 year = {1978}, 29475 volume = {3}, 29476 pages = {282--289} 29477} 29478 29479@Book{ garcia.zangwill:pathways, 29480 author = {C. B. Garcia and W. I. Zangwill}, 29481 title = {Pathways to Solutions, Fixed Points, and Equilibria}, 29482 year = {1981}, 29483 publisher = {Prentice-Hall, Inc}, 29484 address = {Englewood Cliffs, New Jersey} 29485} 29486 29487@Book{ garey.johnson:computers, 29488 author = {M. R. Garey and D. S. Johnson}, 29489 title = {Computers and Intractability, {A} Guide to the Theory of {NP}--Completeness}, 29490 year = {1979}, 29491 publisher = {W.H. Freeman and Company}, 29492 address = {San Francisco} 29493} 29494 29495@Article{ garey.tarjan.ea:one-processor, 29496 author = {M. R. Garey and R. E. Tarjan and G. T. Wilfong}, 29497 title = {One--Processor Scheduling with Symmetric Earliness and Tardiness Penalties}, 29498 journal = {Mathematics of Operations Research}, 29499 year = {1988}, 29500 volume = {13}, 29501 pages = {330--348} 29502} 29503 29504@Book{ garfinkel.nemhauser:integer, 29505 author = {R. S. Garfinkel and G. L. Nemhauser}, 29506 title = {Integer Programming}, 29507 year = {1972}, 29508 publisher = {John Wiley \& Sons}, 29509 address = {New York} 29510} 29511 29512@Book{ gass:linear, 29513 author = {S. Gass}, 29514 title = {Linear Programming Methods and Applications}, 29515 edition = {Fifth}, 29516 publisher = {Boyd and Fraser Publishing Company}, 29517 address = {Danvers, Massachusetts}, 29518 year = {1985} 29519} 29520 29521@InProceedings{ gay:combining, 29522 author = {D. M. Gay}, 29523 title = {On Combining the Schemes of {R}eid and {S}aunders for Sparse {LP} Bases}, 29524 booktitle = {Sparse Matrix Proceedings 1978}, 29525 editor = {I. S. Duff and G. W. Stewart}, 29526 year = {1978}, 29527 organization = {SIAM}, 29528 address = {Philadelphia, Pennsylvania}, 29529 pages = {313--334} 29530} 29531 29532@Article{ gay:electronic, 29533 author = {D. M. Gay}, 29534 title = {Electronic Mail Distribution of Linear Programming Test Problems}, 29535 journal = {{COAL} Newsletter}, 29536 year = {1985}, 29537 volume = {13}, 29538 pages = {10--12} 29539} 29540 29541@TechReport{ gay:hooking, 29542 author = {D. M. Gay}, 29543 title = {Hooking Your Solver to {AMPL}}, 29544 year = {1997}, 29545 institution = {Bell Laboratories}, 29546 address = {Murray Hill, New Jersey}, 29547 note = {Revised 1994, 1997} 29548} 29549 29550@Article{ gay:variant, 29551 author = {D. Gay}, 29552 title = {A Variant of {K}armarkar's Linear Programming Algorithm for Problems in Standard 29553 Form}, 29554 journal = {Mathematical Programming}, 29555 year = {1987}, 29556 volume = {37}, 29557 pages = {81--90} 29558} 29559 29560@Article{ geiger.kanzow:resolution, 29561 author = {C. Geiger and C. Kanzow}, 29562 title = {On the Resolution of Monotone Complementarity Problems}, 29563 journal = {Computational Optimization and Applications}, 29564 volume = {5}, 29565 year = {1996}, 29566 pages = {155--173} 29567} 29568 29569@Book{ geist.beguelin.ea:pvm, 29570 author = {G. A. Geist and A. L. Beguelin and J. J. Dongarra and W. Jiang and R. Manchek and 29571 V. S. Sunderam}, 29572 title = {{PVM}: Parallel Virtual Machine}, 29573 publisher = {MIT Press}, 29574 address = {Cambridge, Massachusetts}, 29575 year = {1994} 29576} 29577 29578@Article{ gendron.crainic:parallel, 29579 author = {B. Gendron and T. G. Crainic}, 29580 title = {Parallel Branch-and-Bound Algorithms: Survey and Synthesis}, 29581 journal = {Operations Research}, 29582 year = {1994}, 29583 volume = {42}, 29584 pages = {1042--1060} 29585} 29586 29587@Article{ george:automatic, 29588 author = {A. George}, 29589 title = {An automatic one-way dissection algorithm for irregular finite-element problems}, 29590 journal = {SIAM Journal on Numerical Analysis}, 29591 vol = {17}, 29592 pages = {740--751}, 29593 year = {1980} 29594} 29595 29596@InProceedings{ georges-schleuter:asparagos, 29597 crossref = {schaeffer:third}, 29598 author = {M. Georges--Schleuter}, 29599 title = {Asparagos: An Asynchronous Parallel Genetic Algorithm}, 29600 pages = {416--421} 29601} 29602 29603@Article{ georgiou:comments, 29604 author = {G. M. Georgiou}, 29605 title = {Comments On Hidden Nodes in Neural Nets}, 29606 journal = {IEEE Transactions on Circuits and Systems}, 29607 year = {1991}, 29608 volume = {38}, 29609 pages = {1410} 29610} 29611 29612@TechReport{ gertz.linderoth.ea:object-oriented, 29613 author = {M. Gertz and J. Linderoth and S. Wright}, 29614 title = {Object-Oriented Software for Linear Complementarity and Quadratic Programming}, 29615 institution = {MCS Division, Argonne National Laboratory}, 29616 year = {in preparation} 29617} 29618 29619@Article{ ghellinck.vial:polynomial, 29620 author = {G. de Ghellinck and J.--Ph. Vial}, 29621 title = {A Polynomial {N}ewton Method for Linear Programming}, 29622 journal = {Algorithmica}, 29623 year = {1986}, 29624 volume = {1}, 29625 pages = {425--453} 29626} 29627 29628@InCollection{ gilbert.ng:predicting, 29629 author = {J. R. Gilbert and E. Ng}, 29630 title = {Predicting Structure in Nonsymmetric Sparse Matrix Factorizations}, 29631 year = {1993}, 29632 booktitle = {Graph Theory and Sparse Matrix Computation}, 29633 editor = {A. George and J. Gilbert and J. Liu}, 29634 publisher = {Springer-Verlag} 29635} 29636 29637@Article{ gilbert-lemarechal, 29638 author = {J. C. Gilbert and C. Lemarechal}, 29639 title = {Some Numerical Experiments with Variable-Storage Quasi-Newton Algorithms}, 29640 journal = {Mathematical Programming}, 29641 year = {1989}, 29642 volume = {45}, 29643 pages = {407--434} 29644} 29645 29646@Article{ gill.murray.ea:computing, 29647 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29648 title = {Computing Forward-Difference Intervals for Numerical Optimization}, 29649 journal = {SIAM Journal on Scientific and Statistical Computing}, 29650 year = {1983}, 29651 volume = {4}, 29652 pages = {310--321} 29653} 29654 29655@Article{ gill.murray.ea:maintaining, 29656 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29657 title = {Maintaining {LU} Factors of a General Sparse Matrix}, 29658 year = {1987}, 29659 journal = {Linear Algebra and Its Applications}, 29660 volume = {88/89}, 29661 pages = {239--270} 29662} 29663 29664@Book{ gill.murray.ea:practical, 29665 author = {P. E. Gill and W. Murray and M. H. Wright}, 29666 title = {Practical Optimization}, 29667 year = {1981}, 29668 publisher = {Academic Press}, 29669 address = {London} 29670} 29671 29672@Article{ gill.murray.ea:practical*1, 29673 author = {P. E. Gill and W. Murray and M. A. Saunders and M. H. Wright}, 29674 title = {A Practical Anti-Cycling Procedure for Linearly Constrained Optimization}, 29675 journal = {Mathematical Programming}, 29676 year = {1989}, 29677 volume = {45}, 29678 pages = {437--474} 29679} 29680 29681@Article{ gill.murray.ea:projected, 29682 author = {P. E. Gill and W. Murray and M. A. Saunders and J. A. Tomlin and M. H. Wright}, 29683 title = {On Projected {N}ewton Barrier Methods for Linear Programming and an Equivalence 29684 to {K}armarkar's Projective Method}, 29685 journal = {Mathematical Programming}, 29686 year = {1986}, 29687 volume = {36}, 29688 pages = {183--209} 29689} 29690 29691@Article{ gill.murray:newton-type, 29692 author = {P. E. Gill and W. Murray}, 29693 title = {{N}ewton--Type Methods for Unconstrained and Linearly Constrained Optimization}, 29694 journal = {Mathematical Programming}, 29695 year = {1974}, 29696 volume = {7}, 29697 pages = {311--350} 29698} 29699 29700@InProceedings{ gill.murray:nonlinear, 29701 author = {P. E. Gill and W. Murray}, 29702 title = {Nonlinear Least Squares and Nonlinearly Constrained Optimization}, 29703 booktitle = {Numerical Analysis, Dundee 1975}, 29704 year = {1976}, 29705 editor = {G. A. Watson}, 29706 publisher = {Springer-Verlag}, 29707 address = {Berlin}, 29708 note = {Lecture Notes in Mathematics 506} 29709} 29710 29711@Book{ ginsburgh.waelbroeck:activity, 29712 author = {V. Ginsburgh and J. Waelbroeck}, 29713 title = {Activity Analysis and General Equilibrium Modelling}, 29714 publisher = {North--Holland}, 29715 year = {1981}, 29716 address = {Amsterdam} 29717} 29718 29719@Article{ glad.goldstein:errors, 29720 author = {T. Glad and A. Goldstein}, 29721 title = {Optimization of Functions Whose Values are Subject to Small Errors}, 29722 journal = {BIT}, 29723 year = {1977}, 29724 volume = {17}, 29725 pages = {160--169} 29726} 29727 29728@Article{ glad.polak:multiplier, 29729 author = {T. Glad and E. Polak}, 29730 title = {A Multiplier Method with Automatic Limitation of Penalty Growth}, 29731 journal = {Mathematical Programming}, 29732 year = {1979}, 29733 volume = {17}, 29734 pages = {140--155} 29735} 29736 29737@Book{ glashoff.gustafson:linear, 29738 author = {K. Glashoff and S.--\AA. Gustafson}, 29739 title = {Linear Optimization and Approximation}, 29740 year = {1983}, 29741 publisher = {Springer-Verlag}, 29742 address = {New York} 29743} 29744 29745@Article{ glover:improved, 29746 author = {F. Glover}, 29747 title = {Improved Linear Programming Models for Discriminant Analysis}, 29748 journal = {Decision Sciences}, 29749 year = {1990}, 29750 volume = {21}, 29751 pages = {771--785} 29752} 29753 29754@Book{ glasserman:gradient, 29755 author = {P. Glasserman}, 29756 title = {Gradient Estimation via Perturbation Analysis}, 29757 publisher = {Kluwer}, 29758 year = {1991}, 29759 address = {Norwell, MA} 29760} 29761 29762@Article{ glover:tabu, 29763 author = {F. Glover}, 29764 title = {Tabu Search -- Part 1}, 29765 journal = {ORSA Journal on Computing}, 29766 year = {1989}, 29767 volume = {1}, 29768 pages = {190--206} 29769} 29770 29771@Article{ glowinski.marroco:sur, 29772 author = {R. Glowinski and A. Marroco}, 29773 title = {Sur l'Approximation, par Elements d'Ordre un, et la Resolution, par 29774 Penalisation-Dualit\'{e}, d'une Classe de Problemes de {D}irichlet non Lineares}, 29775 journal = {Revue Fran\c{c}aise d'Automatique, Informatique, et Recherche Operationelle}, 29776 year = {1975}, 29777 volume = {9(R-2)}, 29778 pages = {41--76} 29779} 29780 29781@TechReport{ goeleven.nguyen:convergence, 29782 author = {D. Goeleven and V. H. Nguyen}, 29783 title = {On the Convergence of the Parallel Constraint Distribution Algorithm}, 29784 institution = {Department of Mathematics, Facultes Universitaires de Namur}, 29785 year = {1992}, 29786 address = {B-5000 Namur, Belgium} 29787} 29788 29789@Book{ goldberg:genetic, 29790 author = {D. E. Goldberg}, 29791 title = {Genetic Algorithms in Search, Optimization and Machine Learning}, 29792 year = {1989}, 29793 publisher = {Addison-Wesley}, 29794 address = {Reading MA} 29795} 29796 29797@Article{ golden.skiscim:simulated, 29798 author = {B. L. Golden and C. C. Skiscim}, 29799 title = {Using Simulated Annealing to Solve Routing and Location Problems}, 29800 journal = {Naval Research Logistics Quarterly}, 29801 year = {1989}, 29802 volume = {33}, 29803 pages = {261--279} 29804} 29805 29806@Article{ goldfarb.reid:practical, 29807 author = {D. Goldfarb and J. K. Reid}, 29808 title = {A Practical Steepest--Edge Simplex Algorithm}, 29809 journal = {Mathematical Programming}, 29810 year = {1977}, 29811 volume = {12}, 29812 pages = {361--371} 29813} 29814 29815@InProceedings{ goldman.tucker:theory, 29816 author = {A. J. Goldman and A. W. Tucker}, 29817 title = {Theory of Linear Programming}, 29818 booktitle = {Linear Inequalities and Related Systems}, 29819 year = {1956}, 29820 editor = {H. W. Kuhn and A. W. Tucker}, 29821 publisher = {Princeton University Press}, 29822 address = {Princeton, New Jersey}, 29823 pages = {53--97} 29824} 29825 29826@Book{ goldstein:constructive, 29827 author = {A. A. Goldstein}, 29828 title = {Constructive Real Analysis}, 29829 year = {1967}, 29830 publisher = {Harper and Row}, 29831 address = {New York} 29832} 29833 29834@Article{ golshtein:block, 29835 author = {Ye. G. Golshtein}, 29836 title = {The Block Method of Convex Programming}, 29837 journal = {Soviet Mathematics Doklady}, 29838 year = {1986}, 29839 volume = {33}, 29840 pages = {584--587} 29841} 29842 29843@Article{ golshtein:general, 29844 author = {Ye. G. Golshtein}, 29845 title = {A General Approach to Decomposition of Optimization Systems}, 29846 journal = {Soviet Journal of Computer and Systems Sciences}, 29847 year = {1987}, 29848 volume = {3}, 29849 pages = {105--114} 29850} 29851 29852@Article{ golub.kahan:calculating, 29853 author = {G. H. Golub and W. Kahan}, 29854 title = {Calculating the Singular Values and Pseudoinverse of a Matrix}, 29855 journal = {SIAM Journal on Numerical Analysis}, 29856 year = {1965}, 29857 volume = {2}, 29858 pages = {205--224} 29859} 29860 29861@Book{ golub.vanloan:matrix, 29862 author = {G. H. Golub and C. F. {Van Loan}}, 29863 title = {Matrix Computations}, 29864 year = {1996}, 29865 publisher = {The John Hopkins University Press}, 29866 address = {Baltimore, Maryland}, 29867 edition = {Third} 29868} 29869 29870@TechReport{ gomez.barron:exponential, 29871 author = {S. Gom\'{e}z and C. Barr\'{o}n}, 29872 title = {The Exponential Tunneling Method}, 29873 institution = {Universidad Nacional Autonoma de Mexico}, 29874 year = {1991}, 29875 type = {Serie Reportes de Investigacion}, 29876 number = {3}, 29877 address = {Mexico} 29878} 29879 29880@Article{ gondzio:multiple, 29881 author = {J. Gondzio}, 29882 title = {Multiple Centrality Corrections in a Primal-Dual Method for Linear Programming}, 29883 journal = {Computational Optimization and Applications}, 29884 year = {1996}, 29885 volume = {6}, 29886 pages = {137--156} 29887} 29888 29889@TechReport{ gonzaga:algorithm, 29890 author = {C. C. Gonzaga}, 29891 title = {An Algorithm for Solving Linear Programming Problems in {O}($n^3${L}) 29892 operations}, 29893 institution = {Electronics Research Laboratory, University of California}, 29894 year = {1987}, 29895 address = {Berkeley, California}, 29896 number = {UCB/ERL M87/10}, 29897 type = {Memorandum} 29898} 29899 29900@Article{ gould.tolle:necessary, 29901 author = {F. J. Gould and J. W. Tolle}, 29902 title = {A Necessary and Sufficient Qualification for Constrained Optimization}, 29903 journal = {SIAM Journal on Applied Mathematics}, 29904 year = {1971}, 29905 volume = {20}, 29906 pages = {164--172} 29907} 29908 29909@InProceedings{ goux.kulkarni.ea:enabling, 29910 author = {J.-P. Goux and S. Kulkarni and J. Linderoth and M. E. Yoder}, 29911 title = {An Enabling Framework for Master-Worker Applications on the Computational Grid}, 29912 booktitle = {Proceedings of the Ninth {IEEE} International Symposium on High Performance 29913 Distributed Computing}, 29914 year = {2000} 29915} 29916 29917@Article{ gowda.pang:basic, 29918 author = {M. S. Gowda and J. S. Pang}, 29919 title = {The Basic Theorem of Complementarity Revisited}, 29920 journal = {Mathematical Programming}, 29921 year = {1993}, 29922 volume = {58}, 29923 pages = {161--178} 29924} 29925 29926@Article{ gowda.pang:boundedness, 29927 author = {M. S. Gowda and J. S. Pang}, 29928 title = {On the Boundedness and Stability of Solutions to the Affine Variational 29929 Inequality Problem}, 29930 journal = {SIAM Journal on Control and Optimization}, 29931 year = {1994}, 29932 volume = {32}, 29933 pages = {421--441} 29934} 29935 29936@Article{ gowda.pang:stability, 29937 author = {M. S. Gowda and J. S. Pang}, 29938 title = {Stability analysis of variational inequalities and nonlinear complementarity 29939 problems, via the mixed linear complementarity problem and degree theory}, 29940 journal = {Mathematics of Operations Research}, 29941 year = {1994}, 29942 volume = {19}, 29943 pages = {831--879} 29944} 29945 29946@Article{ gowda.sznajder:generalizations, 29947 author = {M. S. Gowda and R. Sznajder}, 29948 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; Extended Vertical and 29949 Horizontal {LCP}s}, 29950 journal = {Linear Algebra and Its Applications}, 29951 year = {1995}, 29952 volume = {223/224}, 29953 pages = {695--715} 29954} 29955 29956@Article{ gowda.sznajder:generalized, 29957 author = {M. S. Gowda and R. Sznajder}, 29958 title = {The Generalized Order Linear Complementarity Problem}, 29959 journal = {SIAM Journal on Matrix Analysis and Applications}, 29960 year = {1994} 29961} 29962 29963@Article{ gowda:analysis, 29964 author = {M. S. Gowda}, 29965 title = {An Analysis of Zero Set and Global Error Bound Properties of a Piecewise Affine 29966 Function via its Recession Function}, 29967 journal = {SIAM Journal on Matrix Analysis and Applications}, 29968 year = {1996}, 29969 volume = {17}, 29970 pages = {594--609} 29971} 29972 29973@Article{ gowda:applications, 29974 author = {M. S. Gowda}, 29975 title = {Applications of Degree Theory to Linear Complementarity Problems}, 29976 journal = {Mathematics of Operations Research}, 29977 year = {1993}, 29978 volume = {18}, 29979 pages = {868--879} 29980} 29981 29982@Article{ grant.woo:clinical, 29983 author = {W. I. Grant and S. Y. Woo}, 29984 title = {Clinical and Financial Issues for Intensity Modulated Radiation Therapy 29985 Delivery}, 29986 journal = {Seminars in Radiation Oncology}, 29987 year = {1999}, 29988 volume = {9}, 29989 pages = {99--107} 29990} 29991 29992@Article{ greenberg.hegerich:branch, 29993 author = {H. Greenberg and R. L. Hegerich}, 29994 title = {A Branch Search Algorithm for the Knapsack Problem}, 29995 journal = {Management Science}, 29996 year = {1970}, 29997 volume = {16}, 29998 pages = {327--332} 29999} 30000 30001@InCollection{ grefenstette:incorporating, 30002 crossref = {davis:genetic}, 30003 author = {J. J. Grefenstette}, 30004 title = {Incorporating Problem Specific Knowledge into Genetic Algorithms} 30005} 30006 30007@Book{ griewank.corliss:automatic, 30008 editor = {A. Griewank and G. F. Corliss}, 30009 title = {Automatic Differentiation of Algorithms: Theory, Implementation and Application}, 30010 publisher = {SIAM}, 30011 year = {1991}, 30012 address = {Philadelphia, Pennsylvania} 30013} 30014 30015@Article{ griewank.juedes.ea:adol-c, 30016 author = {A. Griewank and D. Juedes and J. Utke}, 30017 title = {{ADOL}-{C}: {A} Package for the Automatic Differentiation of Algorithms Written 30018 in {C}/{C}++}, 30019 journal = {{ACM} Transactions on Mathematical Software}, 30020 year = {1996}, 30021 volume = {22}, 30022 pages = {131--167} 30023} 30024 30025@Article{ griffith.stewart:nonlinear, 30026 author = {R. E. Griffith and R. A. Stewart}, 30027 title = {A Nonlinear Programming Technique for the Optimization of Continuous Processing 30028 Systems}, 30029 journal = {Management Science}, 30030 year = {1961}, 30031 volume = {7}, 30032 pages = {379--392} 30033} 30034 30035@Article{ grinold:mathematical, 30036 author = {R. C. Grinold}, 30037 title = {Mathematical Methods for {PA}ttern Classification}, 30038 journal = {Management Science}, 30039 year = {1972}, 30040 volume = {19}, 30041 pages = {272--289} 30042} 30043 30044@Article{ grippo.lampariello.ea:class, 30045 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30046 title = {A Class of Nonmonotone Stabilization Methods in Unconstrained Optimization}, 30047 journal = {Numerische Mathematik}, 30048 year = {1991}, 30049 volume = {59}, 30050 pages = {779--805} 30051} 30052 30053@Article{ grippo.lampariello.ea:global, 30054 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30055 title = {Global Convergence and Stabilization of Unconstrained Minimization Methods 30056 Without Derivatives}, 30057 journal = {Journal of Optimization Theory and Applications}, 30058 year = {1988}, 30059 volume = {56}, 30060 pages = {385--406} 30061} 30062 30063@Article{ grippo.lampariello.ea:nonmonotone, 30064 author = {L. Grippo and F. Lampariello and S. Lucidi}, 30065 title = {A Nonmonotone Line Search Technique for {N}ewton's Method}, 30066 journal = {SIAM Journal on Numerical Analysis}, 30067 year = {1986}, 30068 volume = {23}, 30069 pages = {707--716} 30070} 30071 30072@Misc{ grippo:private, 30073 author = {L. Grippo}, 30074 title = {Private Communication}, 30075 year = {1992}, 30076 address = {Universita degli Studi di Roma ``La Sapienza'',Roma} 30077} 30078 30079@Article{ grotschel.lovasz.ea:ellipsoid, 30080 author = {M. Gr{\"{o}}tschel and L. Lov\'{a}sz and A. Schrijver}, 30081 title = {The Ellipsoid Method and its Consequences in Combinatorial Optimization}, 30082 journal = {Combinatorica}, 30083 year = {1981}, 30084 volume = {1}, 30085 pages = {169--197} 30086} 30087 30088@Article{ guignard:generalized, 30089 author = {M. Guignard}, 30090 title = {Generalized {K}uhn--{T}ucker conditions for Mathematical Programming in a 30091 {B}anach Space}, 30092 journal = {SIAM Journal on Control and Optimization}, 30093 year = {1969}, 30094 volume = {7}, 30095 pages = {232--241} 30096} 30097 30098@Article{ guler.ye:convergence, 30099 author = {O. G{\"{u}}ler and Y. Ye}, 30100 title = {Convergence Behavior of Interior--Point Algorithms}, 30101 journal = {Mathematical Programming}, 30102 year = {1993}, 30103 volume = {60}, 30104 pages = {215--228} 30105} 30106 30107@Article{ guler:existence, 30108 author = {O. G{\"{u}}ler}, 30109 title = {Existence of Interior Points and Interior Paths in Nonlinear Monotone 30110 Complementarity Problems}, 30111 journal = {Mathematics of Operations Research}, 30112 year = {1993}, 30113 volume = {18}, 30114 pages = {128--147} 30115} 30116 30117@Article{ guler:generalized, 30118 author = {O. G{\"{u}}ler}, 30119 title = {Generalized Linear Complementarity Problems}, 30120 journal = {Mathematics of Operations Research}, 30121 year = {1995}, 30122 volume = {20}, 30123 pages = {441--448} 30124} 30125 30126@Article{ gupta.sen:minimizing, 30127 author = {S. Gupta and T. Sen}, 30128 title = {Minimizing the Range of Lateness on a Single Machine}, 30129 journal = {Journal of the Operational Research Society}, 30130 year = {1984}, 30131 volume = {35}, 30132 pages = {853--857} 30133} 30134 30135@InCollection{ gustafson:numerical, 30136 author = {S.-\AA. Gustafson}, 30137 title = {On Numerical Analysis in Semi-Infinite Programming}, 30138 booktitle = {Semi-Infinite Programming}, 30139 year = {1979}, 30140 editor = {R. Hettich}, 30141 publisher = {Springer-Verlag}, 30142 address = {Berlin} 30143} 30144 30145@Article{ gustafsson.lind.ea:simultaneous, 30146 author = {A. Gustafsson and B. K. Lind and R. Svensson and A. Brahme}, 30147 title = {Simultaneous optimization of dynamic multileaf collimation and scanning patterns 30148 or compensation filters using a generalized pencil beam algorithm}, 30149 journal = {Medical Physics}, 30150 year = {1995}, 30151 volume = {22}, 30152 number = {7}, 30153 pages = {1141--1156} 30154} 30155 30156@PhDThesis{ ha:decomposition, 30157 author = {C. D. Ha}, 30158 title = {Decomposition Methods for Structured Convex Programming}, 30159 year = {1980}, 30160 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 30161} 30162 30163@TechReport{ haakonsen.mathiesen:toward, 30164 author = {L. Haakonsen and L. Mathiesen}, 30165 title = {Toward a more comprehensive cost measure for {CO2}-reductions}, 30166 institution = {NHH, Bergen}, 30167 year = {1995}, 30168 type = {Discussion Paper}, 30169 number = {3/95} 30170} 30171 30172@Article{ haaland.norman.ea:vemod, 30173 author = {J. Haaland and V. Norman and T. Rutherford and T. Wergeland}, 30174 title = {{VEMOD}: {A} {R}icardo--{H}eckscher--{O}hlin--{J}ones Model of World Trade}, 30175 journal = {Scandinavian Journal of Economics}, 30176 year = {1987} 30177} 30178 30179@Article{ haarhoff.buys:method, 30180 author = {P. C. Haarhoff and J. D. Buys}, 30181 title = {A New Method for the Optimization of a Nonlinear Function Subject to Nonlinear 30182 Constraints}, 30183 journal = {Computer Journal}, 30184 year = {1970}, 30185 volume = {12}, 30186 pages = {178--184} 30187} 30188 30189@Article{ habetler.kostreva:direct, 30190 author = {G. J. Habetler and M. M. Kostreva}, 30191 title = {On a direct algorithm for nonlinear complementarity problems}, 30192 journal = {SIAM Journal on Control and Optimization}, 30193 volume = {16}, 30194 year = {1978}, 30195 pages = {504--511} 30196} 30197 30198@Book{ hadamard:cauchys, 30199 author = {J. Hadamard}, 30200 title = {Cauchy's Problem in Linear Partial Differential Equations}, 30201 year = {1923}, 30202 publisher = {Yale University Press} 30203} 30204 30205@Article{ haddock.mittenthal:simulation, 30206 author = {J. Haddock and J. Mittenthal}, 30207 title = {Simulation optimization using simulated annealing}, 30208 journal = {Comput. Ind. Eng.}, 30209 year = {1992}, 30210 volume = {22}, 30211 pages = {387--395} 30212} 30213 30214@TechReport{ hamala:general, 30215 author = {M. Hamala}, 30216 title = {A General Approach to Interior Point Methods with Linear Parameter for 30217 Mathematical Programming}, 30218 institution = {Royal Institute of Technology}, 30219 year = {1978}, 30220 number = {1978--20}, 30221 type = {Department of Mathematics Paper TRITA--MAT} 30222} 30223 30224@Article{ han.mangasarian:dual, 30225 author = {S.--P. Han and O. L. Mangasarian}, 30226 title = {A Dual Differentiable Exact Penalty Function}, 30227 journal = {Mathematical Programming}, 30228 year = {1983}, 30229 volume = {25}, 30230 pages = {293--301} 30231} 30232 30233@Article{ han.mangasarian:exact, 30234 author = {S.--P. Han and O. L. Mangasarian}, 30235 title = {Exact Penalty Functions in Nonlinear Programming}, 30236 journal = {Mathematical Programming}, 30237 year = {1979}, 30238 volume = {17}, 30239 pages = {251--269} 30240} 30241 30242@Article{ han.pang.ea:globally, 30243 author = {S.--P. Han and J. S. Pang and N. Rangaraj}, 30244 title = {Globally Convergent {N}ewton Methods for Nonsmooth Equations}, 30245 journal = {Mathematics of Operations Research}, 30246 year = {1992}, 30247 volume = {17}, 30248 pages = {586--607} 30249} 30250 30251@Article{ han:decomposition, 30252 author = {S.--P. Han}, 30253 title = {A Decomposition Method and its Application to Convex Programming}, 30254 journal = {Mathematics of Operations Research}, 30255 year = {1989}, 30256 volume = {14}, 30257 pages = {237--248} 30258} 30259 30260@Article{ han:globally, 30261 author = {S.--P. Han}, 30262 title = {A Globally Convergent Method for Nonlinear Programming}, 30263 journal = {Journal of Optimization Theory and Applications}, 30264 year = {1977}, 30265 volume = {22}, 30266 pages = {297--309} 30267} 30268 30269@Article{ han:superlinearly, 30270 author = {S.--P. Han}, 30271 title = {Superlinearly Convergent Variable Metric Algorithms for General Nonlinear 30272 Programming Problems}, 30273 journal = {Mathematical Programming}, 30274 year = {1976}, 30275 volume = {11}, 30276 pages = {263--282} 30277} 30278 30279@Article{ hansen.koopmans:definition, 30280 author = {T. Hansen and T. C. Koopmans}, 30281 title = {On the Definition and Computation of a Capital Stock Invariant Under 30282 Optimization}, 30283 journal = {Journal of Economic Theory}, 30284 year = {1972}, 30285 volume = {5}, 30286 pages = {487--523} 30287} 30288 30289@InCollection{ harker.pang:damped, 30290 author = {P. T. Harker and J. S. Pang}, 30291 title = {A Damped {N}ewton Method for the Linear Complementarity Problem}, 30292 booktitle = {Computational Solution of Nonlinear Systems of Equations}, 30293 publisher = {AMS}, 30294 year = {1990}, 30295 editor = {E. L. Allgower and K. Georg}, 30296 number = {26}, 30297 series = {Lectures on Applied Mathematics}, 30298 address = {Providence, Rhode Island}, 30299 pages = {265--284} 30300} 30301 30302@Article{ harker.pang:existence, 30303 author = {P. T. Harker and J. S. Pang}, 30304 title = {Existence of Optimal Solutions to Mathematical Programs with Equilibrium 30305 Constraints}, 30306 journal = {Operations Research Letters}, 30307 year = {1988}, 30308 volume = {7}, 30309 pages = {61--64} 30310} 30311 30312@Article{ harker.pang:finite-dimensional, 30313 author = {P. T. Harker and J. S. Pang}, 30314 title = {Finite--dimensional variational inequality and nonlinear complementarity 30315 problems: {A} survey of theory, algorithms and applications}, 30316 journal = {Mathematical Programming}, 30317 year = {1990}, 30318 volume = {48}, 30319 pages = {161--220} 30320} 30321 30322@Article{ harker.xiao:newtons, 30323 author = {P. T. Harker and B. Xiao}, 30324 title = {{N}ewton's Method for the Nonlinear Complementarity Problem: {A} 30325 {B}--Differentiable Equation Approach}, 30326 journal = {Mathematical Programming}, 30327 year = {1990}, 30328 volume = {48}, 30329 pages = {339--358} 30330} 30331 30332@Article{ harker:accelerating, 30333 author = {P. T. Harker}, 30334 title = {Accelerating the Convergence of the Diagonalization and Projection Algorithms for 30335 Finite--Dimensional Variational Inequalities}, 30336 journal = {Mathematical Programming}, 30337 year = {1988}, 30338 volume = {41}, 30339 pages = {29--50} 30340} 30341 30342@Article{ harker:generalized, 30343 author = {P. T. Harker}, 30344 title = {Generalized {N}ash Games and Quasi-Variational Inequalities}, 30345 journal = {European Journal of Operations Research}, 30346 volume = {54}, 30347 pages = {81--94}, 30348 year = {1987} 30349} 30350 30351@Book{ harker:lectures, 30352 author = {P. T. Harker}, 30353 title = {Lectures on Computation of Equilibria with Equation--Based Methods}, 30354 publisher = {CORE Foundation, Louvain--la--Neuve, Universit\'{e} Catholique de Louvain}, 30355 year = {1993}, 30356 series = {CORE Lecture Series} 30357} 30358 30359@Article{ harris:pivot, 30360 author = {P. M. J. Harris}, 30361 title = {Pivot Selection Methods of the {D}evex {LP} Code}, 30362 journal = {Mathematical Programming}, 30363 year = {1973}, 30364 volume = {5}, 30365 pages = {1--28} 30366} 30367 30368@InCollection{ harrison.kristrom:carbon, 30369 author = {G. W. Harrison and B. Kristrom}, 30370 title = {Carbon Emissions and the Economic Costs of Transport Policy in {S}weden}, 30371 booktitle = {Environment and Transport in Economic Modelling}, 30372 publisher = {Kluwer Academic Publishers}, 30373 year = {1997}, 30374 editor = {R. Roson and K. A. Small}, 30375 address = {Amsterdam} 30376} 30377 30378@Article{ harrison.rutherford.ea:increased, 30379 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30380 title = {Increased Competition and Completion of the Market in the {E}uropean {U}nion}, 30381 journal = {Journal of Economic Integration}, 30382 year = {1996}, 30383 volume = {11}, 30384 pages = {332--365} 30385} 30386 30387@Article{ harrison.rutherford.ea:liberalizing, 30388 author = {G. W. Harrison and T. F. Rutherford and I. Wooton}, 30389 title = {Liberalizing Agriculture in the {E}uropean {U}nion}, 30390 journal = {Journal of Policy Modeling}, 30391 year = {1995}, 30392 volume = {17} 30393} 30394 30395@Article{ harrison.rutherford.ea:quantifying, 30396 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30397 title = {Quantifying the {U}ruguay Round}, 30398 journal = {Finance and Development}, 30399 year = {1995}, 30400 volume = {32}, 30401 pages = {38--41} 30402} 30403 30404@InProceedings{ harrison.rutherford.ea:quantifying*1, 30405 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30406 title = {Quantifying the {U}ruguay Round}, 30407 year = {1996}, 30408 booktitle = {The {U}ruguay Round and the Developing Economies}, 30409 address = {New York}, 30410 editors = {W. Martin and L. A. Winters}, 30411 publisher = {Cambridge University Press} 30412} 30413 30414@Article{ harrison.rutherford.ea:quantifying*2, 30415 author = {G. W. Harrison and T. F. Rutherford and D. Tarr}, 30416 title = {Quantifying the {U}ruguay Round}, 30417 journal = {The Economic Journal}, 30418 year = {1997}, 30419 volume = {107}, 30420 pages = {1405--1430} 30421} 30422 30423@Article{ harrison.rutherford.ea:trade, 30424 author = {G. W. Harrison and T. F. Rutherford and D. G. Tarr}, 30425 title = {Trade Reform in the Partially Liberalized Economy of {T}urkey}, 30426 journal = {The World Bank Economic Review}, 30427 year = {1993}, 30428 volume = {7}, 30429 pages = {191--217} 30430} 30431 30432@Article{ hartman.stampacchia:nonlinear, 30433 author = {P. Hartman and G. Stampacchia}, 30434 title = {On some nonlinear differential-functional equations}, 30435 journal = {Acta Mathematica}, 30436 year = {1966}, 30437 volume = {115}, 30438 pages = {271--310} 30439} 30440 30441@Book{ harvey:forecasting, 30442 author = {Andrew C. Harvey}, 30443 title = {Forecasting, Structural Time Series Models and the {K}alman Filter}, 30444 publisher = {Cambridge University Press}, 30445 address = {New York, NY}, 30446 year = {1989} 30447} 30448 30449@Article{ haurie.marcotte:relationship, 30450 author = {A. Haurie and P. Marcotte}, 30451 title = {On the Relationship between {N}ash--{C}ournot and {W}ardrop Equilibria}, 30452 journal = {Networks}, 30453 year = {1985}, 30454 volume = {15}, 30455 pages = {295--308} 30456} 30457 30458@Article{ hearn.lawphongpanich.ea:restricted, 30459 author = {D. W. Hearn and S. Lawphongpanich and J. A. Ventura}, 30460 title = {Restricted Simplicial Decomposition: Computation and Extensions}, 30461 journal = {Mathematical Programming Study}, 30462 year = {1987}, 30463 volume = {31}, 30464 pages = {99--118} 30465} 30466 30467@Article{ hearn:gap, 30468 author = {D. W. Hearn}, 30469 title = {The Gap Function of a Convex Program}, 30470 journal = {Operations Research Letters}, 30471 year = {1982}, 30472 volume = {1}, 30473 pages = {67--71} 30474} 30475 30476@Article{ hedlund.gustavsson:design, 30477 author = {P. Hedlund and A. Gustavsson}, 30478 title = {Design and Evaluation of Modified Simplex Methods having Enhanced Convergence 30479 Ability}, 30480 journal = {Analytica Chimica Acta}, 30481 year = {1992}, 30482 volume = {259}, 30483 pages = {243--256} 30484} 30485 30486@Article{ helgason.kennington.ea:parallelization, 30487 author = {R. V. Helgason and J. L. Kennington and H. A. Zaki}, 30488 title = {A Parallelization of the Simplex Method}, 30489 journal = {Annals of Operations Research}, 30490 year = {1988}, 30491 volume = {14}, 30492 pages = {17--40} 30493} 30494 30495@Article{ helgason.kennington.ea:polynomially, 30496 author = {Richard Helgason and James Kennington and H. Lall}, 30497 title = {A Polynomially Bounded Algorithm for Singly Constrained Quadratic Programs}, 30498 journal = {Mathematical Programming}, 30499 year = {1980}, 30500 volume = {18}, 30501 pages = {338--343} 30502} 30503 30504@Book{ henderson.quandt:microeconomic, 30505 author = {J. M. Henderson and R. E. Quandt}, 30506 title = {Microeconomic Theory}, 30507 publisher = {McGraw--Hill}, 30508 address = {New York}, 30509 year = {1980}, 30510 edition = {Third} 30511} 30512 30513@TechReport{ hendrickson.leland:chaco, 30514 author = {B. Hendrickson and R. Leland}, 30515 title = {The {C}haco User's Guide: Version 2}, 30516 institution = {Sandia National Laboratories}, 30517 type = {Technical Report}, 30518 number = {SAND94-2692}, 30519 address = {Albuquerque, New Mexico}, 30520 year = {1994} 30521} 30522 30523@InProceedings{ hendrickson.leland:multilevel, 30524 author = {B. Hendrickson and R. Leland}, 30525 title = {A Multilevel Algorithm for Partitioning Graphs}, 30526 booktitle = {Proceedings of Supercomputing '95}, 30527 year = {1995} 30528} 30529 30530@Book{ hertz.krogh.ea:introduction, 30531 author = {J. Hertz and A. Krogh and R. G. Palmer}, 30532 title = {Introduction to the Theory of Neural Computation}, 30533 year = {1991}, 30534 publisher = {Addison-Wesley}, 30535 address = {Redwood City, California} 30536} 30537 30538@Article{ hertz.werra:tabu, 30539 author = {A. Hertz and D. de Werra}, 30540 title = {Using {T}abu Search techniques for Graph Coloring}, 30541 journal = {Computing}, 30542 year = {1987}, 30543 volume = {29}, 30544 pages = {345--351} 30545} 30546 30547@InCollection{ hettich:review, 30548 author = {R. Hettich}, 30549 title = {A Review of Numerical Methods for Semi-Infinite Optimization}, 30550 booktitle = {Semi-Infinite Programming and Applications}, 30551 year = {1983}, 30552 editor = {A. V. Fiacco and K. O. Kortanek}, 30553 publisher = {Springer-Verlag}, 30554 address = {Berlin} 30555} 30556 30557@Article{ highleyman:note, 30558 author = {W. H. Highleyman}, 30559 title = {A Note on Linear Separation}, 30560 journal = {IRE Transactions on Electronic Computers}, 30561 year = {1961}, 30562 volume = {10}, 30563 pages = {777--778} 30564} 30565 30566@Article{ hildreth:quadratic, 30567 author = {C. Hildreth}, 30568 title = {A Quadratic Programming Procedure}, 30569 journal = {Naval Research Logistics Quarterly}, 30570 year = {1957}, 30571 volume = {4}, 30572 pages = {79--85}, 30573 note = {Erratum, p. 361} 30574} 30575 30576@Book{ himmelblau:applied, 30577 author = {D. M. Himmelblau}, 30578 title = {Applied Nonlinear Programming}, 30579 year = {1972}, 30580 publisher = {McGraw--Hill}, 30581 address = {New York} 30582} 30583 30584@Book{ hiriart-urruty.lemarechal:convex, 30585 author = {Jean-Baptiste Hiriart-Urruty and Claude Lemar\'{e}chal}, 30586 title = {Convex Analysis and Minimization Algorithms {I}}, 30587 year = {1993}, 30588 publisher = {Springer Verlag}, 30589 address = {Berlin}, 30590 volume = {305}, 30591 series = {Grundlehren der mathematischen Wissenschaften} 30592} 30593 30594@TechReport{ hironaka:introduction, 30595 author = {H. Hironaka}, 30596 title = {Introduction to real-analytic sets and real-analytic maps}, 30597 institution = {Instituto Matematico ``L. Tonelli'', Universit\`a di Pisa}, 30598 year = {1973}, 30599 type = {Technical Report}, 30600 address = {Pisa, Italy} 30601} 30602 30603@Article{ ho.lee.ea:decomposition, 30604 author = {J. K. Ho and T. C. Lee and R. P. Sundarraj}, 30605 title = {Decomposition of Linear Programs Using Parallel Computation}, 30606 journal = {Mathematical Programming}, 30607 year = {1988}, 30608 volume = {42}, 30609 pages = {391--405} 30610} 30611 30612@Article{ ho.loute:computational, 30613 author = {J. K. Ho and E. Loute}, 30614 title = {Computational Experience with Advanced Implementation of Decomposition Algorithms 30615 for Linear Programming}, 30616 journal = {Mathematical Programming}, 30617 year = {1983}, 30618 volume = {27}, 30619 pages = {283--290} 30620} 30621 30622@Book{ hock.schittkowski:test, 30623 author = {W. Hock and K. Schittkowski}, 30624 title = {Test Examples for Nonlinear Programming Codes}, 30625 volume = {187}, 30626 series = {Lecture Notes in Economics and Mathematical Systems}, 30627 year = {1981}, 30628 publisher = {Springer Verlag}, 30629 address = {Berlin, Germany} 30630} 30631 30632@Book{ hockney.jesshope:parallel, 30633 author = {R. W. Hockney and C. R. Jesshope}, 30634 title = {Parallel Computers 2}, 30635 publisher = {Adam Hilger}, 30636 year = {1988}, 30637 address = {Bristol} 30638} 30639 30640@Article{ hoffman:approximate, 30641 author = {A. J. Hoffman}, 30642 title = {On Approximate Solutions of Systems of Linear Inequalities}, 30643 journal = {Journal of Research of the National Bureau of Standards}, 30644 year = {1952}, 30645 volume = {49}, 30646 pages = {263--265} 30647} 30648 30649@Article{ hogan:comments, 30650 author = {W. W. Hogan}, 30651 title = {Comments on Manne and Richels: `{CO2} Emission Limits: An Economic Cost Analysis 30652 for the {USA}}, 30653 journal = {The Energy Journal}, 30654 year = {1990}, 30655 volume = {11}, 30656 pages = {75--84} 30657} 30658 30659@Article{ hogan:energy, 30660 author = {W. W. Hogan}, 30661 title = {Energy Policy Models for {P}roject {I}ndependence}, 30662 journal = {Computers \& Operations Research}, 30663 year = {1975}, 30664 volume = {2}, 30665 pages = {251--271} 30666} 30667 30668@Book{ holland:adaptation, 30669 author = {J. Holland}, 30670 title = {Adaptation in Natural and Artificial Systems}, 30671 year = {1975}, 30672 publisher = {The University of Michigan Press}, 30673 address = {Ann Arbor, Michigan} 30674} 30675 30676@Article{ holmes.mackie:comparison, 30677 author = {T. Holmes and T. R. Mackie}, 30678 title = {A comparison of three inverse treatment planning algorithms}, 30679 journal = {Physics in Medicine and Biology}, 30680 year = {1994}, 30681 volume = {39}, 30682 number = {1}, 30683 pages = {91--106} 30684} 30685 30686@Article{ holmes.mackie:filtered, 30687 author = {T. Holmes and T. R. Mackie}, 30688 title = {A filtered backprojection dose calculation method for inverse treatment 30689 planning}, 30690 journal = {Medical Physics}, 30691 year = {1994}, 30692 volume = {21}, 30693 number = {2}, 30694 pages = {303--313} 30695} 30696 30697@Article{ hooke.jeeves:direct, 30698 author = {R. Hooke and T. A. Jeeves}, 30699 title = {Direct Search Solution of Numerical and Statistical Problems}, 30700 journal = {Journal of Associated Computing Machinery}, 30701 year = {1961}, 30702 volume = {8}, 30703 pages = {212--229} 30704} 30705 30706@Article{ hoppe.mittelmann:multi-grid, 30707 author = {R. H. W. Hoppe and H. D. Mittelmann}, 30708 title = {A Multi-grid Continuation Strategy for Parameter-dependent Variational 30709 Inequalities}, 30710 journal = {Journal of Computational and Applied Mathematics}, 30711 year = {1989}, 30712 volume = {26}, 30713 pages = {35--46} 30714} 30715 30716@Book{ horn.johnson:matrix, 30717 author = {R. A. Horn and C. R. Johnson}, 30718 title = {Matrix Anaysis}, 30719 publisher = {Cambridge University Press}, 30720 year = {1985}, 30721 address = {Cambridge, England} 30722} 30723 30724@Article{ hornik.stinchcombe.ea:multilayer, 30725 author = {K. Hornik and M. Stinchcombe and H. White}, 30726 title = {Multilayer Feedforward Networks are Universal Approximators}, 30727 journal = {Neural Networks}, 30728 year = {1989}, 30729 volume = {2}, 30730 pages = {359--366} 30731} 30732 30733@Article{ horowitz.sahni:computing, 30734 author = {E. Horowitz and S. Sahni}, 30735 title = {Computing Partitions with Applications to the Knapsack Problem}, 30736 journal = {jacm}, 30737 year = {1974}, 30738 volume = {21}, 30739 pages = {277--292} 30740} 30741 30742@Article{ hristov.fallone:continuous, 30743 author = {D. H. Hristov and B. G. Fallone}, 30744 title = {A continuous penalty function method for inverse treatment planning}, 30745 journal = {Medical Physics}, 30746 year = {1998}, 30747 volume = {25}, 30748 number = {2}, 30749 pages = {208--223} 30750} 30751 30752@Article{ hu.cheng.ea:numerical, 30753 author = {Y. Hu and H. S. Cheng and T. Arai and Y. Kobayashi and S. Aoyama}, 30754 title = {Numerical simulation of piston ring in mixed lubrication---a nonaxisymmetrical 30755 analysis}, 30756 journal = {Transactions of the {ASME}}, 30757 volume = {116}, 30758 year = {1994}, 30759 pages = {470--478} 30760} 30761 30762@InProceedings{ hua.sheu:skyscraper, 30763 author = {K. A. Hua and S. Sheu}, 30764 title = {Skyscraper Broadcasting: {A} New Broadcasting System for Metropolitan 30765 Video-On-Demand Systems}, 30766 year = {1997}, 30767 booktitle = {Proceedings of the {ACM SIGCOMM'97} Conference}, 30768 address = {Cannes, France}, 30769 pages = {89--100} 30770} 30771 30772@Article{ huang.pang:option, 30773 author = {J. Huang and J. S. Pang}, 30774 title = {Option Pricing and Linear Complementarity}, 30775 journal = {Journal of Computational Finance}, 30776 volume = {2}, 30777 year = {1998}, 30778 pages = {31--60} 30779} 30780 30781@InCollection{ huard:resolution, 30782 author = {P. Huard}, 30783 title = {Resolution of Mathematical Programming with Nonlinear Constraints by the Method 30784 of Centers}, 30785 booktitle = {Nonlinear Programming}, 30786 year = {1967}, 30787 editor = {J. Abadie}, 30788 publisher = {North--Holland}, 30789 address = {Amsterdam}, 30790 pages = {207--219} 30791} 30792 30793@Book{ huber:robust, 30794 author = {P. J. Huber}, 30795 title = {Robust Statistics}, 30796 year = {1981}, 30797 publisher = {John Wiley}, 30798 address = {New York} 30799} 30800 30801@Book{ hudson:piecewise, 30802 author = {J. F. P. Hudson}, 30803 title = {Piecewise Linear Topology}, 30804 publisher = {Benjamin}, 30805 address = {New York}, 30806 year = {1969} 30807} 30808 30809@InCollection{ hunter.markusen.ea:north, 30810 author = {L. Hunter and J. R. Markusen and T. F. Rutherford}, 30811 title = {{N}orth {A}merican free trade and the production of finished automobiles}, 30812 booktitle = {Modeling North American Economic Integration}, 30813 publisher = {Kluwer Academic Publishers}, 30814 year = {1995}, 30815 editor = {T. Kehoe and P. Kehoe}, 30816 pages = {117--130} 30817} 30818 30819@Article{ ibarra.kim:fast, 30820 author = {O. H. Ibarra and C. E. Kim}, 30821 title = {Fast Approximation Algorithms for the Knapsack and Sum of Subset Problems}, 30822 journal = {jacm}, 30823 year = {1975}, 30824 volume = {22}, 30825 pages = {463--468} 30826} 30827 30828@Article{ ijiri:fundamental, 30829 author = {Y. Ijiri}, 30830 title = {Fundamental Queries in Aggregation Theory}, 30831 journal = {Journal of the American Statistical Association}, 30832 year = {1971}, 30833 volume = {66}, 30834 pages = {766--782} 30835} 30836 30837@Article{ ingargiola.korsh:reduction, 30838 author = {G. P. Ingargiola and J. F. Korsh}, 30839 title = {A Reduction Algorithm for the Zero--One Single Knapsack Problem}, 30840 journal = {Management Science}, 30841 year = {1973}, 30842 volume = {20}, 30843 pages = {460--463} 30844} 30845 30846@Article{ ioffe:variational, 30847 author = {A. D. Ioffe}, 30848 title = {Variational Analysis of a Composite Function: {A} Formula for the Lower 30849 Second--Order Directional Derivative}, 30850 journal = {Journal of Mathematical Analysis and its Applications}, 30851 year = {1993} 30852} 30853 30854@Article{ iri.imai:multiplicative, 30855 author = {M. Iri and H. Imai}, 30856 title = {A Multiplicative Barrier Function Method for Linear Programming}, 30857 journal = {Algorithmica}, 30858 year = {1986}, 30859 volume = {1}, 30860 pages = {455--482} 30861} 30862 30863@Article{ isac.goeleven:implicit, 30864 author = {G. Isac and D. Goeleven}, 30865 title = {The Implicit General Order Complementarity Problem, Models and Iterative 30866 Methods}, 30867 journal = {Annals of Operations Research}, 30868 year = {1993} 30869} 30870 30871@Article{ isac.kostreva:generalized, 30872 author = {G. Isac and M. M. Kostreva}, 30873 title = {The Generalized Order Complementarity Problem}, 30874 journal = {Journal of Optimization Theory and Applications}, 30875 volume = {19}, 30876 pages = {227--232}, 30877 year = {1991} 30878} 30879 30880@Book{ isac:complementarity, 30881 author = {G. Isac}, 30882 title = {Complementarity Problems}, 30883 publisher = {Springer-Verlag}, 30884 year = {1992}, 30885 series = {Lecture Notes in Mathematics}, 30886 address = {New York} 30887} 30888 30889@Article{ iusem.svaiter:variant, 30890 author = {A. N. Iusem and B. F. Svaiter}, 30891 title = {A Variant of {K}orpelevich's Method for Variational Inequalities with a New 30892 Search Strategy}, 30893 journal = {Optimization}, 30894 year = {1997}, 30895 volume = {42}, 30896 pages = {309--321} 30897} 30898 30899@Article{ iusem:convergence, 30900 author = {A. N. Iusem}, 30901 title = {On the Convergence of Iterative Methods for Symmetric Linear Complementarity 30902 Problems}, 30903 journal = {Mathematical Programming}, 30904 year = {1993}, 30905 volume = {59}, 30906 pages = {33--48} 30907} 30908 30909@Article{ jackson.kutcher.ea:probability, 30910 author = {A. Jackson and G. J. Kutcher and E. D. Yorke}, 30911 title = {Probability of Radiation-Induced Complications for Normal Tissues with Parallel 30912 Architecture subject to Non-Uniform Irradiation}, 30913 journal = {Medical Physics}, 30914 year = {1993}, 30915 volume = {20}, 30916 pages = {613--625} 30917} 30918 30919@Article{ jackson:optimization, 30920 author = {A. Jackson and X. H. Wang and R. Mohan}, 30921 title = {Optimization of Conformal Treatment Planning and Quadratic Dose Objectives 30922 (abstract)}, 30923 journal = {Medical Physics}, 30924 year = {1994}, 30925 volume = {21}, 30926 pages = {1006} 30927} 30928 30929@TechReport{ jackson:scheduling, 30930 author = {J. R. Jackson}, 30931 title = {Scheduling a Production Line to Minimize Maximum Tardiness}, 30932 institution = {University of California}, 30933 year = {1955}, 30934 address = {Los Angeles}, 30935 number = {43}, 30936 type = {Research Report} 30937} 30938 30939@Article{ jansen.roos.ea:polynomiality, 30940 author = {B. Jansen and C. Roos and T. Terlaky and A. Yoshise}, 30941 title = {Polynomiality of Primal-Dual Affine Scaling Algorithms for Nonlinear 30942 Complementarity Problems}, 30943 journal = {Mathematical Programming}, 30944 volume = {78}, 30945 pages = {315--346}, 30946 year = {1997} 30947} 30948 30949@Article{ jiang.fukushima.ea:trust, 30950 author = {H. Jiang and M. Fukushima and L. Qi and D. Sun}, 30951 title = {A Trust Region Method for Solving Generalized Complementarity Problems}, 30952 journal = {SIAM Journal on Optimization}, 30953 volume = {8}, 30954 pages = {140--157}, 30955 year = {1998} 30956} 30957 30958@Article{ jiang.qi:nonsmooth, 30959 author = {H. Jiang and L. Qi}, 30960 title = {A New Nonsmooth Equations Approach to Nonlinear Complementarity Problems}, 30961 journal = {SIAM Journal on Control and Optimization}, 30962 volume = {35}, 30963 pages = {178--193}, 30964 year = {1997} 30965} 30966 30967@TechReport{ jiang.ralph:qpecgen, 30968 author = {H. Jiang and D. Ralph}, 30969 title = {{QPECgen}, a {MATLAB} Generator for Mathematical Programs with Quadratic 30970 Objectives and Affine Variational Inequality Constraints}, 30971 year = {1997}, 30972 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 30973 address = {Australia} 30974} 30975 30976@TechReport{ jiang.ralph:smooth, 30977 author = {H. Jiang and D. Ralph}, 30978 title = {Smooth {SQP} methods for Mathematical Programs with Nonlinear Complementarity 30979 Constraints}, 30980 year = {1997}, 30981 institution = {Department of Mathematics and Statistics, The University of Melbourne}, 30982 address = {Australia} 30983} 30984 30985@Article{ jiang:unconstrained, 30986 author = {H. Jiang}, 30987 title = {Unconstrained Minimization Approaches to Nonlinear Complementarity Problems}, 30988 journal = {Journal of Global Optimization, forthcoming}, 30989 year = {1997} 30990} 30991 30992@Article{ jittorntrum.osborne:strong, 30993 author = {K. Jittorntrum and M. R. Osborne}, 30994 title = {Strong uniqueness and second order convergence in nonlinear discrete 30995 approximation}, 30996 journal = {Numerische Mathematik}, 30997 year = {1980}, 30998 volume = {34}, 30999 pages = {439--455} 31000} 31001 31002@InProceedings{ jog.suh.ea:effects, 31003 crossref = {schaeffer:third}, 31004 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31005 title = {The Effects of Population Size, Heuristic Crossover and Local Improvement on a 31006 Genetic Algorithm for the Travelling Salesman Problem}, 31007 pages = {110--115} 31008} 31009 31010@Article{ jog.suh.ea:parallel, 31011 author = {P. Jog and J. Y. Suh and D. Van Gucht}, 31012 title = {Parallel Genetic Algorithms Applied to the Travelling Salesman Problem}, 31013 journal = {SIAM Journal on Optimization}, 31014 year = {1991}, 31015 volume = {1} 31016} 31017 31018@Article{ johansson.klarbring:rigid, 31019 author = {L. Johansson and A. Klarbring}, 31020 title = {The Rigid Punch Problem with Friction using Variational Inequalities and Linear 31021 Complementarity}, 31022 journal = {Mechanics of Structures \& Machines}, 31023 volume = {20}, 31024 pages = {293--319}, 31025 year = {1992} 31026} 31027 31028@Article{ johnson.aragon.ea:optimization, 31029 author = {D. S. Johnson and C. R. Aragon and L. A. McGeoch and C. Schevon}, 31030 title = {Optimization by Simulated Annealing: An Experimental Evaluation; Part {I}, Graph 31031 Partitioning}, 31032 journal = {Operations Research}, 31033 year = {1989}, 31034 volume = {37}, 31035 pages = {865--892} 31036} 31037 31038@Article{ johnson:optimally, 31039 author = {R. Johnson}, 31040 title = {Optimally Balancing Large Assembly Lines with {FABLE}}, 31041 journal = {Management Science}, 31042 year = {1988}, 31043 volume = {34}, 31044 pages = {240--253} 31045} 31046 31047@Article{ johnsson:solving, 31048 author = {S. L. Johnsson}, 31049 title = {Solving Tridiagonal Systems on Ensemble Architectures}, 31050 journal = {SIAM Journal on Scientific and Statistical Computing}, 31051 year = {1987}, 31052 volume = {8}, 31053 pages = {475--489} 31054} 31055 31056@Article{ jorgenson.wilcoxen:reducing, 31057 author = {D. W. Jorgenson and P. J. Wilcoxen}, 31058 title = {Reducing {US} Carbon Emissions: An Econometric General Equilibrium Assessment}, 31059 journal = {Resource and Energy Economics}, 31060 year = {1993}, 31061 volume = {15}, 31062 pages = {7--25} 31063} 31064 31065@TechReport{ josephy:hogans, 31066 author = {N. H. Josephy}, 31067 title = {Hogan's {PIES} Example and {L}emke's Algorithm}, 31068 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31069 year = {1979}, 31070 address = {Madison, Wisconsin}, 31071 number = {1972}, 31072 type = {Technical Summary Report} 31073} 31074 31075@TechReport{ josephy:newton, 31076 author = {N. H. Josephy}, 31077 title = {A {N}ewton Method for the {PIES} Energy Model}, 31078 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 31079 year = {1979}, 31080 address = {Madison, Wisconsin}, 31081 number = {1971}, 31082 type = {Technical Summary Report} 31083} 31084 31085@PhDThesis{ josephy:newtons, 31086 author = {N. H. Josephy}, 31087 title = {{N}ewton's Method for Generalized Equations and the {PIES} Energy Model}, 31088 year = {1979}, 31089 school = {Department of Industrial Engineering, University of Wisconsin--Madison} 31090} 31091 31092@TechReport{ josephy:newtons*1, 31093 author = {N. H. Josephy}, 31094 title = {{N}ewton's Method for Generalized Equations}, 31095 institution = {Mathematics Research Center, University of Wisconsin}, 31096 year = {1979}, 31097 address = {Madison, Wisconsin}, 31098 number = {1965}, 31099 type = {Technical Summary Report} 31100} 31101 31102@TechReport{ josephy:quasi-newton, 31103 author = {N. H. Josephy}, 31104 title = {Quasi--{N}ewton Methods for Generalized Equations}, 31105 institution = {Mathematics Research Center, University of Wisconsin}, 31106 year = {1979}, 31107 address = {Madison, Wisconsin}, 31108 number = {1966}, 31109 type = {Technical Summary Report} 31110} 31111 31112@PhDThesis{ kabbadj:methodes, 31113 author = {S. Kabbadj}, 31114 title = {Methodes Proximales Entropiques}, 31115 school = {Universit\'{e} de Montpellier II -- Sciences et Techniques du Languedoc}, 31116 year = {1994}, 31117 type = {Doctoral Thesis} 31118} 31119 31120@Book{ kall.wallace:stochastic, 31121 author = {P. Kall and S. W. Wallace}, 31122 title = {Stochastic Programming}, 31123 publisher = {John Wiley \& Sons}, 31124 year = {1994}, 31125 address = {Chichester} 31126} 31127 31128@Article{ kallman.agren.ea:tumor, 31129 author = {P. Kallman and A. Agren and A. Brahme}, 31130 title = {Tumor and Normal Tissue Responses to Fractionated Non-Uniform Dose Delivery}, 31131 journal = {International Journal of Radiation Biology}, 31132 year = {1992}, 31133 volume = {62}, 31134 pages = {249--262} 31135} 31136 31137@Misc{ kalvelagen:gams, 31138 author = {Erwin Kalvelagen}, 31139 title = {The {GAMS} {I/O} Library}, 31140 howpublished = {mimeo, GAMS Development Corporation}, 31141 year = {1992}, 31142 note = {Preliminary Version} 31143} 31144 31145@Article{ kaneko:complete, 31146 author = {I. Kaneko}, 31147 title = {Complete solution of a class of elastic-plastic structures}, 31148 journal = {Computer Methods in Applied Mechanics and Engineering}, 31149 volume = {21}, 31150 year = {1980}, 31151 pages = {193--209} 31152} 31153 31154@Article{ kaneko:mathematical, 31155 author = {I. Kaneko}, 31156 title = {A mathematical programming method for the inelastic analysis of reinforced 31157 concrete frames}, 31158 journal = {International Journal for Numerical Methods in Engineering}, 31159 volume = {11}, 31160 year = {1977}, 31161 pages = {1137--1154} 31162} 31163 31164@Article{ kaneko:piecewise, 31165 author = {I. Kaneko}, 31166 title = {Piecewise linear elastic-plastic analysis}, 31167 journal = {International Journal for Numerical Methods in Engineering}, 31168 volume = {14}, 31169 year = {1979}, 31170 pages = {757--767} 31171} 31172 31173@Article{ kanet:minimizing, 31174 author = {J. J. Kanet}, 31175 title = {Minimizing the Average Deviation of Job Completion Times about a Common Due 31176 Date}, 31177 journal = {Naval Research Logistics Quarterly}, 31178 year = {1981}, 31179 volume = {28}, 31180 pages = {643--651} 31181} 31182 31183@Article{ kantorovich:mathematical, 31184 author = {L. V. Kantorovich}, 31185 title = {Mathematical Methods in the Organization and Planning of Production}, 31186 journal = {Management Science}, 31187 year = {1960}, 31188 volume = {6}, 31189 pages = {366--422}, 31190 note = {English translation, Russian version 1939} 31191} 31192 31193@Article{ kanzow.fukushima:equivalence, 31194 author = {C. Kanzow and M. Fukushima}, 31195 title = {Equivalence of the Generalized Complementarity Problem to Differentiable 31196 Unconstrained Minimization}, 31197 journal = {Journal of Optimization Theory and Applications}, 31198 year = {1996}, 31199 volume = {90}, 31200 pages = {581--603} 31201} 31202 31203@Article{ kanzow.fukushima:theoretical, 31204 author = {C. Kanzow and M. Fukushima}, 31205 title = {Theoretical and Numerical Investigation of the {D}-gap function for 31206 Box-Constrained Variational Inequalities}, 31207 journal = {Mathematical Programming}, 31208 year = {1998}, 31209 volume = {83}, 31210 pages = {55--88} 31211} 31212 31213@Article{ kanzow.jiang:continuation, 31214 author = {C. Kanzow and H. Jiang}, 31215 title = {A Continuation Method for (Strongly) Monotone Variational Inequalities}, 31216 journal = {Mathematical Programming}, 31217 year = {1998}, 31218 volume = {81}, 31219 pages = {103--125} 31220} 31221 31222@Article{ kanzow.kleinmichel:class, 31223 author = {C. Kanzow and H. Kleinmichel}, 31224 title = {A Class of {N}ewton-Type Methods for Equality and Inequality Constrained 31225 Optimization}, 31226 journal = {Optimization Methods and Software}, 31227 year = {1995}, 31228 volume = {5}, 31229 pages = {173--198} 31230} 31231 31232@Article{ kanzow.kleinmichel:new, 31233 author = {C. Kanzow and H. Kleinmichel}, 31234 title = {A New Class of Semismooth {N}ewton-Type Methods for Nonlinear Complementarity 31235 Problems}, 31236 journal = {Computational Optimization and Applications}, 31237 volume = {11}, 31238 pages = {227--251}, 31239 year = {1998} 31240} 31241 31242@Article{ kanzow.pieper:jacobian, 31243 author = {C. Kanzow and H. Pieper}, 31244 title = {Jacobian Smoothing Methods for Nonlinear Complementarity Problems}, 31245 journal = {SIAM Journal on Optimization}, 31246 year = {1999}, 31247 volume = {9}, 31248 pages = {342--373} 31249} 31250 31251@Article{ kanzow.qi:qp-free, 31252 author = {C. Kanzow and H. -D. Qi}, 31253 title = {A {QP}-free constrained {N}ewton-type method for variational inequality 31254 problems}, 31255 journal = {Mathematical Programming}, 31256 year = {1999}, 31257 volume = {85}, 31258 pages = {81--106} 31259} 31260 31261@Article{ kanzow.yamashita.ea:ncp-functions, 31262 author = {C. Kanzow and N. Yamashita and M. Fukushima}, 31263 title = {New {NCP}-functions and their properties}, 31264 journal = {Journal of Optimization Theory and Applications}, 31265 year = {1997}, 31266 volume = {94}, 31267 pages = {115--135} 31268} 31269 31270@TechReport{ kanzow.zupke:inexact, 31271 author = {C. Kanzow and M. Zupke}, 31272 title = {Inexact Trust-Region Methods for Nonlinear Complementarity Problems}, 31273 year = {1997}, 31274 institution = {Institute of Applied Mathematics, University of Hamburg}, 31275 type = {Preprint}, 31276 number = {127}, 31277 address = {Hamburg, Germany} 31278} 31279 31280@Article{ kanzow:approach, 31281 author = {C. Kanzow}, 31282 title = {A New Approach to Continuation Methods for Complementarity Problems with Uniform 31283 {P}-Functions}, 31284 journal = {Operations Research Letters}, 31285 volume = {20}, 31286 year = {1997}, 31287 pages = {85--92} 31288} 31289 31290@Article{ kanzow:equation-based, 31291 author = {C. Kanzow}, 31292 title = {Some Equation--Based Methods for the Nonlinear Complementarity Problem}, 31293 journal = {Optimization Methods and Software}, 31294 year = {1994}, 31295 volume = {3}, 31296 pages = {327--340} 31297} 31298 31299@Article{ kanzow:global, 31300 author = {C. Kanzow}, 31301 title = {Global Convergence Properties of Some Iterative Methods for Linear 31302 Complementarity Problems}, 31303 journal = {SIAM Journal on Optimization}, 31304 year = {1996}, 31305 volume = {6}, 31306 pages = {326--341} 31307} 31308 31309@Article{ kanzow:inexact, 31310 author = {C. Kanzow}, 31311 title = {An Inexact {QP}--based method for nonlinear complementarity problems}, 31312 journal = {Numerische Mathematik, forthcoming}, 31313 year = {1999} 31314} 31315 31316@Article{ kanzow:noninterior, 31317 author = {C. Kanzow}, 31318 title = {Some Noninterior Continuation Methods for Linear Complementarity Problems}, 31319 journal = {SIAM Journal on Matrix Analysis and Applications}, 31320 volume = {17}, 31321 pages = {851--868}, 31322 year = {1996} 31323} 31324 31325@Article{ kanzow:nonlinear, 31326 author = {C. Kanzow}, 31327 title = {Nonlinear Complementarity as Unconstrained Optimization}, 31328 journal = {Journal of Optimization Theory and Applications}, 31329 year = {1996}, 31330 volume = {88}, 31331 pages = {139--155} 31332} 31333 31334@TechReport{ kanzow:semismooth, 31335 author = {C. Kanzow}, 31336 title = {Semismooth {N}ewton-Type Methods for the Solution of Nonlinear Complementarity 31337 Problems}, 31338 institution = {Institute of Applied Mathematics, University of Hamburg}, 31339 year = {1997}, 31340 type = {Preprint}, 31341 address = {Hamburg, Germany} 31342} 31343 31344@TechReport{ kanzow:tools, 31345 annote = {This should be replaced by kanzow:noninterior}, 31346 author = {C. Kanzow}, 31347 title = {Some Tools Allowing Interior--Point Methods to Become Noninterior}, 31348 institution = {Institute of Applied Mathematics, University of Hamburg}, 31349 year = {1994}, 31350 address = {Germany} 31351} 31352 31353@Article{ kaplan.meier:nonparametric, 31354 author = {E. L. Kaplan and P. Meier}, 31355 title = {Nonparametric Estimation from Incomplete Observations}, 31356 journal = {J. Am. Stat. Assoc.}, 31357 year = {1958}, 31358 volume = {53}, 31359 pages = {457--481} 31360} 31361 31362@Article{ karamardian:complementarity, 31363 author = {S. Karamardian}, 31364 title = {The Complementarity Problem}, 31365 journal = {Mathematical Programming}, 31366 year = {1972}, 31367 volume = {2}, 31368 pages = {107--129} 31369} 31370 31371@Article{ karamardian:complementarity*1, 31372 author = {S. Karamardian}, 31373 title = {Complementarity Problems over {C}ones with Monotone and Pseudomonotone Maps}, 31374 journal = {Journal of Optimization Theory and Applications}, 31375 year = {1976}, 31376 volume = {18}, 31377 pages = {445--454} 31378} 31379 31380@Article{ karamardian:generalized, 31381 author = {S. Karamardian}, 31382 title = {Generalized Complementarity Problem}, 31383 journal = {Journal of Optimization Theory and Applications}, 31384 year = {1971}, 31385 volume = {8}, 31386 pages = {161--167} 31387} 31388 31389@Article{ karmarkar.karp.ea:probabilistic, 31390 author = {N. Karmarkar and R. M. Karp and G. S. Lueker and A. M. Odlyzko}, 31391 title = {Probabilistic Analysis of Optimum Partitioning}, 31392 journal = {Journal of Applied Probability}, 31393 year = {1986}, 31394 volume = {23}, 31395 pages = {626--645} 31396} 31397 31398@Article{ karmarkar:polynomial, 31399 author = {N. Karmarkar}, 31400 title = {A New Polynomial Time Algorithm for Linear Programming}, 31401 journal = {Combinatorica}, 31402 year = {1984}, 31403 volume = {4}, 31404 pages = {373--395} 31405} 31406 31407@Unpublished{ karp:probabilistic, 31408 author = {R. M. Karp}, 31409 title = {Probabilistic Analysis of Algorithms}, 31410 note = {(Lecture Notes)} 31411} 31412 31413@InCollection{ karp:reducibility, 31414 author = {R. M. Karp}, 31415 title = {Reducibility among Combinatorial Problems}, 31416 booktitle = {Complexity of Computer Computations}, 31417 year = {1972}, 31418 editor = {R. E. Miller and J. W. Thatcher}, 31419 publisher = {Plenum Press}, 31420 address = {New York}, 31421 pages = {85--103} 31422} 31423 31424@MastersThesis{ karush:minima, 31425 author = {W. Karush}, 31426 title = {Minima of Functions of Several Variables with Inequalities as Side Conditions}, 31427 year = {1939}, 31428 school = {Department of Mathematics, University of Chicago} 31429} 31430 31431@TechReport{ karypis.kumar:metis, 31432 author = {G. Karypis and V. Kumar}, 31433 title = {{METIS}: Unstructured Graph Partitioning and Sparse Matrix Ordering System, 31434 Version 2.0}, 31435 institution = {University of Minnesota, Department of Computer Science}, 31436 type = {Technical Report}, 31437 address = {Minnesota}, 31438 year = {1995} 31439} 31440 31441@TechReport{ karypis.kumar:multilevel, 31442 author = {G. Karypis and V. Kumar}, 31443 title = {Multilevel k-way Partitioning Scheme for Irregular Graphs}, 31444 institution = {University of Minnesota, Department of Computer Science}, 31445 type = {Technical Report}, 31446 number = {95-064}, 31447 address = {Minnesota}, 31448 year = {1995} 31449} 31450 31451@Article{ katukani:generalization, 31452 author = {S. Katukani}, 31453 title = {A Generalization of {B}rouwer's Fixed Point Theorem}, 31454 journal = {Duke Mathematical Journal}, 31455 year = {1941}, 31456 volume = {8}, 31457 pages = {457--459} 31458} 31459 31460@Article{ keifer.wolfowitz:stochastic, 31461 author = {J. Keifer and J. Wolfowitz}, 31462 title = {Stochastic Estimation of the Maximum of a Regression Function}, 31463 journal = {Annals of Mathematical Statistics}, 31464 year = {1952}, 31465 volume = {23}, 31466 pages = {462--466} 31467} 31468 31469@InCollection{ kellog.li.ea:method, 31470 author = {R. B. Kellog and T. Y. Li and J. A. Yorke}, 31471 title = {A Method of Continuation for Calculating a {B}rouwer Fixed Point}, 31472 booktitle = {Computing Fixed Points with Applications}, 31473 year = {1977}, 31474 editor = {S. Karamardian}, 31475 publisher = {Academic Press}, 31476 pages = {133--147} 31477} 31478 31479@Book{ kennington.helgason:algorithms, 31480 author = {J. L. Kennington and R. V. Helgason}, 31481 title = {Algorithms for Network Programming}, 31482 year = {1980}, 31483 publisher = {John Wiley \& Sons}, 31484 address = {New York} 31485} 31486 31487@Article{ kernighan.lin:efficient, 31488 author = {B. W. Kernighan and S. Lin}, 31489 title = {An Efficient Heuristic Procedure for Partitioning Graphs}, 31490 journal = {The Bell System Technical Journal}, 31491 pages = {291--307}, 31492 volume = {29}, 31493 year = {1970} 31494} 31495 31496@Article{ khachian:polynomial, 31497 author = {L. G. Khachian}, 31498 title = {A Polynomial Algorithm for Linear Programming}, 31499 journal = {Soviet Mathematics Doklady}, 31500 year = {1979}, 31501 volume = {20}, 31502 pages = {191--194} 31503} 31504 31505@Article{ khobotov:modification, 31506 author = {E. N. Khobotov}, 31507 title = {A Modification of the Extragradient Method for the Solution of Variational 31508 Inequalities and some Optimization Problems}, 31509 journal = {Zhurnal Vychislitel'noi Matematiki i Matematicheskoi Fiziki}, 31510 year = {1987}, 31511 volume = {27}, 31512 pages = {1462--1473} 31513} 31514 31515@Book{ khuri.cornell:response, 31516 author = {A. I. Khuri and J. A. Cornell}, 31517 title = {Response Surfaces: Designs and Analyses}, 31518 publisher = {Marcel Dekker}, 31519 year = {1987}, 31520 address = {New York} 31521} 31522 31523@Article{ kibardin:decomposition, 31524 author = {V. M. Kibardin}, 31525 title = {Decomposition into Functions in the Minimization Problems}, 31526 journal = {Automation and Remote Control}, 31527 year = {1980}, 31528 volume = {40}, 31529 pages = {1311--1323} 31530} 31531 31532@TechReport{ king:sposl, 31533 author = {A. J. King}, 31534 title = {{SP/OSL} Version 1.0 Stochastic Programming Interface Library User's Guide}, 31535 institution = {IBM T.J. Watson Research Center}, 31536 year = {1994}, 31537 number = {RC 19757}, 31538 address = {Yorktown Heights, New York} 31539} 31540 31541@Article{ kirkpatrick.gelatt.ea:optimization, 31542 author = {S. Kirkpatrick and C. D. Gelatt and M. P. {Vecchi Jr.}}, 31543 title = {Optimization by Simulated Annealing}, 31544 journal = {Science}, 31545 year = {1983}, 31546 volume = {220}, 31547 pages = {671--680} 31548} 31549 31550@Book{ kiwiel:methods, 31551 author = {K. C. Kiwiel}, 31552 title = {Methods of Descent for Nondifferentiable Optimization}, 31553 year = {1985}, 31554 publisher = {Springer-Verlag}, 31555 address = {Berlin}, 31556 series = {Lecture Notes in Mathematics}, 31557 number = {1133} 31558} 31559 31560@Article{ kiwiel:twice, 31561 author = {K. C. Kiwiel}, 31562 title = {On the Twice Differentiable Cubic Augmented {L}agrangian}, 31563 journal = {Journal of Optimization Theory and Applications}, 31564 year = {1996}, 31565 volume = {88}, 31566 pages = {233--236} 31567} 31568 31569@Article{ klarbring.bjorkman:mathematical, 31570 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31571 title = {A mathematical programming approach to contact problems with friction and varying 31572 contact surface}, 31573 journal = {Computers \& Structures}, 31574 volume = {30}, 31575 year = {1988}, 31576 pages = {1185--1198} 31577} 31578 31579@Article{ klarbring.bjorkman:solution, 31580 author = {A. Klarbring and G. Bj{\"{o}}rkman}, 31581 title = {Solution of large displacement contact problems with friction using {N}ewton's 31582 method for generalized equations}, 31583 journal = {International Journal for Numerical Methods in Engineering}, 31584 volume = {34}, 31585 year = {1992}, 31586 pages = {249--269} 31587} 31588 31589@Article{ klarbring.pang:existence, 31590 author = {A. Klarbring and J. S. Pang}, 31591 title = {Existence of solution to discrete semicoercive frictional contact problems}, 31592 journal = {{SIAM} Journal on Optimization, under review}, 31593 year = {1996} 31594} 31595 31596@Article{ klarbring:discrete, 31597 author = {A. Klarbring}, 31598 title = {On Discrete and Discretized Non-linear Elastic Structures in Unilateral Contact 31599 (Stability, Uniqueness and Variational Principles)}, 31600 journal = {International Journal on Solids and Structures}, 31601 volume = {24}, 31602 pages = {459--479}, 31603 year = {1988} 31604} 31605 31606@TechReport{ klarbring:large, 31607 author = {A. Klarbring}, 31608 title = {Large Displacement Frictional Contact: a Continuum Framework for Finite Element 31609 Discretization}, 31610 number = {LiTH-IKP-R-798}, 31611 institution = {Department of Mechanical Engineering, Link{\"o}ping Institute of Technology}, 31612 address = {Link{\"o}ping}, 31613 year = {1994} 31614} 31615 31616@Article{ klarbring:mathematical, 31617 author = {A. Klarbring}, 31618 title = {A mathematical programming approach to three dimensional contact problems with 31619 friction}, 31620 journal = {Computer Methods in Applied Mechanics and Engineering}, 31621 volume = {58}, 31622 year = {1986}, 31623 pages = {175--200} 31624} 31625 31626@InCollection{ klarbring:mathematical*1, 31627 author = {A. Klarbring}, 31628 title = {Mathematical programming and augmented {L}agrangian methods for frictional 31629 contact problems}, 31630 editor = {A. Curnier}, 31631 booktitle = {Proceedings Contact Mechanics International Symposium}, 31632 publisher = {Presse Polytechniques et Universitaires Romandes}, 31633 address = {Lausanne}, 31634 year = {1992}, 31635 pages = {409--422} 31636} 31637 31638@InCollection{ klarbring:mathematical*2, 31639 author = {A. Klarbring}, 31640 title = {Mathematical programming in contact problems}, 31641 editors = {M. H. Aliabadi and C. A. Brebbia}, 31642 booktitle = {Computational Methods for Contact Problems}, 31643 publisher = {Computational Mechanics Publications}, 31644 address = {Southampton}, 31645 year = {1993}, 31646 pages = {233--264} 31647} 31648 31649@Article{ klarbring:quadratic, 31650 author = {A. Klarbring}, 31651 title = {A quadratic program in frictionless contact problems}, 31652 journal = {International Journal of Engineering Science}, 31653 volume = {24}, 31654 pages = {1207--1217}, 31655 year = {1986} 31656} 31657 31658@InCollection{ klee.minty:how, 31659 author = {V. Klee and G. J. Minty}, 31660 title = {How Good is the Simplex Algorithm?}, 31661 booktitle = {Inequalities--III}, 31662 year = {1972}, 31663 publisher = {Academic Press}, 31664 pages = {159--175} 31665} 31666 31667@Article{ kleywegt.shapiro:sample, 31668 author = {A. Kleywegt and A. Shapiro}, 31669 title = {The Sample Average Approximation Method for Stochastic Discrete Optimization}, 31670 journal = {Stochastic Programming E-Print Series}, 31671 year = {1999}, 31672 note = {Available from dochost.rz.hu-berlin.de/speps} 31673} 31674 31675@Book{ knuth:art, 31676 author = {D. E. Knuth}, 31677 title = {The Art of Computer Programming}, 31678 publisher = {Addison-Wesley Longman Inc.}, 31679 address = {Reading, Massachusetts}, 31680 year = {1998}, 31681 edition = {Third}, 31682 volume = {2} 31683} 31684 31685@InProceedings{ kocvara.outrata:nonsmooth, 31686 author = {M. Ko\v{c}vara and J. V. Outrata}, 31687 title = {A nonsmooth approach to optimization problems with equilibrium constraints}, 31688 crossref = {ferris.pang:complementarity}, 31689 pages = {148--164} 31690} 31691 31692@Article{ kocvara.outrata:optimization, 31693 author = {M. Ko\v{c}vara and J. V. Outrata}, 31694 title = {On Optimization of Systems Governed by Implicit Complementarity Problems}, 31695 volume = {15}, 31696 journal = {Numerical Fucntional Analysis and Optimization}, 31697 year = {1994}, 31698 pages = {869--887} 31699} 31700 31701@InCollection{ kocvara.outrata:solution, 31702 author = {M. Ko\v{c}vara and J. V. Outrata}, 31703 title = {On the solution of optimum design problems with variational inequalities}, 31704 editors = {D. Z. Du and L. Qi and R. Womersley}, 31705 booktitle = {Recent Advances in Nonsmooth Optimization}, 31706 publisher = {World Scientific Publishers}, 31707 address = {Singapore}, 31708 year = {1995}, 31709 pages = {172--192} 31710} 31711 31712@Article{ kojima.hirabayashi:homotopy, 31713 author = {M. Kojima and R. Hirabayashi}, 31714 title = {Continuous deformation of nonlinear programs}, 31715 journal = {Mathematical Programming Study}, 31716 editor = {A.~V. Fiacco}, 31717 publisher = {North--Holland}, 31718 address = {Amsterdam}, 31719 year = {1984}, 31720 volume = {21}, 31721 pages = {150--198} 31722} 31723 31724@Article{ kojima.megiddo.ea:homotopy, 31725 author = {M. Kojima and N. Megiddo and T. Noma}, 31726 title = {Homotopy Continuation Methods for Nonlinear Complementarity Problems}, 31727 journal = {Mathematics of Operations Research}, 31728 year = {1991}, 31729 volume = {16}, 31730 pages = {754--774} 31731} 31732 31733@TechReport{ kojima.megiddo.ea:primal-dual, 31734 author = {M. Kojima and N. Megiddo and S. Mizuno}, 31735 title = {A primal-dual exterior point algorithm for linear programming}, 31736 institution = {IBM Alamaden Research Center}, 31737 year = {1991}, 31738 number = {RJ 8500}, 31739 address = {San Jose, California} 31740} 31741 31742@Book{ kojima.megiddo.ea:unified, 31743 author = {M. Kojima and N. Megiddo and T. Noma and A. Yoshise}, 31744 title = {A Unified Approach to Interior Point Algorithms for Linear Complementarity 31745 Problems}, 31746 year = {1991}, 31747 publisher = {Springer-Verlag}, 31748 address = {Berlin}, 31749 volume = {538}, 31750 series = {Lecture Notes in Computer Science} 31751} 31752 31753@Article{ kojima.mizuno.ea:continuation, 31754 author = {M. Kojima and S. Mizuno and T. Noma}, 31755 title = {A New Continuation Method for Complementarity Problems with Uniform 31756 {P}-function}, 31757 journal = {Mathematical Programming}, 31758 year = {1989}, 31759 volume = {43}, 31760 pages = {107--113} 31761} 31762 31763@TechReport{ kojima.mizuno.ea:infeasible, 31764 author = {M. Kojima and S. Mizuno and M. Todd}, 31765 title = {Infeasible interior-point primal-dual potential-reduction algorithms for linear 31766 programming}, 31767 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 31768 year = {1992}, 31769 number = {1023}, 31770 address = {Ithaca, New York}, 31771 month = aug 31772} 31773 31774@Article{ kojima.mizuno.ea:onl, 31775 author = {M. Kojima and S. Mizuno and A. Yoshise}, 31776 title = {An ${O}(\sqrt{n}{L})$ iteration potential reduction algorithm for linear 31777 complementarity problems}, 31778 journal = {Mathematical Programming}, 31779 year = {1991}, 31780 volume = {50}, 31781 pages = {331--342} 31782} 31783 31784@Article{ kojima.mizuno.ea:polynomial-time, 31785 author = {M. Kojima and S. Mizuno and A. Yoshise}, 31786 title = {A Polynomial-Time Algorithm for a Class of Linear Complementarity Problems}, 31787 journal = {Mathematical Programming}, 31788 year = {1989}, 31789 volume = {44}, 31790 pages = {1--20} 31791} 31792 31793@Article{ kojima.noma.ea:global, 31794 author = {M. Kojima and T. Noma and A. Yoshise}, 31795 title = {Global Convergence in Infeasible Interior--Point Algorithms}, 31796 journal = {Mathematical Programming}, 31797 volume = {65}, 31798 pages = {43--72}, 31799 year = {1994} 31800} 31801 31802@Article{ kojima.shindo.ea:interior-point, 31803 author = {M. Kojima and S. Shindo and S. Hara}, 31804 title = {Interior--Point Methods for the Monotone Semidefinite Linear Complementarity 31805 Problem in Symmetric Matrices}, 31806 journal = {SIAM Journal on Optimization}, 31807 volume = {7}, 31808 pages = {86--125} 31809} 31810 31811@Article{ kojima.shindo:extensions, 31812 author = {M. Kojima and S. Shindo}, 31813 title = {Extensions of {N}ewton and Quasi-{N}ewton Methods to Systems of {PC}$^1$ 31814 Equations}, 31815 journal = {Journal of Operations Research Society of Japan}, 31816 year = {1986}, 31817 volume = {29}, 31818 pages = {352--374} 31819} 31820 31821@Article{ kojima:computational, 31822 author = {M. Kojima}, 31823 title = {Computational Methods for Solving the Nonlinear Complementarity Problem}, 31824 journal = {Keio Engineering Reports}, 31825 year = {1974}, 31826 volume = {27}, 31827 pages = {1--41} 31828} 31829 31830@Article{ kojima:recent, 31831 author = {M. Kojima}, 31832 title = {Recent advances in mathematical programming. {X}. Computation of fixed points by 31833 continuation methods}, 31834 journal = {Systems and Control}, 31835 year = {1981}, 31836 volume = {25}, 31837 pages = {421--430} 31838} 31839 31840@Article{ kolesar:branch, 31841 author = {P. J. Kolesar}, 31842 title = {A Branch and Bound Algorithm for the Knapsack Problem}, 31843 journal = {Management Science}, 31844 year = {1967}, 31845 volume = {13}, 31846 pages = {723--735} 31847} 31848 31849@Book{ kolman.beck:elementary, 31850 author = {B. Kolman and R. E. Beck}, 31851 title = {Elementary Linear Programming with Applications}, 31852 year = {1980}, 31853 publisher = {Academic Press} 31854} 31855 31856@Book{ koopmans:activity, 31857 editor = {T. C. Koopmans}, 31858 title = {Activity Analysis of Production and Allocation}, 31859 publisher = {John Wiley}, 31860 address = {New York}, 31861 year = {1951} 31862} 31863 31864@Article{ korpelevich:extragradient, 31865 author = {G. M. Korpelevich}, 31866 title = {The Extragradient Method for Finding Saddle Points and Other Problems}, 31867 journal = {Matecon}, 31868 year = {1976}, 31869 volume = {12}, 31870 pages = {747--756} 31871} 31872 31873@Article{ kortanek.shi:convergence, 31874 author = {K. O. Kortanek and M. Shi}, 31875 title = {Convergence Results and Numerical Experiments on a Linear Programming Hybrid 31876 Algorithm}, 31877 journal = {European Journal of Operational Research}, 31878 year = {1987}, 31879 volume = {32}, 31880 pages = {47--61} 31881} 31882 31883@TechReport{ kortanek.shi:remarks, 31884 author = {K. O. Kortanek and M. Shi}, 31885 title = {Remarks on `Convergence Results and Numerical Experiments on a Linear Programming 31886 Hybrid Algorithm 1985-6'}, 31887 institution = {College of Business Administration, University of Iowa}, 31888 year = {1987}, 31889 address = {Iowa City}, 31890 number = {87--1}, 31891 type = {Working Paper} 31892} 31893 31894@TechReport{ kortanek:vector-supercomputer, 31895 author = {K. O. Kortanek}, 31896 title = {Vector--Supercomputer Experiments with the Linear Programming Scaling Algorithm}, 31897 institution = {College of Business Administration, University of Iowa}, 31898 year = {1987}, 31899 address = {Iowa City}, 31900 number = {87--2}, 31901 type = {Working Paper} 31902} 31903 31904@Article{ kostreva:block, 31905 author = {M. M. Kostreva}, 31906 title = {Block Pivot Methods for Solving the Complementarity Problem}, 31907 journal = {Linear Algebra and Its Applications}, 31908 volume = {21}, 31909 pages = {207--215}, 31910 year = {1978} 31911} 31912 31913@Article{ kostreva:elasto-hydrodynamic, 31914 author = {M. M. Kostreva}, 31915 title = {Elasto-hydrodynamic Lubrication: {A} non-linear complementarity problem}, 31916 journal = {International Journal for Numerical Methods in Fluids}, 31917 year = {1984}, 31918 volume = {4}, 31919 pages = {377--397} 31920} 31921 31922@Article{ kostreva:recent, 31923 author = {M. M. Kostreva}, 31924 title = {Recent Results on Complementarity Models for Engineering and Economics}, 31925 journal = {Infor, Journal of the Canadian {OR} Society}, 31926 year = {1990}, 31927 volume = {28}, 31928 pages = {324--334} 31929} 31930 31931@Article{ kotiah.steinberg:occurrences, 31932 author = {T. C. T. Kotiah and D. I. Steinberg}, 31933 title = {Occurrences of Cycling and Other Phenomena Arising in a Class of Linear 31934 Programming Models}, 31935 journal = {Communications of the ACM}, 31936 volume = {20}, 31937 year = {1977}, 31938 pages = {107--112} 31939} 31940 31941@Article{ kotiah.steinberg:possibility, 31942 author = {T. C. T. Kotiah and D. I. Steinberg}, 31943 title = {On the Possibility of Cycling with the Simplex Method}, 31944 journal = {Operations Research}, 31945 volume = {26}, 31946 year = {1978}, 31947 pages = {374--376} 31948} 31949 31950@InCollection{ kuhn.tucker:nonlinear, 31951 author = {H. W. Kuhn and A. W. Tucker}, 31952 title = {Nonlinear Programming}, 31953 booktitle = {Proceedings of the Second Berkeley Symposium on Mathematical Statistics and 31954 Probability}, 31955 year = {1951}, 31956 editor = {J. Neyman}, 31957 publisher = {University of California Press}, 31958 address = {Berkeley and Los Angeles}, 31959 pages = {481--492} 31960} 31961 31962@Article{ kummer:metric, 31963 author = {B. Kummer}, 31964 title = {Metric regularity: characterizations, nonsmooth variations, and successive 31965 approximation}, 31966 journal = {Journal of Mathematical Analysis and its Applications}, 31967 year = {}, 31968 optkey = {}, 31969 optvolume = {}, 31970 optnumber = {}, 31971 optpages = {}, 31972 optmonth = {}, 31973 optnote = {}, 31974 optannote = {} 31975} 31976 31977@InCollection{ kummer:newtons, 31978 author = {B. Kummer}, 31979 title = {{N}ewton's Method for Non--Differentiable Functions}, 31980 booktitle = {Advances in Mathematical Optimization}, 31981 publisher = {Akademie--Verlag}, 31982 year = {1988}, 31983 editors = {J. Guddat et al.}, 31984 pages = {114--125}, 31985 address = {Berlin} 31986} 31987 31988@Unpublished{ kuntsevich.kappel:solvopt, 31989 author = {A. Kuntsevich and F. Kappel}, 31990 title = {{SolvOpt}: The Solver for Local Nonlinear Optimization Problems}, 31991 year = {1997}, 31992 note = {Institute for Mathematics, Karl-Franzens University of Graz}, 31993 url = {http://bedvgm.kfunigraz.ac.at:8001/alex/solvopt/solvopt.html} 31994} 31995 31996@Book{ kushner.clark:stochastic, 31997 author = {H. J. Kushner and D. S. Clark}, 31998 title = {Stochastic Approximation Methods for Constrained and Unconstrained Systems}, 31999 publisher = {Springer-Verlag}, 32000 year = {1978}, 32001 address = {New York} 32002} 32003 32004@Article{ kutcher.burman.ea:histogram, 32005 author = {G. J. Kutcher and C. Burman and L. Brewster and M. Goitein and R. Mohan}, 32006 title = {Histogram reduction method for calculating complication probabilities for 32007 three-dimensional treatment planning evaluation}, 32008 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32009 year = {1991}, 32010 optvolume = {21}, 32011 optpages = {137-146} 32012} 32013 32014@Article{ kutcher.burman:calculation, 32015 author = {G. J. Kutcher and C. Burman}, 32016 title = {Calculation of Complication Probability Factors for Non-Uniform Normal Tissue 32017 Irradiation: The Effective Volume Method}, 32018 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32019 year = {1989}, 32020 volume = {16}, 32021 pages = {1623--1630} 32022} 32023 32024@Article{ kwak.lee:complementarity, 32025 author = {B. M. Kwak and B. C. Lee.}, 32026 title = {A Complementarity Problem Formulation for Two-Dimensional Frictional Contact 32027 Problem}, 32028 journal = {Computers and Structures}, 32029 volume = {18}, 32030 pages = {469--480}, 32031 year = {1988} 32032} 32033 32034@Article{ kwak:complementarity, 32035 author = {B. M. Kwak}, 32036 title = {Complementarity Problem Formulation of Three-Dimensional Frictional Contact}, 32037 journal = {Journal of Applied Mechanics}, 32038 volume = {58}, 32039 pages = {134--140}, 32040 year = {1991} 32041} 32042 32043@Article{ lagarias.reeds.ea:convergence, 32044 author = {J. C. Lagarias and J. A. Reeds and M. H. Wright and P. E. Wright}, 32045 title = {Convergence of the {N}elder-{M}ead Simplex method in Low Dimensions}, 32046 journal = {SIAM Journal on Optimization}, 32047 year = {1998}, 32048 volume = {9}, 32049 pages = {112--147} 32050} 32051 32052@Article{ lahaye:methode, 32053 author = {E. Lahaye}, 32054 title = {Une {M}\'{e}thode de {R}\'{e}solution d'une Cat\'{e}gorie d'\'{E}quations 32055 transcendantes}, 32056 journal = {C. R. Acad. Sci. Paris}, 32057 year = {1934}, 32058 volume = {198}, 32059 pages = {1840--1842} 32060} 32061 32062@Article{ lahaye:solution, 32063 author = {E. Lahaye}, 32064 title = {Solution of Systems of Transcendental Equations}, 32065 journal = {Acad. Roy. Belg. Bull. Cl. Sci.}, 32066 year = {1948}, 32067 volume = {5}, 32068 pages = {805--822} 32069} 32070 32071@Article{ lahenbruch.mickey:estimation, 32072 author = {P. A. Lahenbruch and R. M. Mickey}, 32073 title = {Estimation of Error Rates in Discriminant Analysis}, 32074 journal = {Technometrics}, 32075 year = {1968}, 32076 volume = {10}, 32077 pages = {1--11} 32078} 32079 32080@Article{ lakshminarayan.lakshmanan.ea:optimal, 32081 author = {S. Lakshminarayan and R. Lakshmanan and R. L. Papineau and R. Rochette}, 32082 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness}, 32083 journal = {Operations Research}, 32084 year = {1978}, 32085 volume = {26}, 32086 pages = {1079--1082} 32087} 32088 32089@Article{ land.doig:automatic, 32090 author = {A. H. Land and A. G. Doig}, 32091 title = {An Automatic Method for Solving Discrete Programming Problems}, 32092 journal = {Econometrica}, 32093 volume = {28}, 32094 year = {1960}, 32095 pages = {497-520} 32096} 32097 32098@Article{ langer.morrill:comparison, 32099 author = {M. Langer and S. Morrill}, 32100 title = {A comparison of mixed integer programming and fast simulated annealing for 32101 optimized beam weights in radiation therapy}, 32102 journal = {Medical Physics}, 32103 year = {1996}, 32104 volume = {23}, 32105 number = {6}, 32106 pages = {957--964} 32107} 32108 32109@Article{ larsson.patriksson:class, 32110 author = {T. Larsson and M. Patriksson}, 32111 title = {A Class of Gap Functions for Variational Inequalities}, 32112 journal = {Mathematical Programming}, 32113 year = {1994}, 32114 volume = {64}, 32115 pages = {53--79} 32116} 32117 32118@Article{ lasdon.waren.ea:solving, 32119 author = {L. S. Lasdon and A. Waren and S. Sarkar and F. Palacios}, 32120 title = {Solving the Pooling Problem Using Generalized Reduced Gradient and Successive 32121 Linear Programming Algorithms}, 32122 journal = {ACM SIGMAP Bulletin}, 32123 year = {1979}, 32124 volume = {27}, 32125 pages = {9--15} 32126} 32127 32128@TechReport{ lawler.lenstra.ea:sequencing, 32129 author = {E. L. Lawler and J. K. Lenstra and A. H. G. Rinnooy Kan and D. B. Shmoys}, 32130 title = {Sequencing and Scheduling: Algorithms and Complexity}, 32131 institution = {Centre for Mathematics and Computer Science}, 32132 year = {1989}, 32133 address = {P.O. Box 4079, 1009 AB Amsterdam, The Netherlands}, 32134 number = {BS--R89xx} 32135} 32136 32137@Article{ lawler:fast, 32138 author = {E. L. Lawler}, 32139 title = {Fast Approximations Algorithms for Knapsack Problems}, 32140 journal = {Mathematics of Operations Research}, 32141 year = {1979}, 32142 volume = {4}, 32143 pages = {339--356} 32144} 32145 32146@Book{ lawless:statistical, 32147 author = {J. F. Lawless}, 32148 title = {Statistical Models and Methods for Lifetime Data}, 32149 year = {1982}, 32150 publisher = {John Wiley and Sons}, 32151 address = {New York, NY} 32152} 32153 32154@Article{ lawrence.spingarn:fixed, 32155 author = {J. Lawrence and J. E. Spingarn}, 32156 title = {On fixed points of non-expansive piecewise isometric mappings}, 32157 journal = {Proceedings of the London Mathematical Society}, 32158 year = {1987}, 32159 volume = {55}, 32160 number = {3}, 32161 pages = {605--624} 32162} 32163 32164@Article{ leavitt.martin.ea:dynamic, 32165 author = {D. D. Leavitt and M. Martin and J. H. Moeller and W. L. Lee}, 32166 title = {Dynamic wedge field techniques through computer-controlled collimator motion and 32167 dose delivery}, 32168 journal = {Medical Physics}, 32169 year = {1990}, 32170 volume = {17}, 32171 number = {1}, 32172 pages = {87--92} 32173} 32174 32175@Article{ leblanc.morlok.ea:efficient, 32176 author = {L. J. LeBlanc and E. K. Morlok and W. P. Pierskalla}, 32177 title = {An Efficient Approach to Solving the Road Network Equilibrium Traffic Assignment 32178 Problem}, 32179 journal = {Transportation Research}, 32180 volume = {9}, 32181 year = {1975}, 32182 pages = {309--318} 32183} 32184 32185@Article{ lee:computational, 32186 author = {S. S. Lee}, 32187 title = {A computational method for frictional contact problem using finite element 32188 method}, 32189 journal = {International Journal for Numerical Methods in Engineering}, 32190 volume = {37}, 32191 year = {1994}, 32192 pages = {217--228} 32193} 32194 32195@PhDThesis{ lee:military, 32196 author = {D. K. Lee}, 32197 title = {Military Force Planning Problems Under Uncertainty}, 32198 school = {University of Wisconsin -- Madison}, 32199 year = {1996}, 32200 address = {Madison, Wisconsin} 32201} 32202 32203@Article{ leibel.kutcher.ea:improved, 32204 author = {S. A. Leibel and G. J. Kutcher and L. B. Harrison and D. E. Fass and C. Burman 32205 and M. Hunt and R. Mohan and L. J. Brewster and C. C. Ling and Z. Y. Fuks}, 32206 title = {Improved Dose Distributions For 3{D} Conformal Boost Treatments in Carcinoma of 32207 the Nasopharynx}, 32208 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32209 year = {1991}, 32210 volume = {20}, 32211 pages = {823--833} 32212} 32213 32214@Article{ lee.gallagher.ea:treatment, 32215 author = {E. K. Lee and R. J. Gallagher and D. Silvern and C. S. Wuu and M. Zaider}, 32216 title = {Treatment Planning for Brachytherapy: an Integer Programming Model, Two 32217 Computational Approaches and Experiments with Permanent Prostate Implant 32218 Planning}, 32219 journal = {Physics in Medicine and Biology}, 32220 year = {1999}, 32221 volume = {44}, 32222 pages = {145--165} 32223} 32224 32225@Article{ lemarechal.nemirovskii.ea:variants, 32226 author = {C. Lemar\'{e}chal and A. Nemirovskii and Y. Nesterov}, 32227 title = {New Variants of Bundle Methods}, 32228 year = {1995}, 32229 journal = {Mathematical Programming}, 32230 volume = {69}, 32231 pages = {111--147} 32232} 32233 32234@InCollection{ lemarechal.strodiot.ea:bundle, 32235 author = {C. Lemar\'{e}chal and J. J. Strodiot and A. Bihain}, 32236 title = {On a Bundle Algorithm for Nonsmooth Optimization}, 32237 booktitle = {Nonlinear Programming}, 32238 year = {1981}, 32239 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 32240 publisher = {Academic Press}, 32241 pages = {245--282}, 32242 volume = {4} 32243} 32244 32245@Article{ lemke.howson:equilibrium, 32246 author = {C. E. Lemke and J. T. Howson}, 32247 title = {Equilibrium Points of Bimatrix Games}, 32248 journal = {SIAM Journal on Applied Mathematics}, 32249 year = {1964}, 32250 volume = {12}, 32251 pages = {413--423} 32252} 32253 32254@Article{ lemke:bimatrix, 32255 author = {C. E. Lemke}, 32256 title = {Bimatrix Equilibrium Points and Mathematical Programming}, 32257 journal = {Management Science}, 32258 year = {1965}, 32259 volume = {11}, 32260 pages = {681--689} 32261} 32262 32263@InCollection{ lemke:complementary, 32264 author = {C. E. Lemke}, 32265 title = {On Complementary Pivot Theory}, 32266 booktitle = {Mathematics of the Decision Sciences: Part 1}, 32267 publisher = {American Mathematical Society}, 32268 year = {1968}, 32269 editor = {G. B. Dantzig and A. F. Veinott}, 32270 volume = {11}, 32271 series = {Lectures in Applied Mathematics}, 32272 address = {Providence}, 32273 pages = {95--114} 32274} 32275 32276@Article{ levenberg:method, 32277 author = {K. Levenberg}, 32278 title = {A Method for the Solution of Certain Nonlinear Problems in Least Squares}, 32279 journal = {Quarterly Applied Mathematics}, 32280 year = {1944}, 32281 volume = {2}, 32282 pages = {164--168} 32283} 32284 32285@Article{ levitin.polyak:constrained, 32286 author = {E. S. Levitin and B. T. Polyak}, 32287 title = {Constrained minimization methods}, 32288 journal = {Computational Mathematics and Mathematical Physics}, 32289 year = {1968}, 32290 volume = {6}, 32291 pages = {1--50}, 32292 note = {Translated from Russian} 32293} 32294 32295@Article{ li.swetis:linear, 32296 author = {W. Li and J. J. Swetits}, 32297 title = {The Linear $\ell_1$ Estimator and the {H}uber {M}-Estimator}, 32298 journal = {SIAM Journal on Optimization}, 32299 volume = {8}, 32300 pages = {457-475}, 32301 year = {1998} 32302} 32303 32304@TechReport{ li:error, 32305 author = {W. Li}, 32306 title = {Error Bounds for Piecewise Convex Quadratic Programs and Applications}, 32307 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32308 year = {1993}, 32309 address = {Norfolk, VA 23529}, 32310 number = {TR93-1}, 32311 note = {SIAM Journal on Control and Optimization, to appear} 32312} 32313 32314@TechReport{ li:linearly, 32315 author = {W. Li}, 32316 title = {Linearly Convergent Descent Methods for Unconstrained Minimization of Convex 32317 Quadratic Splines}, 32318 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32319 year = {1993}, 32320 address = {Norfolk, VA 23529}, 32321 number = {TR93-3}, 32322 note = {Journal of Optimization Theory and Applications, to appear} 32323} 32324 32325@InProceedings{ li:merit, 32326 author = {W. Li}, 32327 title = {A Merit Function and a {N}ewton-Type Method for Symmetric Linear Complementarity 32328 Problems}, 32329 crossref = {ferris.pang:complementarity} 32330} 32331 32332@Article{ li:remarks, 32333 author = {W. Li}, 32334 title = {Remarks on Convergence of Matrix Splitting Algorithm for the Symmetric Linear 32335 Complementarity Problem}, 32336 journal = {SIAM Journal on Optimization}, 32337 year = {1993}, 32338 volume = {3}, 32339 pages = {155--163} 32340} 32341 32342@TechReport{ li:sharp, 32343 author = {W. Li}, 32344 title = {Sharp {L}ipschitz Constants for Basic Optimal Solutions of Linear Programs}, 32345 institution = {Department of Mathematics and Statistics, Old Dominion University}, 32346 year = {1991}, 32347 address = {Norfolk, VA 23529}, 32348 number = {TR91-13}, 32349 note = {SIAM Journal on Control and Optimization, to appear} 32350} 32351 32352@Article{ lin.kernighan:efficient, 32353 author = {S. Lin and B. W. Kernighan}, 32354 title = {An Efficient Heuristic Algorithm for the Traveling Salesman Problem}, 32355 journal = {Operations Research}, 32356 year = {1973}, 32357 volume = {21}, 32358 pages = {498--516} 32359} 32360 32361@Article{ lin.pang:iterative, 32362 author = {Y. Y. Lin and J. S. Pang}, 32363 title = {Iterative Methods for Large Convex Quadratic Programs: {A} Survey}, 32364 journal = {SIAM Journal on Control and Optimization}, 32365 year = {1987}, 32366 volume = {25}, 32367 pages = {383--411} 32368} 32369 32370@Unpublished{ linderoth:branch, 32371 author = {J. Linderoth}, 32372 title = {A {B}ranch-and-{P}rice Approach to Stochastic Integer Programming}, 32373 institution = {Argonne National Laboratories}, 32374 year = {2000}, 32375 note = {Working Paper} 32376} 32377 32378@Article{ lions.stampacchia:variational, 32379 author = {J. L. Lions and G. Stampacchia}, 32380 title = {Variational Inequalities}, 32381 journal = {Communications on Pure and Applied Math}, 32382 year = {1967}, 32383 volume = {20}, 32384 pages = {493--19} 32385} 32386 32387@Article{ lions.mercier:splitting, 32388 author = {P.--L. Lions and B. Mercier}, 32389 title = {Splitting Methods for the Sum of Two Nonlinear Operators}, 32390 journal = {SIAM Journal on Numerical Analysis}, 32391 year = {1979}, 32392 volume = {16}, 32393 pages = {964--979} 32394} 32395 32396@Article{ lions:methode, 32397 author = {P.--L. Lions}, 32398 title = {Une {M}\'{e}thode it\'{e}rative de resolution d'une inequation variationnelle}, 32399 journal = {Israel Journal of Mathematics}, 32400 year = {1978}, 32401 volume = {31}, 32402 number = {2}, 32403 pages = {204--208} 32404} 32405 32406@InProceedings{ litzkow.livny.ea:condor, 32407 author = {M. J. Litzkow and M. Livny and M. W. Mutka}, 32408 title = {Condor: {A} Hunter of Idle Workstations}, 32409 booktitle = {Proceedings of the 8th International Conference on Distributed Computing 32410 Systems}, 32411 year = {1988}, 32412 pages = {104--111}, 32413 month = jun 32414} 32415 32416@Article{ liu.nocedal:limited, 32417 author = {D. C. Liu and J. Nocedal}, 32418 title = {On the Limited Memory Method for Large Scale Optimization}, 32419 journal = {Mathematical Programming}, 32420 year = {1989}, 32421 volume = {45}, 32422 pages = {503--528} 32423} 32424 32425@InBook{ livny.raman:high, 32426 author = {M. Livny and R. Raman}, 32427 title = {The Grid: Blueprint for a Future Computing Infrastructure}, 32428 chapter = {High Throughput Resource Management}, 32429 publisher = {Morgan Kaufmann Publishers}, 32430 year = {1999}, 32431 pages = {311--337} 32432} 32433 32434@Article{ llacer:inverse, 32435 author = {J. Llacer}, 32436 title = {Inverse Radiation Treatment Planning using the Dynamically Penalized Likelihood 32437 Method}, 32438 journal = {Medical Physics}, 32439 year = {1997}, 32440 volume = {24}, 32441 number = {11}, 32442 pages = {1751--1764} 32443} 32444 32445@Book{ lojasiewicz:ensembles, 32446 author = {M. S. Lojasiewicz}, 32447 title = {Ensembles semi-analytiques}, 32448 publisher = {Institut des Hautes Etudes Scientifiques}, 32449 year = {1964}, 32450 address = {Bures-sur-Yvette} 32451} 32452 32453@Article{ lootsma:logarithmic, 32454 author = {F. A. Lootsma}, 32455 title = {Logarithmic Programming: {A} Method of Solving Nonlinear Programming Problems}, 32456 journal = {Phillips Research Reports}, 32457 year = {1967}, 32458 volume = {22}, 32459 pages = {329--344} 32460} 32461 32462@InCollection{ lootsma:survey, 32463 author = {F. A. Lootsma}, 32464 title = {A Survey of Methods for Solving Constrained Minimization Problems via 32465 Unconstrained Minimization}, 32466 booktitle = {Numerical Methods for Nonlinear Optimization}, 32467 year = {1972}, 32468 editor = {F. A. Lootsma}, 32469 publisher = {Academic Press}, 32470 address = {London} 32471} 32472 32473@TechReport{ lopezdesilanes.markusen.ea:anti-competitive, 32474 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32475 title = {Anti--Competitive and Rent--Shifting Aspects of Domestic--Content Provisions in 32476 Regional Trade Blocks}, 32477 institution = {National Bureau of Economic Research, Inc.}, 32478 year = {1993}, 32479 number = {4512}, 32480 address = {Cambridge, Massechusetts} 32481} 32482 32483@InCollection{ lopezdesilanes.markusen.ea:auto, 32484 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32485 title = {The auto industry and the {N}orth {A}merican free-trade agreement}, 32486 year = {1994}, 32487 booktitle = {Modelling Trade Policy: AGE Assessments of North American Free Trade}, 32488 publisher = {Cambridge University Press}, 32489 editor = {C. Shields and J. Francois} 32490} 32491 32492@Article{ lopezdesilanes.markusen.ea:complementarity, 32493 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32494 title = {Complementarity and Increasing Returns in Intermediate Inputs}, 32495 journal = {Journal of Development Economics}, 32496 year = {1994}, 32497 volume = {45}, 32498 pages = {133--151} 32499} 32500 32501@Article{ lopezdesilanes.markusen.ea:trade, 32502 author = {F. {Lopez-de-Silanes} and J. R. Markusen and T. F. Rutherford}, 32503 title = {Trade Policy Subtleties with Multinational Firms}, 32504 journal = {European Economic Review}, 32505 year = {1996} 32506} 32507 32508@Article{ lotstedt:coulomb, 32509 author = {P. L{\"{o}}tstedt}, 32510 title = {Coulomb friction in two-dimensional rigid body systems}, 32511 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 32512 volume = {61}, 32513 year = {1981}, 32514 pages = {605--615} 32515} 32516 32517@Article{ lotstedt:mechanical, 32518 author = {P. L{\"{o}}tstedt}, 32519 title = {Mechanical systems of rigid bodies subject to unilateral constraints}, 32520 journal = {SIAM Journal on Applied Mathematics}, 32521 volume = {42}, 32522 year = {1982}, 32523 pages = {281--296} 32524} 32525 32526@Book{ luenberger:linear, 32527 author = {D. G. Luenberger}, 32528 title = {Linear and Nonlinear Programming}, 32529 year = {1984}, 32530 publisher = {Addison-Wesley}, 32531 edition = {Second} 32532} 32533 32534@Book{ luenberger:optimization, 32535 author = {D. G. Luenberger}, 32536 title = {Optimization by Vector Space Methods}, 32537 year = {1969}, 32538 publisher = {John Wiley \& Sons}, 32539 address = {New York} 32540} 32541 32542@Article{ lundy.mees:convergence, 32543 author = {M. Lundy and A. Mees}, 32544 title = {Convergence of an Annealing Algorithm}, 32545 journal = {Mathematical Programming}, 32546 year = {1986}, 32547 volume = {34}, 32548 pages = {111--124} 32549} 32550 32551@Article{ luo.luo:extension, 32552 author = {X.-D. Luo and Z.-Q. Luo}, 32553 title = {Extension of Hoffman's Error Bound to Polynomial Systems}, 32554 journal = {SIAM Journal on Optimization}, 32555 year = {1994}, 32556 volume = {4}, 32557 pages = {383--392} 32558} 32559 32560@Article{ luo.mangasarian.ea:error, 32561 author = {Z.-Q. Luo and O. L. Mangasarian and J. Ren and M. V. Solodov}, 32562 title = {New Error Bounds for the Linear Complementarity Problem}, 32563 journal = {Mathematics of Operations Research}, 32564 year = {1994}, 32565 pages = {880--892}, 32566 volume = {19} 32567} 32568 32569@Article{ luo.pang.ea:exact, 32570 author = {Z.-Q. Luo and J. S. Pang and D. Ralph and S.-Q. Wu}, 32571 title = {Exact Penalization and Stationarity Conditions of Mathematical Programs with 32572 Equilibrium Constraints}, 32573 journal = {Mathematical Programming}, 32574 volume = {75}, 32575 pages = {19--76}, 32576 year = {1996} 32577} 32578 32579@Book{ luo.pang.ea:mathematical, 32580 author = {Z.-Q. Luo and J. S. Pang and D. Ralph}, 32581 title = {Mathematical Programs with Equilibrium Constraints}, 32582 publisher = {Cambridge University Press}, 32583 year = {1996} 32584} 32585 32586@Article{ luo.pang:error, 32587 author = {Z.-Q. Luo and J. S. Pang}, 32588 title = {Error Bounds for Analytic Systems and their Applications}, 32589 journal = {Mathematical Programming}, 32590 year = {1994}, 32591 volume = {67}, 32592 pages = {1--28} 32593} 32594 32595@Article{ luo.shu.ea:optimizing, 32596 author = {L. Luo and H. Shu and W. Yu and Y. Yan and X. Bao and Y. Fu}, 32597 title = {Optimizing computerized treatment planning for the Gamma Knife by source 32598 culling}, 32599 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32600 year = {1999}, 32601 volume = {45}, 32602 number = {5}, 32603 pages = {1339--1346} 32604} 32605 32606@InProceedings{ luo.tseng:class, 32607 author = {Z.-Q. Luo and P. Tseng}, 32608 title = {A New Class of Merit Functions for the Nonlinear Complementarity Problem}, 32609 crossref = {ferris.pang:complementarity}, 32610 pages = {204--225} 32611} 32612 32613@Article{ luo.tseng:convergence, 32614 author = {Z.-Q. Luo and P. Tseng}, 32615 title = {On the Convergence of the Coordinate Descent Method for Convex Differentiable 32616 Minimization}, 32617 journal = {Journal of Optimization Theory and Applications}, 32618 year = {1992}, 32619 volume = {72}, 32620 pages = {7--35} 32621} 32622 32623@Article{ luo.tseng:convergence*1, 32624 author = {Z.-Q. Luo and P. Tseng}, 32625 title = {On the Convergence of a Matrix Splitting Algorithm for the Symmetric Monotone 32626 Linear Complementarity Problem}, 32627 journal = {SIAM Journal on Control and Optimization}, 32628 year = {1991}, 32629 volume = {29}, 32630 pages = {1037--1060} 32631} 32632 32633@Article{ luo.tseng:convergence*2, 32634 author = {Z.-Q. Luo and P. Tseng}, 32635 title = {On the Convergence Rate of Dual Ascent Methods for Strictly Convex Minimization}, 32636 journal = {Mathematics of Operations Research}, 32637 year = {1993}, 32638 volume = {18}, 32639 pages = {846--867} 32640} 32641 32642@Article{ luo.tseng:error, 32643 author = {Z.--Q. Luo and P. Tseng}, 32644 title = {Error Bound and Convergence Analysis of Matrix Splitting Algorithms for the 32645 Affine Variational Inequality Problem}, 32646 journal = {SIAM Journal on Optimization}, 32647 year = {1992}, 32648 volume = {2}, 32649 pages = {43--54} 32650} 32651 32652@Article{ luo.tseng:error*1, 32653 author = {Z.-Q. Luo and P. Tseng}, 32654 title = {Error Bound and Reduced Gradient Projection Algorithms for Convex Minimization 32655 Over a Polyhedral Set}, 32656 journal = {SIAM Journal on Optimization}, 32657 year = {1993}, 32658 volume = {3}, 32659 pages = {43--59} 32660} 32661 32662@Article{ luo.tseng:error*2, 32663 author = {Z.-Q. Luo and P. Tseng}, 32664 title = {Error Bounds and Convergence Analysis of Feasible Descent Methods: {A} General 32665 Approach}, 32666 journal = {Annals of Operations Research}, 32667 year = {1993}, 32668 volume = {46}, 32669 pages = {157--178} 32670} 32671 32672@Article{ luo.tseng:global, 32673 author = {Z.-Q. Luo and P. Tseng}, 32674 title = {On Global Error Bound for a Class of Monotone Affine Variational Inequality 32675 Problems}, 32676 journal = {Operations Research Letters}, 32677 year = {1992}, 32678 volume = {11}, 32679 pages = {159--165} 32680} 32681 32682@Article{ luo.tseng:linear, 32683 author = {Z.-Q. Luo and P. Tseng}, 32684 title = {On the linear convergence of descent methods for convex essentially smooth 32685 minimization}, 32686 journal = {SIAM Journal on Control and Optimization}, 32687 year = {1992}, 32688 volume = {30}, 32689 pages = {408--425} 32690} 32691 32692@TechReport{ luo:convergence, 32693 author = {Z.-Q. Luo}, 32694 title = {Convergence Analysis of Primal--Dual Interior--Point Algorithms for Convex 32695 Quadratic Programs}, 32696 institution = {Communications Research Laboratory, McMaster University}, 32697 year = {1992}, 32698 address = {Hamilton, Ontario} 32699} 32700 32701@Article{ lustig.marsten.ea:computational, 32702 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32703 title = {Computational Experience with a Primal-Dual Interior Point Method for Linear 32704 Programming}, 32705 journal = {Linear Algebra and Its Applications}, 32706 year = {1991}, 32707 volume = {152}, 32708 pages = {191--222} 32709} 32710 32711@Article{ lustig.marsten.ea:implementing, 32712 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32713 title = {On implementing {M}ehrotra's predictor-corrector interior point method for linear 32714 programming}, 32715 journal = {SIAM Journal on Optimization}, 32716 year = {1992}, 32717 volume = {2}, 32718 pages = {435--449} 32719} 32720 32721@Article{ lustig.marsten.ea:interior-point, 32722 author = {I. J. Lustig and R. E. Marsten and D. F. Shanno}, 32723 title = {Interior-Point Methods for Linear Programming: Computational State of the Art}, 32724 journal = {ORSA Journal on Computing}, 32725 year = {1994}, 32726 volume = {6}, 32727 number = {1}, 32728 pages = {1--38} 32729} 32730 32731@Article{ lyman.wolbarst:optimization, 32732 author = {J. T. Lyman and A. B. Wolbarst}, 32733 title = {Optimization of Radiation Therapy {IV}: {A} Dose Volume Histogram Reduction 32734 Algorithm}, 32735 journal = {International Journal of Radiation Oncology, Biology and Physics}, 32736 year = {1989}, 32737 volume = {17}, 32738 pages = {433--436} 32739} 32740 32741@Article{ mackie.holmes.ea:tomotherapy*1, 32742 author = {T. R. Mackie and T. Holmes and S. Swerdloff and P. Reckwerdt and J. O. Deasy and 32743 J. Yang and B. Paliwal and T. Kinsella}, 32744 title = {Tomotherapy: a new concept for the delivery of dynamic conformal radiotherapy}, 32745 journal = {Medical Physics}, 32746 year = {1993}, 32747 volume = {20}, 32748 number = {6}, 32749 pages = {1709--1719} 32750} 32751 32752@Article{ mackie.holmes.ea:tomotherapy*2, 32753 author = {T. R. Mackie and T. W. Holmes and P. J. Reckwerdt and J. Yang}, 32754 title = {Tomotherapy: Optimized Planning and Delivery of Radiation Therapy}, 32755 journal = {Int. J. of Imaging Systems and Technology}, 32756 year = {1995}, 32757 volume = {6}, 32758 pages = {43--55} 32759} 32760 32761@Article{ mackie.scrimger.ea:convolution, 32762 author = {T. R. Mackie and J. W. Scrimger and J. J. Batista}, 32763 title = {A convolution method of calculating dose from 15 Me{V} x-rays}, 32764 journal = {Medical Physics}, 32765 year = {1985}, 32766 volume = {12}, 32767 pages = {188--196} 32768} 32769 32770@Article{ mackinnon:technique, 32771 author = {James G. Mac{K}innon}, 32772 title = {A Technique for the Solution of Spatial Equilibrium Models}, 32773 journal = {Journal of Regional Science}, 32774 year = {1976}, 32775 volume = {16}, 32776 pages = {293--307} 32777} 32778 32779@PhDThesis{ madsen:minimization, 32780 author = {K. Madsen}, 32781 title = {Minimization of Nonlinear Approximation Functions}, 32782 year = {1985}, 32783 address = {Lyngby, Denmark}, 32784 school = {Institute of Numerical Analysis, Technical University of Denmark}, 32785 annote = {Dissertation} 32786} 32787 32788@Book{ magill.quinzii:theory, 32789 author = {M. Magill and M. Quinzii}, 32790 title = {Theory of Incomplete Markets}, 32791 publisher = {MIT Press}, 32792 year = {1996} 32793} 32794 32795@InCollection{ magnanti:models, 32796 author = {T. L. Magnanti}, 32797 title = {Models and Algorithms for Predicting Urban Traffic Equilibria}, 32798 booktitle = {Transportation Planning Models}, 32799 year = {1984}, 32800 editor = {M. Florian}, 32801 publisher = {North Holland}, 32802 pages = {153--186} 32803} 32804 32805@InCollection{ maguregui:modified, 32806 author = {J. Maguregui}, 32807 title = {A modified {N}ewton algorithm for functions over convex sets}, 32808 crossref = {mangasarian.meyer.ea:nonlinear*3}, 32809 pages = {461--473} 32810} 32811 32812@PhDThesis{ maguregui:regular, 32813 author = {J. Maguregui}, 32814 title = {Regular Multivalued Functions and Algorithmic Applications}, 32815 year = {1977}, 32816 address = {Madison, Wisconsin}, 32817 school = {Computer Sciences Department, University of Wisconsin} 32818} 32819 32820@Article{ mahey.oualibouch.ea:proximal, 32821 author = {P. Mahey and S. Oualibouch and D. T. Pham}, 32822 title = {Proximal Decomposition on the Graph of a Maximal Monotone Operator}, 32823 journal = {SIAM Journal on Optimization}, 32824 year = {1995}, 32825 volume = {5}, 32826 pages = {454--466} 32827} 32828 32829@Article{ mahey.pham:partial, 32830 author = {P. Mahey and D. T. Pham}, 32831 title = {Partial Regularization of the Sum of Two Maximal Monotone Operators}, 32832 journal = {{RAIRO} Mod\'{e}lisation et Analyse Num\'{e}rique}, 32833 year = {1993}, 32834 volume = {27}, 32835 pages = {375--392} 32836} 32837 32838@InCollection{ maier.novati:shakedown, 32839 author = {G. Maier and G. Novati}, 32840 title = {A shakedown and bounding theory allowing for nonlinear hardening and second order 32841 geometric effects with reference to discrete structural models}, 32842 editors = {J. A. K{\"{o}}nig and M. Kleiber}, 32843 booktitle = {Inelastic Solids and Structures, A. Sawczuk memorial volume}, 32844 publisher = {Pineridge Press}, 32845 address = {Swansea}, 32846 year = {1990}, 32847 pages = {451--471} 32848} 32849 32850@Article{ maier:incremental, 32851 author = {G. Maier}, 32852 title = {Incremental Plastic Analysis in the Presence of Large Displacement and Physical 32853 Instabilizing Effects}, 32854 journal = {International Journal of Solids and Structures}, 32855 volume = {7}, 32856 year = {1971}, 32857 pages = {345--372} 32858} 32859 32860@InCollection{ maier:inverse, 32861 author = {G. Maier}, 32862 title = {Inverse Problems in Engineering Plasticity: {A} Quadratic Programming Approach}, 32863 booktitle = {Serie VIII}, 32864 publisher = {Academia Nazionale dei Lincei}, 32865 year = {1981}, 32866 volume = {LXX}, 32867 pages = {203--209} 32868} 32869 32870@Article{ maier:matrix, 32871 author = {G. Maier}, 32872 title = {A matrix structural theory of piecewise linear elastoplasticity with interacting 32873 yield planes}, 32874 journal = {Meccanica}, 32875 volume = {5}, 32876 year = {1970}, 32877 pages = {54--66} 32878} 32879 32880@Article{ maier:quadratic, 32881 author = {G. Maier}, 32882 title = {A quadratic programming approach for certain classes of nonlinear structural 32883 problems}, 32884 journal = {Meccanica}, 32885 volume = {3}, 32886 year = {1968}, 32887 pages = {121--130} 32888} 32889 32890@Book{ manber:introduction, 32891 author = {U. Manber}, 32892 title = {Introduction to Algorithms: {A} Creative Approach}, 32893 year = {1989}, 32894 publisher = {Addison-Wesley} 32895} 32896 32897@Article{ mangasarian.deleone:error, 32898 author = {O. L. Mangasarian and R. {De~Leone}}, 32899 title = {Error Bounds for Strongly Convex Programs and (Super)linearly Convergent 32900 Iterative Schemes for the Least 2--norm Solution of Linear Programs}, 32901 journal = {Applied Mathematics and Optimization}, 32902 year = {1988}, 32903 volume = {17}, 32904 pages = {1--14} 32905} 32906 32907@Article{ mangasarian.deleone:parallel, 32908 author = {O. L. Mangasarian and R. {De~Leone}}, 32909 title = {Parallel Successive Overrelaxation Methods for Symmetric Linear Complementarity 32910 Problems and Linear Programs}, 32911 journal = {Journal of Optimization Theory and Applications}, 32912 year = {1987}, 32913 volume = {54}, 32914 pages = {437--446} 32915} 32916 32917@Article{ mangasarian.fromovitz:fritz, 32918 author = {O. L. Mangasarian and S. Fromovitz}, 32919 title = {The {F}ritz {J}ohn necessary optimality conditions in the presence of equality 32920 and inequality constraints}, 32921 journal = {Journal of Mathematical Analysis and its Applications}, 32922 year = {1967}, 32923 volume = {17}, 32924 pages = {37--47} 32925} 32926 32927@Article{ mangasarian.mclinden:simple, 32928 author = {O. L. Mangasarian and L. McLinden}, 32929 title = {Simple Bounds for Solutions of Monotone Complementarity Problems and Convex 32930 Programs}, 32931 journal = {Mathematical Programming}, 32932 year = {1985}, 32933 volume = {32}, 32934 pages = {32--40} 32935} 32936 32937@Article{ mangasarian.meyer:nonlinear, 32938 author = {O. L. Mangasarian and R. R. Meyer}, 32939 title = {Nonlinear Perturbation of Linear Programs}, 32940 journal = {SIAM Journal on Control and Optimization}, 32941 year = {1979}, 32942 volume = {17}, 32943 pages = {745--752} 32944} 32945 32946@TechReport{ mangasarian.musicant:active, 32947 author = {O. L. Mangasarian and David R. Musicant}, 32948 title = {Active Set Support Vector Machine Classification}, 32949 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32950 year = {2000}, 32951 number = {00-04}, 32952 address = {Madison, Wisconsin} 32953} 32954 32955@TechReport{ mangasarian.musicant:lagrangian, 32956 author = {O. L. Mangasarian and D. R. Musicant}, 32957 title = {Lagrangian Support Vector Machines}, 32958 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32959 year = {2000}, 32960 number = {00-06}, 32961 address = {Madison, Wisconsin} 32962} 32963 32964@TechReport{ mangasarian.musicant:robust, 32965 author = {O. L. Mangasarian and David R. Musicant}, 32966 title = {Robust Linear and Support Vector Regression}, 32967 institution = {Data Mining Institute, Computer Sciences Department, University of Wisconsin}, 32968 year = {1999}, 32969 number = {99-09}, 32970 address = {Madison, Wisconsin} 32971} 32972 32973@Article{ mangasarian.musicant:successive, 32974 author = {O. L. Mangasarian and David R. Musicant}, 32975 title = {Successive Overrelaxation for Support Vector Machines}, 32976 journal = {IEEE Transactions on Neural Networks}, 32977 volume = {10}, 32978 year = {1999}, 32979 pages = {1032-1037} 32980} 32981 32982@Article{ mangasarian.pang:exact, 32983 author = {O. L. Mangasarian and J. S. Pang}, 32984 title = {Exact Penalty Functions for Mathematical Programs with Linear Complementarity 32985 Constraints}, 32986 journal = {Optimization}, 32987 year = {1997}, 32988 volume = {42}, 32989 pages = {1--8} 32990} 32991 32992@Article{ mangasarian.pang:extended, 32993 author = {O. L. Mangasarian and J. S. Pang}, 32994 title = {The Extended Linear Complementarity Problem}, 32995 journal = {SIAM Journal on Matrix Analysis and Applications}, 32996 year = {1994}, 32997 volume = {16} 32998} 32999 33000@Article{ mangasarian.ren:error, 33001 author = {O. L. Mangasarian and J. Ren}, 33002 title = {New error bounds for the nonlinear complementarity problem}, 33003 year = {1994}, 33004 volume = {1}, 33005 pages = {49--56}, 33006 journal = {Communications on Applied Nonlinear Analysis} 33007} 33008 33009@Article{ mangasarian.ren:improved, 33010 author = {O. L. Mangasarian and J. Ren}, 33011 title = {New Improved Error Bounds for the Linear Complementarity Problem}, 33012 year = {1994}, 33013 volume = {66}, 33014 journal = {Mathematical Programming}, 33015 pages = {241--255} 33016} 33017 33018@InProceedings{ mangasarian.setiono.ea:pattern, 33019 crossref = {coleman.li:large-scale}, 33020 author = {O. L. Mangasarian and R. Setiono and W. H. Wolberg}, 33021 title = {Pattern Recognition via Linear Programming: Theory and Application to Medical 33022 Diagnosis}, 33023 pages = {22--31} 33024} 33025 33026@Article{ mangasarian.shiau:error, 33027 author = {O. L. Mangasarian and T.--H. Shiau}, 33028 title = {Error Bounds for Monotone Linear Complementarity Problems}, 33029 journal = {Mathematical Programming}, 33030 year = {1986}, 33031 volume = {36}, 33032 pages = {81--89} 33033} 33034 33035@Article{ mangasarian.shiau:lipschitz, 33036 author = {O. L. Mangasarian and T.--H. Shiau}, 33037 title = {{L}ipschitz Continuity of Solutions of Linear Inequalities, Programs and 33038 Complementarity Problems}, 33039 journal = {SIAM Journal on Control and Optimization}, 33040 year = {1987}, 33041 volume = {25}, 33042 pages = {583--595} 33043} 33044 33045@Article{ mangasarian.solodov:nonlinear, 33046 author = {O. L. Mangasarian and M. V. Solodov}, 33047 title = {Nonlinear Complementarity as Unconstrained and Constrained Minimization}, 33048 journal = {Mathematical Programming}, 33049 year = {1993}, 33050 volume = {62}, 33051 pages = {277--298} 33052} 33053 33054@Article{ mangasarian.solodov:serial, 33055 author = {O. L. Mangasarian and M. V. Solodov}, 33056 title = {Serial and Parallel Backpropagation Convergence via Nonmonotone Perturbed 33057 Minimization}, 33058 year = {1994}, 33059 journal = {Optimization Methods and Software}, 33060 volume = {4}, 33061 pages = {103--116} 33062} 33063 33064@Article{ mangasarian.street.ea:breast, 33065 author = {O. L. Mangasarian and W. N. Street and W. H. Wolberg}, 33066 title = {Breast Cancer Diagnosis and Prognosis via Linear Programming}, 33067 journal = {Operations Research}, 33068 year = {1995}, 33069 volume = {43}, 33070 pages = {570--577} 33071} 33072 33073@Article{ mangasarian.wolberg:cancer, 33074 author = {O. L. Mangasarian and W. H. Wolberg}, 33075 title = {Cancer Diagnosis via Linear Programming}, 33076 journal = {SIAM News}, 33077 year = {1990}, 33078 volume = {23}, 33079 pages = {1 \& 18} 33080} 33081 33082@InCollection{ mangasarian:applications, 33083 author = {O. L. Mangasarian}, 33084 title = {Some Applications of Penalty Functions in Mathematical Programming}, 33085 booktitle = {Optimization and Related Fields}, 33086 year = {1986}, 33087 editor = {R. Conti and E. De~Giorgi and F. Giannessi}, 33088 publisher = {Springer-Verlag}, 33089 address = {Heidelberg}, 33090 pages = {307--329}, 33091 note = {Lecture Notes in Mathematics 1190} 33092} 33093 33094@Article{ mangasarian:characterization, 33095 author = {O. L. Mangasarian}, 33096 title = {Characterization of linear complementarity problems as linear programs}, 33097 journal = {Mathematical Programming Study}, 33098 year = {1978}, 33099 volume = {7}, 33100 pages = {74--87} 33101} 33102 33103@InProceedings{ mangasarian:condition, 33104 author = {O. L. Mangasarian}, 33105 title = {A condition number for linear inequalities and linear programs}, 33106 booktitle = {Proceedings of 6. Symposium uber Operations Research, Augsburg, 7-9 September 33107 1981}, 33108 year = {1981}, 33109 editor = {G. Bamberg and O. Opitz}, 33110 publisher = {Verlagsgruppe Athenaum/Hain/Scriptor/Hanstein}, 33111 address = {Konigstein}, 33112 pages = {3--15} 33113} 33114 33115@Article{ mangasarian:convergence, 33116 author = {O. L. Mangasarian}, 33117 title = {On the Convergence of Iterates of an Inexact Matrix Splitting Algorithm for the 33118 Symmetric Monotone Linear Complementarity Problem}, 33119 journal = {SIAM Journal on Optimization}, 33120 volume = {1}, 33121 pages = {114--122}, 33122 year = {1991} 33123} 33124 33125@Article{ mangasarian:equivalence, 33126 author = {O. L. Mangasarian}, 33127 title = {Equivalence of the Complementarity Problem to a System of Nonlinear Equations}, 33128 journal = {SIAM Journal on Applied Mathematics}, 33129 year = {1976}, 33130 volume = {31}, 33131 pages = {89--92} 33132} 33133 33134@Article{ mangasarian:error, 33135 author = {O. L. Mangasarian}, 33136 title = {Error Bounds for Inconsistent Linear Inequalities and Programs}, 33137 journal = {ORSA Journal on Computing}, 33138 volume = {15}, 33139 pages = {187--192}, 33140 year = {1994} 33141} 33142 33143@Article{ mangasarian:error*1, 33144 author = {O. L. Mangasarian}, 33145 title = {Error Bounds for Nondegenerate Monotone Linear Complementarity Problems}, 33146 journal = {Mathematical Programming}, 33147 year = {1990}, 33148 volume = {48}, 33149 pages = {437--445} 33150} 33151 33152@Article{ mangasarian:generalized, 33153 author = {O. L. Mangasarian}, 33154 title = {Generalized Linear Complementarity Problems as Linear Programs}, 33155 journal = {Methods of Operations Research}, 33156 year = {1979}, 33157 editor = {W. Oettli and F. Steffens}, 33158 volume = {31}, 33159 pages = {393--402} 33160} 33161 33162@InCollection{ mangasarian:generalized*1, 33163 author = {O. L. Mangasarian}, 33164 title = {Generalized Support Vector Machines}, 33165 year = {2000}, 33166 pages = {135-146}, 33167 booktitle = {Advances in Large Margin Classifiers}, 33168 editor = {A. Smola and P.~Bartlett and B.~Sch{\"o}lkopf and D.~Schuurmans}, 33169 publisher = {MIT Press}, 33170 address = {Cambridge, MA} 33171} 33172 33173@Article{ mangasarian:global, 33174 author = {O. L. Mangasarian}, 33175 title = {Global error bounds for monotone affine variational inequality problems}, 33176 journal = {Linear Algebra and Its Applications}, 33177 year = {1992}, 33178 pages = {153--164} 33179} 33180 33181@InCollection{ mangasarian:least, 33182 author = {O. L. Mangasarian}, 33183 title = {Least Norm Solution of Non--Monotone Complementarity Problems}, 33184 booktitle = {Functional Analysis, Optimization and Mathematical Economics}, 33185 year = {1990}, 33186 publisher = {Oxford University Press}, 33187 address = {New York}, 33188 pages = {217--221} 33189} 33190 33191@Article{ mangasarian:least-norm, 33192 author = {O. L. Mangasarian}, 33193 title = {Least--Norm Linear Programming Solution as an Unconstrained Minimization 33194 Problem}, 33195 journal = {Journal of Mathematical Analysis and Applications}, 33196 year = {1983}, 33197 volume = {92}, 33198 pages = {240--251} 33199} 33200 33201@Article{ mangasarian:linear, 33202 author = {O. L. Mangasarian}, 33203 title = {Linear Complementarity Problems Solvable by a Single Linear Program}, 33204 journal = {Mathematical Programming}, 33205 year = {1976}, 33206 volume = {10}, 33207 pages = {263--270} 33208} 33209 33210@Article{ mangasarian:linear*1, 33211 author = {O. L. Mangasarian}, 33212 title = {Linear and Nonlinear Separation of Patterns by Linear Programming}, 33213 journal = {Operations Research}, 33214 year = {1965}, 33215 volume = {13}, 33216 pages = {444--452} 33217} 33218 33219@Article{ mangasarian:locally, 33220 author = {O. L. Mangasarian}, 33221 title = {Locally Unique Solutions of Quadratic Programs, Linear and Nonlinear 33222 Complementarity Problems}, 33223 journal = {Mathematical Programming}, 33224 year = {1980}, 33225 volume = {19}, 33226 pages = {200--212} 33227} 33228 33229@InCollection{ mangasarian:machine, 33230 author = {O. L. Mangasarian}, 33231 title = {Machine Learning via Polyhedral Concave Minimization}, 33232 editor = {H. Fischer and B. Riedmueller and S. Schaeffler}, 33233 booktitle = {Applied Mathematics and Parallel Computing - Festschrift for Klaus Ritter}, 33234 pages = {175-188}, 33235 year = {1996}, 33236 address = {Heidelberg}, 33237 publisher = {Physica-Verlag A Springer-Verlag Company} 33238} 33239 33240@Article{ mangasarian:mathematical, 33241 author = {O. L. Mangasarian}, 33242 title = {Mathematical Programming in Neural Networks}, 33243 journal = {ORSA Journal on Computing}, 33244 volume = {5}, 33245 pages = {349--360}, 33246 year = {1993} 33247} 33248 33249@InProceedings{ mangasarian:mathematical*1, 33250 author = {O. L. Mangasarian}, 33251 title = {Mathematical Programming in Machine Learning}, 33252 booktitle = {Nonlinear Optimization and Applications}, 33253 editor = {G. Di Pillo and F. Giannessi}, 33254 publisher = {Plenum Publishing}, 33255 address = {New York}, 33256 pages = {283--295}, 33257 year = {1996} 33258} 33259 33260@Article{ mangasarian:mathematical*2, 33261 author = {O. L. Mangasarian}, 33262 title = {Mathematical Programming in Data Mining}, 33263 journal = {Data Mining and Knowledge Discovery}, 33264 volume = {1}, 33265 year = {1997}, 33266 pages = {183-201} 33267} 33268 33269@Article{ mangasarian:multi-surface, 33270 author = {O. L. Mangasarian}, 33271 title = {Multi-surface Method of Pattern Separation}, 33272 journal = {IEEE Transactions on Information Theory}, 33273 year = {1968}, 33274 volume = {IT-14}, 33275 pages = {801--807} 33276} 33277 33278@Book{ mangasarian:nonlinear, 33279 author = {O. L. Mangasarian}, 33280 title = {Nonlinear Programming}, 33281 year = {1969}, 33282 publisher = {McGraw--Hill}, 33283 address = {New York}, 33284 note = {SIAM Classics in Applied Mathematics 10, SIAM, Philadelphia, 1994} 33285} 33286 33287@Article{ mangasarian:normal, 33288 author = {O. L. Mangasarian}, 33289 title = {Normal Solutions of Linear Programs}, 33290 journal = {Mathematical Programming Study}, 33291 year = {1984}, 33292 volume = {22}, 33293 pages = {206--216} 33294} 33295 33296@Article{ mangasarian:optimal, 33297 author = {O. L. Mangasarian}, 33298 title = {Optimal Simplex Tableau Characterization of Unique and Bounded Solutions of 33299 Linear Programs}, 33300 journal = {Journal of Optimization Theory and Applications}, 33301 year = {1981}, 33302 volume = {35}, 33303 pages = {123--128} 33304} 33305 33306@Article{ mangasarian:parallel, 33307 author = {O. L. Mangasarian}, 33308 title = {Parallel Gradient Distribution in Unconstrained Optimization}, 33309 journal = {SIAM Journal on Control and Optimization}, 33310 volume = {33}, 33311 pages = {1916--1925}, 33312 year = {1995} 33313} 33314 33315@TechReport{ mangasarian:regularized, 33316 author = {O. L. Mangasarian}, 33317 title = {Regularized Linear Programs with Equilibrium Constraints}, 33318 institution = {Computer Sciences Department, University of Wisconsin}, 33319 year = {1997}, 33320 address = {Madison, Wisconsin}, 33321 type = {Mathematical Programming Technical Report}, 33322 number = {97--13}, 33323 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/97-13.ps} 33324} 33325 33326@Article{ mangasarian:simple, 33327 author = {O. L. Mangasarian}, 33328 title = {A Simple Characterization of Solution Sets of Convex Programs}, 33329 journal = {Operations Research Letters}, 33330 year = {1988}, 33331 volume = {7}, 33332 pages = {21--26} 33333} 33334 33335@Article{ mangasarian:solution, 33336 author = {O. L. Mangasarian}, 33337 title = {Solution of Symmetric Linear Complementarity Problems by Iterative Methods}, 33338 journal = {Journal of Optimization Theory and Applications}, 33339 year = {1977}, 33340 month = aug, 33341 volume = {22}, 33342 pages = {465--485} 33343} 33344 33345@Article{ mangasarian:stable, 33346 author = {O. L. Mangasarian}, 33347 title = {A Stable Theorem of the Alternative: An Extension of the {G}ordan Theorem}, 33348 journal = {Linear Algebra and Its Applications}, 33349 year = {1981}, 33350 volume = {41}, 33351 pages = {209--223} 33352} 33353 33354@Article{ mangasarian:sufficiency, 33355 author = {O. L. Mangasarian}, 33356 title = {Sufficiency of Exact Penalty Minimization}, 33357 journal = {SIAM Journal on Control and Optimization}, 33358 year = {1985}, 33359 month = jan, 33360 volume = {23}, 33361 pages = {30--37} 33362} 33363 33364@Article{ mangasarian:unconstrained, 33365 author = {O. L. Mangasarian}, 33366 title = {Unconstrained {L}agrangians in Nonlinear Programming}, 33367 journal = {SIAM Journal on Control and Optimization}, 33368 year = {1975}, 33369 volume = {13}, 33370 pages = {772--791} 33371} 33372 33373@Book{ manne.richels:buying, 33374 author = {A. S. Manne and R. G. Richels}, 33375 title = {Buying Greenhouse Insurance: The Economics of Carbon Dioxide Emission Limits}, 33376 publisher = {MIT Press}, 33377 year = {1992}, 33378 address = {Cambridge MA} 33379} 33380 33381@Article{ manne.richels:global, 33382 author = {A. S. Manne and R. G. Richels}, 33383 title = {Global {CO2} Emission Reductions - the Impacts of Rising Energy Costs}, 33384 journal = {The Energy Journal}, 33385 year = {1991}, 33386 volume = {12}, 33387 pages = {87--107} 33388} 33389 33390@Article{ manne.richels:international, 33391 author = {A. S. Manne and R. G. Richels}, 33392 title = {International Trade in Carbon Emission Rights: {A} Decomposition Procedure}, 33393 journal = {Economic Review}, 33394 year = {1991}, 33395 volume = {81}, 33396 pages = {135--139} 33397} 33398 33399@Article{ manne.rutherford:international, 33400 author = {A. S. Manne and T. F. Rutherford}, 33401 title = {International Trade in Oil, Gas and Carbon Emission Rights: An Intertemporal 33402 General Equilibrium Model}, 33403 journal = {The Energy Journal}, 33404 year = {1993}, 33405 volume = {14}, 33406 pages = {1--20} 33407} 33408 33409@InCollection{ manne:eta-macro, 33410 author = {A. S. Manne}, 33411 title = {{ETA}-{M}acro: {A} {M}odel of Energy-Economy Interactions}, 33412 booktitle = {Modeling Energy-Economy Interactions}, 33413 year = {1977}, 33414 editor = {C. J. Hitch}, 33415 publisher = {Resources for the Future}, 33416 address = {Washington DC} 33417} 33418 33419@PhDThesis{ maratos:exact, 33420 author = {N. Maratos}, 33421 title = {Exact Penalty Function Algorithms for Finite Dimensional and Control Optimization 33422 Problems}, 33423 year = {1978}, 33424 school = {Imperial College, University of London} 33425} 33426 33427@Article{ marcotte.dussault:note, 33428 author = {P. Marcotte and J.--P. Dussault}, 33429 title = {A Note on a Globally Convergent {N}ewton Method for Solving Monotone Variational 33430 Inequalities}, 33431 journal = {Operations Research Letters}, 33432 year = {1987}, 33433 volume = {6}, 33434 pages = {35--42} 33435} 33436 33437@Article{ marcotte.zhu:exact, 33438 author = {P. Marcotte and D. L. Zhu}, 33439 title = {Exact and Inexact Penalty Methods for the Generalized Bilevel Programming 33440 Problem}, 33441 journal = {Mathematical Programming}, 33442 year = {1996}, 33443 volume = {74}, 33444 pages = {141--158} 33445} 33446 33447@Article{ marcotte:algorithm, 33448 author = {P. Marcotte}, 33449 title = {A New Algorithm for Solving Variational Inequalities with Application to the 33450 Traffic Assignment Problem}, 33451 journal = {Mathematical Programming}, 33452 year = {1985}, 33453 volume = {33}, 33454 pages = {339--351} 33455} 33456 33457@Article{ marcotte:application, 33458 author = {P. Marcotte}, 33459 title = {Application of {K}hobotov's Algorithm to Variational Inequalities and Network 33460 Equilibrium Problems}, 33461 journal = {Information Systems and Operational Research}, 33462 year = {1991}, 33463 volume = {29}, 33464 pages = {258--270} 33465} 33466 33467@Article{ marcotte:network, 33468 author = {P. Marcotte}, 33469 title = {Network Design Problem with Congestion Effects: {A} Case of Bilevel Programming}, 33470 journal = {Mathematical Programming}, 33471 year = {1986}, 33472 volume = {34}, 33473 pages = {142--162} 33474} 33475 33476@Article{ markusen.rutherford.ea:el, 33477 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33478 title = {El libre comercio en {A}merica del {N}orte y la produccion de automoviles}, 33479 journal = {Cuadernos Economicos de Ice}, 33480 year = {1995}, 33481 volume = {59}, 33482 pages = {57--68} 33483} 33484 33485@Article{ markusen.rutherford.ea:trade, 33486 author = {J. R. Markusen and T. F. Rutherford and L. Hunter}, 33487 title = {Trade liberalization in a multinational-dominated industry}, 33488 journal = {Journal of International Economics}, 33489 year = {1995}, 33490 volume = {38}, 33491 pages = {95--118} 33492} 33493 33494@Article{ markusen.rutherford:discrete, 33495 author = {J. R. Markusen and T. F. Rutherford}, 33496 title = {Discrete plant-location decisions in an applied general equilibrium model of 33497 trade liberalization}, 33498 journal = {Weltwirtshchaftliches Archiv}, 33499 year = {1994} 33500} 33501 33502@Article{ markusen.wigle:nash, 33503 author = {J. Markusen and R. Wigle}, 33504 title = {Nash Equilibrium Tariffs for the {U}nited {S}tates and {C}anada: The Roles of 33505 Country Size, Scale Economies and Capital Mobility}, 33506 journal = {Journal of Political Mobility}, 33507 year = {1989}, 33508 volume = {97}, 33509 pages = {368--386} 33510} 33511 33512@Article{ marquardt:algorithm, 33513 author = {D. W. Marquardt}, 33514 title = {An Algorithm for Least--Squares Estimation of Nonlinear Parameters}, 33515 journal = {SIAM Journal on Applied Mathematics}, 33516 year = {1963}, 33517 volume = {11}, 33518 pages = {431--441} 33519} 33520 33521@Article{ martello.toth:algorithm, 33522 author = {S. Martello and P. Toth}, 33523 title = {A New Algorithm for the 0--1 Knapsack Problem}, 33524 journal = {Management Science}, 33525 year = {1988}, 33526 volume = {34}, 33527 pages = {633--644} 33528} 33529 33530@InCollection{ martello.toth:algorithms, 33531 author = {S. Martello and P. Toth}, 33532 title = {Algorithms for Knapsack Problems}, 33533 booktitle = {Surveys in Combinatorial Optimization}, 33534 year = {1987}, 33535 editor = {S. Martello and G. Laporte and M. Minoux and C. Ribeiro}, 33536 publisher = {Annals of Discrete Mathematics 31, North--Holland}, 33537 address = {Amsterdam} 33538} 33539 33540@Article{ martello.toth:mixture, 33541 author = {S. Martello and P. Toth}, 33542 title = {A Mixture of Dynamic Programming and Branch--and--Bound for the Subset--Sum 33543 Problem}, 33544 journal = {Management Science}, 33545 year = {1984}, 33546 volume = {30}, 33547 pages = {765--771} 33548} 33549 33550@Article{ martello.toth:worst-case, 33551 author = {S. Martello and P. Toth}, 33552 title = {Worst--Case Analysis of Greedy Algorithms for the Subset Sum Problem}, 33553 journal = {Mathematical Programming}, 33554 year = {1984}, 33555 volume = {28}, 33556 pages = {198--205} 33557} 33558 33559@Article{ martinet:regularisation, 33560 author = {Bernard Martinet}, 33561 title = {Regularisation d'Inequations Variationelles par Approximations Successives}, 33562 journal = {Revue Fran\c{c}aise d'Informatique et Recherche Operationelle}, 33563 year = {1970}, 33564 volume = {4}, 33565 pages = {154--159} 33566} 33567 33568@Article{ maskin.tirole:theory, 33569 author = {E. Maskin and J. Tirole}, 33570 title = {A theory of Dynamic Oligopoly, {I}: Overview and quantity competition with large 33571 fixed costs}, 33572 journal = {Econometrica}, 33573 volume = {56}, 33574 year = {1988}, 33575 pages = {549--569} 33576} 33577 33578@Article{ maskin.tirole:theory*1, 33579 author = {E. Maskin and J. Tirole}, 33580 title = {A theory of Dynamic Oligopoly, {II}: Price competition, Kinked demand curves, and 33581 Edgeworth cycles}, 33582 journal = {Econometrica}, 33583 volume = {56}, 33584 year = {1988}, 33585 pages = {571--579} 33586} 33587 33588@Article{ maskus.rutherford.ea:economic, 33589 author = {K. Maskus and T. F. Rutherford and S. Selby}, 33590 title = {Economic Implications of Changes in Labor Standards: a Computational Analysis for 33591 {M}exico}, 33592 journal = {North American Journal of Economics and Finance}, 33593 year = {1996} 33594} 33595 33596@Article{ mastor:experimental, 33597 author = {A. A. Mastor}, 33598 title = {An Experimental Investigation and Comparative Evaluation of Production Line 33599 Balancing Techniques}, 33600 journal = {Management Science}, 33601 year = {1970}, 33602 volume = {16}, 33603 pages = {728--746} 33604} 33605 33606@Article{ mathias.pang:error, 33607 author = {R. Mathias and J. S. Pang}, 33608 title = {Error bounds for the linear complementarity problem with a {P}-matrix}, 33609 journal = {Linear Algebra and Its Applications}, 33610 year = {1990}, 33611 volume = {132}, 33612 pages = {123--136} 33613} 33614 33615@Article{ mathiesen:algorithm, 33616 author = {L. Mathiesen}, 33617 title = {An Algorithm based on a Sequence of Linear Complementarity Problems applied to a 33618 {W}alrasian Equilibrium Model: An Example}, 33619 journal = {Mathematical Programming}, 33620 year = {1987}, 33621 volume = {37}, 33622 pages = {1--18} 33623} 33624 33625@Article{ mathiesen:computation, 33626 author = {L. Mathiesen}, 33627 title = {Computation of Economic Equilibria by a Sequence of Linear Complementarity 33628 Problems}, 33629 journal = {Mathematical Programming Study}, 33630 year = {1985}, 33631 volume = {23}, 33632 pages = {144--162} 33633} 33634 33635@Article{ mathiesen:computational, 33636 author = {L. Mathiesen}, 33637 title = {Computational Experience in Solving Equilibrium Models by a Sequence of Linear 33638 Complementarity Problems}, 33639 journal = {Operations Research}, 33640 year = {1985}, 33641 volume = {33}, 33642 pages = {1225--1250} 33643} 33644 33645@Book{ matlab:users, 33646 author = {{MATLAB}}, 33647 title = {User's Guide}, 33648 year = {1992}, 33649 publisher = {The MathWorks, Inc.} 33650} 33651 33652@Book{ mcclelland.rummelhart:explorations, 33653 author = {J. L. McClelland and D. E. Rummelhart}, 33654 title = {Explorations in Parallel Distributed Processing: {A} Handbook of Models, 33655 Programs, and Exercises}, 33656 year = {1987}, 33657 publisher = {MIT Press}, 33658 address = {Cambridge, Massachusetts} 33659} 33660 33661@Article{ mccormick:modification, 33662 author = {G. P. McCormick}, 33663 title = {A Modification of {A}rmijo's Step--Size Rule for Negative Curvature}, 33664 journal = {Mathematical Programming}, 33665 year = {1977}, 33666 volume = {13}, 33667 pages = {111--115} 33668} 33669 33670@Book{ mccormick:nonlinear, 33671 author = {G. P. McCormick}, 33672 title = {Nonlinear Programming: Theory, Algorithms and Applications}, 33673 year = {1983}, 33674 publisher = {John Wiley \& Sons}, 33675 address = {New York} 33676} 33677 33678@Article{ mcculloch.pitts:logical, 33679 author = {W. McCulloch and W. Pitts}, 33680 title = {A Logical Calculus of the Ideas Immanent in Nervous Activity}, 33681 journal = {Bulletin of Mathematical Biophysics}, 33682 year = {1943}, 33683 volume = {7}, 33684 pages = {115--133} 33685} 33686 33687@TechReport{ mckenna.zenios:optimal, 33688 author = {M. McKenna and S. A. Zenios}, 33689 title = {An Optimal Parallel Implementation of a Quadratic Transportation Algorithm}, 33690 institution = {Thinking Machines Corporation}, 33691 year = {1990}, 33692 type = {Working Paper}, 33693 address = {Cambridge, MA} 33694} 33695 33696@Article{ mckinnon:convergence, 33697 author = {K. I. M. McKinnon}, 33698 title = {Convergence of the {N}elder-{M}ead Simplex Method to a Nonstationary Point}, 33699 journal = {SIAM Journal on Optimization}, 33700 year = {1998}, 33701 volume = {9}, 33702 pages = {148--158} 33703} 33704 33705@Article{ mcshane.monma.ea:implementation, 33706 author = {K. A. McShane and C. L. Monma and D. F. Shanno}, 33707 title = {An implementation of a primal-dual interior point method for linear programming}, 33708 journal = {ORSA Journal of Computing}, 33709 year = {1989}, 33710 volume = {1}, 33711 pages = {70--83} 33712} 33713 33714@PhDThesis{ medhi:decomposition, 33715 author = {D. Medhi}, 33716 title = {Decomposition of Structured Large--Scale Optimization Problems and Parallel 33717 Optimization}, 33718 school = {Computer Sciences Department, University of Wisconsin}, 33719 year = {1987}, 33720 address = {Madison, Wisconsin}, 33721 note = {Technical Report 718} 33722} 33723 33724@Article{ medhi:parallel, 33725 author = {D. Medhi}, 33726 title = {Parallel Bundle-Based Decomposition for Large-Scale Structured Mathematical 33727 Programming Problems}, 33728 journal = {Annals of Operations Research}, 33729 year = {1990}, 33730 volume = {22}, 33731 pages = {101--127} 33732} 33733 33734@Article{ megiddo:complexity, 33735 author = {N. Megiddo}, 33736 title = {On the complexity of polyhedral separability}, 33737 journal = {Discrete and Computational Geometry}, 33738 year = {1988}, 33739 volume = {3}, 33740 pages = {325--337} 33741} 33742 33743@Article{ megiddo:finding, 33744 author = {N. Megiddo}, 33745 title = {On Finding Primal-- and Dual--Optimal Bases}, 33746 journal = {ORSA Journal on Computing}, 33747 year = {1991}, 33748 volume = {3}, 33749 pages = {63--65} 33750} 33751 33752@Article{ mehrotra:implementation, 33753 author = {S. Mehrotra}, 33754 title = {On the implementation of a primal-dual interior point method}, 33755 journal = {SIAM Journal on Optimization}, 33756 year = {1992}, 33757 volume = {2}, 33758 pages = {575--601} 33759} 33760 33761@PhDThesis{ merrill:applications, 33762 author = {O. H. Merrill}, 33763 title = {Application and Extensions of an Algorithm that Computes Fixed Points of Upper 33764 Semicontinuous Point to Set Mappings}, 33765 year = {1972}, 33766 school = {University of Michigan} 33767} 33768 33769@Article{ merten.muller:variance, 33770 author = {A. G. Merten and M. E. Muller}, 33771 title = {Variance Minimization in Single Machine Sequencing Problems}, 33772 journal = {Management Science}, 33773 year = {1972}, 33774 volume = {18}, 33775 pages = {518--528} 33776} 33777 33778@TechReport{ meyer:continuity, 33779 author = {R. R. Meyer}, 33780 title = {Continuity Properties of Linear Programs}, 33781 institution = {Computer Sciences Department, University of Wisconsin}, 33782 year = {1979}, 33783 address = {Madison, Wisconsin}, 33784 number = {373} 33785} 33786 33787@Article{ miersemann.mittelmann:continuation, 33788 author = {E. Miersemann and H. D. Mittelmann}, 33789 title = {Continuation for Parametrized Nonlinear Variational Inequalities}, 33790 journal = {Journal of Computational and Applied Mathematics}, 33791 year = {1989}, 33792 volume = {26}, 33793 pages = {23--34} 33794} 33795 33796@Article{ mifflin:semismooth, 33797 author = {R. Mifflin}, 33798 title = {Semismooth and semiconvex functions in constrained optimization}, 33799 journal = {SIAM Journal on Control and Optimization}, 33800 year = {1977}, 33801 volume = {15}, 33802 pages = {957--972} 33803} 33804 33805@Article{ mifflin:stable, 33806 author = {R. Mifflin}, 33807 title = {A Stable Method for Solving Certain Constrained Least Squares Problems}, 33808 journal = {Mathematical Programming}, 33809 vol = {16}, 33810 pages = {141--158}, 33811 year = {1979} 33812} 33813 33814@Book{ miller:survival, 33815 author = {Jr. R. G. Miller}, 33816 title = {Survival Analysis}, 33817 year = {1981}, 33818 publisher = {John Wiley \& Sons}, 33819 address = {New York} 33820} 33821 33822@Book{ minsky.papert:perceptrons, 33823 author = {M. Minsky and S. Papert}, 33824 title = {Perceptrons: An Introduction to Computational Geometry}, 33825 year = {1969}, 33826 publisher = {MIT Press}, 33827 address = {Cambridge, Massachusetts} 33828} 33829 33830@Article{ minty:monotone, 33831 author = {G. J. Minty}, 33832 title = {Monotone (Nonlinear) Operators in {H}ilbert Space}, 33833 journal = {Duke Mathematics Journal}, 33834 year = {1962}, 33835 volume = {29}, 33836 pages = {341--346} 33837} 33838 33839@Article{ minty:monotonicity, 33840 author = {G. J. Minty}, 33841 title = {On the Monotonicity of the Gradient of a Convex Function}, 33842 journal = {Pacific Journal of Mathematics}, 33843 year = {1964}, 33844 volume = {14}, 33845 pages = {243--247} 33846} 33847 33848@TechReport{ mizuno.jarre.ea:unified, 33849 author = {S. Mizuno and F. Jarre and J. Stoer}, 33850 title = {A Unified approach to infeasible--interior--point algorithms via geometrical 33851 linear complementarity problems}, 33852 institution = {Mathematische Institut der Universit{\"{a}}t W{\"{u}}rzburg}, 33853 address = {W{\"{u}}rzburg, Germany}, 33854 year = {1994}, 33855 number = {Nr. 213}, 33856 type = {Preprint} 33857} 33858 33859@TechReport{ mizuno:polynomiality, 33860 author = {S. Mizuno}, 33861 title = {Polynomiality of {K}ojima-{M}egiddo-{M}izuno infeasible-interior-point algorithm 33862 for linear programming}, 33863 institution = {School of Operations Research and Industrial Engineering, Cornell University}, 33864 year = {1993}, 33865 number = {1006}, 33866 address = {Ithaca, New York}, 33867 month = jan 33868} 33869 33870@Article{ mohan.mageras.ea:clinically, 33871 author = {R. Mohan and G. S. Mageras and B. Baldwin and L. J. Brewster and G. J. Kutcher 33872 and S. Leibel and C. M. Burman and C. C. Ling and Z. Fuks}, 33873 title = {Clinically Relevant Optimization of 3-{D} Conformal Treatments}, 33874 journal = {Medical Physics}, 33875 year = {1992}, 33876 volume = {19}, 33877 number = {4}, 33878 pages = {933--944} 33879} 33880 33881@Article{ mohan:field, 33882 author = {R. Mohan}, 33883 title = {Field Shaping for Three-Dimensional Conformal Radiation Therapy and Multileaf 33884 Collimation}, 33885 journal = {Seminars in Radiation Oncology}, 33886 year = {1995}, 33887 volume = {5}, 33888 number = {2}, 33889 pages = {86--99} 33890} 33891 33892@Article{ monteiro.pang.ea:positive, 33893 author = {R. D. C. Monteiro and J. S. Pang and T. Wang}, 33894 title = {A Positive Algorithm for the Nonlinear Complementarity Problem}, 33895 journal = {SIAM Journal on Optimization}, 33896 year = {1995}, 33897 volume = {5}, 33898 pages = {129--148} 33899} 33900 33901@Article{ monteiro.tsuchiya:limiting, 33902 author = {R. D. C. Monteiro and T. Tsuchiya}, 33903 title = {Limiting Behavior of the Derivatives of Certain Trajectories Associated with a 33904 Monotone Horizontal Linear Complementarity Problem}, 33905 year = {1996}, 33906 journal = {Mathematics of Operations Research}, 33907 pages = {793--814}, 33908 volume = {21} 33909} 33910 33911@Article{ monteiro.wright:local, 33912 author = {R. D. C. Monteiro and S. J. Wright}, 33913 title = {Local Convergence of Interior--Point Algorithms for Degenerate {LCP}}, 33914 journal = {Computational Optimization and Applications}, 33915 year = {1994}, 33916 volume = {3}, 33917 pages = {131--155} 33918} 33919 33920@Article{ monteiro.wright:superlinear, 33921 author = {R. D. C. Monteiro and S. J. Wright}, 33922 title = {A Superlinear Infeasible-Interior-Point Affine Scaling Algorithm for {LCP}}, 33923 year = {1996}, 33924 journal = {SIAM Journal on Optimization}, 33925 volume = {6}, 33926 pages = {1--18} 33927} 33928 33929@Article{ monteiro.wright:superlinear*1, 33930 author = {R. D. C. Monteiro and S. J. Wright}, 33931 title = {Superlinear Primal-Dual Affine Scaling Algorithms for {LCP}}, 33932 journal = {Mathematical Programming}, 33933 year = {1995}, 33934 volume = {69}, 33935 pages = {311--333} 33936} 33937 33938@Article{ more.garbow.ea:testing, 33939 author = {J. J. Mor\'{e} and B. S. Garbow and K. E. Hillstrom}, 33940 title = {Testing Unconstrained Optimization Software}, 33941 journal = {ACM Transactions on Mathematical Software}, 33942 year = {1981}, 33943 volume = {7}, 33944 pages = {17--41} 33945} 33946 33947@Article{ more.rheinboldt:p, 33948 author = {J. J. Mor\'{e} and W. C. Rheinboldt}, 33949 title = {On {P}-- and {S}--functions and Related Classes of {N}--Dimensional Nonlinear 33950 Mappings}, 33951 journal = {Linear Algebra and Its Applications}, 33952 year = {1973}, 33953 volume = {6}, 33954 pages = {45--68} 33955} 33956 33957@Article{ more.sorensen:use, 33958 author = {J. J. Mor\'{e} and D. C. Sorensen}, 33959 title = {On the use of Directions of Negative Curvature in a Modified {N}ewton Method}, 33960 journal = {Mathematical Programming}, 33961 year = {1979}, 33962 volume = {16}, 33963 pages = {1--20} 33964} 33965 33966@Article{ more.sorensen:computing, 33967 author = {J. J. Mor\'{e} and D. C. Sorensen}, 33968 title = {Computing a Trust Region Step}, 33969 journal = {SIAM Journal on Scientific and Statistical Computing}, 33970 year = {1983}, 33971 volume = {4}, 33972 pages = {553--572} 33973} 33974 33975@Article{ more.toraldo:solution, 33976 author = {J. J. Mor\'e and G. Toraldo}, 33977 title = {On the Solution of Large Quadratic Programming Problems with Bound Constraints}, 33978 journal = {SIAM Journal on Optimization}, 33979 year = {1991}, 33980 volume = {1}, 33981 pages = {93--113} 33982} 33983 33984@TechReport{ more.vavasis:solution, 33985 author = {J. J. Mor\'{e} and S. A. Vavasis}, 33986 title = {On the Solution of Concave Knapsack Problems}, 33987 institution = {Argonne National Laboratory}, 33988 year = {1988}, 33989 address = {Argonne, Illinois}, 33990 number = {ANL/MCS--P40--1288}, 33991 type = {Mathematics and Computer Science Division Report} 33992} 33993 33994@Book{ more.wright:optimization, 33995 author = {J. J. Mor\'{e} and S. J. Wright}, 33996 title = {Optimization Software Guide}, 33997 publisher = {SIAM}, 33998 address = {Philadelphia, Pennsylvania}, 33999 series = {Frontiers in Applied Mathematics}, 34000 number = {14}, 34001 year = {1993} 34002} 34003 34004@TechReport{ more.wu:global, 34005 author = {J. J. Mor\'{e} and Z. Wu}, 34006 title = {Global Continuation for Distance Geometry Problems}, 34007 institution = {Argonne National Laboratory}, 34008 year = {1995}, 34009 type = {Preprint}, 34010 number = {MCS-P505-0395}, 34011 address = {Argonne, Illinois} 34012} 34013 34014@TechReport{ more.wu:issues, 34015 author = {J. J. Mor\'{e} and Z. Wu}, 34016 title = {Issues in Large-Scale Global Molecular Optimization}, 34017 institution = {Argonne National Laboratory}, 34018 year = {1995}, 34019 type = {Preprint}, 34020 number = {MCS-P539-1095}, 34021 address = {Argonne, Illinois} 34022} 34023 34024@TechReport{ more:collection, 34025 author = {J. J. Mor\'e}, 34026 title = {A Collection of Nonlinear Model Problems}, 34027 institution = {Argonne National Laboratory}, 34028 year = {1989}, 34029 type = {Preprint}, 34030 address = {Argonne, Illinois}, 34031 number = {MCS-P60-0289} 34032} 34033 34034@Article{ more:global, 34035 author = {J. J. Mor\'e}, 34036 title = {Global Methods for Nonlinear Complementarity Problems}, 34037 year = {1996}, 34038 journal = {Mathematics of Operations Research}, 34039 pages = {589--614}, 34040 volume = {21} 34041} 34042 34043@Article{ moreau:proximite, 34044 author = {J.--J. Moreau}, 34045 title = {Proximit\'{e} et Dualit\'{e} dans un Espace {H}ilbertien}, 34046 journal = {Bulletin de la Soci\'{e}t\'{e} Math\'{e}matique de France}, 34047 year = {1965}, 34048 volume = {93}, 34049 pages = {273--299} 34050} 34051 34052@Article{ morrill.lane.ea:dose-volume, 34053 author = {S. Morrill and R. Lane and J. Wong and I. Rosen}, 34054 title = {Dose-volume considerations with linear programming}, 34055 journal = {Medical Physics}, 34056 year = {1991}, 34057 volume = {18}, 34058 number = {6}, 34059 pages = {1201--1210} 34060} 34061 34062@Article{ morrill:very, 34063 author = {S. M. Morrill and K. S. Lam and R. G. Lane and M. Langer and I. I. Rosen}, 34064 title = {Very Fast Simulated Annealing in Radiation Therapy Treatment Plan Optimization}, 34065 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34066 year = {1995}, 34067 volume = {31}, 34068 pages = {179--188} 34069} 34070 34071@TechReport{ morshedi.tapia:karmarkar, 34072 author = {A. M. Morshedi and R. A. Tapia}, 34073 title = {Karmarkar as a Classical Method}, 34074 institution = {Department of Mathematical Sciences, Rice University}, 34075 year = {1987}, 34076 number = {87--7}, 34077 type = {Technical Report} 34078} 34079 34080@Article{ mosco:dual, 34081 author = {U. Mosco}, 34082 title = {Dual Variational Inequalities}, 34083 journal = {Journal of Mathematical Analysis and its Applications}, 34084 year = {1972}, 34085 volume = {40}, 34086 pages = {202--206} 34087} 34088 34089@Article{ motzkin.schoenberg:relaxation, 34090 author = {T. S. Motzkin and I. J. Schoenberg}, 34091 title = {The relaxation method for linear inequalities}, 34092 journal = {Canadian Journal of Mathematics}, 34093 year = {1954}, 34094 volume = {6}, 34095 pages = {393--404} 34096} 34097 34098@InProceedings{ muhlenbein:parallel, 34099 crossref = {schaeffer:third}, 34100 author = {H. M{\"{}u}hlenbein}, 34101 title = {Parallel Genetic Algorithms, Population Genetics and Combinatorial Optimization}, 34102 pages = {416--421} 34103} 34104 34105@Article{ mukhopadhyay.roy.ea:polynomial, 34106 author = {S. Mukhopadhyay and A. Roy and S. Govil}, 34107 title = {A polynomial time algorithm for generating neural networks for pattern 34108 classification: Its stability properties and some test results}, 34109 journal = {Neural Computation}, 34110 year = {1993}, 34111 volume = {5}, 34112 pages = {317--330} 34113} 34114 34115@Article{ mulvey.ruszczynski:diagonal, 34116 author = {J. M. Mulvey and A. Ruszczynski}, 34117 title = {A Diagonal Quadratic Approximation Methods for Large Scale Linear Programs}, 34118 journal = {Operations Research Letters}, 34119 year = {1992}, 34120 volume = {12}, 34121 pages = {205--215} 34122} 34123 34124@TechReport{ mulvey.ruszczynski:scenario, 34125 author = {J. M. Mulvey and A. Ruszczynski}, 34126 title = {A New Scenario Decomposition Method for Large--Scale Stochastic Optimization}, 34127 institution = {Department of Civil Engineering and Operations Research, Princeton University}, 34128 year = {1991}, 34129 address = {Princeton, New Jersey}, 34130 number = {SOR 91-19}, 34131 type = {Technical Report} 34132} 34133 34134@PhDThesis{ munson:algorithms, 34135 author = {T. S. Munson}, 34136 title = {Algorithms and Environments for Complementarity}, 34137 school = {University of Wisconsin--Madison}, 34138 year = {2000}, 34139 address = {Madison, Wisconsin}, 34140 month = aug, 34141 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/00-02.ps} 34142} 34143 34144@Article{ munson.facchinei.ea:semismooth, 34145 author = {T. S. Munson and F. Facchinei and M. C. Ferris and A. Fischer and C. Kanzow}, 34146 title = {The Semismooth Algorithm for Large Scale Complementarity Problems}, 34147 journal = {INFORMS Journal on Computing}, 34148 year = {2001}, 34149 volume = {forthcoming} 34150} 34151 34152@Article{ murchland:braess, 34153 author = {J. D. Murchland}, 34154 title = {Braess' Paradox of Traffic Flow}, 34155 journal = {Transportation Research}, 34156 year = {1970}, 34157 volume = {4}, 34158 pages = {391--394} 34159} 34160 34161@Unpublished{ murphy.aha:uci, 34162 author = {P. M. Murphy and D. W. Aha}, 34163 title = {{UCI} Repository of Machine Learning Databases}, 34164 year = {1992}, 34165 note = {Department of Information and Computer Science, University of California, Irvine, 34166 California, http://www.ics.uci.edu/AI/ML/MLDBRepository.html} 34167} 34168 34169@Book{ murphy.lawrence.ea:american, 34170 editor = {G. P. Murphy and W. L. Lawrence and R. E. Lenhard}, 34171 title = {American Cancer Society Textbook of Clinical Oncology}, 34172 publisher = {The American Cancer Society, Inc.}, 34173 address = {Atlanta, Georgia}, 34174 year = {1995} 34175} 34176 34177@Article{ murphy.sherali.ea:mathematical, 34178 author = {Frederic H. Murphy and Hanif D. Sherali and Allen L. Soyster}, 34179 title = {A Mathematical Programming Approach for Determining Oligopolistic Market 34180 Equilibrium}, 34181 journal = {Mathematical Programming}, 34182 year = {1982}, 34183 volume = {24}, 34184 pages = {92--106} 34185} 34186 34187@TechReport{ murtagh.saunders:minos, 34188 author = {B. A. Murtagh and M. A. Saunders}, 34189 title = {{MINOS} 5.0 User's Guide}, 34190 institution = {Stanford University}, 34191 address = {Stanford, California}, 34192 year = {1983}, 34193 number = {{SOL} 83.20}, 34194 type = {Technical Report} 34195} 34196 34197@InProceedings{ murthy.kasif.ea:oc1, 34198 author = {S. Murthy and S. Kasif and S. Salzberg and R. Beigel}, 34199 title = {{OC1}: Randomized Induction of Oblique Decision Trees}, 34200 booktitle = {Proceedings of the Eleventh National Conference on Artificial Intelligence}, 34201 year = {1993}, 34202 publisher = {The AAAI Press/The MIT Press}, 34203 address = {Cambridge, MA 02142}, 34204 pages = {322--327} 34205} 34206 34207@Book{ murty:linear, 34208 author = {K. G. Murty}, 34209 title = {Linear Complementarity, Linear and Nonlinear Programming}, 34210 year = {1988}, 34211 publisher = {Helderman-Verlag}, 34212 address = {Berlin} 34213} 34214 34215@Book{ murty:linear*1, 34216 author = {K. G. Murty}, 34217 title = {Linear Programming}, 34218 year = {1983}, 34219 publisher = {John Wiley \& Sons}, 34220 address = {New York} 34221} 34222 34223@Article{ murty:number, 34224 author = {K. G. Murty}, 34225 title = {On the number of solutions of the complementarity problem and spanning properties 34226 of cones}, 34227 journal = {Linear Algebra and Its Applications}, 34228 year = {1972}, 34229 volume = {5}, 34230 pages = {65--108} 34231} 34232 34233@Book{ murty:linear*2, 34234 author = {K. G. Murty}, 34235 title = {Linear and Combinatorial Programming}, 34236 year = {1976}, 34237 publisher = {John Wiley \& Sons}, 34238 address = {New York} 34239} 34240 34241@Book{ nagurney:network, 34242 author = {A. Nagurney}, 34243 title = {Network Economics -- {A} Variational Inequality Approach}, 34244 publisher = {Kluwer Academic Publishers}, 34245 year = {1993}, 34246 address = {Dordrecht, The Netherlands} 34247} 34248 34249@Article{ nash.nocedal:numerical, 34250 author = {S. G. Nash and J. Nocedal}, 34251 title = {A Numerical Study of the Limited Memory {BFGS} Method and the Truncated-{N}ewton 34252 Method for Large Scale Optimization}, 34253 journal = {SIAM Journal on Optimization}, 34254 year = {1991}, 34255 volume = {3}, 34256 pages = {358--372} 34257} 34258 34259@Article{ nash:equilibrium, 34260 author = {J. F. Nash}, 34261 title = {Equilibrium Points in {N}--Person Games}, 34262 journal = {Proceedings of the National Academy of Sciences}, 34263 year = {1950}, 34264 volume = {36}, 34265 pages = {48--49} 34266} 34267 34268@Article{ nash:non-cooperative, 34269 author = {J. F. Nash}, 34270 title = {Non-cooperative games}, 34271 journal = {Annals of Mathematics}, 34272 year = {1951}, 34273 volume = {54}, 34274 pages = {286--295} 34275} 34276 34277@Article{ nash:newton-type, 34278 author = {S. G. Nash}, 34279 title = {{N}ewton--Type Minimization via {L}anczos Method}, 34280 journal = {SIAM Journal on Numerical Analysis}, 34281 year = {1984}, 34282 volume = {21}, 34283 pages = {770--788} 34284} 34285 34286@Article{ nauss:efficient, 34287 author = {R. M. Nauss}, 34288 title = {An Efficient Algorithm for the 0--1 Knapsack Problem}, 34289 journal = {Management Science}, 34290 year = {1976}, 34291 volume = {23}, 34292 pages = {27--31} 34293} 34294 34295@Book{ nazareth:computer, 34296 author = {J. L. Nazareth}, 34297 title = {Computer Solution of Linear Programs}, 34298 year = {1987}, 34299 publisher = {Oxford University Press}, 34300 address = {Oxford} 34301} 34302 34303@Article{ nelder.mead:simplex, 34304 title = {A Simplex Method for Function Minimization}, 34305 author = {J. A. Nelder and R. Mead}, 34306 journal = {Computer Journal}, 34307 volume = {7}, 34308 pages = {308--313}, 34309 year = {1965} 34310} 34311 34312@Article{ nemhauser.savelsbergh.ea:minto, 34313 author = {G. L. Nemhauser and M. W. P. Savelsbergh and G. S. Sigismondi}, 34314 title = {{MINTO}, {A} Mixed Integer Optimizer}, 34315 journal = {Operations Research Letters}, 34316 year = {1994}, 34317 optkey = {}, 34318 optvolume = {15}, 34319 optnumber = {}, 34320 optpages = {47--58}, 34321 optmonth = {}, 34322 optnote = {}, 34323 optannote = {} 34324} 34325 34326@Book{ nemhauser.wolsey:integer, 34327 author = {G. L. Nemhauser and L. A. Wolsey}, 34328 title = {Integer and Combinatorial Optimization}, 34329 publisher = {John Wiley \& Sons}, 34330 year = {1988}, 34331 address = {New York, NY} 34332} 34333 34334@Article{ nestor.pasurka:alternative, 34335 author = {D. Vaughn Nestor and C. Pasurka}, 34336 title = {Alternative Specifications for Environmental Control Costs in a General 34337 Equilibrium Framework}, 34338 journal = {Economics Letters}, 34339 year = {1995}, 34340 volume = {48}, 34341 pages = {273--280} 34342} 34343 34344@Article{ nestor.pasurka:cge, 34345 author = {D. Vaughn Nestor and C. Pasurka}, 34346 title = {{CGE} Model of Pollution Abatement Processes for Assessing the Economic Effects 34347 of Environmental Policy}, 34348 journal = {Economic Modelling}, 34349 year = {1995}, 34350 volume = {12}, 34351 pages = {53--59} 34352} 34353 34354@Article{ newman.shapiro:theorems, 34355 author = {D. J. Newman and H. S. Shapiro}, 34356 title = {Some Theorems on \v{C}eby\v{s}ev Approximation}, 34357 journal = {Duke Mathematical Journal}, 34358 year = {1963}, 34359 volume = {30}, 34360 pages = {673--682} 34361} 34362 34363@Article{ ng.peyton:block, 34364 author = {E. Ng and B. Peyton}, 34365 title = {Block Sparse Cholesky Algorithms on Advanced Uniprocessor Computers}, 34366 journal = {SIAM Journal on Scientific and Statistical Computing}, 34367 year = {1993}, 34368 volume = {14}, 34369 pages = {1034--1056} 34370} 34371 34372@TechReport{ nielsen.zenios:solving, 34373 author = {S. S. Nielsen and S. A. Zenios}, 34374 title = {Solving Linear Stochastic Network Programs using Massively Parallel Proximal 34375 Algorithms}, 34376 institution = {Decision Sciences Department, The Wharton School, University of Pennsylvania}, 34377 year = {1992}, 34378 address = {Philadelphia}, 34379 number = {92-01-05} 34380} 34381 34382@Article{ niemierko:optimization, 34383 author = {A. Niemierko}, 34384 title = {Optimization of 3{D} Radiation Therapy With Both Physical and Biological End 34385 Points and Constraints}, 34386 journal = {International Journal of Radiation Oncology, Biology and Physics}, 34387 year = {1992}, 34388 volume = {23}, 34389 pages = {99--108} 34390} 34391 34392@InCollection{ niemierko:treatment, 34393 author = {A. Niemierko}, 34394 title = {Treatment Plan Optimization}, 34395 booktitle = {3-D Radiation Treatment Planning and Conformal Therapy}, 34396 editor = {J. A. Purdy and B. Emami}, 34397 publisher = {Medical Physics Publishing}, 34398 year = {1993}, 34399 pages = {49--55}, 34400 address = {St. Louis, Missouri} 34401} 34402 34403@Article{ niemireko:optimization, 34404 author = {A. Niemierko}, 34405 title = {Optimization of intensity modulated beams: Local or global optimum?}, 34406 journal = {Medical Physics}, 34407 year = {1996}, 34408 optvolume = {23}, 34409 optpages = {1072} 34410} 34411 34412@Manual{ nih:radiation, 34413 title = {Radiation Therapy and You - {A} Guide to Self-Help During Treatment}, 34414 author = {N. C. I. National Institutes of Health}, 34415 organization = {NIH Publication}, 34416 address = {Bethesda, Maryland}, 34417 edition = {97-2227}, 34418 year = {1997} 34419} 34420 34421@Book{ nilsson:learning, 34422 author = {N. J. Nilsson}, 34423 title = {Learning Machines}, 34424 year = {1966}, 34425 publisher = {MIT Press}, 34426 address = {Cambridge, Massachusetts} 34427} 34428 34429@Article{ nocedal:theory, 34430 author = {J. Nocedal}, 34431 title = {Theory of Algorithms for Unconstrained Optimization}, 34432 journal = {Acta Numerica}, 34433 year = {1992}, 34434 pages = {199--242} 34435} 34436 34437@InProceedings{ noyes:neural, 34438 author = {J. L. Noyes}, 34439 title = {Neural Network Optimization Methods}, 34440 booktitle = {Proceedings of the Fourth Conference on Neural Networks and Parallel Distributed 34441 Processing}, 34442 year = {1991}, 34443 publisher = {Indiana-Purdue University}, 34444 address = {Fort Wayne, Indiana}, 34445 pages = {1--12} 34446} 34447 34448@Article{ nygard.juell.ea:neural, 34449 author = {K. E. Nygard and P. Juell and N. Kadaba}, 34450 title = {Neural Networks for Selecting Vehicle Routing Heuristics}, 34451 journal = {ORSA Journal on Computing}, 34452 year = {1990}, 34453 volume = {4}, 34454 pages = {353--364} 34455} 34456 34457@Article{ oh.goenka:elastohydrodynamic, 34458 author = {K. P. Oh and P. K. Goenka}, 34459 title = {The Elastohydrodynamic Solution of Journal Bearings under Dynamic Loading}, 34460 journal = {Transactions of the {ASME}, Journal of Tribology}, 34461 volume = {107}, 34462 year = {1985}, 34463 pages = {389--395} 34464} 34465 34466@Article{ oh.li.ea:elastohydrodynamic, 34467 author = {K. P. Oh and C. H. Li and P. K. Goenka}, 34468 title = {Elastohydrodynamic Lubrication of Piston Skirts}, 34469 journal = {Transactions of the {ASME}, Journal of Tribology}, 34470 volume = {109}, 34471 pages = {356--362}, 34472 year = {1987} 34473} 34474 34475@Article{ oh:analysis, 34476 author = {K. P. Oh}, 34477 title = {Analysis of a Needle Bearing}, 34478 journal = {Transactions of the {ASME}, Journal of Tribology}, 34479 volume = {106}, 34480 pages = {78--87}, 34481 year = {1984} 34482} 34483 34484@Article{ oh:formulation, 34485 author = {K. P. Oh}, 34486 title = {The Formulation of the Mixed Lubrication Problem as a Generalized Nonlinear 34487 Complementarity Problem}, 34488 journal = {Transactions of the {ASME}, Journal of Tribology}, 34489 volume = {108}, 34490 year = {1986}, 34491 pages = {598--604} 34492} 34493 34494@Article{ oh:numerical, 34495 author = {K. P. Oh}, 34496 title = {The Numerical Solution of Dynamically Loaded Elastohydrodynamic Contact as a 34497 Nonlinear Complementarity Problem}, 34498 journal = {Transactions of the {ASME}, Journal of Tribology}, 34499 volume = {106}, 34500 year = {1984}, 34501 pages = {88--95} 34502} 34503 34504@Article{ olivera.shepard.ea:maximum, 34505 author = {G. H. Olivera and D. M. Shepard and P. J. Reckwerdt and K. Ruchala and J. Zachman 34506 and E. E. Fitchard and T. R. Mackie}, 34507 title = {Maximum Likelihood as a Common Computational Framework in Tomotherapy}, 34508 journal = {Physics in Medicine and Biology}, 34509 year = {1998}, 34510 pages = {3277--3294} 34511} 34512 34513@Article{ opial:weak, 34514 author = {Z. Opial}, 34515 title = {Weak Convergence of the Sequence of Successive Approximations for Nonexpansive 34516 Mappings}, 34517 journal = {Bulletin of the American Mathematical Society}, 34518 year = {1967}, 34519 volume = {73}, 34520 pages = {591--597} 34521} 34522 34523@Book{ orchard-hays:advanced, 34524 author = {W. Orchard--Hays}, 34525 title = {Advanced Linear Programming Computing Techniques}, 34526 year = {1968}, 34527 publisher = {McGraw--Hill}, 34528 address = {New York} 34529} 34530 34531@Article{ orourke.taylor.ea:factor, 34532 author = {K. O'Rourke and A. M. Taylor and J. G. Williamson}, 34533 title = {Factor price convergence in the late nineteenth century}, 34534 journal = {International Economic Review}, 34535 year = {1996} 34536} 34537 34538@Article{ orourke.williamson:open, 34539 author = {K. O'Rourke and J. G. Williamson}, 34540 title = {Open economy forces and late 19th century {S}wedish catch-up: a quantitative 34541 accounting}, 34542 journal = {Scandinavian Economic and Social History}, 34543 year = {1995}, 34544 volume = {XLIII}, 34545 pages = {171--203} 34546} 34547 34548@Article{ orourke:costs, 34549 author = {K. O'Rourke}, 34550 title = {The costs of international economic disintegration: {I}reland in the 1930's}, 34551 journal = {Research in Economic History}, 34552 year = {1995}, 34553 volume = {15}, 34554 pages = {215--259} 34555} 34556 34557@Article{ orourke:industrial, 34558 author = {K. O'Rourke}, 34559 title = {Industrial policy, employment policy and the non-traded sector}, 34560 journal = {Journal of the Statistical and Social Inquiry Society of Ireland}, 34561 year = {1996} 34562} 34563 34564@Article{ orourke:measuring, 34565 author = {K. O'Rourke}, 34566 title = {Measuring protection: a cautionary tale}, 34567 journal = {Journal of Development Economics}, 34568 year = {1996} 34569} 34570 34571@Book{ ortega.rheinboldt:iterative, 34572 author = {J. M. Ortega and W. C. Rheinboldt}, 34573 title = {Iterative Solution of Nonlinear Equations in Several Variables}, 34574 year = {1970}, 34575 publisher = {Academic Press}, 34576 address = {San Diego, California} 34577} 34578 34579@Book{ ortega:introduction, 34580 author = {J. M. Ortega}, 34581 title = {Introduction to Parallel and Vector Solution of Linear Systems}, 34582 year = {1988}, 34583 publisher = {Plenum Press}, 34584 address = {New York} 34585} 34586 34587@Book{ ortega:numerical, 34588 author = {J. M. Ortega}, 34589 title = {Numerical Analysis, {A} Second Course}, 34590 year = {1972}, 34591 publisher = {Academic Press} 34592} 34593 34594@Article{ osborne.womersley:strong, 34595 author = {M. R. Osborne and R. S. Womersley}, 34596 title = {Strong uniqueness in sequential linear programming}, 34597 journal = {Journal of the Australian Mathematical Society, Series B}, 34598 year = {1990}, 34599 volume = {31}, 34600 pages = {379--384} 34601} 34602 34603@InCollection{ osborne:strong, 34604 author = {M. R. Osborne}, 34605 title = {Strong uniqueness in nonlinear approximation}, 34606 booktitle = {The numerical solution of nonlinear problems}, 34607 year = {1981}, 34608 editor = {C. T. H. Baker and C. Phillips}, 34609 publisher = {Clarendon Press}, 34610 address = {Oxford} 34611} 34612 34613@Book{ outrata.kocvara.ea:nonsmooth, 34614 author = {J. Outrata and M. Ko\v{c}vara and J. Zowe}, 34615 title = {Nonsmooth Approach to Optimization Problems with Equilibrium Constraints}, 34616 publisher = {Kluwer Academic Publishers}, 34617 year = {1998}, 34618 address = {Dordrecht, The Netherlands} 34619} 34620 34621@Article{ outrata.zowe:numerical, 34622 author = {J. V. Outrata and J. Zowe}, 34623 title = {A Numerical Approach to Optimization Problems with Variational Inequality 34624 Constraints}, 34625 journal = {Mathematical Programming}, 34626 year = {1995}, 34627 volume = {68}, 34628 pages = {105--130} 34629} 34630 34631@Article{ outrata:necessary, 34632 author = {J. V. Outrata}, 34633 title = {On Necessary Optimality Conditions for {S}tackelberg Problems}, 34634 journal = {Journal of Optimization Theory and Applications}, 34635 volume = {76}, 34636 year = {1993}, 34637 pages = {305--320} 34638} 34639 34640@Article{ outrata:numerical, 34641 author = {J. V. Outrata}, 34642 title = {On the Numerical Solution of a Class of {S}tackelberg Problems}, 34643 journal = {Zeitschrift f{\"{u}}r Operations Research}, 34644 volume = {4}, 34645 year = {1990}, 34646 pages = {255--278} 34647} 34648 34649@Article{ outrata:optimization, 34650 author = {J. V. Outrata}, 34651 title = {On Optimization Problems with Variational Inequality Constraints}, 34652 journal = {SIAM Journal on Optimization}, 34653 volume = {4}, 34654 year = {1994}, 34655 pages = {340--357} 34656} 34657 34658@Article{ paige.saunders:lsqr, 34659 author = {C. C. Paige and M. A. Saunders}, 34660 title = {{LSQR}: An Algorithm for Sparse Linear Equations and Sparse Least Squares}, 34661 journal = {{ACM} Transactions on Mathematical Software}, 34662 year = {1982}, 34663 volume = {8}, 34664 pages = {43--71} 34665} 34666 34667@Article{ paige.saunders:solution, 34668 author = {C. C. Paige and M. A. Saunders}, 34669 title = {Solution of Sparse Indefinite Systems of Linear Equations}, 34670 journal = {SIAM Journal on Numerical Analysis}, 34671 year = {1975}, 34672 volume = {12}, 34673 pages = {617--629} 34674} 34675 34676@Article{ palacios-gomez.lasdon.ea:nonlinear, 34677 author = {F. Palacios--Gomez and L. Lasdon and M. Engquist}, 34678 title = {Nonlinear Optimization by Successive Linear Programming}, 34679 journal = {Management Science}, 34680 year = {1982}, 34681 volume = {28}, 34682 pages = {1106--1120} 34683} 34684 34685@Article{ palomares.mangasarian:superlinearly, 34686 author = {U. M. Garcia Palomares and O. L. Mangasarian}, 34687 title = {Superlinearly Convergent {Q}uasi--{N}ewton Algorithms for Nonlinearly Constrained 34688 Optimization Problems}, 34689 journal = {Mathematical Programming}, 34690 year = {1976}, 34691 volume = {11}, 34692 pages = {1--13} 34693} 34694 34695@Article{ panagiotopoulos.al-fahed:robot, 34696 author = {P. D. Panagiotopoulos and A. M. Al-Fahed}, 34697 title = {Robot Hand Grasping and Related Problems: Optimal Contol and Identification}, 34698 journal = {The International Journal of Robotics Research}, 34699 year = {1994}, 34700 volume = {13}, 34701 pages = {127--136} 34702} 34703 34704@Book{ panagiotopoulos:hemivariational, 34705 author = {P. D. Panagiotopoulos}, 34706 title = {Hemivariational Inequalities}, 34707 publisher = {Springer-Verlag}, 34708 address = {Berlin}, 34709 year = {1993} 34710} 34711 34712@Book{ panagiotopoulos:inequality, 34713 author = {P. D. Panagiotopoulos}, 34714 title = {Inequality Problems in Mechanics and Applications}, 34715 publisher = {Birkh{\"{a}}user}, 34716 address = {Boston}, 34717 year = {1985} 34718} 34719 34720@Article{ pang.chan:iterative, 34721 author = {J. S. Pang and D. Chan}, 34722 title = {Iterative Methods for Variational and Complementarity Problems}, 34723 journal = {Mathematical Programming}, 34724 year = {1982}, 34725 volume = {24}, 34726 pages = {284--313} 34727} 34728 34729@Article{ pang.gabriel:nesqp, 34730 author = {J. S. Pang and S. A. Gabriel}, 34731 title = {{NE/SQP}: {A} Robust Algorithm for the Nonlinear Complementarity Problem}, 34732 journal = {Mathematical Programming}, 34733 year = {1993}, 34734 volume = {60}, 34735 pages = {295--338} 34736} 34737 34738@Article{ pang.han.ea:minimization, 34739 author = {J. S. Pang and S.--P. Han and N. Rangaraj}, 34740 title = {Minimization of Locally {L}ipschitzian Functions}, 34741 journal = {SIAM Journal on Optimization}, 34742 year = {1991}, 34743 volume = {1}, 34744 pages = {57--82} 34745} 34746 34747@Article{ pang.qi:nonsmooth, 34748 author = {J. S. Pang and L. Qi}, 34749 title = {Nonsmooth Equations: Motivation and Algorithms}, 34750 journal = {SIAM Journal on Optimization}, 34751 year = {1993}, 34752 volume = {3}, 34753 pages = {443--465} 34754} 34755 34756@Article{ pang.trinkle.ea:complementarity, 34757 author = {J. S. Pang and J. C. Trinkle and G. Lo}, 34758 title = {A Complementarity Approach to a Quasistatic Multi-Rigid-Body Contact Problem}, 34759 journal = {Computational Optimization and Applications}, 34760 volume = {5}, 34761 pages = {97--138}, 34762 year = {1996} 34763} 34764 34765@Article{ pang.trinkle:complementarity, 34766 author = {J. S. Pang and J. C. Trinkle}, 34767 title = {Complementarity Formulations and Existence of Solutions of Multi-Rigid-Body 34768 Contact Problems with {C}oulomb Friction}, 34769 year = {1996}, 34770 journal = {Mathematical Programming}, 34771 volume = {73}, 34772 pages = {199--226} 34773} 34774 34775@TechReport{ pang.wang:embedding, 34776 author = {J. S. Pang and Z. P. Wang}, 34777 title = {Embedding Methods for Variational Inequality and Nonlinear Complementarity 34778 Problems}, 34779 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 34780 year = {1990}, 34781 address = {Baltimore, Maryland} 34782} 34783 34784@TechReport{ pang.yang:parallel, 34785 author = {J. S. Pang and J. M. Yang}, 34786 title = {Parallel {N}ewton Methods for the Nonlinear Complementarity Problem}, 34787 institution = {Department of Mathematical Sciences, The Johns Hopkins University}, 34788 year = {1987}, 34789 address = {Baltimore, Maryland}, 34790 type = {Manuscript} 34791} 34792 34793@Article{ pang.yu:linearized, 34794 author = {J. S. Pang and C. S. Yu}, 34795 title = {Linearized Simplicial Decomposition Methods for Computing Traffic Equilibria on 34796 Networks}, 34797 journal = {Networks}, 34798 volume = {14}, 34799 pages = {427--438}, 34800 year = {1984} 34801} 34802 34803@Article{ pang:b-differentiable, 34804 author = {J. S. Pang}, 34805 title = {A {B}--Differentiable Equation Based, Globally and Locally Quadratically 34806 Convergent Algorithm for Nonlinear Programs, Complementarity and Variational 34807 Inequality Problems}, 34808 journal = {Mathematical Programming}, 34809 year = {1991}, 34810 volume = {51}, 34811 pages = {101--132} 34812} 34813 34814@InCollection{ pang:complementarity, 34815 author = {J. S. Pang}, 34816 title = {Complementarity Problems}, 34817 booktitle = {Handbook in Global Optimization}, 34818 publisher = {Kluwer Academic Publishers}, 34819 year = {1994}, 34820 editor = {R. Horst and P. Pardalos}, 34821 address = {Boston} 34822} 34823 34824@Article{ pang:convergence, 34825 author = {J. S. Pang}, 34826 title = {On the Convergence of a Basic Iterative Method for the Implicit Complementarity 34827 Problem}, 34828 journal = {Journal of Optimization Theory and Applications}, 34829 year = {1982}, 34830 volume = {37}, 34831 pages = {149--162} 34832} 34833 34834@Article{ pang:convergence*1, 34835 author = {J. S. Pang}, 34836 title = {Convergence of Splitting and {N}ewton Methods for Complementarity Problems: An 34837 Application of some Sensitivity Results}, 34838 journal = {Mathematical Programming}, 34839 year = {1993}, 34840 volume = {58}, 34841 pages = {149--160} 34842} 34843 34844@Article{ pang:inexact, 34845 author = {J. S. Pang}, 34846 title = {Inexact {N}ewton Methods for the Nonlinear Complementarity Problem}, 34847 journal = {Mathematical Programming}, 34848 year = {1986}, 34849 volume = {36}, 34850 pages = {54--71} 34851} 34852 34853@Article{ pang:more, 34854 author = {J. S. Pang}, 34855 title = {More Results on the Convergence of Iterative Methods for the Symmetric Linear 34856 Complementarity Problem}, 34857 journal = {Journal of Optimization Theory and Applications}, 34858 year = {1986}, 34859 volume = {49}, 34860 pages = {107--134} 34861} 34862 34863@Article{ pang:more*1, 34864 author = {J. S. Pang}, 34865 title = {More Results on the Convergence of Iterative Methods for Symmetric Linear 34866 Complementarity Problems}, 34867 journal = {Journal of Optimization Theory and Applications}, 34868 year = {1986}, 34869 volume = {49}, 34870 pages = {107--134} 34871} 34872 34873@Article{ pang:necessary, 34874 author = {J. S. Pang}, 34875 title = {Necessary and Sufficient Conditions for the Convergence of Iterative Methods for 34876 the Linear Complementarity Problem}, 34877 journal = {Journal of Optimization Theory and Applications}, 34878 year = {1984}, 34879 volume = {42}, 34880 pages = {1--17} 34881} 34882 34883@Article{ pang:newtons, 34884 author = {J. S. Pang}, 34885 title = {{N}ewton's Method for {B}--Differentiable Equations}, 34886 journal = {Mathematics of Operations Research}, 34887 year = {1990}, 34888 volume = {15}, 34889 pages = {311--341} 34890} 34891 34892@Article{ pang:posteriori, 34893 author = {J. S. Pang}, 34894 title = {A Posteriori Error Bound for the Linearly--Constrained Variational Inequality 34895 Problem}, 34896 journal = {Mathematics of Operations Research}, 34897 year = {1987}, 34898 volume = {12}, 34899 pages = {474--484} 34900} 34901 34902@Article{ pantoja.mayne:sequential, 34903 author = {J. F. A. D. Pantoja and D. Q. Mayne}, 34904 title = {Sequential Quadratic Programming Algorithm for Discrete Optimal Control Problems 34905 with Control Inequality Constraints}, 34906 journal = {International Journal on Control}, 34907 year = {1991}, 34908 volume = {53}, 34909 pages = {823--836} 34910} 34911 34912@Book{ papadimitriou.steiglitz:combinatorial, 34913 author = {C. H. Papadimitriou and K. Steiglitz}, 34914 title = {Combinatorial Optimization: Algorithms and Complexity}, 34915 year = {1982}, 34916 publisher = {Prentice-Hall, Inc}, 34917 address = {Englewood Cliffs, New Jersey} 34918} 34919 34920@Article{ papanikolau.mackie.ea:investigation, 34921 author = {N. Papanikolaou and T. R. Mackie and C. Meger-Wells and M. Gehring and P. 34922 Reckwerdt}, 34923 title = {Investigation of the convolution method for polyenergetic spectra}, 34924 journal = {Medical Physics}, 34925 year = {1993}, 34926 volume = {20}, 34927 number = {5}, 34928 pages = {1327--1336} 34929} 34930 34931@Article{ parisot:resolution, 34932 author = {G. R. Parisot}, 34933 title = {{R}\'{e}solution Num\'{e}rique Approach\'{e}e du Probl\`{e}me de Programmation 34934 Lin\'{e}aire par Application de la Programmation Logarithmique}, 34935 journal = {Revue Fran\c{c}aise Recherche Op\'{e}rationnelle}, 34936 year = {1961}, 34937 volume = {20}, 34938 pages = {227--259} 34939} 34940 34941@Article{ parker.cave.ea:comparison, 34942 author = {L. R. Parker and M. R. Cave and R. M. Barnes}, 34943 title = {Comparison of Simplex Algorithms}, 34944 journal = {Analytica Chimica Acta}, 34945 year = {1985}, 34946 volume = {175}, 34947 pages = {231--237} 34948} 34949 34950@InProceedings{ parker:optimal, 34951 author = {D. Parker}, 34952 title = {Optimal Algorithms for Adaptive Networks: Second Order Direct Propagation, and 34953 Second Order Hebbian Learning}, 34954 booktitle = {Proceedings of the IEEE First International Conference on Neural Networks: Volume 34955 II}, 34956 year = {1987}, 34957 address = {San Diego:IEEE}, 34958 pages = {593--600} 34959} 34960 34961@Book{ pascali.sburlan:nonlinear, 34962 author = {D. Pascali and S. Sburlan}, 34963 title = {Nonlinear Mappings of Monotone Type}, 34964 publisher = {Editura Academeie}, 34965 year = {1978} 34966} 34967 34968@Article{ passty:ergodic, 34969 author = {G. B. Passty}, 34970 title = {Ergodic convergence to a zero of the sum of monotone operators in {H}ilbert 34971 space}, 34972 journal = {Journal of Mathematical Analysis and Applications}, 34973 year = {1979}, 34974 volume = {72}, 34975 pages = {383--390} 34976} 34977 34978@Article{ peaceman.rachford:numerical, 34979 author = {D. W. Peaceman and H. H. Rachford}, 34980 title = {The numerical solution of parabolic and elliptic differential equations}, 34981 journal = {SIAM Journal}, 34982 year = {1955}, 34983 volume = {3}, 34984 pages = {28--41} 34985} 34986 34987@Book{ peck.tiesberg:global, 34988 author = {S. Peck and T. Tiesberg}, 34989 title = {Global Warming Uncertainties and the Value of Information: An Analysis Using 34990 {CETA}}, 34991 publisher = {The Electric Power Institute}, 34992 year = {1992}, 34993 address = {Paolo Alto CA} 34994} 34995 34996@TechReport{ peng:convexity, 34997 author = {J. -M. Peng}, 34998 title = {The Convexity of the Implicit {L}agrangian}, 34999 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35000 year = {1995}, 35001 type = {Technical Report}, 35002 address = {Beijing} 35003} 35004 35005@Article{ peng:equivalence, 35006 author = {J. -M. Peng}, 35007 title = {Equivalence of Variational Inequality Problems to Unconstrained Optimization}, 35008 journal = {Mathematical Programming}, 35009 year = {1997}, 35010 volume = {78}, 35011 pages = {347--356} 35012} 35013 35014@Article{ pennisi:taking, 35015 author = {E. Pennisi}, 35016 title = {Taking a structured approach to understanding proteins}, 35017 journal = {Science}, 35018 year = {1998}, 35019 volume = {279}, 35020 pages = {978--979} 35021} 35022 35023@Article{ penot:regularity, 35024 author = {J. P. Penot}, 35025 title = {On regularity conditions in mathematical programming}, 35026 journal = {Mathematical Programming Study}, 35027 year = {1982}, 35028 volume = {17}, 35029 pages = {28--66} 35030} 35031 35032@Book{ perez:principles, 35033 author = {C. A. Perez and L. W. Brady}, 35034 title = {Principles and practice of radiotherapy}, 35035 publisher = {Lippincott-Raven}, 35036 year = {1998}, 35037 address = {Philadelphia}, 35038 edition = {3rd} 35039} 35040 35041@Article{ perroni.rutherford:international, 35042 author = {C. Perroni and T. Rutherford}, 35043 title = {International Trade in Carbon Emission Rights and Basic Materials: General 35044 Equilibrium Calculations for 2020}, 35045 journal = {Scandinavian Journal of Economics}, 35046 year = {1993} 35047} 35048 35049@Article{ perroni.rutherford:regular, 35050 author = {C. Perroni and T. Rutherford}, 35051 title = {Regular Flexibility of Nested {CES} Functions}, 35052 journal = {European Economic Review}, 35053 year = {1995}, 35054 volume = {39}, 35055 pages = {335--343} 35056} 35057 35058@InCollection{ perroni.wigle:environmental, 35059 author = {C. Perroni and R. M. Wigle}, 35060 title = {Environmental Policy Modeling}, 35061 booktitle = {Global Trade Analysis: Modeling and Applications}, 35062 publisher = {Cambridge University Press}, 35063 year = {1996}, 35064 editor = {T. Hertel} 35065} 35066 35067@Article{ peterson:review, 35068 author = {D. W. Peterson}, 35069 title = {A Review of Constraint Qualifications in Finite--Dimensional Spaces}, 35070 journal = {SIAM Review}, 35071 year = {1973}, 35072 volume = {15}, 35073 pages = {639--654} 35074} 35075 35076@PhDThesis{ petersson:optimization, 35077 author = {J. Petersson}, 35078 title = {Optimization of Structures in Unilateral Contact}, 35079 type = {{L}ink{\"o}ping Studies in Science and Technology, Dissertations}, 35080 number = {397}, 35081 school = {Division of Mechanics, Department of Mechanical Engineering, Link{\"o}ping 35082 University}, 35083 address = {Link{\"o}ping, Sweden}, 35084 year = {1995} 35085} 35086 35087@Book{ petri:modelling, 35088 author = {P. Petri}, 35089 title = {Modelling {J}apanese--{A}merican Trade, {A} Study of Asymmetric Interdependence}, 35090 publisher = {Harvard University Press}, 35091 year = {1984} 35092} 35093 35094@InProceedings{ petrzykowski:application, 35095 author = {T. Petrzykowski}, 35096 title = {Application of the Steepest Ascent Method to Concave Programming}, 35097 booktitle = {Proceedings of the {IFIPS} Congress, Munich, 1962}, 35098 year = {1962}, 35099 publisher = {North--Holland}, 35100 address = {Amsterdam}, 35101 pages = {185--189} 35102} 35103 35104@InProceedings{ pettey.leuze.ea:parallel, 35105 crossref = {grefenstette:genetic}, 35106 author = {C. C. Pettey and M. R. Leuze and J. J. Grefenstette}, 35107 title = {A Parallel Genetic Algorithm}, 35108 pages = {155--161} 35109} 35110 35111@InProceedings{ pettey.leuze:theoretical, 35112 crossref = {schaeffer:third}, 35113 author = {C. C. Pettey and M. R. Leuze}, 35114 title = {A Theoretical Investigation of a Parallel Genetic Algorithm}, 35115 pages = {398--405} 35116} 35117 35118@Book{ pfeiffer.glocker:multibody, 35119 author = {F. Pfeiffer and C. Glocker}, 35120 title = {Multibody Dynamics with Unilateral Contact}, 35121 year = {1996}, 35122 publisher = {John Wiley \& Sons} 35123} 35124 35125@TechReport{ pierro.iusem:convergence, 35126 author = {A. R. de Pierro and A. N. Iusem}, 35127 title = {Convergence Properties of Iterative Methods for Symmetric Positive Semidefinite 35128 Linear Complementarity Problems}, 35129 institution = {Instituto de Matematica, Elasticita e Ciencia da Computacao}, 35130 year = {1990}, 35131 address = {Universidade Estadual de Campinas, CP 6065, Campinas, 13081, SP, Brazil} 35132} 35133 35134@InCollection{ pillo.grippo.ea:class, 35135 author = {G. Di Pillo and L. Grippo and F. Lampariello}, 35136 title = {A Class of Methods for the Solution of Optimization Problems with Inequalities}, 35137 booktitle = {System Modelling and Optimization}, 35138 year = {1981}, 35139 editor = {R. F. Drenick and F. Kozin}, 35140 publisher = {Springer-Verlag}, 35141 address = {Berlin} 35142} 35143 35144@Article{ pillo.grippo:augmented, 35145 author = {G. Di Pillo and L. Grippo}, 35146 title = {An Augmented {L}agrangian for Inequality Constraints in Nonlinear Programming 35147 Problems}, 35148 journal = {Journal of Optimization Theory and Applications}, 35149 year = {1982}, 35150 volume = {36}, 35151 pages = {495--519} 35152} 35153 35154@Article{ pillo.grippo:class, 35155 author = {G. Di Pillo and L. Grippo}, 35156 title = {A New Class of Augmented {L}agrangians in Nonlinear Programming}, 35157 journal = {SIAM Journal on Control and Optimization}, 35158 year = {1979}, 35159 volume = {17}, 35160 pages = {618--628} 35161} 35162 35163@Article{ pillo.grippo:continuously, 35164 author = {G. Di Pillo and L. Grippo}, 35165 title = {A Continuously Differentiable Exact Penalty Function for Nonlinear Programming 35166 Problems with Inequality Constraints}, 35167 journal = {SIAM Journal on Control and Optimization}, 35168 year = {1985}, 35169 volume = {23}, 35170 pages = {72--84} 35171} 35172 35173@Article{ pillo.grippo:exact, 35174 author = {G. Di Pillo and L. Grippo}, 35175 title = {An Exact Penalty Method with Global Convergence Properties for Nonlinear 35176 Programming Problems}, 35177 journal = {Mathematical Programming}, 35178 year = {1986}, 35179 volume = {36}, 35180 pages = {1--18} 35181} 35182 35183@InProceedings{ plambeck.fu.ea:throughput, 35184 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35185 title = {Throughput Optimization in Tandem Production Lines via Nonsmooth Programming}, 35186 booktitle = {Proceedings of the 1993 Summer Computer Simulation Conference}, 35187 editor = {J. Schoen}, 35188 year = {1993}, 35189 publisher = {Society for Computer Simulation}, 35190 address = {San Diego, CA}, 35191 pages = {70--75} 35192} 35193 35194@Article{ plambeck.fu.ea:sample-path, 35195 author = {E. L. Plambeck and B. --R. Fu and S.M. Robinson and R. Suri}, 35196 title = {Sample-Path Optimization of Convex Stochastic Performance Functions}, 35197 journal = {Mathematical Programming}, 35198 year = {1996}, 35199 volume = {75}, 35200 pages = {137--176} 35201} 35202 35203@InProceedings{ platt:sequential, 35204 author = {J. Platt}, 35205 title = {Sequential Minimal Optimization: A Fast Algorithm for Training Support Vector 35206 Machines}, 35207 editor = {Bernhard {Sch\"olkopf} and Christopher J. C. Burges and Alexander J. Smola}, 35208 booktitle = {Advances in Kernel Methods {-} Support Vector Learning}, 35209 publisher = {MIT Press}, 35210 pages = {185-208}, 35211 year = {1999} 35212} 35213 35214@Book{ poincare:sur, 35215 author = {H. Poincar\'{e}}, 35216 title = {Sur les Courbes {D}\'{e}fin\'{e}es par une \'{E}quation Differentielle {I}}, 35217 year = {1881}, 35218 publisher = {Oeuvres I}, 35219 address = {Gauthier--Villars, Paris} 35220} 35221 35222@Article{ polak.ribiere:note, 35223 author = {E. Polak and G. Ribi\`{e}re}, 35224 title = {Note sur la convergence de m\'{e}thodes de directions conjug\'{e}es}, 35225 journal = {Revue Francaise Informatique et Recherche Op\'{e}rationelle}, 35226 year = {1969}, 35227 volume = {16-R1}, 35228 pages = {35--43} 35229} 35230 35231@Book{ polak:computational, 35232 author = {E. Polak}, 35233 title = {Computational Methods in Optimization; {A} Unified Approach}, 35234 year = {1971}, 35235 publisher = {Academic Press}, 35236 address = {New York} 35237} 35238 35239@Article{ polak:global, 35240 author = {E. Polak}, 35241 title = {On the Global Stabilization of Locally Convergent Algorithms}, 35242 journal = {Automatica}, 35243 year = {1976}, 35244 volume = {12}, 35245 pages = {337--349} 35246} 35247 35248@Article{ polyak.tretiyakov:concerning, 35249 author = {B. T. Polyak and N. V. Tretiyakov}, 35250 title = {Concerning an Iterative Method for Linear Programming and its Economic 35251 Interpretation}, 35252 journal = {Economics and Mathematical Methods}, 35253 year = {1972}, 35254 volume = {8}, 35255 pages = {740--751}, 35256 note = {(Russian)} 35257} 35258 35259@Article{ polyak.tretiyakov:method, 35260 author = {B. T. Polyak and N. V. Tretiyakov}, 35261 title = {The Method of Penalty Estimates for Conditional Extremeum Problems}, 35262 journal = {U.S.S.R. Computational Mathematics and Mathematical Physics}, 35263 year = {1973}, 35264 volume = {13}, 35265 pages = {42--58} 35266} 35267 35268@Article{ polyak:conjugate, 35269 author = {B. T. Polyak}, 35270 title = {The conjugate gradient method in extremal problems}, 35271 journal = {USSR Computational Mathematics and Mathematical Physics}, 35272 year = {1969}, 35273 volume = {9}, 35274 pages = {94--112}, 35275 note = {Translated from Russian} 35276} 35277 35278@Book{ polyak:introduction, 35279 author = {B. T. Polyak}, 35280 title = {Introduction to Optimization}, 35281 year = {1987}, 35282 publisher = {Optimization Software, Inc.}, 35283 address = {Publications Division, New York} 35284} 35285 35286@Unpublished{ polyak:methods, 35287 author = {R. A. Polyak}, 35288 title = {On the Methods of Centers}, 35289 year = {1988}, 35290 note = {Unpublished manuscript} 35291} 35292 35293@Unpublished{ polyak:sharp, 35294 author = {B. T. Polyak}, 35295 title = {Sharp Minima}, 35296 year = {1979}, 35297 note = {A Talk given at the {IIASA} Workshop on Generalized {L}agrangians and their 35298 Applications, {IIASA}, Laxenburg, Austria} 35299} 35300 35301@InProceedings{ polyak:smooth, 35302 author = {R. A. Polyak}, 35303 title = {Smooth Optimization Methods for Solving Nonlinear Extremal and Equilibrium 35304 Problems with Constraints}, 35305 booktitle = {Abstracts of the Papers of the 11th International Symposium on Mathematical 35306 Programming}, 35307 year = {1982}, 35308 address = {Bonn} 35309} 35310 35311@Article{ polychronopoulos.tsitsiklis:analysis, 35312 author = {G. H. Polychronopoulos and J. N. Tsitsiklis}, 35313 title = {Stochastic Shortest Path Problems with Recourse}, 35314 journal = {Networks}, 35315 year = {1996}, 35316 volume = {27}, 35317 pages = {133--143} 35318} 35319 35320@TechReport{ potra.bonnans:infeasible, 35321 author = {F. A. Potra and J. F. Bonnans}, 35322 title = {Infeasible path following algorithms for linear complementarity problems}, 35323 institution = {INRIA}, 35324 year = {1994}, 35325 month = dec, 35326 number = {RR--2445}, 35327 type = {Research Report} 35328} 35329 35330@Article{ potra.sheng:large-step, 35331 author = {F. A. Potra and R. Sheng}, 35332 title = {A Large--Step Infeasible--Interior--Point Method for the ${P}_*$--Matrix {LCP}}, 35333 year = {1997}, 35334 journal = {SIAM Journal on Optimization}, 35335 volume = {7}, 35336 pages = {318--335} 35337} 35338 35339@Article{ potra:infeasible, 35340 author = {F. A. Potra}, 35341 title = {An infeasible interior-point predictor-corrector algorithm for linear 35342 programming}, 35343 journal = {SIAM Journal on Optimization}, 35344 year = {1996}, 35345 volume = {6}, 35346 pages = {19--32} 35347} 35348 35349@TechReport{ potra:onl, 35350 author = {F. A. Potra}, 35351 title = {An ${O}(n{L})$ infeasible--interior--point algorithm for {LCP} with quadratic 35352 convergence.}, 35353 institution = {Department of Mathematics, The University of Iowa}, 35354 address = {Iowa City, Iowa}, 35355 year = {1994}, 35356 number = {50}, 35357 type = {Reports on Computational Mathematics} 35358} 35359 35360@TechReport{ potra:predictor-corrector, 35361 author = {F. A. Potra}, 35362 title = {On a predictor-corrector method for solving linear programs from infeasible 35363 starting points}, 35364 institution = {Department of Mathematics, University of Iowa}, 35365 address = {Iowa City, Iowa}, 35366 year = {1992}, 35367 number = {34}, 35368 type = {Reports on Computational Mathematics} 35369} 35370 35371@TechReport{ potra:quadratically, 35372 author = {F. A. Potra}, 35373 title = {A quadratically convergent infeasible interior-point algorithm for linear 35374 programming}, 35375 institution = {Department of Mathematics, University of Iowa}, 35376 year = {1992}, 35377 number = {28}, 35378 address = {Iowa City, Iowa}, 35379 month = jul 35380} 35381 35382@InCollection{ powell:convergence, 35383 author = {M. J. D. Powell}, 35384 title = {The Convergence of Variable Metric Methods for Nonlinearly Constrained 35385 Optimization Calculations}, 35386 crossref = {mangasarian.meyer.ea:nonlinear*3}, 35387 pages = {27--63} 35388} 35389 35390@InProceedings{ powell:direct, 35391 author = {M. J. D. Powell}, 35392 title = {A Direct Search Optimization Method that Models the Objective and Constraint 35393 Functions by Linear Interpolation}, 35394 booktitle = {Advances in Optimization and Numerical Analysis, Proceedings of the Sixth 35395 Workshop on Optimization and Numerical Analysis, Oaxaca, Mexico}, 35396 volume = {275}, 35397 year = {1994}, 35398 publisher = {Kluwer Academic Publishers}, 35399 pages = {51--67}, 35400 address = {Dordrecht, The Netherlands} 35401} 35402 35403@Article{ powell:efficient, 35404 author = {M. J. D. Powell}, 35405 title = {An Efficient Method for Finding the Minimum of a Function of Several Variables 35406 without Calculating Derivatives}, 35407 journal = {Computer Journal}, 35408 year = {1964}, 35409 volume = {17}, 35410 pages = {155--162} 35411} 35412 35413@InCollection{ powell:general, 35414 author = {M. J. D. Powell}, 35415 title = {General Algorithm for Discrete Nonlinear Approximation Calculations}, 35416 booktitle = {Approximation Theory IV}, 35417 year = {1983}, 35418 editor = {L. L. Schumaker C. K. Chui and J. D. Ward}, 35419 publisher = {Academic Press}, 35420 address = {New York}, 35421 pages = {187--218} 35422} 35423 35424@InCollection{ powell:hybrid, 35425 author = {M. J. D. Powell}, 35426 title = {A hybrid method for nonlinear equations}, 35427 booktitle = {Numerical Methods for Nonlinear Algebraic Equations}, 35428 publisher = {Gordon and Breach}, 35429 year = {1970}, 35430 editor = {P. Rabinowitz} 35431} 35432 35433@TechReport{ powell:karmarkars, 35434 author = {M. J. D. Powell}, 35435 title = {{K}armarkar's algorithm: a view from nonlinear programming}, 35436 institution = {Department of Applied Mathematics and Theoretical Physics, University of 35437 Cambridge}, 35438 year = {1989}, 35439 month = nov, 35440 address = {Cambridge, CB3 9EW, England} 35441} 35442 35443@InCollection{ powell:method, 35444 author = {M. J. D. Powell}, 35445 title = {A Method for Nonlinear Constraints in Minimization Problems}, 35446 booktitle = {Optimization}, 35447 year = {1969}, 35448 editor = {R. Fletcher}, 35449 publisher = {Academic Press}, 35450 address = {London}, 35451 pages = {283--298} 35452} 35453 35454@Book{ prekopa:stochastic, 35455 author = {A. Pr{\'{e}}kopa}, 35456 title = {Stochastic Programming}, 35457 publisher = {Kluwer Academic Publishers}, 35458 year = {1995}, 35459 address = {Dordrecht, The Netherlands} 35460} 35461 35462@Book{ press.flannery.ea:numerical, 35463 author = {William H. Press and Brian P. Flannery and Saul A. Teukolsky and William T. 35464 Vetterling}, 35465 title = {Numerical Recipes : the Art of Scientific Computing}, 35466 publisher = {Cambridge University Press}, 35467 year = {1988} 35468} 35469 35470@Article{ pruyne.livny:interfacing, 35471 author = {J. Pruyne and M. Livny}, 35472 title = {Interfacing {C}ondor and {PVM} to Harness the Cycles of Workstation Clusters}, 35473 journal = {Journal on Future Generations of Computer Systems}, 35474 volume = {12}, 35475 year = {1996}, 35476 pages = {67--85} 35477} 35478 35479@InCollection{ pruyne.livny:parallel, 35480 author = {J. Pruyne and M. Livny}, 35481 title = {Parallel Processing on Dynamic Resources using {CARMI}}, 35482 booktitle = {Job Scheduling Strategies for Parallel Processing}, 35483 publisher = {Springer-Verlag}, 35484 year = {1995}, 35485 editor = {D. G. Feitelson and L. Rudolph}, 35486 volume = {949}, 35487 series = {Lecture Notes in Computer Science} 35488} 35489 35490@PhDThesis{ pruyne:resource, 35491 author = {J. C. Pruyne}, 35492 title = {Resource Management Services for Parallel Applications}, 35493 school = {University of Wisconsin--Madison}, 35494 year = {1996}, 35495 address = {Madison, Wisconsin} 35496} 35497 35498@Book{ pshenichny.danilin:numerical, 35499 author = {B. N. Pshenichny and Yu. M. Danilin}, 35500 title = {Numerical Methods in Extremal Problems}, 35501 year = {1978}, 35502 publisher = {MIR Publishers}, 35503 address = {Moscow} 35504} 35505 35506@TechReport{ qi.chen:globally, 35507 author = {L. Qi and X. Chen}, 35508 title = {A Globally Convergent Successive Approximation Method for Nonsmooth Equations}, 35509 institution = {School of Mathematics, University of New South Wales}, 35510 year = {1993}, 35511 annote = {revised}, 35512 address = {Sydney} 35513} 35514 35515@Article{ qi.jiang:semismooth, 35516 author = {L. Qi and H. Jiang}, 35517 title = {Semismooth {K}arush--{K}uhn--{T}ucker Equations and Convergence Analysis of 35518 {N}ewton Methods and Quasi--{N}ewton Methods for Solving these Equations}, 35519 journal = {Mathematics of Operations Research}, 35520 volume = {22}, 35521 pages = {301--325}, 35522 year = {1997} 35523} 35524 35525@TechReport{ qi.peng:unconstrained, 35526 author = {H. -D. Qi and J. -M. Peng}, 35527 title = {A New Unconstrained Optimization Approach for Nonlinear Complementarity 35528 Problems}, 35529 institution = {State Key Laboratory of Scientific and Engineering Computing, Academic Sinica}, 35530 year = {1996}, 35531 type = {Technical Report}, 35532 address = {Beijing} 35533} 35534 35535@InCollection{ qi.sun:survey, 35536 author = {L. Qi and D. Sun}, 35537 title = {A Survey of Some Nonsmooth Equations and Smoothing {N}ewton Methods}, 35538 year = {1999}, 35539 editor = {A. Eberhard and B. Glover and R. Hill and D. Ralph}, 35540 booktitle = {Progress in Optimization}, 35541 pages = {121--146}, 35542 series = {Applied Optimization}, 35543 volume = {30}, 35544 publisher = {Kluwer Academic Publishers}, 35545 address = {Dordrecht} 35546} 35547 35548@Article{ qi.sun:nonsmooth, 35549 author = {L. Qi and J. Sun}, 35550 title = {A Nonsmooth Version of {N}ewton's Method}, 35551 journal = {Mathematical Programming}, 35552 year = {1993}, 35553 volume = {58}, 35554 pages = {353--368} 35555} 35556 35557@Article{ qi:convergence, 35558 author = {L. Qi}, 35559 title = {Convergence Analysis of Some Algorithms for Solving Nonsmooth Equations}, 35560 journal = {Mathematics of Operations Research}, 35561 year = {1993}, 35562 volume = {18}, 35563 pages = {227--244} 35564} 35565 35566@TechReport{ qi:regular, 35567 author = {L. Qi}, 35568 title = {Regular pseudo-smooth {NCP} and {BVIP} functions and globally and quadratically 35569 convergent generalized {N}ewton methods for complementarity and variational 35570 inequality problems}, 35571 institution = {School of Mathematics, University of New South Wales}, 35572 year = {1997}, 35573 type = {Applied Mathematics Report}, 35574 number = {AMR 97/14}, 35575 address = {Sydney, Australia} 35576} 35577 35578@Article{ radner:competitive, 35579 author = {R. Radner}, 35580 title = {Competitive Equilibrium under Uncertainty}, 35581 journal = {Econometrica}, 35582 year = {1968}, 35583 volume = {36}, 35584 pages = {31--58} 35585} 35586 35587@Article{ radstrom:embedding, 35588 author = {H. R{\aa}dstr{\"{o}}m}, 35589 title = {An embedding theorem for spaces of convex sets}, 35590 journal = {Proc. Amer. Math. Soc.}, 35591 year = {1952}, 35592 volume = {3}, 35593 pages = {165--169} 35594} 35595 35596@Article{ raghavachari:connections, 35597 author = {M. Raghavachari}, 35598 title = {On Connections between Zero--One Integer Programming and Concave Programming 35599 Under Linear Constraints}, 35600 journal = {Operations Research}, 35601 year = {1969}, 35602 volume = {17}, 35603 pages = {680--684} 35604} 35605 35606@Article{ rajan.burridge.ea:dynamics, 35607 author = {V. T. Rajan and R. Burridge and J. T. Schwartz}, 35608 title = {Dynamics of a rigid body in frictional contact with rigid walls}, 35609 journal = {IEEE International Conference on Robotics and Automation, Raleigh NC}, 35610 month = mar, 35611 year = {1987}, 35612 pages = {671--677} 35613} 35614 35615@Article{ ralph:branching, 35616 author = {D. Ralph}, 35617 title = {On Branching Numbers of Normal Manifolds}, 35618 journal = {Nonlinear Analysis, Theory, Methods and Applications}, 35619 volume = {22}, 35620 pages = {1041--1050}, 35621 year = {1994} 35622} 35623 35624@Article{ ralph:global, 35625 author = {D. Ralph}, 35626 title = {Global Convergence of Damped {N}ewton's Method for Nonsmooth Equations, via the 35627 Path Search}, 35628 journal = {Mathematics of Operations Research}, 35629 year = {1994}, 35630 volume = {19}, 35631 pages = {352--389} 35632} 35633 35634@InProceedings{ ralph:piecewise, 35635 author = {D. Ralph}, 35636 title = {A Piecewise Sequential Quadratic Programming Method for Mathematical Programs 35637 with Linear Complementarity Constraints}, 35638 booktitle = {Proceedings of the Seventh Conference on Computational Techniques and 35639 Applications (CTAC95)}, 35640 year = {1996} 35641} 35642 35643@PhDThesis{ raman:integration, 35644 author = {R. Raman}, 35645 title = {Integration of logic and heuristic knowledge in discrete optimization techniques 35646 for process systems.}, 35647 address = {Pittsburgh, Pennsylvania}, 35648 year = {1993}, 35649 school = {Department of Chemical Engineering, Carnegie Mellon University} 35650} 35651 35652@PhDThesis{ rangaraj:nonsmooth, 35653 author = {Narayan Rangaraj}, 35654 title = {Nonsmooth Optimization: Algorithms and Applications}, 35655 year = {1990}, 35656 address = {Baltimore, MD}, 35657 school = {Department of Mathematical Sciences, The Johns Hopkins University} 35658} 35659 35660@InProceedings{ reckwerdt.mackie.ea:three-dimensional, 35661 author = {P. J. Reckwerdt and T. R. Mackie and J. P. Balog and T. R. McNutt}, 35662 title = {Three-Dimensional Inverse Treatment Optimization for Tomotherapy}, 35663 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 35664 Radiation Therapy, Salt Lake City}, 35665 year = {1997}, 35666 editor = {D. D. Leavitt and G. Starkshall}, 35667 publisher = {Medical Physics Publishing}, 35668 address = {St. Louis, Missouri}, 35669 pages = {420--422} 35670} 35671 35672@Article{ reid:sparsity-exploiting, 35673 author = {J. K. Reid}, 35674 title = {A Sparsity-Exploiting Variant of the {B}artels-{G}olub Decomposition for Linear 35675 Programming Bases}, 35676 journal = {Mathematical Programming}, 35677 year = {1982}, 35678 volume = {24}, 35679 pages = {55--69} 35680} 35681 35682@Book{ reingold.nievergelt.ea:combinatorial, 35683 author = {E. Reingold and J. Nievergelt and N. Deo}, 35684 title = {Combinatorial Algorithms: Theory and Practice}, 35685 publisher = {Prentice-Hall, Inc}, 35686 address = {Englewood Cliffs, New Jersey} 35687} 35688 35689@PhDThesis{ reinoza:degree, 35690 author = {J. A. Reinoza}, 35691 title = {A Degree for Generalized Equations}, 35692 year = {1979}, 35693 address = {Madison, Wisconsin}, 35694 school = {University of Wisconsin} 35695} 35696 35697@Article{ reinoza:solving, 35698 author = {A. Reinoza}, 35699 title = {Solving Generalized Equations via Homotopies}, 35700 journal = {Mathematical Programming}, 35701 year = {1985}, 35702 volume = {31}, 35703 pages = {307--320} 35704} 35705 35706@PhDThesis{ ren:computable, 35707 author = {J. Ren}, 35708 title = {Computable Error Bounds in Mathematical Programming}, 35709 school = {Computer Sciences Department, University of Wisconsin}, 35710 year = {1993}, 35711 address = {Madison, Wisconsin}, 35712 note = {Technical Report 1173} 35713} 35714 35715@Article{ renegar:polynomial-time, 35716 author = {J. Renegar}, 35717 title = {A Polynomial--Time Algorithm, based on {N}ewton's method, for Linear 35718 Programming}, 35719 journal = {Mathematical Programming}, 35720 year = {1988}, 35721 volume = {40}, 35722 pages = {59--94} 35723} 35724 35725@Article{ robbins.monro:stochastic, 35726 author = {H. Robbins and S. Monro}, 35727 title = {A Stochastic Approximation Method}, 35728 journal = {Annals of Mathematical Statistics}, 35729 year = {1951}, 35730 volume = {22}, 35731 pages = {400--407} 35732} 35733 35734@Article{ robinson:analysis, 35735 author = {S. M. Robinson}, 35736 title = {Analysis of Sample-Path Optimization}, 35737 journal = {Mathematics of Operations Research}, 35738 year = {1996}, 35739 volume = {21}, 35740 pages = {513--528} 35741} 35742 35743@InCollection{ robinson:bundle-based, 35744 author = {S. M. Robinson}, 35745 title = {Bundle-Based Decomposition: Conditions for Convergence}, 35746 booktitle = {Analyse Non Lin\'{e}aire}, 35747 year = {1989}, 35748 editor = {H. Attouch and J. P. Aubin and F. Clarke and I. Ekeland}, 35749 publisher = {Gauthier-Villaars}, 35750 address = {Paris}, 35751 pages = {435--447} 35752} 35753 35754@InCollection{ robinson:bundle-based*1, 35755 author = {S. M. Robinson}, 35756 title = {Bundle-Based Decomposition: Description and Preliminary Results}, 35757 booktitle = {System Modeling and Optimization}, 35758 year = {1986}, 35759 editor = {A Pr\'{e}kopa and J. Szelezc\'{a}n and B. Straazicky}, 35760 publisher = {Springer-Verlag}, 35761 address = {Berlin}, 35762 pages = {751--756}, 35763 volume = {84}, 35764 series = {Lecture Notes in Control and Information Sciences} 35765} 35766 35767@Article{ robinson:continuity, 35768 author = {S. M. Robinson}, 35769 title = {Some Continuity Properties of Polyhedral Multifunctions}, 35770 journal = {Mathematical Programming Study}, 35771 year = {1981}, 35772 volume = {14}, 35773 pages = {206--214} 35774} 35775 35776@Article{ robinson:extension, 35777 author = {S. M. Robinson}, 35778 title = {Extension of {N}ewton's Method to Nonlinear Functions with Values in a Cone}, 35779 journal = {Numerische Mathematik}, 35780 year = {1972}, 35781 volume = {19}, 35782 pages = {341--347} 35783} 35784 35785@InCollection{ robinson:generalized, 35786 crossref = {bachem.grotschel.ea:mathematical}, 35787 author = {S. M. Robinson}, 35788 title = {Generalized Equations}, 35789 pages = {346--367} 35790} 35791 35792@Article{ robinson:generalized*1, 35793 author = {S. M. Robinson}, 35794 title = {Generalized Equations and their Solution: {P}art {I}: Basic Theory}, 35795 journal = {Mathematical Programming Study}, 35796 year = {1979}, 35797 volume = {10}, 35798 pages = {128--141} 35799} 35800 35801@InCollection{ robinson:homeomorphism, 35802 author = {S. M. Robinson}, 35803 title = {Homeomorphism Conditions for Normal Maps of Polyhedra}, 35804 booktitle = {Optimization and Nonlinear Analysis}, 35805 year = {1992}, 35806 editor = {A. Ioffe and M. Marcus and S. Reich}, 35807 publisher = {Longman}, 35808 address = {Harlow, Essex, England}, 35809 pages = {240--248}, 35810 series = {Pitman Research Notes in Mathematics Series No. 244} 35811} 35812 35813@Article{ robinson:implicit-function, 35814 author = {S. M. Robinson}, 35815 title = {An Implicit--Function Theorem for a Class of Nonsmooth Functions}, 35816 journal = {Mathematics of Operations Research}, 35817 year = {1991}, 35818 volume = {16}, 35819 pages = {292--309} 35820} 35821 35822@Article{ robinson:local*1, 35823 author = {S. M. Robinson}, 35824 title = {Local Epi--Continuity and Local Optimization}, 35825 journal = {Mathematical Programming}, 35826 year = {1987}, 35827 volume = {37}, 35828 pages = {208--222} 35829} 35830 35831@Article{ robinson:local*2, 35832 author = {S. M. Robinson}, 35833 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{II}: 35834 Nondegeneracy}, 35835 journal = {Mathematical Programming Study}, 35836 year = {1984}, 35837 volume = {22}, 35838 pages = {217--230} 35839} 35840 35841@Article{ robinson:local*3, 35842 author = {S. M. Robinson}, 35843 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{III}: 35844 Stability and Sensitivity}, 35845 journal = {Mathematical Programming Study}, 35846 year = {1987}, 35847 volume = {30}, 35848 pages = {45--66} 35849} 35850 35851@Article{ robinson:mathematical, 35852 author = {S. M. Robinson}, 35853 title = {Mathematical Foundations of Nonsmooth Embedding Methods}, 35854 journal = {Mathematical Programming}, 35855 year = {1990}, 35856 volume = {48}, 35857 pages = {221--229} 35858} 35859 35860@Article{ robinson:newtons, 35861 author = {S. M. Robinson}, 35862 title = {{N}ewton's Method for a Class of Nonsmooth Functions}, 35863 journal = {Set Valued Analysis}, 35864 year = {1994}, 35865 volume = {2}, 35866 pages = {291--305} 35867} 35868 35869@Article{ robinson:nonsingularity, 35870 author = {S. M. Robinson}, 35871 title = {Nonsingularity and Symmetry for Linear Normal Maps}, 35872 journal = {Mathematical Programming}, 35873 year = {1993}, 35874 volume = {62}, 35875 pages = {415--425} 35876} 35877 35878@InCollection{ robinson:nonsmooth, 35879 author = {S. M. Robinson}, 35880 title = {Nonsmooth Continuation for Generalized Equations}, 35881 year = {1997}, 35882 pages = {282--291}, 35883 editors = {P. Gritzmann and R. Horst and E. Sachs and R. Tichatschke}, 35884 booktitle = {Recent Advances in Optimization}, 35885 series = {Lecture Notes in Economics and Mathematical Systems}, 35886 volume = {452}, 35887 publisher = {Springer-Verlag}, 35888 address = {Heidelberg} 35889} 35890 35891@Article{ robinson:normal, 35892 author = {S. M. Robinson}, 35893 title = {Normal Maps Induced by Linear Transformations}, 35894 journal = {Mathematics of Operations Research}, 35895 year = {1992}, 35896 volume = {17}, 35897 pages = {691--714} 35898} 35899 35900@Article{ robinson:normed, 35901 author = {S. M. Robinson}, 35902 title = {Normed Convex Processes}, 35903 journal = {Transactions of the American Mathematical Society}, 35904 year = {1972}, 35905 volume = {174}, 35906 pages = {127--140} 35907} 35908 35909@Article{ robinson:reduction, 35910 author = {S. M. Robinson}, 35911 title = {A reduction method for variational inequalities}, 35912 journal = {Mathematical Programming}, 35913 year = {1998}, 35914 volume = {80}, 35915 pages = {161--169} 35916} 35917 35918@Article{ robinson:regularity, 35919 author = {S. M. Robinson}, 35920 title = {Regularity and stability for convex multivalued functions}, 35921 journal = {Mathematics of Operations Research}, 35922 year = {1976}, 35923 volume = {1}, 35924 pages = {130--143} 35925} 35926 35927@Unpublished{ robinson:shadow, 35928 author = {S. M. Robinson}, 35929 title = {Shadow {JUNK} for biblio file}, 35930 year = {1800} 35931} 35932 35933@Article{ robinson:shadow*1, 35934 author = {S. M. Robinson}, 35935 title = {Shadow Prices for Measures of Effectiveness {I}: Linear Model}, 35936 journal = {Operations Research}, 35937 year = {1993}, 35938 volume = {41}, 35939 pages = {518--535} 35940} 35941 35942@Article{ robinson:shadow*2, 35943 author = {S. M. Robinson}, 35944 title = {Shadow Prices for Measures of Effectiveness {II}: General Model}, 35945 journal = {Operations Research}, 35946 year = {1993}, 35947 volume = {41}, 35948 pages = {536--548} 35949} 35950 35951@Unpublished{ robinson:stability, 35952 author = {S. M. Robinson}, 35953 title = {Stability {JUNK} for biblio file}, 35954 year = {1800} 35955} 35956 35957@Article{ robinson:stability*1, 35958 author = {S. M. Robinson}, 35959 title = {Stability theory for systems of inequalities, {P}art {I}: linear systems}, 35960 journal = {SIAM Journal on Numerical Analysis}, 35961 year = {1975}, 35962 volume = {12}, 35963 pages = {754--769} 35964} 35965 35966@Article{ robinson:stability*2, 35967 author = {S. M. Robinson}, 35968 title = {Stability theory for systems of inequalities, {P}art {II}: Differentiable 35969 Nonlinear Systems}, 35970 journal = {SIAM Journal on Numerical Analysis}, 35971 year = {1976}, 35972 volume = {13}, 35973 pages = {497--513} 35974} 35975 35976@Article{ robinson:strongly, 35977 author = {S. M. Robinson}, 35978 title = {Strongly Regular Generalized Equations}, 35979 journal = {Mathematics of Operations Research}, 35980 year = {1980}, 35981 volume = {5}, 35982 pages = {43--62} 35983} 35984 35985@Article{ rockafellar.wets:generalized, 35986 author = {R. T. Rockafellar and R. J.--B. Wets}, 35987 title = {Generalized Linear-Quadratic Problems of Deterministic and Stochastic Optimal 35988 Control in Discrete Time}, 35989 journal = {SIAM Journal on Control and Optimization}, 35990 year = {1990}, 35991 volume = {28}, 35992 pages = {810--822} 35993} 35994 35995@Article{ rockafellar.wets:lagrangian, 35996 author = {R. T. Rockafellar and R. J.--B. Wets}, 35997 title = {A {L}agrangian Finite Generation Technique for Solving Linear-Quadratic Problems 35998 in Stochastic Programming}, 35999 journal = {Mathematical Programming Study}, 36000 year = {1986}, 36001 volume = {28}, 36002 pages = {63--93} 36003} 36004 36005@InCollection{ rockafellar.wets:linear-quadratic, 36006 author = {R. T. Rockafellar and R. J.--B. Wets}, 36007 title = {Linear-Quadratic Programming Problems with Stochastic Penalties: the Finite 36008 Generation Algorithm}, 36009 booktitle = {Stochastic Optimization}, 36010 publisher = {Springer-Verlag}, 36011 year = {1987}, 36012 editor = {V. I. Arkin and A. Shiraer and R. J.--B. Wets}, 36013 series = {Lecture Notes in Control and Information Sciences, IIASA Series No. 81}, 36014 pages = {545--560}, 36015 address = {New York, Berlin} 36016} 36017 36018@Article{ rockafellar.wets:scenarios, 36019 author = {R. T. Rockafellar and R. J.--B. Wets}, 36020 title = {Scenarios and Policy Aggregation in Optimization under Uncertainty}, 36021 journal = {Mathematics of Operations Research}, 36022 year = {1991}, 36023 volume = {10}, 36024 pages = {119--147} 36025} 36026 36027@InProceedings{ rockafellar:applications, 36028 author = {R. T. Rockafellar}, 36029 title = {New Applications of Duality in Convex Programming}, 36030 booktitle = {Proceedings of the Fourth Conference on Probability}, 36031 year = {1971}, 36032 address = {Brasov, Romania} 36033} 36034 36035@Article{ rockafellar:augmented, 36036 author = {R. T. Rockafellar}, 36037 title = {Augmented {L}agrange Multiplier Functions and Duality in Nonconvex Programming}, 36038 journal = {SIAM Journal on Control and Optimization}, 36039 year = {1974}, 36040 volume = {12}, 36041 pages = {268--285} 36042} 36043 36044@Article{ rockafellar:augmented*1, 36045 author = {R. T. Rockafellar}, 36046 title = {Augmented {L}agrangians and Applications of the Proximal Point Algorithm in 36047 Convex Programming}, 36048 journal = {Mathematics of Operations Research}, 36049 year = {1976}, 36050 volume = {1}, 36051 pages = {97--116} 36052} 36053 36054@Article{ rockafellar:characterization, 36055 author = {R. T. Rockafellar}, 36056 title = {Characterization of the subdifferentials of convex functions}, 36057 journal = {Pacific Journal of Mathematics}, 36058 year = {1966}, 36059 volume = {17}, 36060 number = {3}, 36061 pages = {497--510} 36062} 36063 36064@Article{ rockafellar:computational, 36065 author = {R. T. Rockafellar}, 36066 title = {Computational Schemes for Large--Scale Problems in Extended Linear--Quadratic 36067 Programming}, 36068 journal = {Mathematical Programming}, 36069 year = {1990}, 36070 volume = {48}, 36071 pages = {447--474} 36072} 36073 36074@Book{ rockafellar:conjugate, 36075 author = {R. T. Rockafellar}, 36076 title = {Conjugate Duality and Optimization}, 36077 year = {1974}, 36078 publisher = {SIAM}, 36079 address = {Philadelphia, Pennsylvania}, 36080 volume = {16}, 36081 series = {Conference Board of the Mathematical Sciences} 36082} 36083 36084@Book{ rockafellar:convex, 36085 author = {R. T. Rockafellar}, 36086 title = {Convex Analysis}, 36087 year = {1970}, 36088 publisher = {Princeton University Press}, 36089 address = {Princeton, New Jersey} 36090} 36091 36092@Article{ rockafellar:first-, 36093 author = {R. T. Rockafellar}, 36094 title = {First-- and Second--Order Epi--Differentiabilty in Nonlinear Programming}, 36095 journal = {Transactions of the American Mathematical Society}, 36096 year = {1988}, 36097 volume = {307}, 36098 pages = {75--108} 36099} 36100 36101@InProceedings{ rockafellar:generalized, 36102 author = {R. T. Rockafellar}, 36103 title = {A Generalized Approach to Linear-Quadratic Programming}, 36104 booktitle = {Proceedings of the International Conference on Numerical Optimization and 36105 Applications}, 36106 year = {1986}, 36107 pages = {58--66}, 36108 note = {(Xi'an, China)} 36109} 36110 36111@InProceedings{ rockafellar:generalized*1, 36112 crossref = {bachem.grotschel.ea:mathematical}, 36113 author = {R. T. Rockafellar}, 36114 title = {Generalized Subgradients in Mathematical Programming}, 36115 pages = {368--390} 36116} 36117 36118@InCollection{ rockafellar:large-scale, 36119 author = {R. T. Rockafellar}, 36120 title = {Large-Scale Extended Linear-Quadratic Programming and Multistage Optimization}, 36121 booktitle = {Advances in Numerical Partial Differential Equations and Optimization}, 36122 chapter = {15}, 36123 year = {1991}, 36124 editor = {S. Gomez and J. P. Hennart and R. A. Tapia}, 36125 publisher = {SIAM Publications}, 36126 pages = {247--261} 36127} 36128 36129@Article{ rockafellar:linear-quadratic, 36130 author = {R. T. Rockafellar}, 36131 title = {Linear-Quadratic Programming and Optimal Control}, 36132 journal = {SIAM Journal on Control and Optimization}, 36133 year = {1987}, 36134 volume = {25}, 36135 pages = {781--814} 36136} 36137 36138@Article{ rockafellar:maximality, 36139 author = {R. T. Rockafellar}, 36140 title = {On the Maximality of Sums of Nonlinear Monotone Operators}, 36141 journal = {Transactions of the American Mathematical Society}, 36142 year = {1970}, 36143 volume = {149}, 36144 pages = {75--88} 36145} 36146 36147@InCollection{ rockafellar:monotone, 36148 author = {R. T. Rockafellar}, 36149 title = {Monotone Operators and Augmented {L}agrangian Methods in Nonlinear Programming}, 36150 crossref = {mangasarian.meyer.ea:nonlinear*3}, 36151 pages = {1--26} 36152} 36153 36154@Article{ rockafellar:monotone*1, 36155 author = {R. T. Rockafellar}, 36156 title = {Monotone Operators and the Proximal Point Algorithm}, 36157 journal = {SIAM Journal on Control and Optimization}, 36158 year = {1976}, 36159 volume = {14}, 36160 pages = {877--898} 36161} 36162 36163@Article{ rockafellar:multiplier, 36164 author = {R. T. Rockafellar}, 36165 title = {The Multiplier Method of {H}estenes and {P}owell Applied to Convex Programming}, 36166 journal = {Journal of Optimization Theory and Applications}, 36167 year = {1973}, 36168 volume = {12}, 36169 pages = {555--562} 36170} 36171 36172@Article{ rockafellar:multistage, 36173 author = {R. T. Rockafellar}, 36174 title = {Multistage Convex Programming and Discrete-Time Optimal Control}, 36175 journal = {Control and Cybernetics}, 36176 year = {1988}, 36177 volume = {17}, 36178 number = {2-3}, 36179 pages = {225--245} 36180} 36181 36182@Book{ rockafellar:network, 36183 author = {R. T. Rockafellar}, 36184 title = {Network Flows and Monotropic Optimization}, 36185 publisher = {John Wiley}, 36186 year = {1984}, 36187 address = {New York} 36188} 36189 36190@Article{ rodrigues:mixed, 36191 author = {H. C. Rodrigues}, 36192 title = {A mixed variational formulation for shape optimization of solids with contact 36193 conditions}, 36194 journal = {Structural Optimization}, 36195 volume = {6}, 36196 year = {1993}, 36197 pages = {19--28} 36198} 36199 36200@Book{ rodrigues:obstacle, 36201 author = {J. F. Rodrigues}, 36202 title = {Obstacle Problems in Mathematical Physics}, 36203 publisher = {Elsevier Publishing Company}, 36204 address = {Amsterdam}, 36205 year = {1987} 36206} 36207 36208@Book{ roos.terlaky.ea:theory, 36209 author = {C. Roos and T. Terlaky and J.--Ph. Vial}, 36210 title = {Theory and Algorithms for Linear Optimization: An Interior-Point Approach}, 36211 publisher = {John Wiley \& Sons}, 36212 year = {1997}, 36213 address = {Chichester} 36214} 36215 36216@TechReport{ rosa:decomposition, 36217 author = {C. H. Rosa}, 36218 title = {A Decomposition Technique for Equilibrium Programming under Uncertainty}, 36219 institution = {IIASA}, 36220 year = {1996}, 36221 number = {WP-96-013}, 36222 address = {A-2361 Laxenburg, Austria} 36223} 36224 36225@Article{ rosen.lane.ea:treatment, 36226 author = {I. Rosen and R. Lane and S. Morrill and J. Belli}, 36227 title = {Treatment Plan Optimization Using Linear Programming}, 36228 journal = {Medical Physics}, 36229 year = {1990}, 36230 volume = {18}, 36231 number = {2}, 36232 pages = {141--152} 36233} 36234 36235@TechReport{ rosenblatt:perceptron-a, 36236 author = {F. Rosenblatt}, 36237 title = {The perceptron--a perceiving and recognizing automaton}, 36238 institution = {Cornell Aeronautical Laboratory}, 36239 year = {1957}, 36240 month = jan, 36241 address = {Ithaca, New York}, 36242 number = {85-460-1} 36243} 36244 36245@Book{ rosenblatt:principles, 36246 author = {F. Rosenblatt}, 36247 title = {Principles of Neurodynamics}, 36248 year = {1962}, 36249 publisher = {Spartan Books}, 36250 address = {New York} 36251} 36252 36253@InProceedings{ rosenblatt:two, 36254 author = {F. Rosenblatt}, 36255 title = {Two theorems of statistical separability in the perceptron}, 36256 booktitle = {Proceedings of Symposium Held at National Physical Laboratory, November 1958}, 36257 year = {1959}, 36258 publisher = {{HMS} Stationery Office}, 36259 address = {London}, 36260 volume = {1} 36261} 36262 36263@Article{ rosenbrock:automatic, 36264 author = {H. H. Rosenbrock}, 36265 title = {Automatic Method for Finding the Greatest or Least Value of a Function}, 36266 journal = {Computer Journal}, 36267 year = {1960}, 36268 volume = {3}, 36269 pages = {175--184} 36270} 36271 36272@Article{ roy.mukhopadhyay:pattern, 36273 author = {A. Roy and S. Mukhopadhyay}, 36274 title = {Pattern Classification Using Linear Programming}, 36275 journal = {ORSA Journal on Computing}, 36276 year = {1990}, 36277 volume = {3}, 36278 pages = {66--80} 36279} 36280 36281@Book{ rubinstein:monte, 36282 author = {R. Rubinstein}, 36283 title = {Monte Carlo Optimization, Simulation, and Sensitivity Analysis of Queueing 36284 Networks}, 36285 publisher = {Wiley}, 36286 address = {New York, NY}, 36287 year = {1986} 36288} 36289 36290@Article{ ruchala.olivera.ea:comparison, 36291 author = {K. J. Ruchala and G. H. Olivera and T. R. Mackie}, 36292 title = {A Comparison of Maximum-Likelihood and Iterative Filtered Backprojection 36293 Reconstruction Algorithms for Megavoltage {CT} on a Tomotherapy System}, 36294 journal = {Physics in Medicine and Biology, forthcoming}, 36295 year = {1999} 36296} 36297 36298@Book{ rudin:principles, 36299 author = {W. Rudin}, 36300 title = {Principles of Mathematical Analysis}, 36301 year = {1976}, 36302 publisher = {McGraw--Hill}, 36303 address = {Tokyo, Japan}, 36304 edition = {Third} 36305} 36306 36307@Book{ rudin:real, 36308 author = {W. Rudin}, 36309 title = {Real and Complex Analysis}, 36310 year = {1974}, 36311 publisher = {McGraw--Hill}, 36312 address = {Tokyo, Japan}, 36313 edition = {Second} 36314} 36315 36316@InProceedings{ rumelhart.hinton.ea:learning, 36317 author = {D. E. Rumelhart and G. E. Hinton and R. J. Williams}, 36318 title = {Learning Internal Representations by Error Propagation}, 36319 booktitle = {Parallel Distributed Processing}, 36320 year = {1986}, 36321 editor = {D. E. Rumelhart and J. L. McClelland}, 36322 publisher = {MIT Press}, 36323 address = {Cambridge, Massachusetts}, 36324 pages = {318--362} 36325} 36326 36327@Book{ rumelhart.mcclelland:parallel, 36328 author = {D. E. Rumelhart and J. L. McClelland}, 36329 title = {Parallel Distributed Processing}, 36330 year = {1986}, 36331 publisher = {MIT Press}, 36332 address = {Cambridge, Massachusetts} 36333} 36334 36335@InCollection{ ruszczynski:regularized, 36336 author = {A. Ruszczynski}, 36337 title = {On the Regularized Decomposition for Stochastic Programming Problems}, 36338 year = {1995}, 36339 booktitle = {Stochastic Programming: Numerical Techniques and Engineering Applications}, 36340 editor = {K. Marti and P. Kall}, 36341 publisher = {Springer-Verlag}, 36342 address = {Berlin}, 36343 volume = {425}, 36344 series = {Lecture Notes in Control and Information Sciences}, 36345 pages = {93--108} 36346} 36347 36348@Article{ rutherford.rutstrom.ea:lacord, 36349 author = {T. F. Rutherford and E. E. Rutstrom and D. Tarr}, 36350 title = {{L}'accord de libre-echange entre le {M}aroc et la {CE}: une evaluation 36351 quantitative}, 36352 journal = {Revue d' Economie du developpement}, 36353 year = {1994} 36354} 36355 36356@InCollection{ rutherford.tarr:blueprints, 36357 author = {T. Rutherford and D. Tarr}, 36358 title = {Blueprints, Spillovers and the Dynamic Gains from Trade Liberalization in a Small 36359 Open Economy}, 36360 booktitle = {Dynamic Issues in Applied Commercial Policy Analysis}, 36361 publisher = {Cambridge University Press}, 36362 year = {1997}, 36363 editor = {R. Baldwin and J. Francois}, 36364 address = {New York} 36365} 36366 36367@Article{ rutherford:applied, 36368 author = {T. F. Rutherford}, 36369 title = {Applied General Equilibrium Modeling with {MPSGE} as a {GAMS} Subsystem: An 36370 Overview of the Modeling Framework and Syntax}, 36371 year = {1999}, 36372 volume = {14}, 36373 pages = {1--46}, 36374 journal = {Computational Economics} 36375} 36376 36377@PhDThesis{ rutherford:applied*1, 36378 author = {T. F. Rutherford}, 36379 title = {Applied General Equilibrium Modeling}, 36380 school = {Stanford University}, 36381 year = {1987} 36382} 36383 36384@Article{ rutherford:extensions, 36385 author = {T. F. Rutherford}, 36386 title = {Extensions of {GAMS} for Complementarity Problems Arising in Applied Economic 36387 Analysis}, 36388 journal = {Journal of Economic Dynamics and Control}, 36389 volume = {19}, 36390 pages = {1299--1324}, 36391 year = {1995} 36392} 36393 36394@Misc{ rutherford:gnuplot, 36395 author = {T. F. Rutherford}, 36396 title = {A Libinclude Interface to Gnuplot from {GAMS}}, 36397 organization = {Department of Economics, University of Colorado}, 36398 address = {Boulder, Colorado}, 36399 note = {http://robles.colorado.edu/~tomruth/gnuplot/gnuplot.htm} 36400} 36401 36402@Unpublished{ rutherford:miles, 36403 author = {T. F. Rutherford}, 36404 title = {{MILES}: {A} Mixed Inequality and nonLinear Equation Solver}, 36405 year = {1993}, 36406 note = {Working Paper, Department of Economics, University of Colorado, Boulder} 36407} 36408 36409@TechReport{ rutherford:modeling, 36410 author = {T. F. Rutherford}, 36411 title = {A Modeling System for Applied General Equilibrium Analysis}, 36412 type = {Cowles Foundation Discussion Paper}, 36413 number = {836}, 36414 institution = {Yale University}, 36415 year = {1987} 36416} 36417 36418@TechReport{ rutherford:mpsge, 36419 author = {T. F. Rutherford}, 36420 title = {{MPSGE}}, 36421 institution = {University of Western Ontario}, 36422 year = {1988}, 36423 address = {London, Ontario} 36424} 36425 36426@Article{ rykov:simplex, 36427 author = {A. S. Rykov}, 36428 title = {Simplex Direct Search Algorithms}, 36429 journal = {Automation and Remote Control}, 36430 year = {1980}, 36431 volume = {41}, 36432 pages = {784--793} 36433} 36434 36435@Article{ saad.schultz:gmres, 36436 author = {Y. Saad and M. Schultz}, 36437 title = {{GMRES}: {A} Generalized Minimal Residual Algorithm for Solving Nonsymmetric 36438 Linear Systems}, 36439 journal = {SIAM Journal on Scientific and Statistical Computing}, 36440 year = {1986}, 36441 volume = {44}, 36442 pages = {856--869} 36443} 36444 36445@Book{ saad:iterative, 36446 author = {Y. Saad}, 36447 title = {Iterative Methods for Sparse Linear Systems}, 36448 year = {1996}, 36449 publisher = {PWS Publishing Company}, 36450 address = {Boston, Massachusetts} 36451} 36452 36453@Article{ sahni:approximate, 36454 author = {S. Sahni}, 36455 title = {Approximate Algorithms for the 0/1 Knapsack Problem}, 36456 journal = {jacm}, 36457 year = {1975}, 36458 volume = {22}, 36459 pages = {115--124} 36460} 36461 36462@InProceedings{ sauer.shepard.ea:comparison, 36463 author = {O. A. Sauer and D. M. Shepard and L. Angelos and T. R. Mackie}, 36464 title = {A Comparison of Objective Functions for Use in Radiotherapy Optimization}, 36465 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36466 Radiation Therapy, Salt Lake City}, 36467 year = {1997}, 36468 editor = {D. D. Leavitt and G. Starkshall}, 36469 publisher = {Medical Physics Publishing}, 36470 address = {St. Louis, Missouri} 36471} 36472 36473@Article{ sauer.xu:multivariate, 36474 author = {Th. Sauer and Y. Xu}, 36475 title = {On Multivariate {L}agrange Interpolation}, 36476 journal = {Mathematics of Computation}, 36477 year = {1995}, 36478 volume = {64}, 36479 pages = {1147--1170} 36480} 36481 36482@Article{ savelsbergh:preprocessing, 36483 author = {M. W. P. Savelsbergh}, 36484 title = {Preprocessing and Probing Techniques for Mixed Integer Programming Problems}, 36485 journal = {ORSA Journal on Computing}, 36486 year = {1994}, 36487 volume = {6}, 36488 pages = {445--454} 36489} 36490 36491@Article{ scarf:approximation, 36492 author = {H. E. Scarf}, 36493 title = {The Approximation of Fixed Points of a Continuous Mapping}, 36494 journal = {SIAM Journal on Applied Mathematics}, 36495 year = {1967}, 36496 volume = {15}, 36497 pages = {1328--1343} 36498} 36499 36500@Book{ scarf:computation, 36501 author = {H. E. Scarf}, 36502 title = {The Computation of Economic Equilibria}, 36503 year = {1973}, 36504 publisher = {Yale University Press}, 36505 address = {New Haven, Connecticut} 36506} 36507 36508@TechReport{ scheel.scholtes:mathematical, 36509 author = {H. Scheel and S. Scholtes}, 36510 title = {Mathematical Programs with Complementarity Constraints: Stationarity, Optimality, 36511 and Sensitivity}, 36512 institution = {Judge Institute of Management Studies, University of Cambridge}, 36513 year = {1998}, 36514 type = {Technical Report}, 36515 address = {Cambridge, England} 36516} 36517 36518@Article{ schlick:modified, 36519 author = {T. Schlick}, 36520 title = {Modified {C}holesky Factorization for Sparse Preconditioners}, 36521 journal = {SIAM Journal on Scientific Computing}, 36522 year = {1993}, 36523 volume = {14}, 36524 pages = {424--445} 36525} 36526 36527@Article{ schnabel.eskow:modified, 36528 author = {R. B. Schnabel and E. Eskow}, 36529 title = {A New Modified {C}holesky Factorization}, 36530 journal = {SIAM Journal on Scientific and Statistical Computing}, 36531 year = {1991}, 36532 volume = {11}, 36533 pages = {1136--1158} 36534} 36535 36536@Article{ schneider.zenios:comparative, 36537 author = {M. H. Schneider and S. A. Zenios}, 36538 title = {A Comparative Study of Algorithms for Matrix Balancing}, 36539 journal = {Operations Research}, 36540 year = {1990}, 36541 volume = {38}, 36542 pages = {439--455} 36543} 36544 36545@Book{ scholkopf.burges.ea:advances, 36546 editor = {B. {Sch\"{o}lkopf} and C. Burges and A. Smola}, 36547 title = {Advances in Kernel Methods: Support Vector Machines}, 36548 publisher = {MIT Press}, 36549 address = {Cambridge, MA }, 36550 year = {1998}, 36551 isbn = {0-262-19416-3} 36552} 36553 36554@Article{ scholtes.stohr:exact, 36555 author = {S. Scholtes and M. St{\"{o}}hr}, 36556 title = {Exact Penalization of Mathematical Programs with Equilibrium Constraints}, 36557 journal = {SIAM Journal on Control and Optimization}, 36558 volume = {37}, 36559 pages = {617--652}, 36560 year = {1999} 36561} 36562 36563@TechReport{ scholtes:introduction, 36564 author = {S. Scholtes}, 36565 title = {Introduction to piecewise differentiable equations}, 36566 institution = {Institut f{\"{u}}r Statistik und Mathematische Wirtschaftstheorie, 36567 Universit{\"{a}}t Karlsruhe}, 36568 year = {1994}, 36569 type = {Preprint}, 36570 number = {No. 53/1994}, 36571 address = {Karlsruhe, Germany} 36572} 36573 36574@Article{ schramm.zowe:version, 36575 author = {H. Schramm and J. Zowe}, 36576 title = {A Version of the Bundle Idea for Minimizing a Nonsmooth Function: Conceptual 36577 Idea, Convergence Analysis, Numerical Results}, 36578 journal = {SIAM Journal on Optimization}, 36579 year = {1992}, 36580 volume = {2}, 36581 pages = {121--152} 36582} 36583 36584@Article{ schultz.meyer:interior, 36585 author = {G. L. Schultz and R. R. Meyer}, 36586 title = {An Interior Point Method for Block Angular Optimization}, 36587 journal = {SIAM Journal on Optimization}, 36588 year = {1991}, 36589 volume = {1}, 36590 pages = {583--602} 36591} 36592 36593@InProceedings{ sekiguchi.sato.ea:ninf, 36594 author = {S. Sekiguchi and M. Sato and S. Matsuoka and U. Nagashima}, 36595 title = {Ninf: Network based Information Library for Globally High Performance Computing}, 36596 booktitle = {Proceedings of the Parallel Object-Oriented Methods and Applications ({POOMA})}, 36597 year = {1996}, 36598 address = {Santa Fe} 36599} 36600 36601@InCollection{ sellami.robinson:homotopies, 36602 author = {H. Sellami and S. M. Robinson}, 36603 title = {Homotopies Based on Nonsmooth Equations for Solving Nonlinear Variational 36604 Inequalities}, 36605 booktitle = {Nonlinear Optimization and Applications}, 36606 editor = {G. Di Pillo and F. Giannessi}, 36607 year = {1996}, 36608 pages = {327--343}, 36609 publisher = {Plenum Press}, 36610 address = {New York} 36611} 36612 36613@Article{ sellami.robinson:implementation, 36614 author = {H. Sellami and S. M. Robinson}, 36615 title = {Implementation of a Continuation Method for Normal Maps}, 36616 journal = {Mathematical Programming}, 36617 year = {1997}, 36618 volume = {76}, 36619 pages = {563--578} 36620} 36621 36622@PhDThesis{ sellami:continuation, 36623 author = {H. Sellami}, 36624 title = {A Continuation Method for Normal Maps}, 36625 school = {University of Wisconsin -- Madison}, 36626 year = {1994}, 36627 address = {Madison, Wisconsin} 36628} 36629 36630@Article{ sellami:homotopy, 36631 author = {H. Sellami}, 36632 title = {A Homotopy Continuation Method for Normal Maps}, 36633 journal = {Mathematical Programming}, 36634 vol = {82}, 36635 year = {1998}, 36636 pages = {317--337} 36637} 36638 36639@Book{ seuss:one, 36640 author = {{Dr.} A. Seuss}, 36641 title = {One Fish, Two Fish, Red Fish, Blue Fish}, 36642 year = {1960}, 36643 publisher = {Beginner Books}, 36644 address = {New York}, 36645 series = {Beginner Books, B13}, 36646 note = {A story--poem about the activities of such unusual animals as the Nook, Wump, 36647 Yink, Yop, Gack, and the Zeds} 36648} 36649 36650@Article{ seyfferth.pfeiffer:dynamics, 36651 author = {W. Seyfferth and F. Pfeiffer}, 36652 title = {Dynamics of Assembly Processes With a Manipulator}, 36653 journal = {Proceedings of the 1992 IEEE/RSJ International Conference on Intelligent Robots 36654 and Systems}, 36655 year = {1992}, 36656 pages = {1303--1310} 36657} 36658 36659@Article{ shanno.simantiraki:infeasible, 36660 author = {D. Shanno and E. Simantiraki}, 36661 title = {An Infeasible Interior--Point Method for Linear Complementarity Problems}, 36662 year = {1997}, 36663 journal = {SIAM Journal on Optimization}, 36664 volume = {7}, 36665 pages = {620--640} 36666} 36667 36668@InProceedings{ shanno.simantiraki:interior, 36669 author = {D. Shanno and E. Simantiraki}, 36670 title = {Interior Point Methods for Linear and Nonlinear Programming}, 36671 booktitle = {State of the Art in Numerical Analysis}, 36672 year = {1997}, 36673 editor = {I. S. Duff and G. A. Watson}, 36674 publisher = {Oxford University Press}, 36675 address = {Oxford} 36676} 36677 36678@Article{ shannon:introduction, 36679 author = {R. E. Shannon}, 36680 title = {Introduction to the Art and Science of simulation}, 36681 journal = {WSC98 1998 Winter simulation conference proceedings}, 36682 year = {1998}, 36683 volume = {1}, 36684 pages = {7--14} 36685} 36686 36687@TechReport{ shapiro:concepts, 36688 author = {A. Shapiro}, 36689 title = {On Concepts of Directional Differentiability}, 36690 institution = {Department of Mathematics and Applied Mathematics, University of South Africa}, 36691 year = {1988}, 36692 address = {Pretoria, South Africa}, 36693 number = {73/88(18)}, 36694 type = {Research Report} 36695} 36696 36697@Book{ shavlik.editors:readings, 36698 author = {J. W. Shavlik and T. G. Dietterich {(editors)}}, 36699 title = {Readings in Machine Learning}, 36700 year = {1990}, 36701 publisher = {Morgan Kaufman}, 36702 address = {San Mateo, California} 36703} 36704 36705@Article{ shavlik.mooney.ea:symbolic, 36706 author = {J. W. Shavlik and R. J. Mooney and G. G. Towell}, 36707 title = {Symbolic and Neural Network Learning Algorithms: An Experimental Comparison}, 36708 journal = {Machine Learning}, 36709 year = {1991}, 36710 volume = {6}, 36711 pages = {111--143} 36712} 36713 36714@Book{ sheffi:urban, 36715 author = {Y. Sheffi}, 36716 title = {Urban Transportation Networks}, 36717 publisher = {Prentice-Hall, Inc}, 36718 year = {1985}, 36719 address = {Englewood Cliffs, New Jersey} 36720} 36721 36722@Article{ sheng.potra:quadratically, 36723 author = {R. Sheng and F. A. Potra}, 36724 title = {A Quadratically {CO}nvergent Infeasible-Interior-Point {AL}gorithm for {LCP} with 36725 Polynomial {CO}mplexity}, 36726 journal = {SIAM Journal on Optimization}, 36727 year = {1997}, 36728 volume = {7}, 36729 pages = {304--317} 36730} 36731 36732@InProceedings{ shepard.angelos.ea:simple, 36733 author = {D. M. Shepard and L. Angelos and O. A. Sauer and T. R. Mackie}, 36734 title = {A Simple Model for Examining Radiotherapy Optimization}, 36735 booktitle = {Proceedings of the XII International Conference on the Use of Computers in 36736 Radiation Therapy, Salt Lake City}, 36737 year = {1997}, 36738 editor = {D. D. Leavitt and G. Starkshall}, 36739 publisher = {Medical Physics Publishing}, 36740 address = {St. Louis, Missouri} 36741} 36742 36743@Article{ shepard.ferris.ea:inverse, 36744 author = {D. M. Shepard and M. C. Ferris and R. Ove and L. Ma}, 36745 title = {Inverse Treatment Planning for Gamma Knife Radiosurgery}, 36746 journal = {Medical Physics}, 36747 volume = {27}, 36748 pages = {12}, 36749 year = {2000}, 36750 key = {93} 36751} 36752 36753@Article{ shepard.ferris.ea:optimizing, 36754 author = {D. M. Shepard and M. C. Ferris and G. Olivera and T. R. Mackie}, 36755 title = {Optimizing the Delivery of Radiation to Cancer Patients}, 36756 journal = {SIAM Review}, 36757 volume = {41}, 36758 pages = {721--744}, 36759 year = {1999}, 36760 url = {ftp://ftp.cs.wisc.edu/math-prog/tech-reports/98-07.ps}, 36761 key = {68}, 36762 institution = {Computer Sciences Department, University of Wisconsin}, 36763 address = {Madison, Wisconsin}, 36764 number = {98-07}, 36765 type = {Mathematical Programming Technical Report} 36766} 36767 36768@Article{ sherali.shetty:finitely, 36769 author = {H. D. Sherali and C. M. Shetty}, 36770 title = {A Finitely Convergent Algorithm for Bilinear Programming Problems using Polar 36771 Cuts and Disjunctive Face Cuts}, 36772 journal = {Mathematical Programming}, 36773 year = {1980}, 36774 volume = {19}, 36775 pages = {14--31} 36776} 36777 36778@Article{ sherali.soyster.ea:stackelberg-nash-cournot, 36779 author = {H. D. Sherali and A. L. Soyster and F. H. Murphy}, 36780 title = {{S}tackelberg--{N}ash--{C}ournot Equilibria: Characterization and Computation}, 36781 journal = {Operations Research}, 36782 year = {1983}, 36783 volume = {31}, 36784 pages = {253--276} 36785} 36786 36787@Article{ shi.olafsson.ea:hybrid, 36788 author = {L. Shi and S. \'{O}lafsson and Q. Chen}, 36789 title = {A New Hybrid Optimization Algorithm}, 36790 journal = {Computers and Industrial Engineering}, 36791 year = {1999}, 36792 volume = {36}, 36793 pages = {409--426} 36794} 36795 36796@PhDThesis{ shiau:iterative, 36797 author = {T.--H. Shiau}, 36798 title = {Iterative Linear Programming for Linear Complementarity and Related Problems}, 36799 school = {Computer Sciences Department, University of Wisconsin}, 36800 year = {1983}, 36801 address = {Madison, Wisconsin}, 36802 note = {Technical Report 507} 36803} 36804 36805@InProceedings{ shor:generalized, 36806 crossref = {bachem.grotschel.ea:mathematical}, 36807 author = {N. Z. Shor}, 36808 title = {Generalized Gradient Methods of Nondifferentiable Optimization Employing Space 36809 Dilation Operations}, 36810 pages = {501--529} 36811} 36812 36813@Book{ shor:minimization, 36814 author = {N. Z. Shor}, 36815 title = {Minimization Methods for Nondifferentiable Functions}, 36816 year = {1985}, 36817 publisher = {Springer-Verlag}, 36818 address = {Berlin} 36819} 36820 36821@Article{ shoven.whalley:applied, 36822 author = {J. Shoven and J. Whalley}, 36823 title = {Applied General Equilibrium Models of Taxation and International Trade: 36824 Introduction and Survey}, 36825 journal = {Journal of Economic Literature}, 36826 year = {1984}, 36827 volume = {22}, 36828 pages = {1007--1051} 36829} 36830 36831@Article{ shultz.meyer:interior, 36832 author = {G. L. Shultz and R. R. Meyer}, 36833 title = {An Interior Point Method for Block Angular Optimization}, 36834 journal = {SIAM Journal on Optimization}, 36835 year = {1991}, 36836 volume = {1}, 36837 pages = {583--602} 36838} 36839 36840@Article{ shultz.schnabel.ea:family, 36841 author = {G. A. Shultz and R. B. Schnabel and R. H. Byrd}, 36842 title = {A Family of Trust--Region--Based Algorithms for Unconstrained Minimization}, 36843 journal = {SIAM Journal on Numerical Analysis}, 36844 year = {1985}, 36845 volume = {22}, 36846 pages = {44--67} 36847} 36848 36849@Article{ sibony:methodes, 36850 author = {M. Sibony}, 36851 title = {Methodes iteratives pur les equations et inequations aux derives partielles 36852 nonlineaires de type monotone}, 36853 journal = {Calcolo}, 36854 year = {1970}, 36855 volume = {7}, 36856 pages = {65--183} 36857} 36858 36859@Article{ sidney:optimal, 36860 author = {J. B. Sidney}, 36861 title = {Optimal Single--Machine Scheduling with Earliness and Tardiness Penalties}, 36862 journal = {Operations Research}, 36863 year = {1977}, 36864 volume = {25}, 36865 pages = {62--69} 36866} 36867 36868@Book{ siegel:corba, 36869 author = {J. Siegel}, 36870 title = {{CORBA} - Fundamentals and Programming}, 36871 publisher = {John Wiley \& Sons}, 36872 year = {1996}, 36873 address = {New York, New York} 36874} 36875 36876@TechReport{ simantiraki.shanno:infeasible-interior-point, 36877 author = {E. Simantiraki and D. F. Shanno}, 36878 title = {An infeasible-interior-point algorithm for linear complementarity problems}, 36879 type = {Research Report}, 36880 number = {7-95}, 36881 institution = {Rutgers Center for Operations Research, Rutgers University}, 36882 address = {New Brunswick, New Jersey}, 36883 year = {1995} 36884} 36885 36886@InProceedings{ simantiraki.shanno:infeasible-interior-point*1, 36887 author = {E. Simantiraki and D. F. Shanno}, 36888 title = {An Infeasible-Interior-Point Algorithm for Solving Mixed Complementarity 36889 Problems}, 36890 crossref = {ferris.pang:complementarity}, 36891 pages = {386--404} 36892} 36893 36894@Book{ simpson:artificial, 36895 author = {P. K. Simpson}, 36896 title = {Artificial Neural Systems}, 36897 year = {1990}, 36898 publisher = {Pergamon Press}, 36899 address = {New York} 36900} 36901 36902@Article{ smeers:computable, 36903 author = {Y. Smeers}, 36904 title = {Computable Equilibrium Models and the Restructuring of the {E}uropean Electricity 36905 and Gas Markets}, 36906 journal = {The Energy Journal}, 36907 year = {1997}, 36908 optkey = {}, 36909 optvolume = {18}, 36910 optnumber = {}, 36911 optmonth = {}, 36912 optpages = {1--32}, 36913 optnote = {}, 36914 optannote = {} 36915} 36916 36917@Article{ smith:design, 36918 author = {F. W. Smith}, 36919 title = {Design of Multicategory Pattern Classifiers with Two-Category Classifier Design 36920 Procedures}, 36921 journal = {IEEE Transactions on Computers}, 36922 year = {1969}, 36923 volume = {18}, 36924 pages = {367--372} 36925} 36926 36927@Article{ smith:existence, 36928 author = {M. J. Smith}, 36929 title = {The Existence, Uniqueness and Stability of Traffic Equilibria}, 36930 journal = {Transportation Research}, 36931 year = {1979}, 36932 volume = {13B}, 36933 pages = {295--304} 36934} 36935 36936@Article{ smith:existence*1, 36937 author = {M. J. Smith}, 36938 title = {The existence and calculation of traffic equilibria}, 36939 journal = {Transportation Research}, 36940 volume = {17B}, 36941 year = {1983}, 36942 pages = {291--303} 36943} 36944 36945@Article{ smith:pattern, 36946 author = {F. W. Smith}, 36947 title = {Pattern Classifier Design by Linear Programming}, 36948 journal = {IEEE Transactions on Computers}, 36949 year = {1968}, 36950 volume = {C-17}, 36951 pages = {367--372} 36952} 36953 36954@Article{ solodov.svaiter:projection, 36955 author = {M. V. Solodov and B. F. Svaiter}, 36956 title = {A New Projection Method for Variational Inequality Problems}, 36957 journal = {SIAM Journal on Control and Optimization}, 36958 volume = {37}, 36959 pages = {765--776}, 36960 year = {1999} 36961} 36962 36963@Article{ solodov.tseng:modified, 36964 author = {M. V. Solodov and P. Tseng}, 36965 title = {Modified Projection--Type Methods for Monotone Variational Inequalities}, 36966 year = {1996}, 36967 journal = {SIAM Journal on Control and Optimization}, 36968 pages = {1814--1830}, 36969 volume = {34} 36970} 36971 36972@Article{ solodov:stationary, 36973 author = {M. V. Solodov}, 36974 title = {Stationary Points of Bound Constrained Minimization Reformulations of 36975 Complementarity Problems}, 36976 journal = {Journal of Optimization Theory and Applications, forthcoming}, 36977 year = {1997} 36978} 36979 36980@Article{ spendley.hext.ea:sequential, 36981 author = {W. Spendley and G. R. Hext and F. R. Himsworth}, 36982 title = {Sequential Application of Simplex Designs in Optimization and Evolutionary 36983 Operation}, 36984 journal = {Technometrics}, 36985 year = {1962}, 36986 pages = {441--461}, 36987 volume = {4} 36988} 36989 36990@Article{ spingarn:applications, 36991 author = {J. E. Spingarn}, 36992 title = {Applications of the Method of Partial Inverses to Convex Programming}, 36993 journal = {Mathematical Programming}, 36994 year = {1985}, 36995 volume = {32}, 36996 pages = {199--223} 36997} 36998 36999@Book{ srinivasan.whalley:general, 37000 author = {T. Srinivasan and J. Whalley}, 37001 title = {General Equilibrium Trade Policy Modelling}, 37002 publisher = {MIT Press}, 37003 year = {1986}, 37004 address = {Boston} 37005} 37006 37007@Book{ stackelberg:theory, 37008 author = {H. Van Stackelberg}, 37009 title = {The Theory of Market Economy}, 37010 publisher = {Oxford University Press}, 37011 year = {1952} 37012} 37013 37014@Article{ stavroulakis.panagiotopoulos.ea:rigid, 37015 author = {G. E. Stavroulakis and P. D. Panagiotopoulos and A. M. Al-Fahed}, 37016 title = {On the Rigid Body Displacements and Rotations in Unilateral Contact Problems and 37017 Applications}, 37018 journal = {Computers \& Structures}, 37019 volume = {40}, 37020 year = {1991}, 37021 pages = {599--614} 37022} 37023 37024@Article{ stavroulakis:optimal, 37025 author = {G. E. Stavroulakis}, 37026 title = {Optimal prestress of cracked unilateral structures: finite element analysis of an 37027 optimal control problem for variational inequalities}, 37028 journal = {Computer Methods in Applied Mechanics and Engineering, forthcoming}, 37029 year = {1996} 37030} 37031 37032@Article{ stavroulakis:optimal*1, 37033 author = {G. E. Stavroulakis}, 37034 title = {Optimal prestress of structures with frictional unilateral contact interfaces}, 37035 journal = {Archives of Applied Mechanics, forthcoming}, 37036 year = {1996} 37037} 37038 37039@Book{ steenbrink:optimization, 37040 author = {P. A. Steenbrink}, 37041 title = {Optimization of Transport Networks}, 37042 publisher = {John Wiley \& Sons}, 37043 address = {London, England}, 37044 year = {1974} 37045} 37046 37047@Article{ stephens:asymptotic, 37048 author = {M. A. Stephens}, 37049 title = {Asymptotic Results for Goodness-of-Fit Statistics with Unknown Parameters}, 37050 journal = {Annals of Statistics}, 37051 year = {1976}, 37052 volume = {4}, 37053 pages = {357--369} 37054} 37055 37056@Article{ stephens:edf, 37057 author = {M. A. Stephens}, 37058 title = {{EDF} Statistics for Goodness of Fit and Some Comparisons}, 37059 journal = {Journal of the American Statistical Association}, 37060 year = {1974}, 37061 volume = {69}, 37062 pages = {730--737} 37063} 37064 37065@Article{ stevens:location, 37066 author = {B. H. Stevens}, 37067 title = {Location Theory and Programming Models: The Von Th{\"{u}}nen case}, 37068 journal = {Papers of the Regional Science Association}, 37069 year = {1968}, 37070 volume = {21}, 37071 pages = {19--34} 37072} 37073 37074@Article{ stewart.trinkle:implicit, 37075 author = {D. E. Stewart and J. C. Trinkle}, 37076 title = {An Implicit Time-Stepping Scheme for Rigid Body Dynamics with Inelastic 37077 Collisions and {C}oulomb Friction}, 37078 journal = {International Journal for Numerical Methods in Engineering}, 37079 year = {1996}, 37080 volume = {39}, 37081 pages = {2673--2691} 37082} 37083 37084@Book{ stoer.bulirsch:introduction, 37085 author = {J. Stoer and R. Bulirsch}, 37086 title = {Introduction to Numerical Analysis}, 37087 year = {1980}, 37088 publisher = {Springer-Verlag}, 37089 address = {New York} 37090} 37091 37092@Article{ stoer:complexity, 37093 author = {J. Stoer}, 37094 title = {The complexity of an infeasible interior--point path--following method for the 37095 solution of linear programs}, 37096 journal = {Optimization Methods and Software}, 37097 year = {1994}, 37098 volume = {3}, 37099 pages = {1--12} 37100} 37101 37102@Article{ stone:cross-validatory, 37103 author = {M. Stone}, 37104 title = {Cross-validatory choice and assessment of statistical predictions}, 37105 journal = {Journal of the Royal Statistical Society}, 37106 year = {1974}, 37107 volume = {36}, 37108 pages = {111--147} 37109} 37110 37111@Article{ stone.smith.ea:inverse, 37112 author = {R. A. Stone and V. Smith and L. Verhey}, 37113 title = {Inverse Planning for the {G}amma {K}nife}, 37114 journal = {Medical Physics}, 37115 year = {1993}, 37116 volume = {20}, 37117 pages = {865} 37118} 37119 37120@Book{ strang:linear, 37121 author = {G. Strang}, 37122 title = {Linear Algebra and its Applications}, 37123 year = {1980}, 37124 publisher = {Academic Press}, 37125 address = {New York}, 37126 edition = {Second} 37127} 37128 37129@InProceedings{ street.wolberg.ea:nuclear, 37130 author = {W. N. Street and W. H. Wolberg and O. L. Mangasarian}, 37131 title = {Nuclear Feature Extraction for Breast Tumor Diagnosis}, 37132 booktitle = {Biomedical Image Processing and Biomedical Visualization}, 37133 year = {1993}, 37134 publisher = {SPIE--The International Society for Optical Engineering}, 37135 address = {San Jose, California}, 37136 pages = {861--870}, 37137 volume = {1905} 37138} 37139 37140@Article{ subramanian:gauss-newton, 37141 author = {P. K. Subramanian}, 37142 title = {Gauss--{N}ewton Methods for the Complementarity Problem}, 37143 journal = {Journal of Optimization Theory and Applications}, 37144 year = {1993}, 37145 volume = {77}, 37146 pages = {467--482} 37147} 37148 37149@PhDThesis{ subramanian:iterative, 37150 author = {P. K. Subramanian}, 37151 title = {Iterative Methods of Solution for Complementarity Problems}, 37152 year = {1985}, 37153 address = {Madison, Wisconsin}, 37154 school = {Computer Sciences Department, University of Wisconsin} 37155} 37156 37157@TechReport{ subramanian:note, 37158 author = {P. K. Subramanian}, 37159 title = {A Note on Least Two Norm Solutions of Monotone Complementarity Problems}, 37160 institution = {Mathematics Research Center, University of Wisconsin--Madison}, 37161 year = {1985}, 37162 address = {Madison, Wisconsin}, 37163 number = {2844}, 37164 type = {Technical Summary Report} 37165} 37166 37167@TechReport{ suh.gucht:distributed, 37168 author = {J. Y. Suh and D. Van Gucht}, 37169 title = {Distributed Genetic Algorithms}, 37170 institution = {Computer Science Department, Indiana University}, 37171 year = {1987}, 37172 address = {Bloomington}, 37173 number = {225} 37174} 37175 37176@Article{ sun.natori.ea:computational, 37177 author = {S. M. Sun and M. C. Natori and K. C. Park}, 37178 title = {A Computational Procedure for Flexible Beams with Frictional Contact 37179 Constraints}, 37180 journal = {International Journal for Numerical Methods in Engineering}, 37181 volume = {36}, 37182 pages = {3781--3800}, 37183 year = {1993} 37184} 37185 37186@Article{ sun.qi:ncp-functions, 37187 author = {D. Sun and L. Qi}, 37188 title = {On {NCP}-Functions}, 37189 journal = {Computational Optimization and Applications, forthcoming}, 37190 year = {1998} 37191} 37192 37193@Article{ sun.womersley:unconstrained, 37194 author = {D. Sun and R. S. Womersley}, 37195 title = {A new unconstrained differentiable merit function for box constrained variational 37196 inequality problems and a damped {G}auss-{N}ewton method}, 37197 journal = {SIAM Journal on Optimization}, 37198 year = {1999}, 37199 volume = {9}, 37200 pages = {388--413} 37201} 37202 37203@Article{ sun:class, 37204 author = {D. Sun}, 37205 title = {A Class of Iterative Methods for Nonlinear Projection Equations}, 37206 journal = {Journal of Optimization Theory and Applications}, 37207 year = {1996}, 37208 volume = {91}, 37209 pages = {123--140} 37210} 37211 37212@PhDThesis{ sun:monotropic, 37213 author = {J. Sun}, 37214 title = {On Monotropic Piecewise Quadratic Programming}, 37215 school = {University of Washington}, 37216 year = {1986}, 37217 address = {Seattle, Washington} 37218} 37219 37220@Article{ sun:thermal, 37221 author = {D. C. Sun}, 37222 title = {A Thermal Elastic Theory of Piston-Ring and Cylinder-Bore Contact}, 37223 journal = {Journal of Applied Mechanics}, 37224 volume = {58}, 37225 pages = {141--153}, 37226 year = {1991} 37227} 37228 37229@Article{ sundararaghavan.ahmed:minimizing, 37230 author = {P. S. Sundararaghavan and M. U. Ahmed}, 37231 title = {Minimizing the Sum of Absolute Lateness in Single--Machine and Multimachine 37232 Scheduling}, 37233 journal = {Naval Research Logistics Quarterly}, 37234 year = {1984}, 37235 volume = {31}, 37236 pages = {325--333} 37237} 37238 37239@TechReport{ sznajder.gowda:generalizations, 37240 author = {R. Sznajder and M. S. Gowda}, 37241 title = {Generalizations of ${P}_0$-- and ${P}$-- properties; extended vertical and 37242 horizontal {LCP}s}, 37243 institution = {Department of Mathematics, University of Maryland--Baltimore County}, 37244 year = {1992}, 37245 address = {Catonsville, Maryland}, 37246 number = {92--16}, 37247 type = {Research Report} 37248} 37249 37250@Article{ sznajder.gowda:nondegeneracy, 37251 author = {R. Sznajder and M. S. Gowda}, 37252 title = {Nondegeneracy Concepts for Zeros of Piecewise Smooth Functions}, 37253 journal = {Mathematics of Operations Research}, 37254 year = {1998}, 37255 volume = {23}, 37256 pages = {221--238} 37257} 37258 37259@Article{ taji.fukushima.ea:globally, 37260 author = {K. Taji and M. Fukushima and T. Ibaraki}, 37261 title = {A Globally Convergent {N}ewton Method for Solving Strongly Monotone Variational 37262 Inequalities}, 37263 journal = {Mathematical Programming}, 37264 year = {1993}, 37265 volume = {58}, 37266 pages = {369--383} 37267} 37268 37269@Article{ taji.fukushima:optimization, 37270 author = {K. Taji and M. Fukushima}, 37271 title = {Optimization Based Globally Convergent Methods for the Nonlinear Complementarity 37272 Problem}, 37273 journal = {Journal of the Operations Research Society of Japan}, 37274 year = {1994}, 37275 volume = {37}, 37276 pages = {310--331} 37277} 37278 37279@Article{ talbot.patterson.ea:comparative, 37280 author = {F. B. Talbot and J. H. Patterson and W. V. Gehrlein}, 37281 title = {A Comparative Evaluation of Heuristic Line Balancing Techniques}, 37282 journal = {Management Science}, 37283 year = {1986}, 37284 volume = {32}, 37285 pages = {430--454} 37286} 37287 37288@Article{ talman.yamamoto:simplicial, 37289 author = {A. J. J. Talman and Y. Yamamoto}, 37290 title = {A {S}implicial Algorithm for Stationary Point Problems}, 37291 journal = {Mathematics of Operations Research}, 37292 year = {1989}, 37293 volume = {14}, 37294 pages = {383--399} 37295} 37296 37297@InProceedings{ tanese:distributed, 37298 crossref = {schaeffer:third}, 37299 author = {R. Tanese}, 37300 title = {Distributed Genetic Algorithms}, 37301 pages = {434--439} 37302} 37303 37304@InProceedings{ tanese:parallel, 37305 crossref = {grefenstette:genetic}, 37306 author = {R. Tanese}, 37307 title = {Parallel Genetic Algorithms for a Hypercube}, 37308 pages = {177--183} 37309} 37310 37311@Article{ teboulle:entropic, 37312 author = {M. Teboulle}, 37313 title = {Entropic Proximal Mappings with Applications to Nonlinear Programming}, 37314 year = {1992}, 37315 journal = {Mathematics of Operations Research}, 37316 volume = {17}, 37317 pages = {670--690} 37318} 37319 37320@Article{ thuente:duality, 37321 author = {D. J. Thuente}, 37322 title = {Duality Theory for Generalized Linear Programs with Computational Methods}, 37323 journal = {Operations Research}, 37324 year = {1980}, 37325 volume = {28}, 37326 pages = {1005--1011} 37327} 37328 37329@Book{ tikhonov.arsenin:solutions, 37330 author = {A. N. Tikhonov and V. Y. Arsenin}, 37331 title = {Solutions of Ill--Posed Problems}, 37332 year = {1977}, 37333 publisher = {John Wiley \& Sons}, 37334 address = {New York} 37335} 37336 37337@InProceedings{ tin-loi.ferris:complementarity, 37338 author = {F. Tin-Loi and M. C. Ferris}, 37339 title = {Complementarity Problems in Engineering and Mechanics: Models and Solution}, 37340 booktitle = {Computational Mechanics for the Next Millenium}, 37341 key = {79}, 37342 pages = {1029--1036}, 37343 year = {1999}, 37344 editor = {C. M. Wang and K. H. Lee and K. K. Ang}, 37345 volume = {2}, 37346 series = {Proceedings of APCOM '99, Fourth Asia-Pacific Conference on Computational 37347 Mechanics}, 37348 url = {ftp: //ftp.cs.wisc.edu/math-prog/tech-reports/99-02.ps}, 37349 publisher = {Elsevier Science Ltd}, 37350 type = {Mathematical Programming Technical Report}, 37351 institution = {Computer Sciences Department, University of Wisconsin}, 37352 address = {Madison, Wisconsin}, 37353 number = {99-02} 37354} 37355 37356@InProceedings{ tin-loi.ferris:holonomic, 37357 author = {F. Tin-Loi and M. C. Ferris}, 37358 title = {Holonomic Analysis of Quasibrittle Fracture with Nonlinear Softening}, 37359 booktitle = {Advances in Fracture Research}, 37360 year = {1997}, 37361 editor = {B. L. Karihaloo and Y. W. Mai and M. I. Ripley and R. O. Ritchie}, 37362 volume = {2}, 37363 publisher = {Pergamon Press}, 37364 pages = {2183--2190}, 37365 key = {53} 37366} 37367 37368@InProceedings{ tin-loi.ferris:simple, 37369 author = {F. Tin-Loi and M. C. Ferris}, 37370 title = {A Simple Mathematical Programming Method for a Structural Identification 37371 Problem}, 37372 booktitle = {Seventh International Conference on Computing in Civil and Building Engineering 37373 (ICCCBE-VII), Seoul, Korea, 19-21 August}, 37374 editors = {C. K. Choi and C. B. Yun and H. G. Kwak}, 37375 publisher = {Techno-Press}, 37376 address = {Korea}, 37377 year = {1997}, 37378 pages = {511--518}, 37379 key = {59} 37380} 37381 37382@Article{ tin-loi.misa:large, 37383 author = {F. Tin-Loi and J. S. Misa}, 37384 title = {Large displacement elastoplastic analysis of semirigid steel frames}, 37385 journal = {International Journal for Numerical Methods in Engineering}, 37386 volume = {39}, 37387 pages = {741--762}, 37388 year = {1996} 37389} 37390 37391@Article{ tin-loi.pang:elastoplastic, 37392 author = {F. Tin-Loi and J. S. Pang}, 37393 title = {Elastoplastic analysis of structures with nonlinear hardening}, 37394 journal = {Computer Methods in Applied Mechanics and Engineering}, 37395 volume = {107}, 37396 year = {1993}, 37397 pages = {299--312} 37398} 37399 37400@Article{ tin-loi.vimonsatit:nonlinear, 37401 author = {F. Tin-Loi and V. Vimonsatit}, 37402 title = {Nonlinear Analysis of Semi-Rigid Frames: a Parametric Complementarity Approach}, 37403 journal = {Engineering Structures}, 37404 volume = {18}, 37405 year = {1996}, 37406 pages = {115--124} 37407} 37408 37409@Article{ tobin:uniqueness, 37410 author = {R. L. Tobin}, 37411 title = {Uniqueness results and algorithm for Stackelberg-Cournot-Nash equilibria}, 37412 journal = {Annals of Operations Research}, 37413 volume = {34}, 37414 year = {1992}, 37415 pages = {21--36} 37416} 37417 37418@Article{ tobin:variable, 37419 author = {R. L. Tobin}, 37420 title = {A Variable Dimension Solution Approach for the General Spatial Equilibrium 37421 Problem}, 37422 journal = {Mathematical Programming}, 37423 year = {1988}, 37424 volume = {40}, 37425 pages = {33--51} 37426} 37427 37428@Article{ todd.burrell:extension, 37429 author = {M. J. Todd and B. P. Burrell}, 37430 title = {An Extension of {K}armarkar's Algorithm for Linear Programming Using Dual 37431 Variables}, 37432 journal = {Algorithmica}, 37433 year = {1986}, 37434 volume = {1}, 37435 pages = {409--424} 37436} 37437 37438@Book{ todd:computation, 37439 author = {M. J. Todd}, 37440 title = {Computation of Fixed Points and Applications}, 37441 publisher = {Springer-Verlag}, 37442 year = {1976}, 37443 volume = {124}, 37444 series = {Lecture Notes in Economics and Mathematical Systems}, 37445 address = {Heidelberg} 37446} 37447 37448@Article{ todd:note, 37449 author = {M. J. Todd}, 37450 title = {A Note on Computing Equilibria in Economies with Activity Analysis Models of 37451 Production}, 37452 journal = {Journal of Mathematical Economics}, 37453 year = {1976}, 37454 volume = {6}, 37455 pages = {135--144} 37456} 37457 37458@Article{ toint:assesment, 37459 author = {Ph. L. Toint}, 37460 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37461 Optimization}, 37462 year = {1996}, 37463 journal = {SIAM Journal on Scientific Computing}, 37464 volume = {17}, 37465 pages = {725=-739} 37466} 37467 37468@TechReport{ toint:assesment*1, 37469 author = {Ph. L. Toint}, 37470 title = {An Assesment of Non--Monotone Linesearch Techniques for Unconstrained 37471 Optimization: The Complete Numerical Results}, 37472 institution = {Department of Mathematics, FUNDP}, 37473 year = {1994}, 37474 number = {94/15}, 37475 address = {Namur, Belgium} 37476} 37477 37478@Article{ toint:global, 37479 author = {Ph. L. Toint}, 37480 title = {Global Convergence of a Class of Trust Region Methods for Nonconvex Minimization 37481 in a {H}ilbert Space}, 37482 journal = {IMA Journal of Numerical Analysis}, 37483 year = {1988}, 37484 volume = {8}, 37485 pages = {231--252} 37486} 37487 37488@Article{ toint:non-monotone, 37489 author = {Ph. L. Toint}, 37490 title = {A Non--Monotone Trust--Region Algorithm for Nonlinear Optimization subject to 37491 Convex Constraints}, 37492 year = {1997}, 37493 journal = {Mathematical Programming}, 37494 volume = {77}, 37495 pages = {69--94} 37496} 37497 37498@InCollection{ toint:transportation, 37499 author = {Ph. L. Toint}, 37500 title = {Transportation Modelling and Operations Research: {A} Fruitful Connection}, 37501 booktitle = {Operations Research and Decision Aid Methodologies in Traffic and Transportation 37502 Management}, 37503 publisher = {Springer-Verlag}, 37504 series = {NATO ASI Series F}, 37505 year = {1997}, 37506 editor = {Ph. L. Toint and M. Labbe and K. Tanczos and G. Laporte} 37507} 37508 37509@Article{ tomlin.welch:finding, 37510 author = {J. Tomlin and J. Welch}, 37511 title = {Finding Duplicate Rows in a Linear Programming Model}, 37512 journal = {Operations Research Letters}, 37513 year = {1986}, 37514 volume = {5}, 37515 number = {1}, 37516 pages = {7--11} 37517} 37518 37519@Article{ torczon:convergence, 37520 author = {V. Torczon}, 37521 title = {On the Convergence of the Multidirectional Search Algorithm}, 37522 journal = {SIAM Journal on Optimization}, 37523 year = {1991}, 37524 volume = {1}, 37525 pages = {123--145} 37526} 37527 37528@Article{ torczon:convergence*1, 37529 author = {V. Torczon}, 37530 title = {On the Convergence of Pattern Search Algorithms}, 37531 journal = {SIAM Journal on Optimization}, 37532 year = {1997}, 37533 volume = {7}, 37534 pages = {1--25} 37535} 37536 37537@Misc{ torma.rutherford:general, 37538 author = {H. Torma and T. Rutherford}, 37539 title = {A General Equilibrium Assessment of {F}inland's Grand Tax Reform}, 37540 year = {1992}, 37541 howpublished = {Working Paper 15/1992}, 37542 note = {Department of Economics and Management, University of Jyvaskyla, Finland} 37543} 37544 37545@Article{ trinkle.pang.ea:dynamic, 37546 author = {J. C. Trinkle and J. S. Pang and S. Sudarsky and G. Lo}, 37547 title = {On Dynamic Multi-Rigid-Body Contact Problems}, 37548 journal = {Zeitschrift f{\"{u}}r Angewandte Mathematik und Mechanik}, 37549 year = {1997}, 37550 pages = {267--279}, 37551 volume = {77} 37552} 37553 37554@InProceedings{ trinkle.pang:dynamic, 37555 author = {J. C. Trinkle and J. S. Pang}, 37556 title = {Dynamic multi-rigid-body systems with concurrent distributed contacts friction}, 37557 book = {{IEEE} International Conference on Robotics and Automation}, 37558 pages = {2276--2281}, 37559 year = {1997} 37560} 37561 37562@TechReport{ tseng.bertsekas:convergence, 37563 author = {P. Tseng and D. P. Bertsekas}, 37564 title = {On the Convergence of the Exponential Multiplier Method for Convex Programming}, 37565 institution = {Laboratory for Information and Decision Systems, Massachusetts Institute of 37566 Technology}, 37567 year = {1990}, 37568 type = {technical report}, 37569 number = {LIDS-P-1995}, 37570 address = {Cambridge, MA} 37571} 37572 37573@Article{ tseng.yamashita.ea:equivalence, 37574 author = {P. Tseng and N. Yamashita and M. Fukushima}, 37575 title = {Equivalence of Complementarity Problems to Differentiable Minimization: a Unified 37576 Approach}, 37577 year = {1996}, 37578 journal = {SIAM Journal on Optimization}, 37579 volume = {6}, 37580 pages = {446--460} 37581} 37582 37583@Article{ tseng:applications, 37584 author = {P. Tseng}, 37585 title = {Applications of a splitting algorithm to decomposition in convex programming and 37586 variational inequalities}, 37587 journal = {SIAM Journal on Control and Optimization}, 37588 year = {1991}, 37589 volume = {29}, 37590 pages = {119--138} 37591} 37592 37593@Article{ tseng:dual, 37594 author = {P. Tseng}, 37595 title = {Dual Ascent Methods for Problems with Strictly Convex Costs and Linear 37596 Constraints: a Unified Approach}, 37597 journal = {SIAM Journal on Control and Optimization}, 37598 year = {1990}, 37599 volume = {28}, 37600 pages = {214--242} 37601} 37602 37603@Article{ tseng:dual*1, 37604 author = {P. Tseng}, 37605 title = {Dual Ascent Methods with Strictly Convex Costs and Linear Constraints: {A} 37606 Unified Approach}, 37607 journal = {SIAM Journal on Control and Optimization}, 37608 year = {1990}, 37609 volume = {28}, 37610 pages = {214--242} 37611} 37612 37613@Article{ tseng:dual*2, 37614 author = {P. Tseng}, 37615 title = {Dual Coordinate Ascent Methods for Non--Strictly Convex Minimization}, 37616 journal = {Mathematical Programming}, 37617 year = {1993}, 37618 volume = {59}, 37619 pages = {231--248} 37620} 37621 37622@Article{ tseng:fortified-descent, 37623 author = {P. Tseng}, 37624 title = {Fortified-Descent Simplicial Search Method: a General Approach}, 37625 journal = {SIAM Journal on Optimization}, 37626 volume = {10}, 37627 pages = {269--288}, 37628 year = {2000} 37629} 37630 37631@Article{ tseng:growth, 37632 author = {P. Tseng}, 37633 title = {Growth Behavior of a Class of Merit Functions for the Nonlinear Complementarity 37634 Problem}, 37635 journal = {Journal of Optimization Theory and Applications}, 37636 volume = {89}, 37637 year = {1996}, 37638 pages = {17--37} 37639} 37640 37641@Unpublished{ tseng:matlab, 37642 author = {P. Tseng}, 37643 title = {Matlab Implementations of Complementarity Codes}, 37644 year = {1995}, 37645 note = {Private Communication} 37646} 37647 37648@Article{ ursescu:multifunctions, 37649 author = {C. Ursescu}, 37650 title = {Multifunctions with closed convex graph}, 37651 journal = {Czech. Math. J.}, 37652 year = {1975}, 37653 volume = {35}, 37654 pages = {438--441} 37655} 37656 37657@TechReport{ vaidya:algorithm, 37658 author = {P. M. Vaidya}, 37659 title = {An Algorithm for Linear Programming which Requires 37660 {O}($((m+n)n^2+(m+n)^{1.5})${L}) arithmetic operations}, 37661 institution = {AT\&T Bell Laboratories}, 37662 year = {1987}, 37663 address = {Murray Hill, New Jersey} 37664} 37665 37666@Article{ val:unloading, 37667 author = {P. Du Val}, 37668 title = {The Unloading Problem for Plane Curves}, 37669 journal = {American Journal of Mathematics}, 37670 year = {1940}, 37671 volume = {62}, 37672 pages = {307--311} 37673} 37674 37675@InCollection{ valentine:problem, 37676 author = {F. A. Valentine}, 37677 title = {The Problem of {L}agrange with Differential Inequalities as Added Side 37678 Conditions}, 37679 booktitle = {Contributions to the Calculus of Variations, 1933--1937}, 37680 year = {1937}, 37681 publisher = {University of Chicago Press}, 37682 address = {Chicago}, 37683 pages = {407--448} 37684} 37685 37686@Article{ valle.poch.ea:comparison, 37687 author = {M. del Valle and M. Poch and J. Alonso and J. Bartroli}, 37688 title = {Comparison of the {P}owell and Simplex Methods in the Optimization of 37689 Flow-Injection Systems}, 37690 journal = {Analytica Chimica Acta}, 37691 year = {1990}, 37692 volume = {241}, 37693 pages = {31--42} 37694} 37695 37696@Article{ vandenberghe.demoor.ea:generalized, 37697 author = {L. Vandenberghe and B. L. {De~Moor} and J. Vandewalle}, 37698 title = {The generalized linear complementarity problem applied to the complete analysis 37699 of resistive piecewise-linear circuits}, 37700 journal = {IEEE Transactions on Circuits and Systems}, 37701 volume = {36}, 37702 year = {1989}, 37703 pages = {1382--1391} 37704} 37705 37706@Article{ vanderbei.meketon.ea:modification, 37707 author = {R. J. Vanderbei and M. S. Meketon and B. A. Freedman}, 37708 title = {A Modification of {K}armarkar's Algorithm}, 37709 journal = {Algorithmica}, 37710 year = {1986}, 37711 volume = {1}, 37712 pages = {395--407} 37713} 37714 37715@Article{ vanderbei:affine-scaling, 37716 author = {R. J. Vanderbei}, 37717 title = {Affine--Scaling for Linear Programs with Free Variables}, 37718 journal = {Mathematical Programming}, 37719 year = {1989}, 37720 volume = {43}, 37721 pages = {31--44} 37722} 37723 37724@Article{ vanroy.wolsey:solving, 37725 author = {T. J. Van~Roy and L. A. Wolsey}, 37726 title = {Solving Mixed Integer 0-1 Programs by Automatic Reformulation}, 37727 journal = {Operations Research}, 37728 volume = {35}, 37729 pages = {45--57}, 37730 year = {1987} 37731} 37732 37733@Book{ vapnik:nature, 37734 author = {V. N. Vapnik}, 37735 title = {The Nature of Statistical Learning Theory}, 37736 publisher = {John Wiley \& Sons}, 37737 address = {New York}, 37738 year = {1996} 37739} 37740 37741@Book{ varian:microeconomic, 37742 author = {Hal R. Varian}, 37743 title = {Microeconomic Analysis}, 37744 year = {1978}, 37745 publisher = {W.W. Norton \& Company}, 37746 address = {New York, New York} 37747} 37748 37749@Article{ verhey:immobilizing, 37750 author = {L. J. Verhey}, 37751 title = {Immobilizing and Positioning Patients for Radiotherapy}, 37752 journal = {Seminars in Radiation Oncology}, 37753 year = {1995}, 37754 volume = {5}, 37755 number = {2}, 37756 pages = {100--113} 37757} 37758 37759@Article{ vinante.pintos:differentiable, 37760 author = {C. Vinante and S. Pintos}, 37761 title = {On Differentiable Exact Penalty Functions}, 37762 journal = {Journal of Optimization Theory and Applications}, 37763 year = {1986}, 37764 volume = {50}, 37765 pages = {479--493} 37766} 37767 37768@Article{ vlach:scheduling, 37769 author = {M. Vlach}, 37770 title = {On Scheduling with Earliness and Tardiness Penalties}, 37771 journal = {Methods of Operations Research}, 37772 year = {1983}, 37773 volume = {45}, 37774 pages = {367--375} 37775} 37776 37777@InCollection{ wacker:summary, 37778 author = {H.--J. Wacker}, 37779 title = {A Summary of the Developments on Imbedding Methods}, 37780 booktitle = {Continuation Methods}, 37781 year = {1978}, 37782 editor = {H.--J. Wacker}, 37783 publisher = {Academic Press}, 37784 address = {New York}, 37785 pages = {1--35} 37786} 37787 37788@Article{ wakefield.tin-loi:large, 37789 author = {R. R. Wakefield and F. Tin-Loi}, 37790 title = {Large Scale Nonholonomic Elastoplastic Analysis using a Linear Complementarity 37791 Formulation}, 37792 journal = {Computer Methods in Applied Mechanics and Engineering}, 37793 volume = {84}, 37794 year = {1990}, 37795 pages = {229--242} 37796} 37797 37798@Article{ wakefield.tin-loi:large*1, 37799 author = {R. R. Wakefield and F. Tin-Loi}, 37800 title = {Large Displacement Elastoplastic Analysis of Frames using an Iterative {LCP} 37801 Approach}, 37802 journal = {International Journal Mechanical Science}, 37803 volume = {33}, 37804 year = {1991}, 37805 pages = {379--391} 37806} 37807 37808@Article{ walker:implementation, 37809 author = {H. F. Walker}, 37810 title = {Implementation of the {GMRES} method using {H}ouseholder transformations}, 37811 journal = {SIAM Journal on Scientific Computing}, 37812 volume = {9}, 37813 year = {1988}, 37814 pages = {152--163} 37815} 37816 37817@Book{ wall.schwartz:programming, 37818 author = {L. Wall and R. L. Schwartz}, 37819 title = {Programming Perl}, 37820 publisher = {O'Reilly and Associates, Inc.}, 37821 address = {Sebastopol, CA}, 37822 year = {1991} 37823} 37824 37825@Book{ walras:elements, 37826 author = {L. Walras}, 37827 title = {Elements of Pure Economics}, 37828 publisher = {Allen and Unwin}, 37829 year = {1954}, 37830 address = {London} 37831} 37832 37833@Article{ wang.monteiro.ea:interior, 37834 author = {T. Wang and R. D. C. Monteiro and J. S. Pang}, 37835 title = {An Interior Point Potential Reduction Method for Constrained Equations}, 37836 journal = {Mathematical Programming}, 37837 volume = {74}, 37838 pages = {159--196}, 37839 year = {1996} 37840} 37841 37842@Article{ wardi:stochastic, 37843 author = {Y. Wardi}, 37844 title = {A Stochastic Steepest-Descent Algorithm}, 37845 journal = {Journal of Optimization Theory and Applications}, 37846 year = {1988}, 37847 volume = {59}, 37848 pages = {307--323} 37849} 37850 37851@Article{ wardi:stochastic*1, 37852 author = {Y. Wardi}, 37853 title = {Stochastic Algorithms for with {A}rmijo Stepsizes for Minimization of Functions}, 37854 journal = {Journal of Optimization Theory and Applications}, 37855 year = {1990}, 37856 volume = {64}, 37857 pages = {399--417} 37858} 37859 37860@Article{ wardrop:theoretical, 37861 author = {J. G. Wardrop}, 37862 title = {Some Theoretical Aspects of Road Traffic Research}, 37863 journal = {Proceeding of the Institute of Civil Engineers, Part {II}}, 37864 year = {1952}, 37865 pages = {325--378} 37866} 37867 37868@Article{ warga:minimizing, 37869 author = {J. Warga}, 37870 title = {Minimizing certain convex functions}, 37871 journal = {Journal of SIAM on Applied Mathematics}, 37872 year = {1963}, 37873 volume = {11}, 37874 pages = {588--593} 37875} 37876 37877@Article{ watson.billups.ea:hompack, 37878 author = {L. T. Watson and S. C. Billups and A. P. Morgan}, 37879 title = {Algorithm 652: {HOMPACK}: {A} Suite of Codes for Globally Convergent Homotopy 37880 Algorithms}, 37881 journal = {{ACM} Transactions on Mathematical Software}, 37882 year = {1987}, 37883 volume = {13}, 37884 pages = {281--310} 37885} 37886 37887@Article{ watson.billups.ea:slow, 37888 author = {L. T. Watson and S. C. Billups and C. Y. Wang}, 37889 title = {Slow Viscous Flow in a Syringe}, 37890 journal = {Journal of Biomechanical Engineering}, 37891 year = {1986}, 37892 volume = {108}, 37893 pages = {317--323} 37894} 37895 37896@Article{ watson:discrete, 37897 author = {G. A. Watson}, 37898 title = {Discrete $\ell_1$ approximation by rational functions}, 37899 journal = {IMA Journal of Numerical Analysis}, 37900 year = {1984}, 37901 volume = {4}, 37902 pages = {275--288} 37903} 37904 37905@Article{ watson:solving, 37906 author = {L. T. Watson}, 37907 title = {Solving the nonlinear complementarity problem by a homotopy method}, 37908 journal = {SIAM Journal on Control and Optimization}, 37909 year = {1979}, 37910 volume = {17}, 37911 pages = {36--46} 37912} 37913 37914@Article{ webb:optimum, 37915 author = {S. Webb}, 37916 title = {Optimum Parameters in a Model of Tumor Control Probability including Interpatient 37917 Heterogeneity}, 37918 journal = {Physics in Medicine and Biology}, 37919 year = {1994}, 37920 volume = {39}, 37921 pages = {1895--1914} 37922} 37923 37924@Book{ webb:physics, 37925 author = {S. Webb}, 37926 title = {The Physics of Conformal Radiotherapy: Advances in Technology}, 37927 publisher = {Institute of Physics Publishing Ltd.}, 37928 year = {1997}, 37929 optaddress = {Philadelphia} 37930} 37931 37932@InBook{ webb:theory, 37933 author = {S. Webb}, 37934 editor = {E. Sternick}, 37935 title = {The Theory and Practice of Intensity Modulated Radiation Therapy}, 37936 chapter = {Inverse Planning for IMRT: the Role of Simulated Annealing}, 37937 publisher = {Advanced Medical Publishing}, 37938 year = {1997} 37939} 37940 37941@Book{ weiss.kulikowski:computer, 37942 author = {S. M. Weiss and C. A. Kulikowski}, 37943 title = {Computer Systems that Learn}, 37944 year = {1991}, 37945 publisher = {Morgan Kaufmann Publishers, Inc}, 37946 address = {San Mateo, California} 37947} 37948 37949@PhDThesis{ werbos:beyond, 37950 author = {P. J. Werbos}, 37951 title = {Beyond Regression: New Tools for Prediction and Analysis in the Behaviorial 37952 Sciences}, 37953 year = {1974}, 37954 school = {Harvard University} 37955} 37956 37957@InCollection{ wets:convergence, 37958 author = {R. J.-B. Wets}, 37959 title = {Convergence of Convex Functions, Variational Inequalites, and Convex Optimization 37960 Problems}, 37961 booktitle = {Variational Inequalites and Complementarity Problems}, 37962 year = {1980}, 37963 editor = {R. W. Cottle and F. Giannessi and J.--L. Lions}, 37964 publisher = {John Wiley \& Sons}, 37965 address = {New York}, 37966 pages = {375--403} 37967} 37968 37969@InCollection{ wets:large, 37970 author = {R. J.-B. Wets}, 37971 title = {Large Scale Linear Programming Techniques in Stochastic Programming}, 37972 booktitle = {Numerical Techniques for Stochastic Optimization}, 37973 publisher = {Springer-Verlag}, 37974 year = {1988}, 37975 editor = {Yu. M. Ermoliev and R. J. -B. Wets}, 37976 address = {Berlin}, 37977 pages = {65--93} 37978} 37979 37980@Article{ white:asymptotic, 37981 author = {H. White}, 37982 title = {Some asymptotic results for learning in single hidden-layer feedforward network 37983 models}, 37984 journal = {Journal of the American Stattistical Association}, 37985 year = {1989}, 37986 volume = {84}, 37987 number = {408}, 37988 pages = {1003--1013} 37989} 37990 37991@Article{ white:learning, 37992 author = {H. White}, 37993 title = {Learning in artificial neural networks{:} {A} statistical perspective}, 37994 journal = {Neural Computation}, 37995 year = {1989}, 37996 volume = {1}, 37997 pages = {425--461} 37998} 37999 38000@InProceedings{ whitley.starkweather.ea:scheduling, 38001 crossref = {schaeffer:third}, 38002 author = {D. Whitley and T. Starkweather and D. Fuquay}, 38003 title = {Scheduling Problems and Travelling Salesmen: The Genetic Edge Recombination 38004 Operator}, 38005 pages = {133--140} 38006} 38007 38008@Book{ williams:model, 38009 author = {H. P. Williams}, 38010 title = {Model Building in Mathematical Programming}, 38011 publisher = {John Wiley \& Sons}, 38012 year = {1990}, 38013 edition = {Third} 38014} 38015 38016@Book{ wilmott.dewynne.ea:option, 38017 author = {P. Wilmott and J. Dewynne and S. Howison}, 38018 title = {Option Pricing}, 38019 publisher = {Oxford Financial Press}, 38020 year = {1993}, 38021 address = {Oxford, England} 38022} 38023 38024@PhDThesis{ wilson:simplicial, 38025 author = {R. B. Wilson}, 38026 title = {A Simplicial Algorithm for Concave Programming}, 38027 year = {1963}, 38028 address = {Boston, MA}, 38029 school = {Graduate School of Business Administration, Harvard University} 38030} 38031 38032@TechReport{ wolberg.bennett.ea:breast, 38033 author = {W. H. Wolberg and K. P. Bennett and O. L. Mangasarian}, 38034 title = {Breast Cancer Diagnosis and Prognostic Determination from Cell Analysis}, 38035 institution = {Departments of Surgery and Human Oncology and Computer Sciences, University of 38036 Wisconsin}, 38037 year = {1992}, 38038 address = {Madison, WI 53706}, 38039 type = {Manuscript} 38040} 38041 38042@Article{ wolberg.mangasarian:multisurface, 38043 author = {W. H. Wolberg and O. L. Mangasarian}, 38044 title = {Multisurface Method of Pattern Separation for Medical Diagnosis Applied to Breast 38045 Cytology}, 38046 journal = {Proceedings of the National Academy of Sciences,U.S.A.}, 38047 year = {1990}, 38048 volume = {87}, 38049 pages = {9193--9196} 38050} 38051 38052@Unpublished{ wolberg.mangasarian:wbcd, 38053 author = {W. H. Wolberg and O. L. Mangasarian}, 38054 title = {{WBCD: Wisconsin Breast Cancer Database}}, 38055 year = {1991}, 38056 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. cs. 38057 wisc.edu/math-prog/cpo-dataset/machine-learn/cancer1/} 38058} 38059 38060@Article{ wolberg.street.ea:breast, 38061 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38062 title = {Breast Cytology Diagnosis via Digital Image Analysis}, 38063 journal = {Analytical and Quantitative Cytology and Histology}, 38064 year = {1993}, 38065 volume = {15}, 38066 number = {6}, 38067 pages = {396--404} 38068} 38069 38070@Unpublished{ wolberg.street.ea:wdbc, 38071 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38072 title = {{WDBC: Wisconsin Diagnostic Breast Cancer Database}}, 38073 year = {1995}, 38074 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38075 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WDBC/} 38076} 38077 38078@Unpublished{ wolberg.street.ea:wpbc, 38079 author = {W. H. Wolberg and W. N. Street and O. L. Mangasarian}, 38080 title = {{WPBC: Wisconsin Prognostic Breast Cancer Database}}, 38081 year = {1995}, 38082 note = {Computer Sciences Department, University of Wisconsin, Madison, ftp: //ftp. 38083 cs.wisc.edu/math-prog/cpo-dataset/machine-learn/WPBC/} 38084} 38085 38086@Book{ wolsey:integer, 38087 author = {L. A. Wolsey}, 38088 title = {Integer Programming}, 38089 publisher = {John Wiley \& Sons}, 38090 year = {1998}, 38091 address = {New York, NY} 38092} 38093 38094@Article{ womersley:local, 38095 author = {R. S. Womersley}, 38096 title = {Local Properties of Algorithms for Minimizing Composite Functions}, 38097 journal = {Mathematical Programming}, 38098 year = {1985}, 38099 volume = {32}, 38100 pages = {69--89} 38101} 38102 38103@Article{ woo.sanders.ea:peacock, 38104 author = {S. Y. Woo and M. Sanders and W. Grant and E. B. Butler}, 38105 title = {Does the ``peacock'' have anything to do with radiotherapy?}, 38106 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38107 year = {1994}, 38108 volume = {29}, 38109 number = {1}, 38110 pages = {213--214} 38111} 38112 38113@Article{ wright.ralph:superlinear, 38114 author = {S. J. Wright and D. Ralph}, 38115 title = {A Superlinear Infeasible--Interior--Point Algorithm for Monotone Complementarity 38116 Problems}, 38117 year = {1996}, 38118 journal = {Mathematics of Operations Research}, 38119 volume = {21}, 38120 pages = {815--838} 38121} 38122 38123@TechReport{ wright.zhang:superquadratic, 38124 author = {S. J. Wright and Y. Zhang}, 38125 title = {A Superquadratic Infeasible--Interior--Point Method for linear complementarity 38126 problems}, 38127 institution = {Argonne National Laboratory}, 38128 year = {1994}, 38129 annote = {revised}, 38130 number = {MCS--P418--0294}, 38131 address = {Argonne, Illinois}, 38132 type = {Preprint} 38133} 38134 38135@TechReport{ wright:dynfgm, 38136 author = {S. E. Wright}, 38137 title = {{DYNFGM}: Dynamic Finite Generation Method}, 38138 institution = {Department of Mathematics, University of Washington}, 38139 year = {1989}, 38140 address = {Seattle, Washington} 38141} 38142 38143@Article{ wright:infeasible-interior-point, 38144 author = {S. J. Wright}, 38145 title = {An Infeasible--Interior--Point Algorithm for Linear Complementarity Problems}, 38146 journal = {Mathematical Programming}, 38147 volume = {67}, 38148 pages = {29--51}, 38149 year = {1994} 38150} 38151 38152@Article{ wright:path-following, 38153 author = {S. J. Wright}, 38154 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear 38155 Complementarity Problems}, 38156 journal = {Optimization Methods and Software}, 38157 year = {1993}, 38158 volume = {2}, 38159 pages = {79--106} 38160} 38161 38162@TechReport{ wright:path-following*1, 38163 author = {S. J. Wright}, 38164 title = {A Path--Following Infeasible--Interior--Point Algorithm for Linear and Quadratic 38165 Problems}, 38166 institution = {Argonne National Laboratory}, 38167 year = {1993}, 38168 number = {MCS--P401--1293}, 38169 address = {Argonne, Illinois} 38170} 38171 38172@Book{ wright:primal-dual, 38173 author = {S. J. Wright}, 38174 title = {Primal--Dual Interior--Point Methods}, 38175 year = {1997}, 38176 publisher = {SIAM}, 38177 address = {Philadelphia, Pennsylvania} 38178} 38179 38180@TechReport{ wright:reduced, 38181 author = {S. J. Wright}, 38182 title = {On Reduced Convex QP Formulations of Monotone LCP Problems}, 38183 institution = {Argonne National Laboratory}, 38184 year = {2000}, 38185 number = {MCS--P808--0400}, 38186 address = {Argonne, Illinois} 38187} 38188 38189@Article{ wright:solution, 38190 author = {S. J. Wright}, 38191 title = {Solution of Discrete--Time Optimal Control Problems on Parallel Computers}, 38192 journal = {Parallel Computing}, 38193 year = {1990}, 38194 volume = {16}, 38195 pages = {221--238} 38196} 38197 38198@Article{ wu.bourland:morphology, 38199 author = {Q. J. Wu and J. D. Bourland}, 38200 title = {Morphology-guided radiosurgery treatment planning and optimization for multiple 38201 isocenters}, 38202 journal = {Medical Physics}, 38203 year = {1999}, 38204 volume = {26}, 38205 number = {10}, 38206 pages = {2151--2160} 38207} 38208 38209@Misc{ wunderling:soplex, 38210 author = {R. Wunderling}, 38211 title = {{SOPLEX}: The Sequential Object-Oriented Simplex Class Library}, 38212 howpublished = {http://www.zib.de/Optimization/Software/Soplex/} 38213} 38214 38215@Article{ xiao.harker:nonsmooth, 38216 author = {B. Xiao and P. T. Harker}, 38217 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {I}: Theory}, 38218 journal = {Mathematical Programming}, 38219 year = {1994}, 38220 volume = {65}, 38221 pages = {151--194} 38222} 38223 38224@Article{ xiao.harker:nonsmooth*1, 38225 author = {B. Xiao and P. T. Harker}, 38226 title = {A Nonsmooth {N}ewton Method for Variational Inequalities: {II}: Numerical 38227 Results}, 38228 journal = {Mathematical Programming}, 38229 year = {1994}, 38230 volume = {65}, 38231 pages = {195--216} 38232} 38233 38234@Article{ xiao.zhou:nonmonotone, 38235 author = {Y. Xiao and F. J. Zhou}, 38236 title = {Nonmonotone Trust Region Methods with Curvilinear Paths in Unconstrained 38237 Minimization}, 38238 journal = {Computing}, 38239 year = {1992}, 38240 volume = {48}, 38241 pages = {303--317} 38242} 38243 38244@TechReport{ xiao:global, 38245 author = {B. Xiao}, 38246 title = {Global {N}ewton methods for nonlinear problems and variational inequalities: a 38247 {B}-differentiable equation approach}, 38248 type = {{Ph.D. Thesis}}, 38249 year = {1990}, 38250 institution = {Department of Decision Sciences, The Warton School, University of Pennsylvania}, 38251 address = {Philadelphia, PA} 38252} 38253 38254@Article{ xu.burke:polynomial, 38255 author = {S. Xu and J. V. Burke}, 38256 title = {A Polynomial Time Interior-Point Path-Following Algorithm for {LCP} based on 38257 {C}hen-{H}arker-{K}anzow Smoothing Techniques}, 38258 year = {1999}, 38259 journal = {Mathematical Programming}, 38260 volume = {86}, 38261 pages = {91--104} 38262} 38263 38264@TechReport{ xu:global, 38265 author = {S. Xu}, 38266 title = {The Global Linear Convergence of an Infeasible Non-Interior Path-Following 38267 Algorithm for Complementarity Problems with Uniform {P}-Functions}, 38268 institution = {Department of Mathematics, University of Washington}, 38269 year = {1996}, 38270 type = {Technical Report}, 38271 address = {Seattle, WA} 38272} 38273 38274@Article{ yajima.konno:efficient, 38275 author = {Y. Yajima and H. Konno}, 38276 title = {Efficient Algorithms for Solving Rank Two and Rank Three Bilinear Programming 38277 Problems}, 38278 journal = {Journal of Global Optimization}, 38279 year = {1991}, 38280 volume = {1:1}, 38281 pages = {155--171} 38282} 38283 38284@Article{ yamamoto:path-following, 38285 author = {Y. Yamamoto}, 38286 title = {A Path--Following Algorithm for Stationary Point Problems}, 38287 journal = {Journal of Operations Society of Japan}, 38288 year = {1987}, 38289 volume = {30}, 38290 pages = {181--198} 38291} 38292 38293@Article{ yamashita.fukushima:modified, 38294 author = {N. Yamashita and M. Fukushima}, 38295 title = {Modified {N}ewton Methods for Solving a Semismooth Reformulation of Monotone 38296 Complementarity Problems}, 38297 journal = {Mathematical Programming}, 38298 year = {1997}, 38299 volume = {76}, 38300 pages = {469--492} 38301} 38302 38303@Article{ yamashita.fukushima:stationary, 38304 author = {N. Yamashita and M. Fukushima}, 38305 title = {On Stationary Points of the Implicit Lagrangian for Nonlinear Complementarity 38306 Problems}, 38307 journal = {Journal of Optimization Theory and Applications}, 38308 volume = {84}, 38309 pages = {653--663}, 38310 year = {1995} 38311} 38312 38313@Article{ yamashita.taji.ea:unconstrained, 38314 author = {N. Yamashita and K. Taji and M. Fukushima}, 38315 title = {Unconstrained Optimization Reformulations of Variational Inequality Problems}, 38316 journal = {Journal of Optimization Theory and Applications}, 38317 year = {1997}, 38318 volume = {92}, 38319 pages = {439--456} 38320} 38321 38322@TechReport{ yamashita:properties, 38323 author = {N. Yamashita}, 38324 title = {Some Properties of the Restricted {NCP}-Functions for the Nonlinear 38325 Complementarity Problem}, 38326 institution = {Department of Applied Mathematics and Physics, Kyoto University}, 38327 year = {1996}, 38328 type = {Technical Report}, 38329 address = {Kyoto, Japan} 38330} 38331 38332@Article{ yang.mackie.ea:investigation, 38333 author = {J. N. Yang and T. R. Mackie and P. Reckwerdt and J. O. Deasy and B. R. 38334 Thomadsen}, 38335 title = {An investigation of tomotherapy beam delivery}, 38336 journal = {Medical Physics}, 38337 year = {1997}, 38338 volume = {24}, 38339 number = {3}, 38340 pages = {425--436} 38341} 38342 38343@Article{ yan.shu.ea:clinical, 38344 author = {Y. Yan and H. Shu and X. Bao}, 38345 title = {Clinical Treatment Planning Optimization by {P}owell's method for {G}amma Unit 38346 Treatmen System}, 38347 journal = {International Journal of Radiation Oncology, Biology and Physics}, 38348 year = {1997}, 38349 volume = {39}, 38350 pages = {247--254} 38351} 38352 38353@Article{ yau.gao:obstacle, 38354 author = {S. T. Yau and Y. Gao}, 38355 title = {Obstacle problem for von {K}arm\'an equations}, 38356 journal = {Advances in Applied Mathematics}, 38357 volume = {13}, 38358 year = {1992}, 38359 pages = {123--141} 38360} 38361 38362@Article{ ye.tse:extension, 38363 author = {Y. Ye and E. Tse}, 38364 title = {An Extension of {K}armarkar's Projective Algorithm for Convex Quadratic 38365 Programming}, 38366 journal = {Mathematical Programming}, 38367 year = {1989}, 38368 volume = {44} 38369} 38370 38371@Article{ ye:affine, 38372 author = {Y. Ye}, 38373 title = {On affine scaling algorithms for nonconvex quadratic programming}, 38374 journal = {Mathematical Programming}, 38375 year = {1992}, 38376 volume = {56}, 38377 pages = {285--300} 38378} 38379 38380@PhDThesis{ ye:interior, 38381 author = {Y. Ye}, 38382 title = {Interior Algorithms for Linear, Quadratic, and Linearly Constrained Convex 38383 Programming}, 38384 year = {1987}, 38385 address = {Stanford, California}, 38386 school = {Department of Engineering--Economic Systems, Stanford University} 38387} 38388 38389@Book{ ye:interior*1, 38390 author = {Y. Ye}, 38391 title = {Interior-Point Algorithms: Theory and Analysis}, 38392 publisher = {John Wiley \& Sons}, 38393 year = {1997}, 38394 address = {New York, NY} 38395} 38396 38397@Article{ yu:convergence, 38398 author = {W. --C. Yu}, 38399 title = {The Convergence Property of the Simplex Evolutionary Techniques}, 38400 journal = {Scientia Sinica, Special issue of Mathematics}, 38401 year = {1979}, 38402 volume = {1}, 38403 pages = {68--77} 38404} 38405 38406@Article{ yu.schell:genetic, 38407 author = {Y. Yu and M. C. Schell}, 38408 title = {A Genetic Algorithm for the Optimization of Prostate Implants}, 38409 journal = {Medical Physics}, 38410 year = {1996}, 38411 volume = {23}, 38412 pages = {2085--2091} 38413} 38414 38415@Article{ yuan:superlinear, 38416 author = {Y. Yuan}, 38417 title = {On the Superlinear Convergence of a Trust Region Algorithm for Nonmooth 38418 Optimization}, 38419 journal = {Mathematical Programming}, 38420 year = {1985}, 38421 volume = {31}, 38422 pages = {269--285} 38423} 38424 38425@Book{ zangwill:nonlinear, 38426 author = {W. I. Zangwill}, 38427 title = {Nonlinear Programming: {A} Unified Approach}, 38428 year = {1969}, 38429 publisher = {Prentice-Hall, Inc}, 38430 address = {Englewood Cliffs, New Jersey} 38431} 38432 38433@TechReport{ zangwill:nonlinear*1, 38434 author = {W. I. Zangwill}, 38435 title = {Nonlinear Programming by Sequential Unconstrained Maximization}, 38436 institution = {Center for Research in Management Science, University of California}, 38437 year = {1965}, 38438 address = {Berkeley}, 38439 number = {131}, 38440 type = {Working Paper} 38441} 38442 38443@Article{ zangwill:nonlinear*2, 38444 author = {W. I. Zangwill}, 38445 title = {Nonlinear Programming via Penalty Functions}, 38446 journal = {Management Science}, 38447 year = {1967}, 38448 volume = {13}, 38449 pages = {344--358} 38450} 38451 38452@TechReport{ zenios.censor:massively, 38453 author = {S. A. Zenios and Y. Censor}, 38454 title = {Massively Parallel Row-Action Algorithms for some Nonlinear Transportation 38455 Problems}, 38456 institution = {decision sciences department, Wharton School, University of Pennsylvania}, 38457 year = {1990}, 38458 type = {report}, 38459 number = {89-09-10}, 38460 address = {Philadelphia, PA} 38461} 38462 38463@Article{ zenios.lasken:nonlinear, 38464 author = {S. A. Zenios and R. A. Lasken}, 38465 title = {Nonlinear Network Optimization on a Massively Parallel {C}onnection {M}achine}, 38466 journal = {Annals of Operations Research}, 38467 year = {1988}, 38468 volume = {14}, 38469 pages = {147--163} 38470} 38471 38472@Article{ zenios.mulvey:distributed, 38473 author = {S. A. Zenios and J. M. Mulvey}, 38474 title = {A Distributed Algorithm for Convex Network Optimization Problems}, 38475 journal = {Parallel Computing}, 38476 year = {1988}, 38477 volume = {6}, 38478 pages = {43--56} 38479} 38480 38481@TechReport{ zenios.neilsen:massively, 38482 author = {S. A. Zenios and S. Neilsen}, 38483 title = {Massively Parallel Algorithms for Singly Constrained Nonlinear Programs}, 38484 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38485 year = {1990}, 38486 type = {report}, 38487 number = {90-03-01}, 38488 address = {Philadelphia, PA} 38489} 38490 38491@TechReport{ zenios.qi.ea:comparative, 38492 author = {S. A. Zenios and R. Qi and E. D. Chajakis}, 38493 title = {A Comparative Study of Parallel Dual Coordinate Ascent Implementations for 38494 Nonlinear Network Optimization}, 38495 institution = {Decision Sciences Department, Wharton School, University of Pennsylvania}, 38496 year = {1990}, 38497 type = {report}, 38498 number = {89-10-02}, 38499 address = {Philadelphia, PA} 38500} 38501 38502@Article{ zhang.kim.ea:improved, 38503 author = {J. Zhang and N.--H. Kim and L. Lasdon}, 38504 title = {An Improved Successive Linear Programming Algorithm}, 38505 year = {1985}, 38506 journal = {Management Science}, 38507 volume = {31}, 38508 pages = {1312--1331} 38509} 38510 38511@Article{ zhang.tapia.ea:superlinear, 38512 author = {Y. Zhang and R. A. Tapia and F. Potra}, 38513 title = {On the Superlinear Convergence of Interior Points Algorithms for a general class 38514 of problems}, 38515 journal = {SIAM Journal on Optimization}, 38516 year = {1993}, 38517 volume = {3}, 38518 number = {?}, 38519 pages = {413--422}, 38520} 38521 38522@Article{ zhang.tapia:superlinearly, 38523 author = {Y. Zhang and R. A. Tapia}, 38524 title = {A superlinearly convergent polynomial primal-dual interior-point algorirthm for 38525 linear programming}, 38526 journal = {SIAM Journal on Optimization}, 38527 year = {1993}, 38528 volume = {3}, 38529 pages = {118--133} 38530} 38531 38532@TechReport{ zhang.zhang:superlinear, 38533 author = {Y. Zhang and D. Zhang}, 38534 title = {Superlinear convergence of infeasible interior-point methods for linear 38535 programming}, 38536 institution = {Department of Mathematics and Statistics, University of Maryland}, 38537 year = {1992}, 38538 number = {92-15}, 38539 address = {Baltimore County, Maryland} 38540} 38541 38542@Article{ zhang:convergence, 38543 author = {Yin Zhang}, 38544 title = {On the Convergence of a Class of Infeasible Interior--Point Methods for the 38545 Horizontal Linear Complementarity Problem}, 38546 journal = {SIAM Journal on Optimization}, 38547 year = {1994}, 38548 volume = {4}, 38549 pages = {208--227} 38550} 38551 38552@Article{ zhang:convergence*1, 38553 author = {Y. Zhang}, 38554 title = {On the convergence of a class of infeasible interior-point methods for the 38555 horizontal linear complementarity problem}, 38556 journal = {SIAM Journal on Optimization}, 38557 year = {1994}, 38558 volume = {4}, 38559 pages = {208--227} 38560} 38561 38562@Article{ zhu.rockafellar:primal-dual, 38563 author = {C. Y. Zhu and R. T. Rockafellar}, 38564 title = {Primal-Dual Projected Gradient Algorithms for Extended Linear-Quadratic 38565 Programming}, 38566 journal = {SIAM Journal on Optimization}, 38567 year = {1993}, 38568 volume = {3}, 38569 pages = {751--783} 38570} 38571 38572@Article{ zhu:modified, 38573 author = {C. Y. Zhu}, 38574 title = {Modified Proximal Point Algorithm for Extended Linear--Quadratic Programming}, 38575 journal = {Computational Optimization and Applications}, 38576 year = {1992}, 38577 volume = {2}, 38578 pages = {182--205} 38579} 38580 38581@Article{ zhu:primal-dual, 38582 author = {C. Y. Zhu}, 38583 title = {On the Primal--Dual Steepest Descent Algorithm for Extended Linear--Quadratic 38584 Programming}, 38585 journal = {SIAM Journal on Optimization}, 38586 year = {1995}, 38587 volume = {5}, 38588 pages = {114--128} 38589} 38590 38591@Book{ zoutendijk:methods, 38592 author = {G. Zoutendijk}, 38593 title = {Methods of Feasible Directions}, 38594 year = {1960}, 38595 publisher = {Elsevier Publishing Company}, 38596 address = {Amsterdam} 38597} 38598 38599@Article{ zowe.kurcyusz:regularity, 38600 author = {J. Zowe and S. Kurcyusz}, 38601 title = {Regularity and Stability for Mathematical Programming in {B}anach Spaces}, 38602 journal = {Applied Mathematics and Optimization}, 38603 year = {1979}, 38604 volume = {5}, 38605 pages = {49--62} 38606} 38607 38608@InProceedings{ zowe:nondifferentiable, 38609 author = {J. Zowe}, 38610 title = {Nondifferentiable Optimization}, 38611 booktitle = {Computational Mathematical Programming}, 38612 year = {1985}, 38613 editor = {K. Schittkowski}, 38614 publisher = {Springer-Verlag}, 38615 address = {Berlin} 38616} 38617 38618@Proceedings{ bachem.grotschel.ea:mathematical, 38619 booktitle = {Mathematical Programming: The State of the Art, Bonn 1982}, 38620 title = {Mathematical Programming: The State of the Art, Bonn 1982}, 38621 year = {1983}, 38622 editor = {A. Bachem and M. Gr{\"{o}}tchel and B. Korte}, 38623 publisher = {Springer Verlag}, 38624 address = {Berlin} 38625} 38626 38627@Proceedings{ belew.booker:fourth, 38628 year = {1991}, 38629 editor = {R. K. Belew and L. B. Booker}, 38630 publisher = {Morgan Kaufmann Publishers, Inc}, 38631 address = {San Mateo, California}, 38632 booktitle = {Proceedings of the Fourth International Conference on Genetic Algorithms} 38633} 38634 38635@Proceedings{ coleman.li:large-scale, 38636 year = {1990}, 38637 editor = {T. F. Coleman and Y. Li}, 38638 publisher = {SIAM}, 38639 address = {Philadelphia, Pennsylvania}, 38640 note = {Proceedings of the Workshop on Large-Scale Numerical Optimization, Cornell 38641 University, Ithaca, New York, October 19-20, 1989}, 38642 booktitle = {Large-Scale Numerical Optimization} 38643} 38644 38645@Book{ davis:genetic, 38646 title = {Genetic Algorithms and Simulated Annealing}, 38647 year = {1987}, 38648 editor = {L. D. Davis}, 38649 publisher = {Pitman}, 38650 address = {London}, 38651 booktitle = {Genetic Algorithms and Simulated Annealing} 38652} 38653 38654@Proceedings{ ferris.pang:complementarity, 38655 title = {Complementarity and Variational Problems: State of the Art}, 38656 booktitle = {Complementarity and Variational Problems: State of the Art}, 38657 year = {1997}, 38658 key = {57}, 38659 editor = {M. C. Ferris and J. S. Pang}, 38660 publisher = {SIAM Publications}, 38661 address = {Philadelphia, Pennsylvania} 38662} 38663 38664@Proceedings{ ferris.mangasarian.ea:complementarity, 38665 title = {Complementarity: Applications, Algorithms and Extensions}, 38666 booktitle = {Complementarity: Applications, Algorithms and Extensions}, 38667 year = {2001}, 38668 key = {95}, 38669 editor = {M. C. Ferris and O.L. Mangasarian and J. S. Pang}, 38670 publisher = {Kluwer Academic Publishers}, 38671 address = {Dordrecht, The Netherlands} 38672} 38673 38674@Proceedings{ florian:traffic, 38675 title = {Traffic Equilibrium Methods}, 38676 year = {1976}, 38677 editor = {M. Florian}, 38678 publisher = {Springer-Verlag}, 38679 address = {Berlin} 38680} 38681 38682@Proceedings{ grefenstette:genetic, 38683 title = {Genetic Algorithms and their Applications: Proceedings of the Second 38684 International Conference on Genetic Algorithms}, 38685 year = {1987}, 38686 editor = {J. J. Grefenstette}, 38687 publisher = {Lawrence Erlbaum Associates}, 38688 address = {Hillsdale, New Jersey}, 38689 booktitle = {Genetic Algorithms and their Applications: Proceedings of the Second 38690 International Conference on Genetic Algorithms} 38691} 38692 38693@Proceedings{ mangasarian.meyer.ea:nonlinear*2, 38694 booktitle = {Nonlinear Programming}, 38695 volume = {2}, 38696 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38697 publisher = {Academic Press}, 38698 address = {New York}, 38699 year = {1975} 38700} 38701 38702@Proceedings{ mangasarian.meyer.ea:nonlinear*3, 38703 booktitle = {Nonlinear Programming}, 38704 volume = {3}, 38705 editor = {O. L. Mangasarian and R. R. Meyer and S. M. Robinson}, 38706 publisher = {Academic Press}, 38707 address = {London}, 38708 year = {1978} 38709} 38710 38711@Proceedings{ robinson:local, 38712 title = {Local Structure of Feasible Sets in Nonlinear Programming, {P}art~{I}: 38713 Regularity}, 38714 year = {1983}, 38715 editor = {V. Pereyra and A. Reinoza}, 38716 publisher = {Springer-Verlag}, 38717 address = {Berlin}, 38718 author = {S. M. Robinson}, 38719 pages = {240--251}, 38720 series = {Numerical Methods: Proceedings, Caracas 1982} 38721} 38722 38723@Proceedings{ schaeffer:third, 38724 year = {1989}, 38725 editor = {J. D. Schaeffer}, 38726 publisher = {Morgan Kaufmann Publishers, Inc}, 38727 address = {San Mateo, California}, 38728 booktitle = {Proceedings of the Third International Conference on Genetic Algorithms} 38729} 38730 38731@Book{ vanderbei:linear, 38732 author = {R. J. Vanderbei}, 38733 title = {Linear Programming: Foundations and Extensions}, 38734 year = {1997}, 38735 publisher = {Kluwer Academic Publishers}, 38736 address = {Boston, Massachusetts} 38737} 38738 38739@Book{ dfobook, 38740 title = {Introduction to Derivative-Free Optimization}, 38741 publisher = {Society for Industrial and Applied Mathematics}, 38742 year = {2009}, 38743 author = {Andrew R. Conn and Katya Scheinberg and Lu\'is N. Vicente}, 38744 series = {MPS/SIAM Series on Optimization}, 38745 address = {Philadelphia, PA, USA}, 38746 isbn = {0-89871-460-5} 38747} 38748 38749@Article{ unedf0, 38750 author = {{Kortelainen}, M. and {Lesinski}, T. and {Mor{\'e}}, J. and {Nazarewicz}, W. and 38751 {Sarich}, J. and {Schunck}, N. and {Stoitsov}, M.~V. and {Wild}, S.~M.}, 38752 title = {Nuclear Energy Density Optimization}, 38753 journal = {Physical Review C}, 38754 year = {2010}, 38755 volume = {82}, 38756 number = {2}, 38757 pages = {024313}, 38758 doi = {10.1103/PhysRevC.82.024313} 38759} 38760 38761@Article{ hestenes1969multiplier, 38762 title = {Multiplier and gradient methods}, 38763 author = {Hestenes, Magnus R}, 38764 journal = {Journal of optimization theory and applications}, 38765 volume = {4}, 38766 number = {5}, 38767 pages = {303--320}, 38768 year = {1969}, 38769 publisher = {Springer} 38770} 38771 38772@Article{ powell1969method, 38773 title = {A method for nonlinear constraints in minimization problems}, 38774 author = {Powell, Michael JD}, 38775 journal = {Optimization}, 38776 pages = {283--298}, 38777 year = {1969}, 38778 publisher = {Academic Press} 38779} 38780 38781@Book{ nocedal2006numerical, 38782 title = {Numerical optimization}, 38783 author = {Jorge Nocedal and Stephen Wright}, 38784 year = {2006}, 38785 publisher = {Springer Science \& Business Media} 38786} 38787 38788@Article{ rockafellar1974augmented, 38789 title = {Augmented Lagrange multiplier functions and duality in nonconvex programming}, 38790 author = {Rockafellar, R Tyrrell}, 38791 journal = {SIAM Journal on Control}, 38792 volume = {12}, 38793 number = {2}, 38794 pages = {268--285}, 38795 year = {1974}, 38796 publisher = {SIAM} 38797} 38798 38799@Article{ bacuta2006, 38800 title = {A unified approach for Uzawa algorithms}, 38801 author = {Constantin Bacuta}, 38802 journal = {SIAM Journal on Numerical Analysis}, 38803 volume = {44}, 38804 number = {6}, 38805 pages = {2633--2649}, 38806 year = {2006} 38807} 38808 38809@Article{ manteuffelrugesouthworth2018, 38810 title = {Nonsymmetric algebraic multigrid based on local approximate ideal restriction 38811 (AIR)}, 38812 author = {Thomas A Manteuffel and John Ruge and Ben S Southworth}, 38813 journal = {SIAM Journal on Scientific Computing}, 38814 volume = {40}, 38815 number = {6}, 38816 pages = {A4105--A4130}, 38817 year = {2018} 38818} 38819 38820@Article{ manteuffelmunzenmaierrugesouthworth2019, 38821 title = {Nonsymmetric reduction-based algebraic multigrid}, 38822 author = {Thomas A Manteuffel and Steffen M\"unzenmaier and John Ruge and Ben S Southworth}, 38823 journal = {SIAM Journal on Scientific Computing}, 38824 volume = {41}, 38825 number = {5}, 38826 pages = {S242--S268}, 38827 year = {2019} 38828} 38829 38830@PhDThesis{ sivas2021, 38831 title = {Preconditioning of HDG for the Navier–Stokes Equations}, 38832 author = {Abdullah Ali Sivas}, 38833 department = {Applied Mathematics}, 38834 institution = {University of Waterloo}, 38835 year = {2021} 38836} 38837 38838@Article{ brookshughes1982, 38839 title = {Streamline upwind/{Petrov-Galerkin} formulations for convection dominated flows 38840 with particular emphasis on the incompressible {Navier-Stokes} equations}, 38841 author = {Alexander N Brooks and Thomas JR Hughes}, 38842 journal = {Computer methods in applied mechanics and engineering}, 38843 volume = {32}, 38844 number = {1-3}, 38845 pages = {199--259}, 38846 year = {1982}, 38847 publisher = {Elsevier} 38848} 38849 38850@InProceedings{ suhisaac2020, 38851 title = {Evaluation of a minimally synchronous algorithm for 2: 1 octree balance}, 38852 author = {Hansol Suh and Tobin Isaac}, 38853 booktitle = {SC20: International Conference for High Performance Computing, Networking, 38854 Storage and Analysis}, 38855 pages = {1--12}, 38856 year = {2020}, 38857 organization = {IEEE} 38858} 38859 38860@Misc{ alauzet2010, 38861 title = {Metric-Based Anisotropic Mesh Adaptation}, 38862 author = {Fr\'{e}d\'{e}ric Alauzet}, 38863 howpublished = {\url{https://pages.saclay.inria.fr/frederic.alauzet/cours/cea2010_V3.pdf}}, 38864 year = {2010} 38865} 38866 38867@Article{ chan1994qmrcgs, 38868 title = {A quasi-minimal residual variant of the {Bi-CGSTAB} algorithm for nonsymmetric 38869 systems}, 38870 author = {Chan, Tony F and Gallopoulos, Efstratios and Simoncini, Valeria and Szeto, Tedd 38871 and Tong, Charles H}, 38872 journal = {SIAM Journal on Scientific Computing}, 38873 volume = {15}, 38874 number = {2}, 38875 pages = {338--347}, 38876 year = {1994}, 38877 publisher = {SIAM} 38878} 38879 38880@Article{ ghai2019comparison, 38881 title = {A comparison of preconditioned {K}rylov subspace methods for large-scale 38882 nonsymmetric linear systems}, 38883 author = {Ghai, Aditi and Lu, Cao and Jiao, Xiangmin}, 38884 journal = {Numerical Linear Algebra with Applications}, 38885 volume = {26}, 38886 number = {1}, 38887 pages = {e2215}, 38888 year = {2019}, 38889 publisher = {Wiley Online Library} 38890} 38891 38892@Article{ mishrasalacknepley2022, 38893 title = {On the order of accuracy for finite difference approximations of partial 38894 differential equations using stencil composition}, 38895 author = {Abhishek Mishra and David Salac and Matthew G. Knepley}, 38896 journal = {International Journal on Numerical Methods in Engineering}, 38897 note = {Submitted}, 38898 year = {2022} 38899} 38900 38901@Article{ nathawaniknepley2022, 38902 title = {Droplet formation simulation using mixed finite elements}, 38903 author = {Darsh K. Nathawani and Matthew G. Knepley}, 38904 journal = {Physics of Fluids}, 38905 volume = {34}, 38906 pages = {064105}, 38907 doi = {10.1063/5.0089752}, 38908 year = {2022} 38909} 38910 38911@InProceedings{ nathawaniknepley2022b, 38912 title = {Simulating Paraffin Wax Droplets Using Mixed Finite Element Method}, 38913 author = {Darsh K. Nathawani and Matthew G. Knepley}, 38914 booktitle = {Proceeedings of the International Conference on Computational Fluid Dynamics 11 38915 (ICCFD11)}, 38916 editor = {Christoph Brehm and Shishir Pandya}, 38917 number = {4103}, 38918 year = {2022} 38919} 38920 38921@Article{ nathawaniknepley2023, 38922 title = {One-dimensional model to simulate shear-induced droplet formation}, 38923 author = {Darsh K. Nathawani and Matthew G. Knepley}, 38924 journal = {International Journal of Multiphase Flow}, 38925 note = {Submitted}, 38926 year = {2023} 38927} 38928 38929@InProceedings{ georgalisnathawaniknepleypatra2023, 38930 title = {Uncertainty Quantification of Shear-induced Paraffin Droplet Pinch-off in Hybrid Rocket Motors}, 38931 author = {Georgios Georgalis and Darsh K. Nathawani and Matthew G. Knepley and Abani 38932 Patra}, 38933 booktitle = {AIAA SciTech 2024}, 38934 note = {Accepted}, 38935 year = {2023} 38936} 38937 38938@Article{ brownbarrabeamsghaffariknepleymosesshakeristengelthompsonzhang2022, 38939 title = {Performance Portable Solid Mechanics via Matrix-Free $p$-Multigrid}, 38940 author = {Jed Brown and Valeria Barra and Natalie Beams and Leila Ghaffari and Matthew 38941 Knepley and William Moses and Rezgar Shakeri and Karen Stengel and Jeremy L. 38942 Thompson and Junchao Zhang}, 38943 doi = {10.48550/ARXIV.2204.01722}, 38944 url = {https://arxiv.org/abs/2204.01722}, 38945 publisher = {arXiv}, 38946 note = {Submitted}, 38947 year = {2022} 38948} 38949 38950@InCollection{ mayknepley2023, 38951 title = {Numerical Modeling of Subduction}, 38952 author = {Dave A. May and Matthew G. Knepley}, 38953 booktitle = {Dynamics of Plate Tectonics and Mantle Convection}, 38954 editor = {João C. Duarte}, 38955 pages = {539-571}, 38956 isbn = {978-0-323-85733-8}, 38957 doi = {https://doi.org/10.1016/B978-0-323-85733-8.00020-2}, 38958 url = {https://www.sciencedirect.com/science/article/pii/B9780323857338000202}, 38959 year = {2023} 38960} 38961 38962@Article{ adamsknepley2023, 38963 title = {A bespoke multigrid approach for magnetohydrodynamics models of magnetized 38964 plasmas in {PETSc}}, 38965 author = {Mark F. Adams and Matthew G. Knepley}, 38966 url = {https://arxiv.org/abs/2302.10242}, 38967 note = {In preparation}, 38968 year = {2023}, 38969 petsc_uses = {DMPlex} 38970} 38971 38972@Article{ finnknepleypusztayadams2023, 38973 title = {A Numerical Study of {Landau} Damping with {PETSc-PIC}}, 38974 author = {Daniel S. Finn and Matthew G. Knepley and Joseph V. Pusztay and Mark F. Adams}, 38975 url = {https://arxiv.org/abs/2303.12620}, 38976 journal = {Communications in Applied Mathematics and Computational Science}, 38977 volume = {18}, 38978 number = {1}, 38979 pages = {135--152}, 38980 doi = {10.2140/camcos.2023.18.135}, 38981 year = {2023} 38982} 38983 38984@Article{ eggersdupont1994, 38985 title = {Drop formation in a one-dimensional approximation of the {Navier--Stokes} 38986 equation}, 38987 author = {Jens Eggers and Todd F. Dupont}, 38988 journal = {Journal of fluid mechanics}, 38989 volume = {262}, 38990 pages = {205--221}, 38991 year = {1994}, 38992 publisher = {Cambridge University Press} 38993} 38994 38995@PhDThesis{ pusztaythesis2023, 38996 title = {A Particle Basis Vlasov-Poisson-Landau Solver for Plasma Simulation in PETSc}, 38997 author = {Joseph V. Pusztay}, 38998 type = {{PhD} thesis}, 38999 school = {University at Buffalo, Department of Computer Science and Engineering}, 39000 address = {Buffalo, NY}, 39001 month = may, 39002 year = {2022} 39003} 39004 39005@PhDThesis{ finnthesis2023, 39006 title = {Structure-Preserving Particle-In-Cell Methods for the Vlasov-Poisson-Landau 39007 System}, 39008 author = {Daniel S. Finn}, 39009 type = {{PhD} thesis}, 39010 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39011 Engineering}, 39012 address = {Buffalo, NY}, 39013 month = may, 39014 year = {2023} 39015} 39016 39017@PhDThesis{ nathawanithesis2023, 39018 title = {Droplet Formation: One-dimensional Mathematical Model and Computations}, 39019 author = {Darsh Kiritbhai Nathawani}, 39020 type = {{PhD} thesis}, 39021 school = {University at Buffalo, Program in Computational and Data-Enabled Science and 39022 Engineering}, 39023 address = {Buffalo, NY}, 39024 month = may, 39025 year = {2023} 39026} 39027 39028@article{MckayEriksonKozdon2019, 39029 title = {A computational method for earthquake cycles within anisotropic media}, 39030 author = {Maricela Best Mckay and Brittany A Erickson and Jeremy E Kozdon}, 39031 journal = {Geophysical Journal International}, 39032 volume = {219}, 39033 number = {2}, 39034 pages = {816--833}, 39035 year = {2019}, 39036} 39037 39038article{EricksonOReillyNordstrom2019, 39039 title = {Accuracy of stable, high-order finite difference methods for hyperbolic systems with non-smooth wave speeds}, 39040 author = {Brittany A Erickson and Ossian O’Reilly and Jan Nordstr{\"o}m}, 39041 journal = {Journal of Scientific Computing}, 39042 volume = {81}, 39043 pages = {2356--2387}, 39044 year = {2019}, 39045} 39046 39047@article{KozdonEricksonWilcox2021, 39048 title = {Hybridized summation-by-parts finite difference methods}, 39049 author = {Jeremy E Kozdon and Brittany A Erickson and Lucas C Wilcox}, 39050 journal = {Journal of Scientific Computing}, 39051 volume = {87}, 39052 number = {3}, 39053 pages = {85}, 39054 year = {2021}, 39055} 39056 39057@article{SEAS2022, 39058 title = {Community-driven code comparisons for three-dimensional dynamic modeling of sequences of earthquakes and aseismic slip}, 39059 author = {Junle Jiang and Brittany A Erickson and Val{\`e}re R Lambert and Jean-Paul Ampuero and Ryosuke Ando and Sylvain D Barbot and Camilla Cattania and Luca Dal Zilio and Benchun Duan and Eric M Dunham and Alice-Agnes Gabriel and Nadia Lapusta and Duo Li and Meng Li and Dunyu Liu and Yajing Liu and So Ozawa and Casper Pranger and Ylona van Dinther}, 39060 journal = {Journal of Geophysical Research: Solid Earth}, 39061 volume = {127}, 39062 number = {3}, 39063 pages = {e2021JB023519}, 39064 year = {2022}, 39065} 39066 39067@article{EricksonKozdonHarvey2022, 39068 title = {A non-stiff summation-by-parts finite difference method for the scalar wave equation in second order form: Characteristic boundary conditions and nonlinear interfaces}, 39069 author = {Brittany A Erickson and Jeremy E Kozdon and Tobias Harvey}, 39070 journal = {Journal of Scientific Computing}, 39071 volume = {93}, 39072 number = {1}, 39073 pages = {17}, 39074 year = {2022}, 39075} 39076 39077@article{RuckerEriksonKarlstromLeeGopalakrishnan2022, 39078 title = {A Computational Framework for Time-Dependent Deformation in Viscoelastic Magmatic Systems}, 39079 author = {Cody Rucker and Brittany A Erickson and Leif Karlstrom and Brian Lee and Jay Gopalakrishnan}, 39080 journal = {Journal of Geophysical Research: Solid Earth}, 39081 volume = {127}, 39082 number = {9}, 39083 pages = {e2022JB024506}, 39084 year = {2022}, 39085} 39086 39087@article{HarveyEriksonKozdon2023, 39088 title = {A High-order Accurate Summation-by-Parts Finite Difference Method for Fully-dynamic Earthquake Sequence Simulations within Sedimentary Basins}, 39089 author = {Tobias W Harvey and Brittany A Erickson and Jeremy E Kozdon}, 39090 journal = {Journal of Geophysical Research: Solid Earth}, 39091 pages = {e2022JB025357}, 39092 year = {2023}, 39093} 39094 39095@article{SEAS2023, 39096 title = {Incorporating full elastodynamic effects and dipping fault geometries in community code verification exercises for simulations of earthquake sequences and aseismic slip {(SEAS)}}, 39097 author = {Brittany A Erickson and Junle Jiang and Val{\`e}re Lambert and Sylvain D Barbot and Mohamed Abdelmeguid and Martin Almquist and Jean-Paul Ampuero and Ryosuke Ando and Camilla Cattania and Alexandre Chen and Luca Dal Zilio and Shuai Deng and Eric M. Dunham and Ahmed E. Elbanna and Alice‐Agnes Gabriel and Tobias W. Harvey and Yihe Huang and Yoshihiro Kaneko and Jeremy E. Kozdon and Nadia Lapusta and Duo Li and Meng Li and Chao Liang and Yajing Liu and So Ozawa and Andrea Perez‐Silva and Casper Pranger and Paul Segall and Yudong Sun and Prithvi Thakur and Carsten Uphoff and Ylona van Dinther and Yuyun Yang}, 39098 journal = {Bulletin of the Seismological Society of America}, 39099 volume = {113}, 39100 number = {2}, 39101 pages = {499--523}, 39102 year = {2023}, 39103} 39104